3MX6A

Crystal structure of methionine aminopeptidase from rickettsia prowazekii bound to methionine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
257
Chain Sequence
IKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPLNYKGFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAGNYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTLSPKKLDYPPY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methionine aminopeptidase
publication title Rickettsia prowazekii methionine aminopeptidase as a promising target for the development of antibacterial agents.
pubmed doi rcsb
source organism Rickettsia prowazekii
molecule tags Hydrolase
total genus 80
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 3.4.11.18: Methionyl aminopeptidase.
pdb deposition date 2010-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3mx6A00
4R60A 4RZZA 1C24A 4IKUA 3IU9A 3Q6DA 2BWXA 2BHDA 3CTZA 4A6WA 4FLJA 2GG8A 2ADUA 2GGBA 1CHMA 2V3XA 4FLLA 5CIKA 4MATA 4FO7A 1QXZA 2EVMA 1C27A 2OAZA 3TAVA 2BHBA 3CB5A 1XGOA 1YVMA 1R5HA 2MATA 4ZWOA 4IDYA 2V6CA 1B6AA 2Q95A 2P99A 4FKCA 1WL6A 2Q94A 2ZSGA 2GU5A 5CDEA 1W7VA 3PKDA 2Q92A 1QXWA 2GU6A 1WLRA 4FLIA 3RVAA 2IW2A 1MATA 3MR1A 1R5GA 2EVCA 4FLKA 3PKEA 2GGCA 2V3YA 4IECA 3MX6A 3PKBA 3BITA 3BIQA 4PNCA 4FO8A 2GG0A 1C23A 4FUKA 4IPAA 2BWYA 2B3KA 2BWSA 1C21A 2GG9A 2NQ6A 4Z7MA 5JFRA 4IKRA 5D6FA 2DFIA 3S6BA 4QR8A 3RORA 1WKMA 2OKNA 1KQ9A 4U6ZA 2BWWA 5FCHA 4PV4A 2EA2A 4U75A 4B28A 4S00A 1YW7A 2BHAA 2B3LA 4RZYA 2GG2A 4U6JA 5CNXA 2Q8KA 2EVOA 1XGMA 2GG7A 1M35A 2B3HA 2P98A 2EA4A 2GG3A 3BIPA 4IKSA 2GG5A 3MATA 2GZ5A 4U6EA 1WBQA 1JAWA 1N51A 5CE6A 2Q96A 4ZWPA 3IU8A 2V3ZA 4U69A 4U76A 1A16A 1KQ0A 1YJ3A 1C22A 1BN5A 1YW8A 2BWUA 4IF7A 3PKCA 3D27A 2GA2A 3L7GA 2Q93A 1PV9A 4ZNGA 5CDVA 1XNZA 1XGSA 4S2RP 5JI6A 1QZYA 5JHUA 2P9AA 2BWVA 2GU7A 1O0XA 4U6CA 1WY2A 4HXXA 4U70A 2GU4A 5CLSA 5E5BA 4ZWUA 1B59A 2BN7A 4EGEA 4IU6A 3IG4A 4S01A 2GTXA 3FMQA 1XGNA 2G6PA 1QXYA 4JUQA 1WL9A 2NQ7A 4KM3A 4S2TP 1BOAA 2BHCA 4U6WA 5D6EA 4U73A 5FCFA 3CB6A 1YW9A 2BWTA 2HOWA 4IKTA 3TB5A 1Y1NA 1R58A 1W2MA 3FM3A 4RGZ1 4U71A 4OOKA 2BB7A 4U1BA 4A6VA 1KP0A 3L24A 3PKAA 3IU7A 5CDLA 2BH3A 1WN1A 3FMRA
chains in the Genus database with same CATH superfamily
4R60A 4RZZA 1C24A 4IKUA 3IU9A 3Q6DA 2BWXA 2BHDA 3CTZA 4A6WA 4FLJA 2GG8A 2ADUA 2GGBA 1CHMA 2V3XA 4FLLA 5CIKA 4MATA 4FO7A 1QXZA 2EVMA 1C27A 2OAZA 3TAVA 2BHBA 3CB5A 1XGOA 1YVMA 1R5HA 2MATA 4ZWOA 4IDYA 2V6CA 1B6AA 2Q95A 2P99A 4FKCA 1WL6A 2Q94A 2ZSGA 2GU5A 5CDEA 1W7VA 3PKDA 2Q92A 1QXWA 2GU6A 1WLRA 4FLIA 3RVAA 2IW2A 1MATA 3MR1A 1R5GA 2EVCA 4FLKA 3PKEA 2GGCA 2V3YA 4IECA 3MX6A 3PKBA 3BITA 3BIQA 4PNCA 4FO8A 2GG0A 1C23A 4FUKA 4IPAA 2BWYA 2B3KA 2BWSA 1C21A 2GG9A 2NQ6A 4Z7MA 5JFRA 4IKRA 5D6FA 2DFIA 3S6BA 4QR8A 3RORA 1WKMA 2OKNA 1KQ9A 4U6ZA 2BWWA 5FCHA 4PV4A 2EA2A 4U75A 4B28A 4S00A 1YW7A 2BHAA 2B3LA 4RZYA 2GG2A 4U6JA 5CNXA 2Q8KA 2EVOA 1XGMA 2GG7A 1M35A 2B3HA 2P98A 2EA4A 2GG3A 3BIPA 4IKSA 2GG5A 3MATA 2GZ5A 4U6EA 1WBQA 1JAWA 1N51A 5CE6A 2Q96A 4ZWPA 3IU8A 2V3ZA 4U69A 4U76A 1A16A 1KQ0A 1YJ3A 1C22A 1BN5A 1YW8A 2BWUA 4IF7A 3PKCA 3D27A 2GA2A 3L7GA 2Q93A 1PV9A 4ZNGA 5CDVA 1XNZA 1XGSA 4S2RP 5JI6A 1QZYA 5JHUA 2P9AA 2BWVA 2GU7A 1O0XA 4U6CA 1WY2A 4HXXA 4U70A 2GU4A 5CLSA 5E5BA 4ZWUA 1B59A 2BN7A 4EGEA 4IU6A 3IG4A 4S01A 2GTXA 3FMQA 1XGNA 2G6PA 1QXYA 4JUQA 1WL9A 2NQ7A 4KM3A 4S2TP 1BOAA 2BHCA 4U6WA 5D6EA 4U73A 5FCFA 3CB6A 1YW9A 2BWTA 2HOWA 4IKTA 3TB5A 1Y1NA 1R58A 1W2MA 3FM3A 4RGZ1 4U71A 4OOKA 2BB7A 4U1BA 4A6VA 1KP0A 3L24A 3PKAA 3IU7A 5CDLA 2BH3A 1WN1A 3FMRA
chains in the Genus database with same CATH topology
4R60A 4RZZA 1C24A 4IKUA 3IU9A 3Q6DA 2BWXA 2BHDA 3CTZA 4A6WA 4FLJA 2GG8A 2ADUA 2GGBA 1CHMA 2V3XA 4FLLA 5CIKA 4MATA 4FO7A 1QXZA 2EVMA 1C27A 2OAZA 3TAVA 2BHBA 3CB5A 1XGOA 1YVMA 1R5HA 2MATA 4ZWOA 4IDYA 2V6CA 1B6AA 2Q95A 2P99A 4FKCA 1WL6A 2Q94A 2ZSGA 2GU5A 5CDEA 1W7VA 3PKDA 2Q92A 1QXWA 2GU6A 1WLRA 4FLIA 3RVAA 2IW2A 1MATA 3MR1A 1R5GA 2EVCA 4FLKA 3PKEA 2GGCA 2V3YA 4IECA 3MX6A 3PKBA 3BITA 3BIQA 4PNCA 4FO8A 2GG0A 1C23A 4FUKA 4IPAA 2BWYA 2B3KA 2BWSA 1C21A 2GG9A 2NQ6A 4Z7MA 5JFRA 4IKRA 5D6FA 2DFIA 3S6BA 4QR8A 3RORA 1WKMA 2OKNA 1KQ9A 4U6ZA 2BWWA 5FCHA 4PV4A 2EA2A 4U75A 4B28A 4S00A 1YW7A 2BHAA 2B3LA 4RZYA 2GG2A 4U6JA 5CNXA 2Q8KA 2EVOA 1XGMA 2GG7A 1M35A 2B3HA 2P98A 2EA4A 2GG3A 3BIPA 4IKSA 2GG5A 3MATA 2GZ5A 4U6EA 1WBQA 1JAWA 1N51A 5CE6A 2Q96A 4ZWPA 3IU8A 2V3ZA 4U69A 4U76A 1A16A 1KQ0A 1YJ3A 1C22A 1BN5A 1YW8A 2BWUA 4IF7A 3PKCA 3D27A 2GA2A 3L7GA 2Q93A 1PV9A 4ZNGA 5CDVA 1XNZA 1XGSA 4S2RP 5JI6A 1QZYA 5JHUA 2P9AA 2BWVA 2GU7A 1O0XA 4U6CA 1WY2A 4HXXA 4U70A 2GU4A 5CLSA 5E5BA 4ZWUA 1B59A 2BN7A 4EGEA 4IU6A 3IG4A 4S01A 2GTXA 3FMQA 1XGNA 2G6PA 1QXYA 4JUQA 1WL9A 2NQ7A 4KM3A 4S2TP 1BOAA 2BHCA 4U6WA 5D6EA 4U73A 5FCFA 3CB6A 1YW9A 2BWTA 2HOWA 4IKTA 3TB5A 1Y1NA 1R58A 1W2MA 3FM3A 4RGZ1 4U71A 4OOKA 2BB7A 4U1BA 4A6VA 1KP0A 3L24A 3PKAA 3IU7A 5CDLA 2BH3A 1WN1A 3FMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R60 A;  4RZZ A;  1C24 A;  4IKU A;  3IU9 A;  3Q6D A;  2BWX A;  2BHD A;  3CTZ A;  4A6W A;  4FLJ A;  2GG8 A;  2ADU A;  2GGB A;  1CHM A;  2V3X A;  4FLL A;  5CIK A;  4MAT A;  4FO7 A;  1QXZ A;  2EVM A;  1C27 A;  2OAZ A;  3TAV A;  2BHB A;  3CB5 A;  1XGO A;  1YVM A;  1R5H A;  2MAT A;  4ZWO A;  4IDY A;  2V6C A;  1B6A A;  2Q95 A;  2P99 A;  4FKC A;  1WL6 A;  2Q94 A;  2ZSG A;  2GU5 A;  5CDE A;  1W7V A;  3PKD A;  2Q92 A;  1QXW A;  2GU6 A;  1WLR A;  4FLI A;  3RVA A;  2IW2 A;  1MAT A;  3MR1 A;  1R5G A;  2EVC A;  4FLK A;  3PKE A;  2GGC A;  2V3Y A;  4IEC A;  3MX6 A;  3PKB A;  3BIT A;  3BIQ A;  4PNC A;  4FO8 A;  2GG0 A;  1C23 A;  4FUK A;  4IPA A;  2BWY A;  2B3K A;  2BWS A;  1C21 A;  2GG9 A;  2NQ6 A;  4Z7M A;  5JFR A;  4IKR A;  5D6F A;  2DFI A;  3S6B A;  4QR8 A;  3ROR A;  1WKM A;  2OKN A;  1KQ9 A;  4U6Z A;  2BWW A;  5FCH A;  4PV4 A;  2EA2 A;  4U75 A;  4B28 A;  4S00 A;  1YW7 A;  2BHA A;  2B3L A;  4RZY A;  2GG2 A;  4U6J A;  5CNX A;  2Q8K A;  2EVO A;  1XGM A;  2GG7 A;  1M35 A;  2B3H A;  2P98 A;  2EA4 A;  2GG3 A;  3BIP A;  4IKS A;  2GG5 A;  3MAT A;  2GZ5 A;  4U6E A;  1WBQ A;  1JAW A;  1N51 A;  5CE6 A;  2Q96 A;  4ZWP A;  3IU8 A;  2V3Z A;  4U69 A;  4U76 A;  1A16 A;  1KQ0 A;  1YJ3 A;  1C22 A;  1BN5 A;  1YW8 A;  2BWU A;  4IF7 A;  3PKC A;  3D27 A;  2GA2 A;  3L7G A;  2Q93 A;  1PV9 A;  4ZNG A;  5CDV A;  1XNZ A;  1XGS A;  4S2R P;  5JI6 A;  1QZY A;  5JHU A;  2P9A A;  2BWV A;  2GU7 A;  1O0X A;  4U6C A;  1WY2 A;  4HXX A;  4U70 A;  2GU4 A;  5CLS A;  5E5B A;  4ZWU A;  1B59 A;  2BN7 A;  4EGE A;  4IU6 A;  3IG4 A;  4S01 A;  2GTX A;  3FMQ A;  1XGN A;  2G6P A;  1QXY A;  4JUQ A;  1WL9 A;  2NQ7 A;  4KM3 A;  4S2T P;  1BOA A;  2BHC A;  4U6W A;  5D6E A;  4U73 A;  5FCF A;  3CB6 A;  1YW9 A;  2BWT A;  2HOW A;  4IKT A;  3TB5 A;  1Y1N A;  1R58 A;  1W2M A;  3FM3 A;  4RGZ 1;  4U71 A;  4OOK A;  2BB7 A;  4U1B A;  4A6V A;  1KP0 A;  3L24 A;  3PKA A;  3IU7 A;  5CDL A;  2BH3 A;  1WN1 A;  3FMR A; 
#chains in the Genus database with same CATH topology
 4R60 A;  4RZZ A;  1C24 A;  4IKU A;  3IU9 A;  3Q6D A;  2BWX A;  2BHD A;  3CTZ A;  4A6W A;  4FLJ A;  2GG8 A;  2ADU A;  2GGB A;  1CHM A;  2V3X A;  4FLL A;  5CIK A;  4MAT A;  4FO7 A;  1QXZ A;  2EVM A;  1C27 A;  2OAZ A;  3TAV A;  2BHB A;  3CB5 A;  1XGO A;  1YVM A;  1R5H A;  2MAT A;  4ZWO A;  4IDY A;  2V6C A;  1B6A A;  2Q95 A;  2P99 A;  4FKC A;  1WL6 A;  2Q94 A;  2ZSG A;  2GU5 A;  5CDE A;  1W7V A;  3PKD A;  2Q92 A;  1QXW A;  2GU6 A;  1WLR A;  4FLI A;  3RVA A;  2IW2 A;  1MAT A;  3MR1 A;  1R5G A;  2EVC A;  4FLK A;  3PKE A;  2GGC A;  2V3Y A;  4IEC A;  3MX6 A;  3PKB A;  3BIT A;  3BIQ A;  4PNC A;  4FO8 A;  2GG0 A;  1C23 A;  4FUK A;  4IPA A;  2BWY A;  2B3K A;  2BWS A;  1C21 A;  2GG9 A;  2NQ6 A;  4Z7M A;  5JFR A;  4IKR A;  5D6F A;  2DFI A;  3S6B A;  4QR8 A;  3ROR A;  1WKM A;  2OKN A;  1KQ9 A;  4U6Z A;  2BWW A;  5FCH A;  4PV4 A;  2EA2 A;  4U75 A;  4B28 A;  4S00 A;  1YW7 A;  2BHA A;  2B3L A;  4RZY A;  2GG2 A;  4U6J A;  5CNX A;  2Q8K A;  2EVO A;  1XGM A;  2GG7 A;  1M35 A;  2B3H A;  2P98 A;  2EA4 A;  2GG3 A;  3BIP A;  4IKS A;  2GG5 A;  3MAT A;  2GZ5 A;  4U6E A;  1WBQ A;  1JAW A;  1N51 A;  5CE6 A;  2Q96 A;  4ZWP A;  3IU8 A;  2V3Z A;  4U69 A;  4U76 A;  1A16 A;  1KQ0 A;  1YJ3 A;  1C22 A;  1BN5 A;  1YW8 A;  2BWU A;  4IF7 A;  3PKC A;  3D27 A;  2GA2 A;  3L7G A;  2Q93 A;  1PV9 A;  4ZNG A;  5CDV A;  1XNZ A;  1XGS A;  4S2R P;  5JI6 A;  1QZY A;  5JHU A;  2P9A A;  2BWV A;  2GU7 A;  1O0X A;  4U6C A;  1WY2 A;  4HXX A;  4U70 A;  2GU4 A;  5CLS A;  5E5B A;  4ZWU A;  1B59 A;  2BN7 A;  4EGE A;  4IU6 A;  3IG4 A;  4S01 A;  2GTX A;  3FMQ A;  1XGN A;  2G6P A;  1QXY A;  4JUQ A;  1WL9 A;  2NQ7 A;  4KM3 A;  4S2T P;  1BOA A;  2BHC A;  4U6W A;  5D6E A;  4U73 A;  5FCF A;  3CB6 A;  1YW9 A;  2BWT A;  2HOW A;  4IKT A;  3TB5 A;  1Y1N A;  1R58 A;  1W2M A;  3FM3 A;  4RGZ 1;  4U71 A;  4OOK A;  2BB7 A;  4U1B A;  4A6V A;  1KP0 A;  3L24 A;  3PKA A;  3IU7 A;  5CDL A;  2BH3 A;  1WN1 A;  3FMR A; 
#chains in the Genus database with same CATH homology
 4R60 A;  4RZZ A;  1C24 A;  4IKU A;  3IU9 A;  3Q6D A;  2BWX A;  2BHD A;  3CTZ A;  4A6W A;  4FLJ A;  2GG8 A;  2ADU A;  2GGB A;  1CHM A;  2V3X A;  4FLL A;  5CIK A;  4MAT A;  4FO7 A;  1QXZ A;  2EVM A;  1C27 A;  2OAZ A;  3TAV A;  2BHB A;  3CB5 A;  1XGO A;  1YVM A;  1R5H A;  2MAT A;  4ZWO A;  4IDY A;  2V6C A;  1B6A A;  2Q95 A;  2P99 A;  4FKC A;  1WL6 A;  2Q94 A;  2ZSG A;  2GU5 A;  5CDE A;  1W7V A;  3PKD A;  2Q92 A;  1QXW A;  2GU6 A;  1WLR A;  4FLI A;  3RVA A;  2IW2 A;  1MAT A;  3MR1 A;  1R5G A;  2EVC A;  4FLK A;  3PKE A;  2GGC A;  2V3Y A;  4IEC A;  3MX6 A;  3PKB A;  3BIT A;  3BIQ A;  4PNC A;  4FO8 A;  2GG0 A;  1C23 A;  4FUK A;  4IPA A;  2BWY A;  2B3K A;  2BWS A;  1C21 A;  2GG9 A;  2NQ6 A;  4Z7M A;  5JFR A;  4IKR A;  5D6F A;  2DFI A;  3S6B A;  4QR8 A;  3ROR A;  1WKM A;  2OKN A;  1KQ9 A;  4U6Z A;  2BWW A;  5FCH A;  4PV4 A;  2EA2 A;  4U75 A;  4B28 A;  4S00 A;  1YW7 A;  2BHA A;  2B3L A;  4RZY A;  2GG2 A;  4U6J A;  5CNX A;  2Q8K A;  2EVO A;  1XGM A;  2GG7 A;  1M35 A;  2B3H A;  2P98 A;  2EA4 A;  2GG3 A;  3BIP A;  4IKS A;  2GG5 A;  3MAT A;  2GZ5 A;  4U6E A;  1WBQ A;  1JAW A;  1N51 A;  5CE6 A;  2Q96 A;  4ZWP A;  3IU8 A;  2V3Z A;  4U69 A;  4U76 A;  1A16 A;  1KQ0 A;  1YJ3 A;  1C22 A;  1BN5 A;  1YW8 A;  2BWU A;  4IF7 A;  3PKC A;  3D27 A;  2GA2 A;  3L7G A;  2Q93 A;  1PV9 A;  4ZNG A;  5CDV A;  1XNZ A;  1XGS A;  4S2R P;  5JI6 A;  1QZY A;  5JHU A;  2P9A A;  2BWV A;  2GU7 A;  1O0X A;  4U6C A;  1WY2 A;  4HXX A;  4U70 A;  2GU4 A;  5CLS A;  5E5B A;  4ZWU A;  1B59 A;  2BN7 A;  4EGE A;  4IU6 A;  3IG4 A;  4S01 A;  2GTX A;  3FMQ A;  1XGN A;  2G6P A;  1QXY A;  4JUQ A;  1WL9 A;  2NQ7 A;  4KM3 A;  4S2T P;  1BOA A;  2BHC A;  4U6W A;  5D6E A;  4U73 A;  5FCF A;  3CB6 A;  1YW9 A;  2BWT A;  2HOW A;  4IKT A;  3TB5 A;  1Y1N A;  1R58 A;  1W2M A;  3FM3 A;  4RGZ 1;  4U71 A;  4OOK A;  2BB7 A;  4U1B A;  4A6V A;  1KP0 A;  3L24 A;  3PKA A;  3IU7 A;  5CDL A;  2BH3 A;  1WN1 A;  3FMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...