3MX6A

Crystal structure of methionine aminopeptidase from rickettsia prowazekii bound to methionine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
257
Chain Sequence
IKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPLNYKGFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTLSPKKLDYPPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rickettsia prowazekii methionine aminopeptidase as a promising target for the development of antibacterial agents.
pubmed doi rcsb
source organism Rickettsia prowazekii
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 80
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3mx6A00
3FMRA 2BHBA 2GG3A 4U6EA 5JFRA 1W2MA 2EVOA 4HXXA 4U76A 2Q93A 4JUQA 2EVCA 4RGZ1 1KP0A 2GTXA 1R58A 3D27A 3PKEA 4S00A 4U1BA 2B3HA 1R5HA 4U71A 3IU8A 4FO7A 4S2TP 2NQ7A 4FO8A 2P9AA 1R5GA 3PKDA 1XNZA 5FCHA 3FM3A 1C24A 2Q8KA 1A16A 3CB5A 1YW8A 2Q94A 1B6AA 3PKBA 4U73A 2GG8A 2BHCA 4Z7MA 4FKCA 1CHMA 4PV4A 2MATA 2GGBA 4FLKA 4IF7A 2Q96A 4IECA 1QXWA 4RZYA 1KQ9A 1YJ3A 5CNXA 2P99A 4S2RP 1WL9A 2BH3A 4ZNGA 2BWYA 3IG4A 5D6EA 2GG9A 1XGSA 4PNCA 4IKSA 2HOWA 1MATA 1WLRA 2P98A 1XGOA 3MATA 1N51A 4U6ZA 1C27A 2NQ6A 3L24A 3PKCA 2GA2A 2GG0A 2GG2A 4A6VA 4ZWPA 5CDEA 2Q95A 5FCFA 4ZWUA 2DFIA 5D6FA 3BIPA 1O0XA 3PKAA 2V3XA 2BHAA 3Q6DA 1JAWA 1YW9A 4IKRA 3FMQA 3IU9A 1WKMA 2GGCA 3TAVA 2GU7A 4IPAA 4U69A 1C23A 3S6BA 1C21A 4IU6A 3RORA 2BN7A 2OAZA 2IW2A 1XGMA 1BN5A 2GU6A 2EVMA 4U6WA 2Q92A 2EA2A 4ZWOA 4FUKA 1C22A 2BB7A 4EGEA 2BWTA 1QZYA 5CDVA 4FLJA 3CB6A 4U70A 5JI6A 2EA4A 1BOAA 4A6WA 4RZZA 2GU4A 2ZSGA 3TB5A 1WBQA 2BWWA 3MR1A 4U75A 1KQ0A 1W7VA 2BWXA 1WL6A 1QXYA 3CTZA 2B3LA 4R60A 4KM3A 4OOKA 5CIKA 4U6CA 5E5BA 2BWUA 4B28A 2GZ5A 4IDYA 2GG7A 2OKNA 3RVAA 2B3KA 3BIQA 2V3ZA 5CDLA 1YVMA 2BWSA 4U6JA 4QR8A 2ADUA 5CLSA 3MX6A 4FLIA 3L7GA 1B59A 4S01A 5CE6A 1M35A 1Y1NA 4MATA 1PV9A 2V3YA 1XGNA 3BITA 4IKTA 4IKUA 2GG5A 2GU5A 3IU7A 4FLLA 1WY2A 1WN1A 1QXZA 2BWVA 2V6CA 2G6PA 5JHUA 1YW7A 2BHDA
chains in the Genus database with same CATH superfamily
3FMRA 2BHBA 2GG3A 4U6EA 5JFRA 1W2MA 2EVOA 4HXXA 4U76A 2Q93A 4JUQA 2EVCA 4RGZ1 1KP0A 2GTXA 1R58A 3D27A 3PKEA 4S00A 4U1BA 2B3HA 1R5HA 4U71A 3IU8A 4FO7A 4S2TP 2NQ7A 4FO8A 2P9AA 1R5GA 3PKDA 1XNZA 5FCHA 3FM3A 1C24A 2Q8KA 1A16A 3CB5A 1YW8A 2Q94A 1B6AA 3PKBA 4U73A 2GG8A 2BHCA 4Z7MA 4FKCA 1CHMA 4PV4A 2MATA 2GGBA 4FLKA 4IF7A 2Q96A 4IECA 1QXWA 4RZYA 1KQ9A 1YJ3A 5CNXA 2P99A 4S2RP 1WL9A 2BH3A 4ZNGA 2BWYA 3IG4A 5D6EA 2GG9A 1XGSA 4PNCA 4IKSA 2HOWA 1MATA 1WLRA 2P98A 1XGOA 3MATA 1N51A 4U6ZA 1C27A 2NQ6A 3L24A 3PKCA 2GA2A 2GG0A 2GG2A 4A6VA 4ZWPA 5CDEA 2Q95A 5FCFA 4ZWUA 2DFIA 5D6FA 3BIPA 1O0XA 3PKAA 2V3XA 2BHAA 3Q6DA 1JAWA 1YW9A 4IKRA 3FMQA 3IU9A 1WKMA 2GGCA 3TAVA 2GU7A 4IPAA 4U69A 1C23A 3S6BA 1C21A 4IU6A 3RORA 2BN7A 2OAZA 2IW2A 1XGMA 1BN5A 2GU6A 2EVMA 4U6WA 2Q92A 2EA2A 4ZWOA 4FUKA 1C22A 2BB7A 4EGEA 2BWTA 1QZYA 5CDVA 4FLJA 3CB6A 4U70A 5JI6A 2EA4A 1BOAA 4A6WA 4RZZA 2GU4A 2ZSGA 3TB5A 1WBQA 2BWWA 3MR1A 4U75A 1KQ0A 1W7VA 2BWXA 1WL6A 1QXYA 3CTZA 2B3LA 4R60A 4KM3A 4OOKA 5CIKA 4U6CA 5E5BA 2BWUA 4B28A 2GZ5A 4IDYA 2GG7A 2OKNA 3RVAA 2B3KA 3BIQA 2V3ZA 5CDLA 1YVMA 2BWSA 4U6JA 4QR8A 2ADUA 5CLSA 3MX6A 4FLIA 3L7GA 1B59A 4S01A 5CE6A 1M35A 1Y1NA 4MATA 1PV9A 2V3YA 1XGNA 3BITA 4IKTA 4IKUA 2GG5A 2GU5A 3IU7A 4FLLA 1WY2A 1WN1A 1QXZA 2BWVA 2V6CA 2G6PA 5JHUA 1YW7A 2BHDA
chains in the Genus database with same CATH topology
3FMRA 2BHBA 2GG3A 4U6EA 5JFRA 1W2MA 2EVOA 4HXXA 4U76A 2Q93A 4JUQA 2EVCA 4RGZ1 1KP0A 2GTXA 1R58A 3D27A 3PKEA 4S00A 4U1BA 2B3HA 1R5HA 4U71A 3IU8A 4FO7A 4S2TP 2NQ7A 4FO8A 2P9AA 1R5GA 3PKDA 1XNZA 5FCHA 3FM3A 1C24A 2Q8KA 1A16A 3CB5A 1YW8A 2Q94A 1B6AA 3PKBA 4U73A 2GG8A 2BHCA 4Z7MA 4FKCA 1CHMA 4PV4A 2MATA 2GGBA 4FLKA 4IF7A 2Q96A 4IECA 1QXWA 4RZYA 1KQ9A 1YJ3A 5CNXA 2P99A 4S2RP 1WL9A 2BH3A 4ZNGA 2BWYA 3IG4A 5D6EA 2GG9A 1XGSA 4PNCA 4IKSA 2HOWA 1MATA 1WLRA 2P98A 1XGOA 3MATA 1N51A 4U6ZA 1C27A 2NQ6A 3L24A 3PKCA 2GA2A 2GG0A 2GG2A 4A6VA 4ZWPA 5CDEA 2Q95A 5FCFA 4ZWUA 2DFIA 5D6FA 3BIPA 1O0XA 3PKAA 2V3XA 2BHAA 3Q6DA 1JAWA 1YW9A 4IKRA 3FMQA 3IU9A 1WKMA 2GGCA 3TAVA 2GU7A 4IPAA 4U69A 1C23A 3S6BA 1C21A 4IU6A 3RORA 2BN7A 2OAZA 2IW2A 1XGMA 1BN5A 2GU6A 2EVMA 4U6WA 2Q92A 2EA2A 4ZWOA 4FUKA 1C22A 2BB7A 4EGEA 2BWTA 1QZYA 5CDVA 4FLJA 3CB6A 4U70A 5JI6A 2EA4A 1BOAA 4A6WA 4RZZA 2GU4A 2ZSGA 3TB5A 1WBQA 2BWWA 3MR1A 4U75A 1KQ0A 1W7VA 2BWXA 1WL6A 1QXYA 3CTZA 2B3LA 4R60A 4KM3A 4OOKA 5CIKA 4U6CA 5E5BA 2BWUA 4B28A 2GZ5A 4IDYA 2GG7A 2OKNA 3RVAA 2B3KA 3BIQA 2V3ZA 5CDLA 1YVMA 2BWSA 4U6JA 4QR8A 2ADUA 5CLSA 3MX6A 4FLIA 3L7GA 1B59A 4S01A 5CE6A 1M35A 1Y1NA 4MATA 1PV9A 2V3YA 1XGNA 3BITA 4IKTA 4IKUA 2GG5A 2GU5A 3IU7A 4FLLA 1WY2A 1WN1A 1QXZA 2BWVA 2V6CA 2G6PA 5JHUA 1YW7A 2BHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMR A;  2BHB A;  2GG3 A;  4U6E A;  5JFR A;  1W2M A;  2EVO A;  4HXX A;  4U76 A;  2Q93 A;  4JUQ A;  2EVC A;  4RGZ 1;  1KP0 A;  2GTX A;  1R58 A;  3D27 A;  3PKE A;  4S00 A;  4U1B A;  2B3H A;  1R5H A;  4U71 A;  3IU8 A;  4FO7 A;  4S2T P;  2NQ7 A;  4FO8 A;  2P9A A;  1R5G A;  3PKD A;  1XNZ A;  5FCH A;  3FM3 A;  1C24 A;  2Q8K A;  1A16 A;  3CB5 A;  1YW8 A;  2Q94 A;  1B6A A;  3PKB A;  4U73 A;  2GG8 A;  2BHC A;  4Z7M A;  4FKC A;  1CHM A;  4PV4 A;  2MAT A;  2GGB A;  4FLK A;  4IF7 A;  2Q96 A;  4IEC A;  1QXW A;  4RZY A;  1KQ9 A;  1YJ3 A;  5CNX A;  2P99 A;  4S2R P;  1WL9 A;  2BH3 A;  4ZNG A;  2BWY A;  3IG4 A;  5D6E A;  2GG9 A;  1XGS A;  4PNC A;  4IKS A;  2HOW A;  1MAT A;  1WLR A;  2P98 A;  1XGO A;  3MAT A;  1N51 A;  4U6Z A;  1C27 A;  2NQ6 A;  3L24 A;  3PKC A;  2GA2 A;  2GG0 A;  2GG2 A;  4A6V A;  4ZWP A;  5CDE A;  2Q95 A;  5FCF A;  4ZWU A;  2DFI A;  5D6F A;  3BIP A;  1O0X A;  3PKA A;  2V3X A;  2BHA A;  3Q6D A;  1JAW A;  1YW9 A;  4IKR A;  3FMQ A;  3IU9 A;  1WKM A;  2GGC A;  3TAV A;  2GU7 A;  4IPA A;  4U69 A;  1C23 A;  3S6B A;  1C21 A;  4IU6 A;  3ROR A;  2BN7 A;  2OAZ A;  2IW2 A;  1XGM A;  1BN5 A;  2GU6 A;  2EVM A;  4U6W A;  2Q92 A;  2EA2 A;  4ZWO A;  4FUK A;  1C22 A;  2BB7 A;  4EGE A;  2BWT A;  1QZY A;  5CDV A;  4FLJ A;  3CB6 A;  4U70 A;  5JI6 A;  2EA4 A;  1BOA A;  4A6W A;  4RZZ A;  2GU4 A;  2ZSG A;  3TB5 A;  1WBQ A;  2BWW A;  3MR1 A;  4U75 A;  1KQ0 A;  1W7V A;  2BWX A;  1WL6 A;  1QXY A;  3CTZ A;  2B3L A;  4R60 A;  4KM3 A;  4OOK A;  5CIK A;  4U6C A;  5E5B A;  2BWU A;  4B28 A;  2GZ5 A;  4IDY A;  2GG7 A;  2OKN A;  3RVA A;  2B3K A;  3BIQ A;  2V3Z A;  5CDL A;  1YVM A;  2BWS A;  4U6J A;  4QR8 A;  2ADU A;  5CLS A;  3MX6 A;  4FLI A;  3L7G A;  1B59 A;  4S01 A;  5CE6 A;  1M35 A;  1Y1N A;  4MAT A;  1PV9 A;  2V3Y A;  1XGN A;  3BIT A;  4IKT A;  4IKU A;  2GG5 A;  2GU5 A;  3IU7 A;  4FLL A;  1WY2 A;  1WN1 A;  1QXZ A;  2BWV A;  2V6C A;  2G6P A;  5JHU A;  1YW7 A;  2BHD A; 
#chains in the Genus database with same CATH topology
 3FMR A;  2BHB A;  2GG3 A;  4U6E A;  5JFR A;  1W2M A;  2EVO A;  4HXX A;  4U76 A;  2Q93 A;  4JUQ A;  2EVC A;  4RGZ 1;  1KP0 A;  2GTX A;  1R58 A;  3D27 A;  3PKE A;  4S00 A;  4U1B A;  2B3H A;  1R5H A;  4U71 A;  3IU8 A;  4FO7 A;  4S2T P;  2NQ7 A;  4FO8 A;  2P9A A;  1R5G A;  3PKD A;  1XNZ A;  5FCH A;  3FM3 A;  1C24 A;  2Q8K A;  1A16 A;  3CB5 A;  1YW8 A;  2Q94 A;  1B6A A;  3PKB A;  4U73 A;  2GG8 A;  2BHC A;  4Z7M A;  4FKC A;  1CHM A;  4PV4 A;  2MAT A;  2GGB A;  4FLK A;  4IF7 A;  2Q96 A;  4IEC A;  1QXW A;  4RZY A;  1KQ9 A;  1YJ3 A;  5CNX A;  2P99 A;  4S2R P;  1WL9 A;  2BH3 A;  4ZNG A;  2BWY A;  3IG4 A;  5D6E A;  2GG9 A;  1XGS A;  4PNC A;  4IKS A;  2HOW A;  1MAT A;  1WLR A;  2P98 A;  1XGO A;  3MAT A;  1N51 A;  4U6Z A;  1C27 A;  2NQ6 A;  3L24 A;  3PKC A;  2GA2 A;  2GG0 A;  2GG2 A;  4A6V A;  4ZWP A;  5CDE A;  2Q95 A;  5FCF A;  4ZWU A;  2DFI A;  5D6F A;  3BIP A;  1O0X A;  3PKA A;  2V3X A;  2BHA A;  3Q6D A;  1JAW A;  1YW9 A;  4IKR A;  3FMQ A;  3IU9 A;  1WKM A;  2GGC A;  3TAV A;  2GU7 A;  4IPA A;  4U69 A;  1C23 A;  3S6B A;  1C21 A;  4IU6 A;  3ROR A;  2BN7 A;  2OAZ A;  2IW2 A;  1XGM A;  1BN5 A;  2GU6 A;  2EVM A;  4U6W A;  2Q92 A;  2EA2 A;  4ZWO A;  4FUK A;  1C22 A;  2BB7 A;  4EGE A;  2BWT A;  1QZY A;  5CDV A;  4FLJ A;  3CB6 A;  4U70 A;  5JI6 A;  2EA4 A;  1BOA A;  4A6W A;  4RZZ A;  2GU4 A;  2ZSG A;  3TB5 A;  1WBQ A;  2BWW A;  3MR1 A;  4U75 A;  1KQ0 A;  1W7V A;  2BWX A;  1WL6 A;  1QXY A;  3CTZ A;  2B3L A;  4R60 A;  4KM3 A;  4OOK A;  5CIK A;  4U6C A;  5E5B A;  2BWU A;  4B28 A;  2GZ5 A;  4IDY A;  2GG7 A;  2OKN A;  3RVA A;  2B3K A;  3BIQ A;  2V3Z A;  5CDL A;  1YVM A;  2BWS A;  4U6J A;  4QR8 A;  2ADU A;  5CLS A;  3MX6 A;  4FLI A;  3L7G A;  1B59 A;  4S01 A;  5CE6 A;  1M35 A;  1Y1N A;  4MAT A;  1PV9 A;  2V3Y A;  1XGN A;  3BIT A;  4IKT A;  4IKU A;  2GG5 A;  2GU5 A;  3IU7 A;  4FLL A;  1WY2 A;  1WN1 A;  1QXZ A;  2BWV A;  2V6C A;  2G6P A;  5JHU A;  1YW7 A;  2BHD A; 
#chains in the Genus database with same CATH homology
 3FMR A;  2BHB A;  2GG3 A;  4U6E A;  5JFR A;  1W2M A;  2EVO A;  4HXX A;  4U76 A;  2Q93 A;  4JUQ A;  2EVC A;  4RGZ 1;  1KP0 A;  2GTX A;  1R58 A;  3D27 A;  3PKE A;  4S00 A;  4U1B A;  2B3H A;  1R5H A;  4U71 A;  3IU8 A;  4FO7 A;  4S2T P;  2NQ7 A;  4FO8 A;  2P9A A;  1R5G A;  3PKD A;  1XNZ A;  5FCH A;  3FM3 A;  1C24 A;  2Q8K A;  1A16 A;  3CB5 A;  1YW8 A;  2Q94 A;  1B6A A;  3PKB A;  4U73 A;  2GG8 A;  2BHC A;  4Z7M A;  4FKC A;  1CHM A;  4PV4 A;  2MAT A;  2GGB A;  4FLK A;  4IF7 A;  2Q96 A;  4IEC A;  1QXW A;  4RZY A;  1KQ9 A;  1YJ3 A;  5CNX A;  2P99 A;  4S2R P;  1WL9 A;  2BH3 A;  4ZNG A;  2BWY A;  3IG4 A;  5D6E A;  2GG9 A;  1XGS A;  4PNC A;  4IKS A;  2HOW A;  1MAT A;  1WLR A;  2P98 A;  1XGO A;  3MAT A;  1N51 A;  4U6Z A;  1C27 A;  2NQ6 A;  3L24 A;  3PKC A;  2GA2 A;  2GG0 A;  2GG2 A;  4A6V A;  4ZWP A;  5CDE A;  2Q95 A;  5FCF A;  4ZWU A;  2DFI A;  5D6F A;  3BIP A;  1O0X A;  3PKA A;  2V3X A;  2BHA A;  3Q6D A;  1JAW A;  1YW9 A;  4IKR A;  3FMQ A;  3IU9 A;  1WKM A;  2GGC A;  3TAV A;  2GU7 A;  4IPA A;  4U69 A;  1C23 A;  3S6B A;  1C21 A;  4IU6 A;  3ROR A;  2BN7 A;  2OAZ A;  2IW2 A;  1XGM A;  1BN5 A;  2GU6 A;  2EVM A;  4U6W A;  2Q92 A;  2EA2 A;  4ZWO A;  4FUK A;  1C22 A;  2BB7 A;  4EGE A;  2BWT A;  1QZY A;  5CDV A;  4FLJ A;  3CB6 A;  4U70 A;  5JI6 A;  2EA4 A;  1BOA A;  4A6W A;  4RZZ A;  2GU4 A;  2ZSG A;  3TB5 A;  1WBQ A;  2BWW A;  3MR1 A;  4U75 A;  1KQ0 A;  1W7V A;  2BWX A;  1WL6 A;  1QXY A;  3CTZ A;  2B3L A;  4R60 A;  4KM3 A;  4OOK A;  5CIK A;  4U6C A;  5E5B A;  2BWU A;  4B28 A;  2GZ5 A;  4IDY A;  2GG7 A;  2OKN A;  3RVA A;  2B3K A;  3BIQ A;  2V3Z A;  5CDL A;  1YVM A;  2BWS A;  4U6J A;  4QR8 A;  2ADU A;  5CLS A;  3MX6 A;  4FLI A;  3L7G A;  1B59 A;  4S01 A;  5CE6 A;  1M35 A;  1Y1N A;  4MAT A;  1PV9 A;  2V3Y A;  1XGN A;  3BIT A;  4IKT A;  4IKU A;  2GG5 A;  2GU5 A;  3IU7 A;  4FLL A;  1WY2 A;  1WN1 A;  1QXZ A;  2BWV A;  2V6C A;  2G6P A;  5JHU A;  1YW7 A;  2BHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...