3MX6A

Crystal structure of methionine aminopeptidase from rickettsia prowazekii bound to methionine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
257
Chain Sequence
IKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPLNYKGFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTLSPKKLDYPPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rickettsia prowazekii methionine aminopeptidase as a promising target for the development of antibacterial agents.
pubmed doi rcsb
source organism Rickettsia prowazekii
molecule tags Hydrolase
molecule keywords Methionine aminopeptidase
total genus 80
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3mx6A00
2BWSA 1B59A 1N51A 4IKTA 4U75A 4U1BA 2DFIA 1WL6A 4S2RP 4RGZ1 1O0XA 1Y1NA 2GU7A 5CNXA 4HXXA 3D27A 3L24A 2BWXA 2Q94A 3PKCA 4B28A 4U76A 3MX6A 3PKAA 5CDEA 1XGSA 4U6ZA 3BITA 1W2MA 2GGCA 4OOKA 4S01A 5E5BA 2GU6A 2P98A 4U6CA 1YW7A 1R5HA 5JFRA 5D6EA 2BB7A 2Q8KA 1WKMA 4QR8A 1M35A 1C24A 1YVMA 3L7GA 2BWWA 4IU6A 1CHMA 3IU9A 4A6VA 1JAWA 1B6AA 4RZYA 4FLKA 3IU7A 1BN5A 4MATA 1A16A 4ZWUA 1WY2A 4Z7MA 1QXYA 3FMRA 4U6WA 5CDVA 2GG2A 2BHDA 5JI6A 2B3LA 4KM3A 1R58A 2NQ7A 2GA2A 3Q6DA 4ZWPA 2GZ5A 2MATA 3RVAA 1KQ0A 1WL9A 3PKBA 4IKRA 4EGEA 2B3KA 1XGMA 2BWTA 1QZYA 1C23A 1XNZA 2Q92A 2Q93A 1YW9A 2HOWA 4IKSA 2BWYA 5CE6A 3CTZA 1XGOA 1R5GA 2EA4A 4A6WA 3BIPA 4IPAA 3IU8A 2B3HA 2IW2A 3MR1A 1YJ3A 5CIKA 3FMQA 4FUKA 4U73A 1BOAA 2V3XA 5FCFA 2V3ZA 3FM3A 4PV4A 4U6EA 2Q95A 2EA2A 1C22A 4FLLA 3S6BA 4S2TP 4FLJA 4ZNGA 2GG9A 2EVCA 4U69A 2GTXA 2BHAA 2BWVA 2GG0A 5JHUA 2BH3A 5D6FA 4IECA 3TB5A 2ZSGA 2G6PA 4S00A 5CLSA 1QXWA 3CB6A 2V3YA 1C21A 4JUQA 1C27A 2EVOA 3MATA 2BWUA 2GG8A 2GU5A 4U71A 4IKUA 4IF7A 3TAVA 4U70A 2BN7A 2GG7A 1WLRA 3CB5A 2NQ6A 2ADUA 4RZZA 3BIQA 2GG3A 1W7VA 2P99A 1MATA 1PV9A 4PNCA 2BHBA 2GGBA 4U6JA 2OKNA 2P9AA 2V6CA 2GU4A 1XGNA 3RORA 5FCHA 2BHCA 4R60A 3PKDA 4IDYA 3PKEA 4FLIA 4FO7A 4FO8A 4FKCA 1WBQA 1WN1A 1YW8A 2EVMA 1QXZA 3IG4A 1KQ9A 1KP0A 2OAZA 5CDLA 2GG5A 4ZWOA 2Q96A
chains in the Genus database with same CATH superfamily
2BWSA 1B59A 1N51A 4IKTA 4U75A 4U1BA 2DFIA 1WL6A 4S2RP 4RGZ1 1O0XA 1Y1NA 2GU7A 5CNXA 4HXXA 3D27A 3L24A 2BWXA 2Q94A 3PKCA 4B28A 4U76A 3MX6A 3PKAA 5CDEA 1XGSA 4U6ZA 3BITA 1W2MA 2GGCA 4OOKA 4S01A 5E5BA 2GU6A 2P98A 4U6CA 1YW7A 1R5HA 5JFRA 5D6EA 2BB7A 2Q8KA 1WKMA 4QR8A 1M35A 1C24A 1YVMA 3L7GA 2BWWA 4IU6A 1CHMA 3IU9A 4A6VA 1JAWA 1B6AA 4RZYA 4FLKA 3IU7A 1BN5A 4MATA 1A16A 4ZWUA 1WY2A 4Z7MA 1QXYA 3FMRA 4U6WA 5CDVA 2GG2A 2BHDA 5JI6A 2B3LA 4KM3A 1R58A 2NQ7A 2GA2A 3Q6DA 4ZWPA 2GZ5A 2MATA 3RVAA 1KQ0A 1WL9A 3PKBA 4IKRA 4EGEA 2B3KA 1XGMA 2BWTA 1QZYA 1C23A 1XNZA 2Q92A 2Q93A 1YW9A 2HOWA 4IKSA 2BWYA 5CE6A 3CTZA 1XGOA 1R5GA 2EA4A 4A6WA 3BIPA 4IPAA 3IU8A 2B3HA 2IW2A 3MR1A 1YJ3A 5CIKA 3FMQA 4FUKA 4U73A 1BOAA 2V3XA 5FCFA 2V3ZA 3FM3A 4PV4A 4U6EA 2Q95A 2EA2A 1C22A 4FLLA 3S6BA 4S2TP 4FLJA 4ZNGA 2GG9A 2EVCA 4U69A 2GTXA 2BHAA 2BWVA 2GG0A 5JHUA 2BH3A 5D6FA 4IECA 3TB5A 2ZSGA 2G6PA 4S00A 5CLSA 1QXWA 3CB6A 2V3YA 1C21A 4JUQA 1C27A 2EVOA 3MATA 2BWUA 2GG8A 2GU5A 4U71A 4IKUA 4IF7A 3TAVA 4U70A 2BN7A 2GG7A 1WLRA 3CB5A 2NQ6A 2ADUA 4RZZA 3BIQA 2GG3A 1W7VA 2P99A 1MATA 1PV9A 4PNCA 2BHBA 2GGBA 4U6JA 2OKNA 2P9AA 2V6CA 2GU4A 1XGNA 3RORA 5FCHA 2BHCA 4R60A 3PKDA 4IDYA 3PKEA 4FLIA 4FO7A 4FO8A 4FKCA 1WBQA 1WN1A 1YW8A 2EVMA 1QXZA 3IG4A 1KQ9A 1KP0A 2OAZA 5CDLA 2GG5A 4ZWOA 2Q96A
chains in the Genus database with same CATH topology
2BWSA 1B59A 1N51A 4IKTA 4U75A 4U1BA 2DFIA 1WL6A 4S2RP 4RGZ1 1O0XA 1Y1NA 2GU7A 5CNXA 4HXXA 3D27A 3L24A 2BWXA 2Q94A 3PKCA 4B28A 4U76A 3MX6A 3PKAA 5CDEA 1XGSA 4U6ZA 3BITA 1W2MA 2GGCA 4OOKA 4S01A 5E5BA 2GU6A 2P98A 4U6CA 1YW7A 1R5HA 5JFRA 5D6EA 2BB7A 2Q8KA 1WKMA 4QR8A 1M35A 1C24A 1YVMA 3L7GA 2BWWA 4IU6A 1CHMA 3IU9A 4A6VA 1JAWA 1B6AA 4RZYA 4FLKA 3IU7A 1BN5A 4MATA 1A16A 4ZWUA 1WY2A 4Z7MA 1QXYA 3FMRA 4U6WA 5CDVA 2GG2A 2BHDA 5JI6A 2B3LA 4KM3A 1R58A 2NQ7A 2GA2A 3Q6DA 4ZWPA 2GZ5A 2MATA 3RVAA 1KQ0A 1WL9A 3PKBA 4IKRA 4EGEA 2B3KA 1XGMA 2BWTA 1QZYA 1C23A 1XNZA 2Q92A 2Q93A 1YW9A 2HOWA 4IKSA 2BWYA 5CE6A 3CTZA 1XGOA 1R5GA 2EA4A 4A6WA 3BIPA 4IPAA 3IU8A 2B3HA 2IW2A 3MR1A 1YJ3A 5CIKA 3FMQA 4FUKA 4U73A 1BOAA 2V3XA 5FCFA 2V3ZA 3FM3A 4PV4A 4U6EA 2Q95A 2EA2A 1C22A 4FLLA 3S6BA 4S2TP 4FLJA 4ZNGA 2GG9A 2EVCA 4U69A 2GTXA 2BHAA 2BWVA 2GG0A 5JHUA 2BH3A 5D6FA 4IECA 3TB5A 2ZSGA 2G6PA 4S00A 5CLSA 1QXWA 3CB6A 2V3YA 1C21A 4JUQA 1C27A 2EVOA 3MATA 2BWUA 2GG8A 2GU5A 4U71A 4IKUA 4IF7A 3TAVA 4U70A 2BN7A 2GG7A 1WLRA 3CB5A 2NQ6A 2ADUA 4RZZA 3BIQA 2GG3A 1W7VA 2P99A 1MATA 1PV9A 4PNCA 2BHBA 2GGBA 4U6JA 2OKNA 2P9AA 2V6CA 2GU4A 1XGNA 3RORA 5FCHA 2BHCA 4R60A 3PKDA 4IDYA 3PKEA 4FLIA 4FO7A 4FO8A 4FKCA 1WBQA 1WN1A 1YW8A 2EVMA 1QXZA 3IG4A 1KQ9A 1KP0A 2OAZA 5CDLA 2GG5A 4ZWOA 2Q96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWS A;  1B59 A;  1N51 A;  4IKT A;  4U75 A;  4U1B A;  2DFI A;  1WL6 A;  4S2R P;  4RGZ 1;  1O0X A;  1Y1N A;  2GU7 A;  5CNX A;  4HXX A;  3D27 A;  3L24 A;  2BWX A;  2Q94 A;  3PKC A;  4B28 A;  4U76 A;  3MX6 A;  3PKA A;  5CDE A;  1XGS A;  4U6Z A;  3BIT A;  1W2M A;  2GGC A;  4OOK A;  4S01 A;  5E5B A;  2GU6 A;  2P98 A;  4U6C A;  1YW7 A;  1R5H A;  5JFR A;  5D6E A;  2BB7 A;  2Q8K A;  1WKM A;  4QR8 A;  1M35 A;  1C24 A;  1YVM A;  3L7G A;  2BWW A;  4IU6 A;  1CHM A;  3IU9 A;  4A6V A;  1JAW A;  1B6A A;  4RZY A;  4FLK A;  3IU7 A;  1BN5 A;  4MAT A;  1A16 A;  4ZWU A;  1WY2 A;  4Z7M A;  1QXY A;  3FMR A;  4U6W A;  5CDV A;  2GG2 A;  2BHD A;  5JI6 A;  2B3L A;  4KM3 A;  1R58 A;  2NQ7 A;  2GA2 A;  3Q6D A;  4ZWP A;  2GZ5 A;  2MAT A;  3RVA A;  1KQ0 A;  1WL9 A;  3PKB A;  4IKR A;  4EGE A;  2B3K A;  1XGM A;  2BWT A;  1QZY A;  1C23 A;  1XNZ A;  2Q92 A;  2Q93 A;  1YW9 A;  2HOW A;  4IKS A;  2BWY A;  5CE6 A;  3CTZ A;  1XGO A;  1R5G A;  2EA4 A;  4A6W A;  3BIP A;  4IPA A;  3IU8 A;  2B3H A;  2IW2 A;  3MR1 A;  1YJ3 A;  5CIK A;  3FMQ A;  4FUK A;  4U73 A;  1BOA A;  2V3X A;  5FCF A;  2V3Z A;  3FM3 A;  4PV4 A;  4U6E A;  2Q95 A;  2EA2 A;  1C22 A;  4FLL A;  3S6B A;  4S2T P;  4FLJ A;  4ZNG A;  2GG9 A;  2EVC A;  4U69 A;  2GTX A;  2BHA A;  2BWV A;  2GG0 A;  5JHU A;  2BH3 A;  5D6F A;  4IEC A;  3TB5 A;  2ZSG A;  2G6P A;  4S00 A;  5CLS A;  1QXW A;  3CB6 A;  2V3Y A;  1C21 A;  4JUQ A;  1C27 A;  2EVO A;  3MAT A;  2BWU A;  2GG8 A;  2GU5 A;  4U71 A;  4IKU A;  4IF7 A;  3TAV A;  4U70 A;  2BN7 A;  2GG7 A;  1WLR A;  3CB5 A;  2NQ6 A;  2ADU A;  4RZZ A;  3BIQ A;  2GG3 A;  1W7V A;  2P99 A;  1MAT A;  1PV9 A;  4PNC A;  2BHB A;  2GGB A;  4U6J A;  2OKN A;  2P9A A;  2V6C A;  2GU4 A;  1XGN A;  3ROR A;  5FCH A;  2BHC A;  4R60 A;  3PKD A;  4IDY A;  3PKE A;  4FLI A;  4FO7 A;  4FO8 A;  4FKC A;  1WBQ A;  1WN1 A;  1YW8 A;  2EVM A;  1QXZ A;  3IG4 A;  1KQ9 A;  1KP0 A;  2OAZ A;  5CDL A;  2GG5 A;  4ZWO A;  2Q96 A; 
#chains in the Genus database with same CATH topology
 2BWS A;  1B59 A;  1N51 A;  4IKT A;  4U75 A;  4U1B A;  2DFI A;  1WL6 A;  4S2R P;  4RGZ 1;  1O0X A;  1Y1N A;  2GU7 A;  5CNX A;  4HXX A;  3D27 A;  3L24 A;  2BWX A;  2Q94 A;  3PKC A;  4B28 A;  4U76 A;  3MX6 A;  3PKA A;  5CDE A;  1XGS A;  4U6Z A;  3BIT A;  1W2M A;  2GGC A;  4OOK A;  4S01 A;  5E5B A;  2GU6 A;  2P98 A;  4U6C A;  1YW7 A;  1R5H A;  5JFR A;  5D6E A;  2BB7 A;  2Q8K A;  1WKM A;  4QR8 A;  1M35 A;  1C24 A;  1YVM A;  3L7G A;  2BWW A;  4IU6 A;  1CHM A;  3IU9 A;  4A6V A;  1JAW A;  1B6A A;  4RZY A;  4FLK A;  3IU7 A;  1BN5 A;  4MAT A;  1A16 A;  4ZWU A;  1WY2 A;  4Z7M A;  1QXY A;  3FMR A;  4U6W A;  5CDV A;  2GG2 A;  2BHD A;  5JI6 A;  2B3L A;  4KM3 A;  1R58 A;  2NQ7 A;  2GA2 A;  3Q6D A;  4ZWP A;  2GZ5 A;  2MAT A;  3RVA A;  1KQ0 A;  1WL9 A;  3PKB A;  4IKR A;  4EGE A;  2B3K A;  1XGM A;  2BWT A;  1QZY A;  1C23 A;  1XNZ A;  2Q92 A;  2Q93 A;  1YW9 A;  2HOW A;  4IKS A;  2BWY A;  5CE6 A;  3CTZ A;  1XGO A;  1R5G A;  2EA4 A;  4A6W A;  3BIP A;  4IPA A;  3IU8 A;  2B3H A;  2IW2 A;  3MR1 A;  1YJ3 A;  5CIK A;  3FMQ A;  4FUK A;  4U73 A;  1BOA A;  2V3X A;  5FCF A;  2V3Z A;  3FM3 A;  4PV4 A;  4U6E A;  2Q95 A;  2EA2 A;  1C22 A;  4FLL A;  3S6B A;  4S2T P;  4FLJ A;  4ZNG A;  2GG9 A;  2EVC A;  4U69 A;  2GTX A;  2BHA A;  2BWV A;  2GG0 A;  5JHU A;  2BH3 A;  5D6F A;  4IEC A;  3TB5 A;  2ZSG A;  2G6P A;  4S00 A;  5CLS A;  1QXW A;  3CB6 A;  2V3Y A;  1C21 A;  4JUQ A;  1C27 A;  2EVO A;  3MAT A;  2BWU A;  2GG8 A;  2GU5 A;  4U71 A;  4IKU A;  4IF7 A;  3TAV A;  4U70 A;  2BN7 A;  2GG7 A;  1WLR A;  3CB5 A;  2NQ6 A;  2ADU A;  4RZZ A;  3BIQ A;  2GG3 A;  1W7V A;  2P99 A;  1MAT A;  1PV9 A;  4PNC A;  2BHB A;  2GGB A;  4U6J A;  2OKN A;  2P9A A;  2V6C A;  2GU4 A;  1XGN A;  3ROR A;  5FCH A;  2BHC A;  4R60 A;  3PKD A;  4IDY A;  3PKE A;  4FLI A;  4FO7 A;  4FO8 A;  4FKC A;  1WBQ A;  1WN1 A;  1YW8 A;  2EVM A;  1QXZ A;  3IG4 A;  1KQ9 A;  1KP0 A;  2OAZ A;  5CDL A;  2GG5 A;  4ZWO A;  2Q96 A; 
#chains in the Genus database with same CATH homology
 2BWS A;  1B59 A;  1N51 A;  4IKT A;  4U75 A;  4U1B A;  2DFI A;  1WL6 A;  4S2R P;  4RGZ 1;  1O0X A;  1Y1N A;  2GU7 A;  5CNX A;  4HXX A;  3D27 A;  3L24 A;  2BWX A;  2Q94 A;  3PKC A;  4B28 A;  4U76 A;  3MX6 A;  3PKA A;  5CDE A;  1XGS A;  4U6Z A;  3BIT A;  1W2M A;  2GGC A;  4OOK A;  4S01 A;  5E5B A;  2GU6 A;  2P98 A;  4U6C A;  1YW7 A;  1R5H A;  5JFR A;  5D6E A;  2BB7 A;  2Q8K A;  1WKM A;  4QR8 A;  1M35 A;  1C24 A;  1YVM A;  3L7G A;  2BWW A;  4IU6 A;  1CHM A;  3IU9 A;  4A6V A;  1JAW A;  1B6A A;  4RZY A;  4FLK A;  3IU7 A;  1BN5 A;  4MAT A;  1A16 A;  4ZWU A;  1WY2 A;  4Z7M A;  1QXY A;  3FMR A;  4U6W A;  5CDV A;  2GG2 A;  2BHD A;  5JI6 A;  2B3L A;  4KM3 A;  1R58 A;  2NQ7 A;  2GA2 A;  3Q6D A;  4ZWP A;  2GZ5 A;  2MAT A;  3RVA A;  1KQ0 A;  1WL9 A;  3PKB A;  4IKR A;  4EGE A;  2B3K A;  1XGM A;  2BWT A;  1QZY A;  1C23 A;  1XNZ A;  2Q92 A;  2Q93 A;  1YW9 A;  2HOW A;  4IKS A;  2BWY A;  5CE6 A;  3CTZ A;  1XGO A;  1R5G A;  2EA4 A;  4A6W A;  3BIP A;  4IPA A;  3IU8 A;  2B3H A;  2IW2 A;  3MR1 A;  1YJ3 A;  5CIK A;  3FMQ A;  4FUK A;  4U73 A;  1BOA A;  2V3X A;  5FCF A;  2V3Z A;  3FM3 A;  4PV4 A;  4U6E A;  2Q95 A;  2EA2 A;  1C22 A;  4FLL A;  3S6B A;  4S2T P;  4FLJ A;  4ZNG A;  2GG9 A;  2EVC A;  4U69 A;  2GTX A;  2BHA A;  2BWV A;  2GG0 A;  5JHU A;  2BH3 A;  5D6F A;  4IEC A;  3TB5 A;  2ZSG A;  2G6P A;  4S00 A;  5CLS A;  1QXW A;  3CB6 A;  2V3Y A;  1C21 A;  4JUQ A;  1C27 A;  2EVO A;  3MAT A;  2BWU A;  2GG8 A;  2GU5 A;  4U71 A;  4IKU A;  4IF7 A;  3TAV A;  4U70 A;  2BN7 A;  2GG7 A;  1WLR A;  3CB5 A;  2NQ6 A;  2ADU A;  4RZZ A;  3BIQ A;  2GG3 A;  1W7V A;  2P99 A;  1MAT A;  1PV9 A;  4PNC A;  2BHB A;  2GGB A;  4U6J A;  2OKN A;  2P9A A;  2V6C A;  2GU4 A;  1XGN A;  3ROR A;  5FCH A;  2BHC A;  4R60 A;  3PKD A;  4IDY A;  3PKE A;  4FLI A;  4FO7 A;  4FO8 A;  4FKC A;  1WBQ A;  1WN1 A;  1YW8 A;  2EVM A;  1QXZ A;  3IG4 A;  1KQ9 A;  1KP0 A;  2OAZ A;  5CDL A;  2GG5 A;  4ZWO A;  2Q96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...