3MXNB

Crystal structure of the rmi core complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
131
structure length
131
Chain Sequence
LPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RecQ-mediated genome instability protein 1
publication title Structure and cellular roles of the RMI core complex from the bloom syndrome dissolvasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 31
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16100 RMI2 RecQ-mediated genome instability protein 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3mxnB00
1AE3A 1NMFA 2UUBL 5JEAJ 3T1YL 3A74A 2ES2A 4DV7L 3HOWG 5C44G 1UWVA 2UXCL 1D7QA 2HT1A 3PO2H 4GOPB 4J15A 2A1AA 3HOYG 3T1HQ 2C35B 2PQAB 1XNQQ 1E3PA 1YJNA 1EWIA 1VQMA 4ME3A 3GTQH 1BBWA 3K0XA 4HIDA 1L0WA 3SGIA 4LF8L 2NZHA 5HGQA 2NZOA 1VQDA 4AYBE 4KLKA 1JJCB 3HOXG 4JI8L 2ZJRA 1I94L 3RN2A 5IYCH 2HHHL 4JI2L 1JB7A 1A0IA 1X3EA 4IOCA 4LFAL 4BY1H 2WP8J 4GNXB 3PSIA 1OXTA 4DR4Q 2UXBQ 4DK6C 4R4CA 4POFA 1OXXK 1YIJA 1CKMA 2A19A 2KHJA 4YCWA 4A3IH 1C7YA 1Q46A 2B63G 1K83H 4LNQA 4DAYB 4OWWB 1PV4A 1CKOA 1PH2A 1X3GA 1QVCA 4RG1A 3U4VA 3PIPA 3F2DA 2V1CC 1U5KA 1KQSA 3S2DH 1X9NA 4YCUA 1PYSB 3F2BA 1IBKQ 3J81i 2XGTA 1VQ7A 3RZOH 1X54A 1L1OB 4C2MH 2JK8A 3J7ZC 5GADC 2ZM6L 1J6QA 3K8AA 3UE1A 3GTGH 3TEHB 2E5LL 2ALYB 2NVTH 2N3SA 1PH9A 4LWCA 4XTCS 4DV4Q 2FXQA 3K81C 4WJ4A 1VQKA 1YVCA 3ULJA 2UU9Q 3S14H 1VQEA 1SRUA 2NN6G 1IBMQ 3S17H 3E9IA 1QUQB 2LXJA 4OXPA 4HJ9A 3M7NA 5C0XG 1VQCA 4YHHQ 2JA8H 4C3IH 1N36Q 1XNRQ 4GN4B 4GN3B 4JI3Q 3U50C 4JBMA 1W3SA 1Q86C 5IP7H 3HOVG 1NE3A 1U0LA 4A3KH 3NBHB 4O2DA 5GAEC 1OXVA 1V9PA 2I5LX 3W1BA 4GS3A 1B7YB 2LXKA 3PGZA 1SN8A 1HZAA 1K8GA 3DM3A 4JC0A 5M3MG 2KBNA 2RCNA 3UDXA 3I2ZA 2AKWB 2A8VA 4BXXH 4JYAQ 3OYYA 4X65Q 1B8AA 4B3TQ 3KJOA 3W5OA 1IZ6A 3AEVA 5BR8L 4LFBL 3PV0A 4GLAC 3TQYA 1CSPA 5J3BA 2K52A 5IYCG 1G291 4JI4L 4A3GH 2VUMG 4EQ5A 4DV2Q 2JA6H 1V1QA 2K14A 2HQLA 1LUZA 5IYBH 3G4SA 5FLMH 4DV5Q 1VQOA 5C4XH 1Y1WH 2UU9L 4A3BH 1HZCA 4DV1Q 4LF5Q 2UUCL 4DAMA 5IYDH 5FJ8G 1Z9FA 3NELA 3CF5A 4HJAA 2OTLA 3KDFB 3CD6A 3HOZG 3EBEA 3D0FA 1K73C 2UXDQ 4IFDG 3S16H 3RR5A 2IY5B 1MJCA 1K8AC 3K7UC 1NTGA 3I4NG 4X62Q 1X56A 1HNWL 5M3FH 2Z6KA 3CQZH 5JJKA 3CCJA 2JA9A 4JOIC 1KAWA 5C0XI 3T1YQ 4DV7Q 1KL9A 2K5HA 2UXCQ 3UDIA 3RNUA 4UP7A 1PH6A 4LUVA 4JV5Q 1VQGA 1O7IA 3L0OA 5GAHC 3NEMA 2IHEA 5M5YH 1N33Q 4L5TA 4DNIA 1XTDA 5HY6A 1A63A 4HJ7A 2LSSA 2R92G 3TS2A 1VQFA 5IP9H 1A62A 2WB1G 4IPDA 5GQOA 3RLFA 4LF8Q 4KHPQ 4A76A 3A5ZB 3MEFA 2CQOA 1WFQA 1VQ6A 3K7AH 1I94Q 3I7FA 3STBC 5FLXc 1NJIC 2HHHQ 4A3DH 4DV1L 4JI2Q 2MFIA 4LFAQ 1PHJA 1PH1A 2RHSB 1Z47A 5DLQE 4DR6Q 4GKJL 4YY3L 4A3JG 3Q8DA 2BH2A 4BBRG 3G48A 3L2PA 1FJGQ 2K5NA 3OW2A 1P8LA 2BA1A 1D8LA 1PA6A 2R6GA 5C4JH 4A3GG 4IFDI 1E1TA 4TVAB 1CKNB 4A4IA 4JV5L 1K0RA 1EIFA 2BA0A 4A3FG 3WWVA 2QGQA 1SMXA 4APVA 4GNXC 4UPAA 4GKKL 2ZM6Q 2Q2HA 4R1JA 3F8TA 4BBSH 2E5LQ 1N33L 3ERSX 3RZDH 3I4MG 1QVGA 3CMEA 2OQKA 3CPFA 4KHPL 4A3LG 1S40A 1YHAA 1UEBA 3AYHB 3STBD 1HH2P 4O0AA 5M3FG 1BKBA 1JMCA 2YTYA 3GTOH 3B6YA 2R7ZG 3GO5A 1EYGA 1LM0A 2I0QA 1XPRA 2F4VL 1EQQA 4UP9A 2YV5A 3G71A 4LF6L 2K4KA 1L1OC 1TWHH 4X66L 3G6EA 4DR6L 1IL2A 1UE1A 1PYBA 1Y14B 2B29A 1FJGL 4MNOA 3HOUG 5C3EH 1Q12A 3I55A 4A93H 4JG2A 4X64L 1EOVA 3GTPH 4AH6A 3PF5A 2R93H 1JT8A 5IY0A 5GROA 1X65A 5BR8Q 4LFBQ 4PMWA 2EQSA 5M5WH 2N78A 2PNHA 3J81c 3OTOL 4JI4Q 1VQ9A 1YI2A 4DV6Q 1WJJA 1VQNA 1Q1BA 4MZ9A 1QZHA 2OQ0A 2JEAI 4JCVE 3M85A 3IRBA 2WFWA 3H0GG 2UUAL 3CC4A 1XPUA 2UUCQ 4IPHA 1GVPA 4LF7L 5LMUQ 1HZ9A 2IHFA 1K9MC 2QEXA 2JE6I 3PUYA 1VQ5A 3TRZA 1PH7A 1HNZL 4B3ML 2Q2IA 4DR1L 4JI6L 4A3CH 3I56A 1MIUA 4POGA 3PO2G 1HNWQ 2KHIA 2WB1E 4TQUS 1SFOH 1PFSA 1FGUA 2ZTDA 3GTMH 1YZ6A 3PUVA 4R4TA 3ER0A 1CSQA 2VQFL 2CFMA 5EAYA 1MKHA 3TREA 1H95A 2KCMA 2ZJQA 3FKIH 3BZKA 2JA5H 2GVAA 2JQOA 1N8RC 3I4OA 1VQAA 3H3VH 3GTLH 5ELNA 4DPGA 1VCIA 3GD7A 1N9WA 4BA1I 4BY1G 4DV6L 4LUOA 4OWTB 4P74A 4P71A 1XMQQ 3CCEA 3F2CA 4C3HH 2MO1A 1GD7A 4LUZA 4DR2Q 4A3IG 1G51A 1LYLA 4OONA 4JI0L 1TWFH 4XIGS 5LMUL 2K50A 1IBLL 3ULPA 2B3GA 4L5SA 4GKJQ 4DUYL 1HNXL 1VQ8A 4YY3Q 5C0XJ 3CCQA 2OTJA 4IJLA 2OCEA 4R4OA 3KF6A 3JAMi 2JA7H 4BY7H 4IPCA 1P16A 1SE8A 2Y0SG 2ZTCA 4DR5Q 5AJ3L 2DGYA 4A3MH 1KHIA 1E1OA 3L7ZC 4H02A 3UE0A 2ASBA 4GOPA 4QY7A 1VQLA 2CWAA 1V43A 4OX9L 3HOWH 1BVSA 5C44H 4HIMA 4HJ8A 5M5XH 1AE2A 3BU2A 2PQAA 3ULLA 2MNAA 3HOYH 3J80i 2RHQB 1KC8C 4QIWE 4GKKQ 1PH4A 2VY3A 4JI7Q 4A75A 1E7ZA 1G6PA 2VZAA 2CWPA 2D62A 2JA8G 1WYDA 1HJPA 1N34L 4DR3L 3S1NH 3HOXH 1XMQL 3GTKH 2IX0A 3S2HH 1VQJA 5IP7G 4A3KG 1VQ4A 2F4VQ 4DR2L 1NMGA 3RLNA 1YHQA 4LF6Q 1PH8A 1R9TH 3GTJH 4X66Q 3S15H 2VS1A 2QA4A 1OXSC 4MTNA 5K36G 4BXXG 3FKIG 1IXRA 4IFDJ 3CAMA 3KOJA 1B70B 1S3OA 3PCOB 3H15A 3M4PA 4DR5L 2B63H 4X64Q 3PO3H 2H5XA 4IO9A 1QZGA 1PH5A 1UE5A 1OTCA 1EFWA 2HIVA 4AIMA 2JEBI 4JI1L 2ZTEA 4LFCQ 4DR7Q 4B3RQ 1L1OA 1A8VA 4QGUA 4QL5A 5LMNQ 2JA6G 4LF9L 5IYBG 5FLMG 1Y1WG 5C4XG 3OTOQ 4A3BG 4PZ8A 4GN5A 4NXNL 3CCUA 5IYDG 4JI7L 1EUJA 4OO1I 4DV0L 1SLJA 1QUQA 3CCMA 1I3QH 1ASZA 2UUAQ 3PIOA 3PUWA 1TWGH 3DLLA 2PI2E 1KRSA 4R4IA 4QQBX 4LF7Q 1YHBA 2RF4A 2YU9H 4QJFA 2YYZA 1KD1C 2R7DA 1I50H 3VDYA 5ELOA 1HNZQ 4P75A 4DR1Q 4B3MQ 1YITA 4JI6Q 3BJUA 1DGSA 1ASYA 2I5HA 4DUZL 3D31A 3S24A 3HOVH 1WCMH 3BZCA 5IWAL 3KFUA 1YBYA 3EIVA 1J5EL 1RIPA 1K3RA 2Q2UA 1WOCA 4IJHA 3ICEA 2F3IA 3M4QA 4IPGA 5M3MH 2VQFQ 3S1MH 4HIOA 5IP9G 1MJEA 1AH9A 4R4QA 1X6OA 3KLWA 1KRTA 4JI5L 3FHWA 4LFCL 3A5UA 3FP9A 4NXML 2IX1A 4DK3C 1KIXA 4NPSA 5LMNL 3RLOA 3CCLA 1VS0A 4K0KL 1PH3A 4C3JH 3CC7A 1S72A 1XMOL 2HIXA 2WAQG 5H1SE 4A3DG 1YNXA 3CW2C 3NENA 3H3VI 2Y0SE 2VUMH 3CMAA 2KCTA 5LMNW 5JJIA 1EIYB 3S1RH 4B3SL 4HIKA 4Y7NH 1NBWA 3HKZG 3KDFA 2VQEL 2CCZA 1I5FA 2D0OA 2I5MX 3AFPA 5FJ8H 4JI0Q 3PO3G 3HOZH 1HR0L 1IBLQ 3PF4A 2VW9A 1BBUA 2OWOA 4DUYQ 1HNXQ 2Q2TA 4PZ6A 1WI5A 4RMFA 1Q8KA 4P73A 3I4NH 3KYHC 3CXCA 2L15A 5AJ3Q 2PI2A 3AFQA 1HR0W 3M9BA 4OWXB 3T1HL 2N8NA 4LW1A 4UY8C 1VQIA 2AWNA 3A0JA 1XNQL 4BBSG 4OX9Q 3UDGA 1LTLA 3AQQA 2R7FA 1QVFA 3KF8B 1YEZA 1C9OA 2E2JH 2K5VA 1GO3E 4NB3A 4GLXA 4DR7L 4B3RL 1SR3A 3GDEA 2YTXA 4ALPA 2Z0SA 3CP0A 2R92H 4JOIA 3K80C 1Q7YC 4Y52H 2EIFA 5IE8A 1T9HA 3MXNB 3U58A 4L5QA 1Q81C 1N34Q 4DR3Q 4IOAA 3F1ZA 4DR4L 1L2FA 1I6HH 2UXBL 4FDBA 3CCVA 1GKHA 2E8GA 1GM5A 1N32Q 1WCMG 1Q1EA 1YJWA 5C3EG 3CC2A 4A93G 1CUKA 3CCRA 1KXLA 4AYBG 2BH8A 1XJVA 1E22A 1SROA 4LF4Q 4A3JH 1JJ2A 2R93G 4YWKA 4BBRH 4AQYQ 1M1KC 1E24A 1Y1VH 4KHZA 3JAMc 2F52A 4A3EH 1IBKL 1CKNA 4JBJA 4WJ3M 1X55A 4OO1G 5IT9c 2NVQH 1RL2A 4JI1Q 2XTIA 1TWCH 4DV4L 4LF9Q 1PVOA 4A3FH 3PUZA 2PMZE 3J80c 2D0PA 1UE6A 2K75A 3HFZB 1UE7A 4GLVB 2AMCB 4BA2I 1OXUA 4NXNQ 1IBML 1JJGA 4P72A 3I4MH 4DV0Q 4YHHL 1IYJB 2CKZB 2N49A 2ATWA 1N36L 4DV3Q 1XNRL 3J81j 4JI3L 4A3LH 4A3CG 3CPWA 1W2BA 1N32L 1FVIA 4GNXA 2NN6I 3J7A5 5JEAG 2R7ZH 4PG3A 2MQHA 3M4OH 3JC66 4L5RC 2UUBQ 1HZBA 3EN2A 2ID0A 5E7NA 4JBWA 2WAQE 2E2HH 4YWMA 4DUZQ 4LF4L 2JA5G 1X3FA 5IWAQ 4X65L 4AQYL 3KJPA 4JYAL 2GVBA 4B3TL 3HOUH 1J5EQ 3E9HA 3LGJA 1C0AA 1TXYA 1VQHA 2NVYH 3HKZE 3UDFA 2JJQA 3S1QH 2KENA 3E0EA 4JI5Q 1NY4A 4UP8A 4YCVA 4NXMQ 2VNUD 2VL6A 4DV2L 3RN5A 4K0KQ 5GAGC 2DUDA 3HKSA 2Z6KC 1JE5A 4PZ7A 4HJ5A 4JI8Q 2NVXH 4DV5L 4DKAC 4KI0A 1XMOQ 5JJLA 1FL0A 2AWOA 4GOPC 1XPOA 4LF5L 1TWAH 2MO0A 3M3YH 1M90C 4X6AH 2EXDA 2E2IH 3U4ZA 1VQBA 3ZJYC 4EX5A 1EQRA 2UXDL 2YTVA 2GN5A 1VQPA 4B3SQ 4DV3L 1Q82C 3W1GA 2VQEQ 3H0GH 2JA7G 4BY7G 4X62L 1Y1VG 3CCSA 2AHOB 1YJ9A 3PUXA 4A3EG 2IT1A 4YWLA 1HR0Q 4JBKA 4A3MG 3TS0A 2ZJPA 3KF6B
chains in the Genus database with same CATH superfamily
5JEAJ 2A6HC 3D8GA 3HOWG 5C44G 1I4RA 3SE0A 2HT1A 3PO2H 4GOPB 4H13C 3HOYG 1ET6A 2F03A 1E3PA 1YJNA 1EWIA 3EVQA 1TKWB 4ME3A 1ET9A 1BBWA 3K0XA 3WOFA 2VB3X 5ELCA 2SNSA 4AYBE 3HOXG 4JI8L 4ZYSA 2HHHL 4LMQD 3T53B 4BY1H 4GNXB 3DWAA 3TDQA 1C4QA 3Q23A 4BBRB 2TSSA 3C3LA 2MUYA 4YCWA 2KHJA 4R8NA 2EVBA 3TBIB 4IN3A 5CORA 5CBAE 1ENCA 1PH2A 1LTTD 1KQSA 3PIPA 1J8IA 1K28A 4A3FB 1XYIA 3UI2A 5C4HA 3RZOH 1AFPA 2B2WA 3J7ZC 5GADC 2ZM6L 1J6QA 3TEHB 2ALYB 4ZUJA 5HURA 5AFWA 4DV4Q 1ILPA 2K01A 2UU9Q 1YVCA 3ULJA 5M3FB 3S14H 1S4ZA 2NN6G 3BYTB 1IBMQ 3E9IA 2R7ZB 1DM0B 2LFNA 1GJXA 4GN4B 4JI3Q 5I4DA 4A3KH 1V9PA 2I5LX 2LXKA 1K8GA 4I7AA 2KBNA 2K28A 2D9UA 3UDXA 5EKKA 3OYYA 1HA5A 3W5OA 5BR8L 1HUMA 3TQYA 5IYCG 3KBXA 2E2IB 3DWQA 1BOSA 1TS3A 5EJWA 2RDFA 5IYBH 5FLMH 4DV5Q 1Y1WH 5C4XH 2UU9L 4IUTA 4DV1Q 1IKLA 3VA7A 2OTLA 3KDFB 3SK6A 1BCPF 3ONAB 3C46A 1MJCA 3K7UC 3A54A 1X56A 2Z9HA 3NWSA 5M3FH 2Z6KA 2I07B 3CQZH 4Z9CB 4JOIC 1SNMA 5C0XI 3GTQB 2F0UA 3T1YQ 3AMUA 2B8FA 2K5HA 1O7IA 1EY9A 3L0OA 1STAA 3VR5A 3NEMA 1ML0D 3TS2A 5IP9H 1A62A 5GQOA 4KHPQ 1S5FD 4A76A 2EPBA 3MEFA 3H09A 1WFQA 4WJWA 1B1ZA 4Q0FA 1I94Q 5FLXc 2NTSA 2SOBA 4DV1L 3I73A 3H91A 4ODGA 1ZKOA 3I3CA 4GKJL 1EU3A 2NYZD 3Q8DA 4C2MB 1D8LA 4XQJA 5FLXL 4KJNA 3R93A 4H7BA 4A4IA 4N9PA 4GNXC 4GKKL 2E5LQ 1QCBD 1AW7A 3I4MG 4C3IB 1F2LA 3G7LA 3CMEA 2OQKA 4KHPL 2CW0C 2XN9C 2WV6D 1EYDA 4ME5A 1JMCA 2K03A 3IAYA 1S5ED 1XPRA 4UP9A 2PPBC 2KVMA 4U68A 2N55A 4RAUC 3H94A 1EY0A 3GV3A 3BVZA 1UE1A 2B29A 5A2QL 4MNOA 1Q12A 1F2MA 4JG2A 1EOVA 4AH6A 2JA6B 4LFBQ 4A3BB 3J81c 3OTOL 2EXZA 4DV6Q 1F9PA 3SK5A 1STHA 2D5DA 3M85A 3DEPA 4JK1C 2UUAL 2UUCQ 4OGQC 5TSSA 5LMUQ 5DM63 2IHFA 1K9MC 3PUYA 3J81L 3EROA 1HNZL 4JI6L 4A3CH 3PO2G 1HNWQ 4TQUS 1SE2A 2ZTDA 5JEAH 5I9OA 1YZ6A 3PUVA 4R4TA 3W3AA 3Q24A 3A55A 2CFMA 2QDLA 1XX8A 3QOJA 2KCMA 1BXTA 5IGEA 2JA5H 2SEBD 1A3VA 1SSOA 4V0BA 1N8RC 1SYFA 2WAQB 3I4OA 1VQAA 4FO2A 3H3VH 1B4OA 4BY1G 2B2TA 4ZRZA 4DV6L 4NKLA 4LUOA 3LX0A 2MO1A 2PO4A 2F0VA 2RVLA 1G51A 2XWJB 5LMUL 2B3GA 1VQ8A 2KCCA 4IJLA 4BY7H 1KNAA 3NWTA 4IPCA 4DR5Q 2ICEC 5AJ3L 2DGYA 3ZYYX 3U9SA 1HQRD 4H02A 4BBSB 4GOPA 4QY7A 2CWAA 1BVSA 5M5XH 2QILA 3ULLA 1F2ZA 2PZUA 2MNAA 2RDHA 1KC8C 1TIID 4H44C 2VY3A 4JI7Q 2RKSA 4EVOA 4A75A 2VZAA 1DYQA 1WYDA 1TWHB 4DR3L 3S1NH 3GTKH 2IX0A 3S2HH 1VQJA 4MIUA 1BCPD 4A3KG 3VYTA 3GTPB 1NMGA 4AYBB 4CDDC 1PH8A 1X3QA 2KEDA 3GTJH 4X66Q 4X3TA 2QA4A 4TRDA 2BDOA 2NWGA 3PCOB 3TP8A 4DR5L 2B63H 3PO3H 4KN4C 1EFWA 2HIVA 4JI1L 3BG3A 2A73B 5IYBG 4QUCA 2QW7A 5FLMG 1Y1WG 5C4XG 4PZ8A 3NHHA 2XWBB 4JI7L 1EY7A 1GUSA 1HCZA 1JC7A 5KIXA 3D4WA 1W6KA 3DLLA 3NXWA 5CGKA 2PI2E 3KLRA 1EYAA 3GTMB 2YU9H 1EOTA 4QJFA 3Q0AA 2SDFA 3VA5A 4KD4A 1S5CD 5CV7A 4B3MQ 2F0QA 3BJUA 3D31A 3KLSX 2KCNA 3GTLB 1IYVA 2F3IA 4J6HA 5IP9G 4R4QA 3D4DA 3L9AX 3OIPA 3FP9A 3S17H 3HZXA 4DK3C 2EY5A 2F0KA 2EJMA 4C3HB 2R61A 1PH3A 1K8OA 4E6IA 1SYCA 3NENA 3H3VI 1NR2A 4PMCA 1LACA 3EA6A 4K14A 1EIYB 4N8FA 4B3SL 4HIKA 3KDFA 2CHBD 4A3MB 4ULLA 1HTLD 1U4RA 2LKVA 4OHJA 3HOWB 4IFDH 5C44B 1V1PB 2Q2TA 4PZ6A 1PRTF 4P73A 3DM1A 3KYHC 3I4NH 3HOYB 4OWXB 4LW1A 1MD2D 1LO5D 1AP0A 4X3KA 1RHPA 3A0JA 1XNQL 4OX9Q 3AQQA 5JVH3 1PTOF 1TS2A 2E2JH 5EQ0A 2O4XA 4NB3A 3HOXB 3WOEA 4GLXA 2NTTA 1DCZA 2RDGA 1IW7C 4Y52H 1Q81C 4L5QA 1R9TB 2VXWA 3S15B 2KA7A 4IOAA 4DR4L 1H9SB 2E2DC 1I6HH 1X32A 1N32Q 1TY2A 5BN5A 3NP8A 1CUKA 4HSVA 5EBDA 2FFKB 3CCRA 2AQ1B 5CMDA 1SROA 3NTKA 4A3JH 4YWKA 4C56C 4AQYQ 1E24A 1O7LA 1G6ZA 1JICA 1JQYD 5IT9c 1D6EC 5IIFA 1TWCH 1VMCA 1PVOA 1I3QB 1TWGB 1UE6A 1NCVA 2CH4W 3MTSA 4KKUA 2DY8A 4DV0Q 4YHHL 2ATWA 2K33A 1XNRL 3J81j 4A3CG 3CPWA 5IT9L 1WCMB 1N32L 3P7JA 5JEAG 1KLUD 3M4OH 3JC66 2ID0A 3S1MB 2E2HH 5G3LF 4WRDA 4QF4A 2JA5G 4AQYL 3HOUH 3SEBA 4K5XA 2JJQA 1NAPA 3S1RB 1SEBD 4K0KQ 4Y7NB 2RSOA 5IGBA 1LTSD 3NUCA 4KI0A 1XMOQ 1CZWA 5JJLA 4LF5L 1TWAH 2KJXA 3M3YH 1XWEA 2YTVA 1STBA 4BY7G 1Y1VG 1O80A 4FP5D 1S5BD 1YNND 1H9MA 4A3EG 5EPLA 2MPMA 3TS0A 4JBMA 1CM9A 1I4GA 3LWUA 1NMFA 2ES2A 2O5JC 1HA6A 1U4LA 4J15A 2A1AA 1LT3D 2PQAB 5CR3A 1D1IA 4HIDA 1B9MA 3K6OA 5LHY1 2A6ED 5HGQA 3PQIA 4DNRB 4KLKA 4FF1A 5IYCH 2RCFA 2A69C 4LFAL 2WP8J 5LL6S 3MXPA 1EY8A 2KHSA 1JWSD 1ILQA 1CKMA 2B63G 1K83H 4DAYB 3V96A 3U4VA 3GV6A 1X9NA 1EFID 1IBKQ 5C3XA 1L1OB 3E3XA 5FO9B 2JK8A 3I4MB 3GTGH 3UE1A 2Q8IB 1FNWA 3VYRA 1HHVA 2N3SA 5I6YA 4FF3A 4LWCA 4XTCS 1W6JA 2FXQA 1IHZA 1BUVT 4WJ4A 4HCEA 2F0TA 4HSPA 4PV1C 2JA8H 3NTHA 2VB2X 3U50C 1HXYD 3NBHB 3A8KE 3HP3A 4O2DA 2NVYB 1OXVA 2E76C 1B7YB 3DXJC 1HZAA 1PRTD 2RCNA 1LLRD 4MN3A 3I2ZA 4CBVA 2A8VA 4BXXH 1CA6A 3MEHA 1A2UA 2Z1CA 4B3TQ 2NVXB 1IZ6A 1LABA 4NP5A 1PTOD 5CYUA 4JI4L 4C1NI 5CV6A 1STEA 1FR3A 4HMJA 1VQOA 2B39A 1Y8PB 4ZAIA 3PMFA 2VNUD 2DN8A 2L1BA 3EBEA 4JVZA 2UXDQ 2JP1A 2MGSA 4IFDG 3RR5A 1BO0A 1MGSA 1K8AC 3PO2B 3I4NG 4X62Q 4I65A 1F9QA 2JA9A 4KY7A 2BE5D 2F1MA 4JV5Q 5EKIA 2K32A 5ELFA 2Z4HA 5GAHC 1PFBA 3I4LA 1XTDA 5HY6A 1A63A 4HJ7A 1WD0A 4BY1B 5EPKA 4IPDA 3BS1A 3K57A 2CQOA 3OPOA 1CA5A 5FOBB 3M4YA 3K7AH 4KK7A 3I7FA 2XRSD 2HHHQ 2MFIA 1STYA 1PH1A 2RHSB 3NBIA 1KNEA 3H6MA 4DR6Q 5T1IA 1JCKB 4YY3L 3RMHA 4A3JG 5I2XA 1D5XC 1IKMA 2L9HA 5KNCA 1V1PA 2OF1A 3RZOB 1G2SA 1CTMA 2BA1A 2R6GA 2X69A 5G3LD 5M9OA 1E1TA 3MHBA 4TVAB 1CKNB 4RFBA 4MTKA 1U9RA 3EJIA 4JV5L 3WWVA 2QGQA 1SMXA 3S14B 1SJED 2ZM6Q 1JWMD 2Q2HA 1WTXA 1Z6HA 1KDBA 3ERSX 3RZDH 3PIO3 3CPFA 3DWPA 1S40A 3OOCA 1YHAA 3AYHB 4A3KB 3GTOH 4O0AA 4ZCKA 1H9SA 2ENBA 2F4VL 3ND9A 4KTAA 2YV5A 3G71A 4LF6L 1L1OC 4ZQ3A 2L55A 4DR6L 1IL2A 1PZID 2O2LD 2ZT9C 1EEID 2AQ3B 1IL8A 1Y14B 3HOUG 2QDBA 3KBGA 5C3EH 4A93H 4X64L 3TZUA 2Z8LA 1Q3LA 3CRKC 4G7HC 4CKBA 1EIHA 1Y1WB 5BR8Q 5C4XB 2N78A 2HCCA 3RUZA 4OO1H 3EFXD 5I6WA 1VQNA 1WJJA 1IYUA 4MZ9A 3QB3A 2JEAI 1SE4A 3IRBA 3CQZB 2KQ3A 1RJTA 4IPHA 1GVPA 3FDTA 4LF7L 3TRZA 2JE6I 1FNUA 4K2LA 4DR1L 4X3UA 4FF2A 1LTAD 4EQOA 1SFOH 1PFSA 1WTVA 2K7VA 5IOCA 2G9DA 1JB3A 2EY6A 1RTOA 1UEAB 3OMCA 5EAYA 2ZJQA 5DAUA 4A3MG 2B2VC 2KECA 1CI3M 2GVAA 3HEJA 2K04A 5ELNA 4DPGA 1VCIA 5FK9C 4BA1I 5J1ZA 4P74A 2IW3A 4OWTB 3VR4A 1XMQQ 3CCEA 3F2CA 2EYPA 4LUZA 4DR2Q 1BCPC 1GUTA 1E2VA 5DEHA 1IBLL 2F0GA 4GKJQ 4L5SA 4XXEA 3HG9A 4DUYL 1HNXL 1A3TA 2OCEA 1P16A 1SE8A 2Y0SG 1CFMA 1E1OA 3L7ZC 3UE0A 2ASBA 1A3UA 5COYA 3A8IE 1AE2A 3BU2A 2PQAA 2BDNA 2O5IC 3T4AC 4GKKQ 2Q8TA 2WIIB 4G4KA 1LTGD 1WTRA 1G6PA 2D62A 2JA8G 1T5EA 1RDPD 4HR7B 1LT5D 4F7XA 2DNEA 2JYOA 1XMQL 1AZQA 2F0IA 5D3IB 3P1HA 4DR2L 1L0XB 2FHTA 1LT6D 4M1UB 3RLNA 1YHQA 2A68D 2G5DA 1OXSC 3KLSA 4MTNA 4I7ZC 4BXXG 3FKIG 1IXRA 3X3MA 4DAYA 5BN3A 4IFDJ 4DFAA 4IO9A 4K8IA 1UE5A 1T5XD 3F2UA 4JPBW 4EQNA 2JEBI 2HDMA 2EYJA 1L1OA 1A8VA 5LMNQ 3VYUA 4LF9L 1QWYA 3URYA 3OTOQ 4DK1A 1FGBD 4NXNL 1CQFA 1EUJA 4OO1I 2F0FA 3K5OA 3E6ZX 2MHVA 1HUNA 2IJ0A 2X6GA 3CCMA 2UUAQ 3PIOA 3PUWA 2F0DA 1LTID 1STGA 5EGTA 1YHBA 2RF4A 3OHXC 1KD1C 2R7DA 3MA2B 1HNZQ 4P75A 4DU9A 1YITA 3NBHA 3T13A 4JI6Q 1HFNA 2JA5B 1ASYA 2IL8A 3HOVH 5IWAL 1M4VA 1DONA 1RIPA 1K3RA 4K5WA 5FO7B 4IPGA 3M4QA 5M3MH 5ELDA 4JI5L 1KRTA 4NXML 3FHWA 3A5UA 4NPSA 5LMNL 3RLOA 1GUWA 1VS0A 3D4RA 1D2BA 3CC7A 3C1EA 2ZXPA 1PXUA 2L11A 1F9SA 2Y0SE 2VUMH 2DY7A 2E75C 2KCTA 1A15A 4CJ0B 5JJIA 4BY7B 3HKZG 2B2VA 2CCZA 1F2YA 1I5FA 2XRQD 3AFPA 1HR0L 1SNCA 2OWOA 2NVQB 5M5XB 1H9JA 2EE1A 4RMFA 3MVVA 4R9WA 2PI2A 5AJ3Q 3OSOA 3T1HL 2N8NA 5D14A 1KDCA 1GXDC 3KF8B 4CKCA 1YEZA 4CHTB 2K5VA 1GO3E 4CKEA 3S1NB 3GTKB 3S2HB 4ALPA 2PW5A 1NUCA 1PYWD 2R92H 4JOIA 3K80C 4BWGB 2EIFA 5IE8A 3MXNB 4QIWB 3GTJB 1SE3A 4DR3Q 5D3DA 1L2FA 2V4DA 2UXBL 4FDBA 1PTOB 3NE5B 3T56B 2B63B 2M9VA 5IT9E 3PO3B 1B2TA 3AU7A 5C3EG 4A93G 1KXLA 1AN8A 2RA4A 1E22A 3O13A 3R8BA 4LF4Q 4CJ2C 1M1KC 2F0HA 1HRJA 1Y1VH 4A3EH 4CDEC 1CKNA 1EYCA 1RCVD 4OO1G 2A74C 2NVQH 1RL2A 4JI1Q 2BCOA 1G8ZD 4CDFC 1JOKA 3TMEA 4GLVB 4BA2I 1Q90A 2AMCB 1OXUA 2YU9B 4OELB 3SVMA 2CKZB 2CH4A 2N49A 1N36L 4DV3Q 4A3LH 4V190 4J8QA 2H4OA 4GNXA 2HD3A 5A35A 2AUJD 3EN2A 1CT1D 4JBWA 3MXUA 1JORA 3S17B 4LF4L 4JYAL 1X3FA 4X65L 1PTOH 1F9RA 2NZ1D 2GVBA 4IZ8A 3KJPA 3MZ5A 3DHQA 3E9HA 3LGJA 1C0AA 1TXYA 1VQHA 5IODA 3HKZE 3UDFA 3S1QH 4XYQA 1ICFB 3E0EA 4YCVA 4DV2L 3RN5A 3V05A 5CV9A 3S9WA 3WDNA 4PZ7A 1JE5A 4RA8A 5E4XA 3NQIA 3SK8A 1XPOA 1M90C 4X6AH 1L0YB 2EXDA 3U4ZA 1EQRA 3H3VC 1RD9D 4B3SQ 4DV3L 3I4NB 1JOQA 1SNDA 3H0GH 4EGVA 3D6WA 1YJ9A 2F0JA 3PUXA 2IT1A 2JXMB 2ZJPA 2BOSA 4DV7L 1DZ1A 1UWVA 2UXCL 1EY4A 2E2JB 5KGUA 1BR9A 4QB4A 1XNQQ 4YIJA 2F4IA 2NB0A 1E0BA 2IPKD 4RGOS 3SGIA 5C3WA 4LF8L 1I6HB 1PZJD 1VQDA 5KYLA 4N8X1 2P5ZX 3OWEB 4NW2A 3RN2A 1MSGA 4TSSA 4JI2L 1JB7A 4QUFA 1EWCA 1A2TA 2K1BA 4EQPA 3PSIA 4DR4Q 1SJHD 1CHQD 4DK6C 1BDOA 4A3JB 4R4CA 1OXXK 1YIJA 4WORA 5ELEA 3VR2A 3K5MA 2A19A 4A3IH 2OXPA 2TMPA 1YNJC 1TQOA 1ZXTA 1PRTC 2DJGC 4RG1A 1TWCB 2V1CC 1R4QB 3S2DH 1PYSB 2XGTA 1VQ7A 1X54A 1PFMA 1PTOC 2WINB 2NVTH 4KN7C 1PH9A 3BDLA 1EQVA 4JW0A 1VMPA 4RGTA 3K81C 3TZDA 1VQKA 3VR6A 1SRUA 3M4OB 1QUQB 2LXJA 3P75A 4OXPA 4RHSA 4HJ9A 4YHHQ 4OL7A 5T1GA 4GN3B 1XNRQ 2E2HB 3JAME 2F0EA 5JJZA 2JSOA 3BDCA 1Q86C 4XYOA 1H9RA 3HOVG 3HOUB 1DJRD 5GAEC 3F2DA 2B2YC 3W1BA 1JWUD 1SN8A 1II3A 3DM3A 4JC0A 5M3MG 5JOBA 4RH6A 3J80E 1B8AA 3KJOA 3AEVA 4N9TA 3PV0A 1ONLA 1TU2B 3M3YB 1TWAB 2L5TA 2K52A 5IGFA 2EY1A 2VUMG 2L12A 1V1QA 4RGNA 2CVRA 2HQLA 1LUZA 3G4SA 1HZCA 4DAVA 4LF5Q 5IYDH 1TS5A 3CF5A 4HJAA 1K73C 3L3OC 2IY5B 1QNUA 1EY6A 4L8JA 2L0CA 1ESRA 1KAWA 1KL9A 3UDIA 1PH6A 4UP7A 2F0MA 1D5MC 1SNQA 2XSCA 2CQAA 2IHEA 3GQBA 5JPNC 3BYYB 1N33Q 2K6AA 2MJ8A 2R92G 2WB1G 3RLFA 1Y69U 3A5ZB 2J0TD 3A56A 2KOLA 3R3OA 1VQ6A 1NJIC 4A3DH 1K83B 1ZYRD 5E1FA 4LFAQ 1PHJA 3T16A 4XT3B 4BS9A 5DLQE 2EDGA 3LNNA 1I6VC 2F3WA 2WKDA 1PZKD 2Y0SB 2BH2A 3TP7A 3G48A 2Q8RE 1BF4A 2F0NA 2K5NA 1P8LA 1PA6A 3GTGB 4UHVA 5C4JH 4A3GG 4IFDI 4DGZA 1EIFA 2BA0A 4APVA 4UPAA 3KF8A 2ICIA 4R1JA 1N33L 2JA8B 3MFGA 1QVGA 3D3RA 4A3LG 5C4ZA 1UEBA 3MXNA 3STBD 1DOMA 1BKBA 3HS0C 2YTYA 3B6YA 3GO5A 5KNDA 1EQQA 2MP1A 4K5VA 3OW7A 3G6EA 3FKIB 4KKSA 1PYBA 4LAAA 3P20A 3I55A 1O7YA 3PF5A 1RODA 2R93H 1SYBA 1JT8A 5GROA 5M5WH 2OEOA 4JI4Q 4ID6A 1VQ9A 1B50A 2KUMA 1Q1BA 2D2CC 1QZHA 2B2UC 2F0LA 2WFWA 3H0GG 1DOKA 1XPUA 4R8IA 5HGTA 2M00A 2FMCA 4RCNA 1PH7A 3IL8A 2Q2IA 1VDZA 4POGA 2WB1E 2DJFC 3MC0B 1D5ZC 1FGUA 4M8AA 4ZLTF 1BNZA 4CJ1B 3NPPA 3FMCA 2VQFL 1U4PA 1Y8OB 3TREA 1MKHA 1H95A 3FKIH 3BZKA 3CU7A 3K7AB 3M7GA 4HMIA 1EY5A 3GD7A 1N9WA 5I9PA 3HKZB 4FXKC 2B2WC 4DA2A 4A3IG 5JPMC 1LYLA 3IFTA 4OONA 4JI0L 1TWFH 4XT1B 2K50A 3NSWA 3ULPA 4YY3Q 2OTJA 3CCQA 4R4OA 2JA7H 1JE4A 3JAMi 2XIWA 3AB9A 3Q22A 2X6LA 1VQLA 3RZDB 1V43A 4PQXA 1BCPB 5FLXE 3J80i 4HCSA 3QG1A 4QIWE 3GTOB 1PH4A 1E7ZA 1K0SA 4KY5A 2WACA 1GOZA 1N34L 1ICWA 1VQ4A 5C3EB 2F4VQ 4B9XA 4A93B 1EU4A 4KHVA 1CZGA 4LF6Q 4FVMA 1XTCD 3ND8A 3J7AF 1B70B 1S3OA 3H15A 4X64Q 1SNPA 1KLGD 5A2QE 1PMRA 1QZGA 1ZEQX 4DR7Q 4B3RQ 1WTWA 3G6JB 4QGUA 4QL5A 3BDOA 1NSNS 5IYDG 2ZXOA 3MFYA 2J4XA 5DM73 4OIJA 2EZVA 1M8AA 1QUQA 5KNBA 1ASZA 1SFOB 5FKAC 4LF7Q 5IGDA 3VDYA 5ELOA 1SAPA 3QWNA 4DR1Q 1TS4A 3J81E 2B2UA 4DUZL 3KFUA 2RBMA 1J5EL 2Q2UA 1HTPA 2QKIC 4IJHA 1LTBD 1XXGA 1MJEA 4ABNA 1X6OA 4DR7L 4B3RL 1KIXA 3CCLA 3DMUA 4LFBL 4C3JH 2HIXA 1QE6A 4A3DG 3CMAA 3QOLA 1LT4D 1EL0A 2QEJC 4MHEA 5LMNW 1U4MA 5DNFA 5ELBA 1QNKA 1NBWA 3C1FA 4G7ZC 2VQEL 2Z4IA 2D0OA 1Q8IA 2I5MX 5FJ8H 3HOZH 1IBLQ 2VW9A 5ISRA 1BBUA 2HCIA 4DUYQ 1HNXQ 5J39A 1BBXC 4K2KA 1WI5A 4C1NK 1Q8KA 2L15A 3TP5A 1NR4A 1HR0W 3M9BA 1B3AA 4UY8C 1LTRD 1VQIA 2AWNA 1K8MA 1LTLA 2H1EA 3SXHA 1C9OA 5C6AA 3HRZC 2OT2A 3D6CA 3RD4A 1SR3A 2PW7A 3GDEA 2YTXA 4OEMB 2A69D 4IALA 3CP0A 1Q7YC 1K3BC 3U58A 1T9HA 1KAAA 5I2YA 2LY7A 3DUZA 1GM5A 1GKHA 2E8GA 1WCMG 1YJWA 3CC2A 5KYIA 1HFGA 2A5HA 1XJVA 1GUNA 3FPPA 1KTKA 1JJ2A 2R93G 3KUPA 4H0LC 4BBRH 4KHZA 4JBJA 4WJ3M 1EZ8A 1X55A 1EZ6A 2I46A 3SK4A 3ITPA 1WTHA 4DV4L 1J9OA 4LF9Q 4A3FH 2PMZE 2D0PA 3W2DA 1UE7A 4NXNQ 1IBML 4NMZA 1TY0A 2J7ZA 1IYJB 1TVXA 4JI3L 3I8ZA 1W2BA 3HOVB 1FVIA 3J7A5 2R7ZH 4PG3A 2MQHA 4L5RC 2UUBQ 5M3MB 1HZBA 2B2TC 1I4QA 4YWMA 5K5PA 1SYDA 5IWAQ 4CDCC 2PZTA 3FEWX 4IUQA 2VUMB 3A8JE 2EYLA 4JI5Q 1NY4A 2FMMA 4LK1C 4NXMQ 2VL6A 1X3PA 2DUDA 3HKSA 4G57A 4FF4A 1CHPD 1NNXA 4DKAC 4DV5L 3TP6A 4GOPC 2E2IH 1VQBA 3ZJYC 2EJGC 2LMCB 3OMGA 4WFN3 4XQNA 3E5SA 2JA7G 1SMYD 1ENAA 2AHOB 2EJFC 3NTIA 1HR0Q 4YWLA 4DN4M 1CQVA 3KF6B 4KMUC 1AE3A 2UUBL 1GHKA 3T1YL 3A74A 1UUPA 1D7QA 3MXGA 3VYSA 3BZDB 3T1HQ 2C35B 4O1NA 4UDUC 1G2TA 2R92B 1VQMA 2F0PA 3GTQH 2WB1B 4J1MA 1L0WA 2NZHA 3I72A 2NZOA 4Q5VA 5C5MA 1S5DD 1JJCB 3MWYW 2ZJRA 1I94L 4QMGA 4IUNA 4K6LA 1A0IA 1X3EA 2XNAC 4IOCA 1OXTA 2UXBQ 3N52A 4POFA 1Y1VB 5KEEA 4A3EB 1C7YA 1Q46A 4LNQA 4A3GB 4OWWB 1PV4A 2A6HD 1CKOA 2K05A 1X3GA 1QVCA 1V1OA 2IX3A 1U5KA 4YCUA 1LV9A 3F2BA 4PMBA 3J81i 1QILA 3SHLA 1MI2A 4C2MH 1I4XA 3EQLC 3K8AA 2N88A 2EYOA 2E5LL 3S16B 1B3QA 4X3SA 2EYFA 3J7YW 2PNRC 1SDFA 1V8QA 2IWHA 1VQEA 4GZYC 1PRTB 3BVMA 3M7NA 5C0XG 1VQCA 4FNFA 5C5LA 4C3IH 1N36Q 4FXDA 3C2PA 1W3SA 2G9HD 5IP7H 1I4PA 1NE3A 1U0LA 5M5YB 1AEXA 2EY2A 3K5LA 4GS3A 3PGZA 5E4WC 3S1QB 1QOHA 2AKWB 5K36H 4JYAQ 4X65Q 4F8MA 1E2ZA 2RSNA 3R2TA 4RKBA 4GLAC 4C3JG 5JVG3 1CSPA 5J3BA 2EOTA 1G291 4A3GH 1GUOA 2QCPX 4EQ5A 4DV2Q 2JA6H 2QF7A 2K14A 3H0GB 1STNA 4A3BH 2UUCL 4DAMA 5FJ8G 1Z9FA 1JR0D 1ZYRC 3NELA 3HOZG 3CD6A 3D0FA 3QIAA 3S16H 1GUGA 1NTGA 1Z7TA 1HNWL 1Y8NB 3VR3A 5JJKA 3CCJA 1YNNC 4K8JA 1GHJA 2R3ZA 4DV7Q 2UXCQ 3RNUA 4LUVA 1VQGA 1ENFA 3TSSA 1WTOA 5M5YH 1WVLA 4L5TA 3TN2A 4FXGC 4DNIA 2LSSA 1VQFA 1EWHA 4LF8Q 4F88A 3FRPB 2A6EC 4KJOA 2M2LA 5LL6X 4A3IB 3STBC 4JI2Q 2C5CA 1Z47A 3S2DB 4B08A 4BBRG 1FJGQ 3L2PA 5CBEE 2PCFB 3OW2A 3X3NA 2C9OA 2NVTB 4RGMA 1SYGA 1QG7A 1RF2D 1K0RA 4A3FG 2AQ2B 1HQMC 4KV6A 1A6XA 1C48A 4BBSH 3F8TA 1WD1A 1JOOA 4FYDA 4XQQA 1HH2P 3K59A 5M3FG 2R7ZG 1EYGA 2I0QA 1LM0A 1EEFD 1F77A 2KEEA 1C8CA 1PLFA 2HDLA 5L37A 3IKJA 2PYKA 2E74C 2K4KA 3CKIB 4ZKBB 1TWHH 4X66L 3HGBA 1WTQA 1R4PB 3E0JA 1FJGL 1FNVA 3BVGA 4O42A 3GTPH 4OIKA 1I4HA 3KK7A 5IY0A 3ERQA 1X65A 4PMWA 2EQSA 2PNHA 3CRLC 4RHRA 3NK9A 1YI2A 3SR1A 2CW0D 2OQ0A 4JCVE 2EYHA 3LWEA 3CC4A 3DEOA 3J7AV 2PQEA 1MHWC 2PMZB 1HZ9A 1VQ5A 2QEXA 1CK1A 4B3ML 3I56A 1MIUA 2F0SA 2KHIA 3GTMH 3I70A 3OWFA 3ER0A 2BE5C 1CSQA 5D65A 1O7ZA 2ZXRA 4KY6A 3T51B 5E3FA 4DK0A 3N6RA 2JQOA 4A3DB 3K58A 4ZKCB 3GTLH 5EKLA 1MBYA 1PDQA 4S3SA 4P71A 4C3HH 2LS01 4DF7A 4P2CB 1GD7A 1G91A 2F0OA 3V2TA 4KD3A 4XIGS 5C4JB 1VF5C 5C0XJ 3KF6A 5F2DA 2Z6BA 2ZTCA 4IUVA 4K6DA 4A3MH 1KHIA 3I90A 4L6TB 2AUKA 4IURA 4OX9L 3HOWH 5C44H 4HIMA 4HJ8A 2HQEA 3MAQA 3HOYH 1RTNA 2RHQB 1H9KA 4ZUIA 1AZPA 1I50B 1E2WA 2CWPA 4C3IG 1SYEA 1HJPA 5IGCA 3HOXH 1B9NA 2NBFA 5IP7G 3I91A 1EIGA 4IQZA 1R9TH 4UAIA 3S15H 2VS1A 2R93B 5K36G 3FPUB 3CAMA 2XVSA 3KOJA 5M5WB 3M4PA 2H5XA 1PH5A 4KKTA 1OTCA 4AIMA 4DNTB 4L63B 3CHBD 2ZTEA 4LFCQ 2JA6G 2NUCA 4PNYA 4A3BG 3K5NA 4HN7A 1KABA 4GN5A 3CCUA 2WKCA 5KRUA 1TT2A 5CV4A 4DV0L 1DXMA 1SLJA 1TR5A 2K5WA 4TKOB 1ESFA 5FO8B 1I3QH 1TWGH 3GP7A 2NN6H 1KRSA 4R4IA 5CV8A 4QQBX 4DXFA 2YYZA 4CGYB 1B44D 1I50H 3K0YA 4IUPA 5CV5A 3QJYA 2F0WA 1DGSA 1FYCA 1D1KA 2GA4B 2I5HA 3S24A 1WCMH 3BZCA 4DAPA 5BN4A 1YBYA 2FINB 3EIVA 3A7AB 1WOCA 3ICEA 2VQFQ 5J22A 4HIOA 3S1MH 1WTPA 1AH9A 2PZWA 3KLWA 1PFNA 4LFCL 3OIQA 1FD7D 3SDZA 2IX1A 4K0KL 1SNOA 2B8GA 1S72A 1XMOL 2K5QA 2WAQG 5H1SE 1TWFB 3CW2C 1YNXA 2B2YA 3IFDA 2HUGA 3S1RH 2JA7B 4Y7NH 1DD2A 3QR8A 4DXGA 4NDXA 4JI0Q 3PO3G 3PIP3 3PF4A 5NUCA 1B53A 1MSHA 3CXCA 3AFQA 1UAPA 4RKLA 2F3VA 4BBSG 3UDGA 1QVFA 2R7FA 1BQQT 1UNSA 4LJZC 2Z0SA 3U9OA 1O78A 3Q6SA 1N34Q 3F1ZA 1HPCA 2SNMA 3CCVA 4ILWA 2RQXA 5EPJA 1Q1EA 1YNJD 1SXTA 4AYBG 2BH8A 2A68C 4B9WA 1OO9B 2JN4A 3QO2A 3JAMc 2F52A 1RKNA 5IGGA 1IBKL 1QB5D 2XTIA 4HEDA 3PUZA 3J80c 1QJOA 2K75A 3HFZB 1JJGA 1IW7D 4P72A 1DOLA 3I4MH 2EYMA 3JAML 2K5DA 1SBBB 4RWSC 4RCOA 1SMYC 2NN6I 4QCLA 3J80L 5E7NA 4G7OC 2WAQE 4U673 4DUZQ 4C3JB 1KDAA 4B3TL 4XDXA 1J5EQ 2FJ2A 2NVYH 4ZK9B 3NQTA 4F87A 2KENA 3A7LA 5CC4A 4UP8A 4IUUA 5GAGC 3FVQA 2Z6KC 4HJ5A 2NVXH 4JI8Q 4C3HG 5JAVA 5EBCA 3HOZB 1FL0A 2AWOA 2MO0A 1VF7A 4HTHA 4EX5A 2DNCA 2UXDL 4HAEA 1VQPA 2GN5A 1Q82C 3W1GA 2VQEQ 2L4NA 4X62L 3CCSA 3R2IA 1EQTA 4JBKA 5C0XH
chains in the Genus database with same CATH topology
1AE3A 1NMFA 2UUBL 5JEAJ 3T1YL 3A74A 2ES2A 4DV7L 3HOWG 5C44G 1UWVA 2UXCL 1D7QA 2HT1A 3PO2H 4GOPB 4J15A 2A1AA 3HOYG 3T1HQ 2C35B 2PQAB 1XNQQ 1E3PA 1YJNA 1EWIA 1VQMA 4ME3A 3GTQH 1BBWA 3K0XA 4HIDA 1L0WA 3SGIA 4LF8L 2NZHA 5HGQA 2NZOA 1VQDA 4AYBE 4KLKA 1JJCB 3HOXG 4JI8L 2ZJRA 1I94L 3RN2A 5IYCH 2HHHL 4JI2L 1JB7A 1A0IA 1X3EA 4IOCA 4LFAL 4BY1H 2WP8J 4GNXB 3PSIA 1OXTA 4DR4Q 2UXBQ 4DK6C 4R4CA 4POFA 1OXXK 1YIJA 1CKMA 2A19A 2KHJA 4YCWA 4A3IH 1C7YA 1Q46A 2B63G 1K83H 4LNQA 4DAYB 4OWWB 1PV4A 1CKOA 1PH2A 1X3GA 1QVCA 4RG1A 3U4VA 3PIPA 3F2DA 2V1CC 1U5KA 1KQSA 3S2DH 1X9NA 4YCUA 1PYSB 3F2BA 1IBKQ 3J81i 2XGTA 1VQ7A 3RZOH 1X54A 1L1OB 4C2MH 2JK8A 3J7ZC 5GADC 2ZM6L 1J6QA 3K8AA 3UE1A 3GTGH 3TEHB 2E5LL 2ALYB 2NVTH 2N3SA 1PH9A 4LWCA 4XTCS 4DV4Q 2FXQA 3K81C 4WJ4A 1VQKA 1YVCA 3ULJA 2UU9Q 3S14H 1VQEA 1SRUA 2NN6G 1IBMQ 3S17H 3E9IA 1QUQB 2LXJA 4OXPA 4HJ9A 3M7NA 5C0XG 1VQCA 4YHHQ 2JA8H 4C3IH 1N36Q 1XNRQ 4GN4B 4GN3B 4JI3Q 3U50C 4JBMA 1W3SA 1Q86C 5IP7H 3HOVG 1NE3A 1U0LA 4A3KH 3NBHB 4O2DA 5GAEC 1OXVA 1V9PA 2I5LX 3W1BA 4GS3A 1B7YB 2LXKA 3PGZA 1SN8A 1HZAA 1K8GA 3DM3A 4JC0A 5M3MG 2KBNA 2RCNA 3UDXA 3I2ZA 2AKWB 2A8VA 4BXXH 4JYAQ 3OYYA 4X65Q 1B8AA 4B3TQ 3KJOA 3W5OA 1IZ6A 3AEVA 5BR8L 4LFBL 3PV0A 4GLAC 3TQYA 1CSPA 5J3BA 2K52A 5IYCG 1G291 4JI4L 4A3GH 2VUMG 4EQ5A 4DV2Q 2JA6H 1V1QA 2K14A 2HQLA 1LUZA 5IYBH 3G4SA 5FLMH 4DV5Q 1VQOA 5C4XH 1Y1WH 2UU9L 4A3BH 1HZCA 4DV1Q 4LF5Q 2UUCL 4DAMA 5IYDH 5FJ8G 1Z9FA 3NELA 3CF5A 4HJAA 2OTLA 3KDFB 3CD6A 3HOZG 3EBEA 3D0FA 1K73C 2UXDQ 4IFDG 3S16H 3RR5A 2IY5B 1MJCA 1K8AC 3K7UC 1NTGA 3I4NG 4X62Q 1X56A 1HNWL 5M3FH 2Z6KA 3CQZH 5JJKA 3CCJA 2JA9A 4JOIC 1KAWA 5C0XI 3T1YQ 4DV7Q 1KL9A 2K5HA 2UXCQ 3UDIA 3RNUA 4UP7A 1PH6A 4LUVA 4JV5Q 1VQGA 1O7IA 3L0OA 5GAHC 3NEMA 2IHEA 5M5YH 1N33Q 4L5TA 4DNIA 1XTDA 5HY6A 1A63A 4HJ7A 2LSSA 2R92G 3TS2A 1VQFA 5IP9H 1A62A 2WB1G 4IPDA 5GQOA 3RLFA 4LF8Q 4KHPQ 4A76A 3A5ZB 3MEFA 2CQOA 1WFQA 1VQ6A 3K7AH 1I94Q 3I7FA 3STBC 5FLXc 1NJIC 2HHHQ 4A3DH 4DV1L 4JI2Q 2MFIA 4LFAQ 1PHJA 1PH1A 2RHSB 1Z47A 5DLQE 4DR6Q 4GKJL 4YY3L 4A3JG 3Q8DA 2BH2A 4BBRG 3G48A 3L2PA 1FJGQ 2K5NA 3OW2A 1P8LA 2BA1A 1D8LA 1PA6A 2R6GA 5C4JH 4A3GG 4IFDI 1E1TA 4TVAB 1CKNB 4A4IA 4JV5L 1K0RA 1EIFA 2BA0A 4A3FG 3WWVA 2QGQA 1SMXA 4APVA 4GNXC 4UPAA 4GKKL 2ZM6Q 2Q2HA 4R1JA 3F8TA 4BBSH 2E5LQ 1N33L 3ERSX 3RZDH 3I4MG 1QVGA 3CMEA 2OQKA 3CPFA 4KHPL 4A3LG 1S40A 1YHAA 1UEBA 3AYHB 3STBD 1HH2P 4O0AA 5M3FG 1BKBA 1JMCA 2YTYA 3GTOH 3B6YA 2R7ZG 3GO5A 1EYGA 1LM0A 2I0QA 1XPRA 2F4VL 1EQQA 4UP9A 2YV5A 3G71A 4LF6L 2K4KA 1L1OC 1TWHH 4X66L 3G6EA 4DR6L 1IL2A 1UE1A 1PYBA 1Y14B 2B29A 1FJGL 4MNOA 3HOUG 5C3EH 1Q12A 3I55A 4A93H 4JG2A 4X64L 1EOVA 3GTPH 4AH6A 3PF5A 2R93H 1JT8A 5IY0A 5GROA 1X65A 5BR8Q 4LFBQ 4PMWA 2EQSA 5M5WH 2N78A 2PNHA 3J81c 3OTOL 4JI4Q 1VQ9A 1YI2A 4DV6Q 1WJJA 1VQNA 1Q1BA 4MZ9A 1QZHA 2OQ0A 2JEAI 4JCVE 3M85A 3IRBA 2WFWA 3H0GG 2UUAL 3CC4A 1XPUA 2UUCQ 4IPHA 1GVPA 4LF7L 5LMUQ 1HZ9A 2IHFA 1K9MC 2QEXA 2JE6I 3PUYA 1VQ5A 3TRZA 1PH7A 1HNZL 4B3ML 2Q2IA 4DR1L 4JI6L 4A3CH 3I56A 1MIUA 4POGA 3PO2G 1HNWQ 2KHIA 2WB1E 4TQUS 1SFOH 1PFSA 1FGUA 2ZTDA 3GTMH 1YZ6A 3PUVA 4R4TA 3ER0A 1CSQA 2VQFL 2CFMA 5EAYA 1MKHA 3TREA 1H95A 2KCMA 2ZJQA 3FKIH 3BZKA 2JA5H 2GVAA 2JQOA 1N8RC 3I4OA 1VQAA 3H3VH 3GTLH 5ELNA 4DPGA 1VCIA 3GD7A 1N9WA 4BA1I 4BY1G 4DV6L 4LUOA 4OWTB 4P74A 4P71A 1XMQQ 3CCEA 3F2CA 4C3HH 2MO1A 1GD7A 4LUZA 4DR2Q 4A3IG 1G51A 1LYLA 4OONA 4JI0L 1TWFH 4XIGS 5LMUL 2K50A 1IBLL 3ULPA 2B3GA 4L5SA 4GKJQ 4DUYL 1HNXL 1VQ8A 4YY3Q 5C0XJ 3CCQA 2OTJA 4IJLA 2OCEA 4R4OA 3KF6A 3JAMi 2JA7H 4BY7H 4IPCA 1P16A 1SE8A 2Y0SG 2ZTCA 4DR5Q 5AJ3L 2DGYA 4A3MH 1KHIA 1E1OA 3L7ZC 4H02A 3UE0A 2ASBA 4GOPA 4QY7A 1VQLA 2CWAA 1V43A 4OX9L 3HOWH 1BVSA 5C44H 4HIMA 4HJ8A 5M5XH 1AE2A 3BU2A 2PQAA 3ULLA 2MNAA 3HOYH 3J80i 2RHQB 1KC8C 4QIWE 4GKKQ 1PH4A 2VY3A 4JI7Q 4A75A 1E7ZA 1G6PA 2VZAA 2CWPA 2D62A 2JA8G 1WYDA 1HJPA 1N34L 4DR3L 3S1NH 3HOXH 1XMQL 3GTKH 2IX0A 3S2HH 1VQJA 5IP7G 4A3KG 1VQ4A 2F4VQ 4DR2L 1NMGA 3RLNA 1YHQA 4LF6Q 1PH8A 1R9TH 3GTJH 4X66Q 3S15H 2VS1A 2QA4A 1OXSC 4MTNA 5K36G 4BXXG 3FKIG 1IXRA 4IFDJ 3CAMA 3KOJA 1B70B 1S3OA 3PCOB 3H15A 3M4PA 4DR5L 2B63H 4X64Q 3PO3H 2H5XA 4IO9A 1QZGA 1PH5A 1UE5A 1OTCA 1EFWA 2HIVA 4AIMA 2JEBI 4JI1L 2ZTEA 4LFCQ 4DR7Q 4B3RQ 1L1OA 1A8VA 4QGUA 4QL5A 5LMNQ 2JA6G 4LF9L 5IYBG 5FLMG 1Y1WG 5C4XG 3OTOQ 4A3BG 4PZ8A 4GN5A 4NXNL 3CCUA 5IYDG 4JI7L 1EUJA 4OO1I 4DV0L 1SLJA 1QUQA 3CCMA 1I3QH 1ASZA 2UUAQ 3PIOA 3PUWA 1TWGH 3DLLA 2PI2E 1KRSA 4R4IA 4QQBX 4LF7Q 1YHBA 2RF4A 2YU9H 4QJFA 2YYZA 1KD1C 2R7DA 1I50H 3VDYA 5ELOA 1HNZQ 4P75A 4DR1Q 4B3MQ 1YITA 4JI6Q 3BJUA 1DGSA 1ASYA 2I5HA 4DUZL 3D31A 3S24A 3HOVH 1WCMH 3BZCA 5IWAL 3KFUA 1YBYA 3EIVA 1J5EL 1RIPA 1K3RA 2Q2UA 1WOCA 4IJHA 3ICEA 2F3IA 3M4QA 4IPGA 5M3MH 2VQFQ 3S1MH 4HIOA 5IP9G 1MJEA 1AH9A 4R4QA 1X6OA 3KLWA 1KRTA 4JI5L 3FHWA 4LFCL 3A5UA 3FP9A 4NXML 2IX1A 4DK3C 1KIXA 4NPSA 5LMNL 3RLOA 3CCLA 1VS0A 4K0KL 1PH3A 4C3JH 3CC7A 1S72A 1XMOL 2HIXA 2WAQG 5H1SE 4A3DG 1YNXA 3CW2C 3NENA 3H3VI 2Y0SE 2VUMH 3CMAA 2KCTA 5LMNW 5JJIA 1EIYB 3S1RH 4B3SL 4HIKA 4Y7NH 1NBWA 3HKZG 3KDFA 2VQEL 2CCZA 1I5FA 2D0OA 2I5MX 3AFPA 5FJ8H 4JI0Q 3PO3G 3HOZH 1HR0L 1IBLQ 3PF4A 2VW9A 1BBUA 2OWOA 4DUYQ 1HNXQ 2Q2TA 4PZ6A 1WI5A 4RMFA 1Q8KA 4P73A 3I4NH 3KYHC 3CXCA 2L15A 5AJ3Q 2PI2A 3AFQA 1HR0W 3M9BA 4OWXB 3T1HL 2N8NA 4LW1A 4UY8C 1VQIA 2AWNA 3A0JA 1XNQL 4BBSG 4OX9Q 3UDGA 1LTLA 3AQQA 2R7FA 1QVFA 3KF8B 1YEZA 1C9OA 2E2JH 2K5VA 1GO3E 4NB3A 4GLXA 4DR7L 4B3RL 1SR3A 3GDEA 2YTXA 4ALPA 2Z0SA 3CP0A 2R92H 4JOIA 3K80C 1Q7YC 4Y52H 2EIFA 5IE8A 1T9HA 3MXNB 3U58A 4L5QA 1Q81C 1N34Q 4DR3Q 4IOAA 3F1ZA 4DR4L 1L2FA 1I6HH 2UXBL 4FDBA 3CCVA 1GKHA 2E8GA 1GM5A 1N32Q 1WCMG 1Q1EA 1YJWA 5C3EG 3CC2A 4A93G 1CUKA 3CCRA 1KXLA 4AYBG 2BH8A 1XJVA 1E22A 1SROA 4LF4Q 4A3JH 1JJ2A 2R93G 4YWKA 4BBRH 4AQYQ 1M1KC 1E24A 1Y1VH 4KHZA 3JAMc 2F52A 4A3EH 1IBKL 1CKNA 4JBJA 4WJ3M 1X55A 4OO1G 5IT9c 2NVQH 1RL2A 4JI1Q 2XTIA 1TWCH 4DV4L 4LF9Q 1PVOA 4A3FH 3PUZA 2PMZE 3J80c 2D0PA 1UE6A 2K75A 3HFZB 1UE7A 4GLVB 2AMCB 4BA2I 1OXUA 4NXNQ 1IBML 1JJGA 4P72A 3I4MH 4DV0Q 4YHHL 1IYJB 2CKZB 2N49A 2ATWA 1N36L 4DV3Q 1XNRL 3J81j 4JI3L 4A3LH 4A3CG 3CPWA 1W2BA 1N32L 1FVIA 4GNXA 2NN6I 3J7A5 5JEAG 2R7ZH 4PG3A 2MQHA 3M4OH 3JC66 4L5RC 2UUBQ 1HZBA 3EN2A 2ID0A 5E7NA 4JBWA 2WAQE 2E2HH 4YWMA 4DUZQ 4LF4L 2JA5G 1X3FA 5IWAQ 4X65L 4AQYL 3KJPA 4JYAL 2GVBA 4B3TL 3HOUH 1J5EQ 3E9HA 3LGJA 1C0AA 1TXYA 1VQHA 2NVYH 3HKZE 3UDFA 2JJQA 3S1QH 2KENA 3E0EA 4JI5Q 1NY4A 4UP8A 4YCVA 4NXMQ 2VNUD 2VL6A 4DV2L 3RN5A 4K0KQ 5GAGC 2DUDA 3HKSA 2Z6KC 1JE5A 4PZ7A 4HJ5A 4JI8Q 2NVXH 4DV5L 4DKAC 4KI0A 1XMOQ 5JJLA 1FL0A 2AWOA 4GOPC 1XPOA 4LF5L 1TWAH 2MO0A 3M3YH 1M90C 4X6AH 2EXDA 2E2IH 3U4ZA 1VQBA 3ZJYC 4EX5A 1EQRA 2UXDL 2YTVA 2GN5A 1VQPA 4B3SQ 4DV3L 1Q82C 3W1GA 2VQEQ 3H0GH 2JA7G 4BY7G 4X62L 1Y1VG 3CCSA 2AHOB 1YJ9A 3PUXA 4A3EG 2IT1A 4YWLA 1HR0Q 4JBKA 4A3MG 3TS0A 2ZJPA 3KF6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AE3 A;  1NMF A;  2UUB L;  5JEA J;  3T1Y L;  3A74 A;  2ES2 A;  4DV7 L;  3HOW G;  5C44 G;  1UWV A;  2UXC L;  1D7Q A;  2HT1 A;  3PO2 H;  4GOP B;  4J15 A;  2A1A A;  3HOY G;  3T1H Q;  2C35 B;  2PQA B;  1XNQ Q;  1E3P A;  1YJN A;  1EWI A;  1VQM A;  4ME3 A;  3GTQ H;  1BBW A;  3K0X A;  4HID A;  1L0W A;  3SGI A;  4LF8 L;  2NZH A;  5HGQ A;  2NZO A;  1VQD A;  4AYB E;  4KLK A;  1JJC B;  3HOX G;  4JI8 L;  2ZJR A;  1I94 L;  3RN2 A;  5IYC H;  2HHH L;  4JI2 L;  1JB7 A;  1A0I A;  1X3E A;  4IOC A;  4LFA L;  4BY1 H;  2WP8 J;  4GNX B;  3PSI A;  1OXT A;  4DR4 Q;  2UXB Q;  4DK6 C;  4R4C A;  4POF A;  1OXX K;  1YIJ A;  1CKM A;  2A19 A;  2KHJ A;  4YCW A;  4A3I H;  1C7Y A;  1Q46 A;  2B63 G;  1K83 H;  4LNQ A;  4DAY B;  4OWW B;  1PV4 A;  1CKO A;  1PH2 A;  1X3G A;  1QVC A;  4RG1 A;  3U4V A;  3PIP A;  3F2D A;  2V1C C;  1U5K A;  1KQS A;  3S2D H;  1X9N A;  4YCU A;  1PYS B;  3F2B A;  1IBK Q;  3J81 i;  2XGT A;  1VQ7 A;  3RZO H;  1X54 A;  1L1O B;  4C2M H;  2JK8 A;  3J7Z C;  5GAD C;  2ZM6 L;  1J6Q A;  3K8A A;  3UE1 A;  3GTG H;  3TEH B;  2E5L L;  2ALY B;  2NVT H;  2N3S A;  1PH9 A;  4LWC A;  4XTC S;  4DV4 Q;  2FXQ A;  3K81 C;  4WJ4 A;  1VQK A;  1YVC A;  3ULJ A;  2UU9 Q;  3S14 H;  1VQE A;  1SRU A;  2NN6 G;  1IBM Q;  3S17 H;  3E9I A;  1QUQ B;  2LXJ A;  4OXP A;  4HJ9 A;  3M7N A;  5C0X G;  1VQC A;  4YHH Q;  2JA8 H;  4C3I H;  1N36 Q;  1XNR Q;  4GN4 B;  4GN3 B;  4JI3 Q;  3U50 C;  4JBM A;  1W3S A;  1Q86 C;  5IP7 H;  3HOV G;  1NE3 A;  1U0L A;  4A3K H;  3NBH B;  4O2D A;  5GAE C;  1OXV A;  1V9P A;  2I5L X;  3W1B A;  4GS3 A;  1B7Y B;  2LXK A;  3PGZ A;  1SN8 A;  1HZA A;  1K8G A;  3DM3 A;  4JC0 A;  5M3M G;  2KBN A;  2RCN A;  3UDX A;  3I2Z A;  2AKW B;  2A8V A;  4BXX H;  4JYA Q;  3OYY A;  4X65 Q;  1B8A A;  4B3T Q;  3KJO A;  3W5O A;  1IZ6 A;  3AEV A;  5BR8 L;  4LFB L;  3PV0 A;  4GLA C;  3TQY A;  1CSP A;  5J3B A;  2K52 A;  5IYC G;  1G29 1;  4JI4 L;  4A3G H;  2VUM G;  4EQ5 A;  4DV2 Q;  2JA6 H;  1V1Q A;  2K14 A;  2HQL A;  1LUZ A;  5IYB H;  3G4S A;  5FLM H;  4DV5 Q;  1VQO A;  5C4X H;  1Y1W H;  2UU9 L;  4A3B H;  1HZC A;  4DV1 Q;  4LF5 Q;  2UUC L;  4DAM A;  5IYD H;  5FJ8 G;  1Z9F A;  3NEL A;  3CF5 A;  4HJA A;  2OTL A;  3KDF B;  3CD6 A;  3HOZ G;  3EBE A;  3D0F A;  1K73 C;  2UXD Q;  4IFD G;  3S16 H;  3RR5 A;  2IY5 B;  1MJC A;  1K8A C;  3K7U C;  1NTG A;  3I4N G;  4X62 Q;  1X56 A;  1HNW L;  5M3F H;  2Z6K A;  3CQZ H;  5JJK A;  3CCJ A;  2JA9 A;  4JOI C;  1KAW A;  5C0X I;  3T1Y Q;  4DV7 Q;  1KL9 A;  2K5H A;  2UXC Q;  3UDI A;  3RNU A;  4UP7 A;  1PH6 A;  4LUV A;  4JV5 Q;  1VQG A;  1O7I A;  3L0O A;  5GAH C;  3NEM A;  2IHE A;  5M5Y H;  1N33 Q;  4L5T A;  4DNI A;  1XTD A;  5HY6 A;  1A63 A;  4HJ7 A;  2LSS A;  2R92 G;  3TS2 A;  1VQF A;  5IP9 H;  1A62 A;  2WB1 G;  4IPD A;  5GQO A;  3RLF A;  4LF8 Q;  4KHP Q;  4A76 A;  3A5Z B;  3MEF A;  2CQO A;  1WFQ A;  1VQ6 A;  3K7A H;  1I94 Q;  3I7F A;  3STB C;  5FLX c;  1NJI C;  2HHH Q;  4A3D H;  4DV1 L;  4JI2 Q;  2MFI A;  4LFA Q;  1PHJ A;  1PH1 A;  2RHS B;  1Z47 A;  5DLQ E;  4DR6 Q;  4GKJ L;  4YY3 L;  4A3J G;  3Q8D A;  2BH2 A;  4BBR G;  3G48 A;  3L2P A;  1FJG Q;  2K5N A;  3OW2 A;  1P8L A;  2BA1 A;  1D8L A;  1PA6 A;  2R6G A;  5C4J H;  4A3G G;  4IFD I;  1E1T A;  4TVA B;  1CKN B;  4A4I A;  4JV5 L;  1K0R A;  1EIF A;  2BA0 A;  4A3F G;  3WWV A;  2QGQ A;  1SMX A;  4APV A;  4GNX C;  4UPA A;  4GKK L;  2ZM6 Q;  2Q2H A;  4R1J A;  3F8T A;  4BBS H;  2E5L Q;  1N33 L;  3ERS X;  3RZD H;  3I4M G;  1QVG A;  3CME A;  2OQK A;  3CPF A;  4KHP L;  4A3L G;  1S40 A;  1YHA A;  1UEB A;  3AYH B;  3STB D;  1HH2 P;  4O0A A;  5M3F G;  1BKB A;  1JMC A;  2YTY A;  3GTO H;  3B6Y A;  2R7Z G;  3GO5 A;  1EYG A;  1LM0 A;  2I0Q A;  1XPR A;  2F4V L;  1EQQ A;  4UP9 A;  2YV5 A;  3G71 A;  4LF6 L;  2K4K A;  1L1O C;  1TWH H;  4X66 L;  3G6E A;  4DR6 L;  1IL2 A;  1UE1 A;  1PYB A;  1Y14 B;  2B29 A;  1FJG L;  4MNO A;  3HOU G;  5C3E H;  1Q12 A;  3I55 A;  4A93 H;  4JG2 A;  4X64 L;  1EOV A;  3GTP H;  4AH6 A;  3PF5 A;  2R93 H;  1JT8 A;  5IY0 A;  5GRO A;  1X65 A;  5BR8 Q;  4LFB Q;  4PMW A;  2EQS A;  5M5W H;  2N78 A;  2PNH A;  3J81 c;  3OTO L;  4JI4 Q;  1VQ9 A;  1YI2 A;  4DV6 Q;  1WJJ A;  1VQN A;  1Q1B A;  4MZ9 A;  1QZH A;  2OQ0 A;  2JEA I;  4JCV E;  3M85 A;  3IRB A;  2WFW A;  3H0G G;  2UUA L;  3CC4 A;  1XPU A;  2UUC Q;  4IPH A;  1GVP A;  4LF7 L;  5LMU Q;  1HZ9 A;  2IHF A;  1K9M C;  2QEX A;  2JE6 I;  3PUY A;  1VQ5 A;  3TRZ A;  1PH7 A;  1HNZ L;  4B3M L;  2Q2I A;  4DR1 L;  4JI6 L;  4A3C H;  3I56 A;  1MIU A;  4POG A;  3PO2 G;  1HNW Q;  2KHI A;  2WB1 E;  4TQU S;  1SFO H;  1PFS A;  1FGU A;  2ZTD A;  3GTM H;  1YZ6 A;  3PUV A;  4R4T A;  3ER0 A;  1CSQ A;  2VQF L;  2CFM A;  5EAY A;  1MKH A;  3TRE A;  1H95 A;  2KCM A;  2ZJQ A;  3FKI H;  3BZK A;  2JA5 H;  2GVA A;  2JQO A;  1N8R C;  3I4O A;  1VQA A;  3H3V H;  3GTL H;  5ELN A;  4DPG A;  1VCI A;  3GD7 A;  1N9W A;  4BA1 I;  4BY1 G;  4DV6 L;  4LUO A;  4OWT B;  4P74 A;  4P71 A;  1XMQ Q;  3CCE A;  3F2C A;  4C3H H;  2MO1 A;  1GD7 A;  4LUZ A;  4DR2 Q;  4A3I G;  1G51 A;  1LYL A;  4OON A;  4JI0 L;  1TWF H;  4XIG S;  5LMU L;  2K50 A;  1IBL L;  3ULP A;  2B3G A;  4L5S A;  4GKJ Q;  4DUY L;  1HNX L;  1VQ8 A;  4YY3 Q;  5C0X J;  3CCQ A;  2OTJ A;  4IJL A;  2OCE A;  4R4O A;  3KF6 A;  3JAM i;  2JA7 H;  4BY7 H;  4IPC A;  1P16 A;  1SE8 A;  2Y0S G;  2ZTC A;  4DR5 Q;  5AJ3 L;  2DGY A;  4A3M H;  1KHI A;  1E1O A;  3L7Z C;  4H02 A;  3UE0 A;  2ASB A;  4GOP A;  4QY7 A;  1VQL A;  2CWA A;  1V43 A;  4OX9 L;  3HOW H;  1BVS A;  5C44 H;  4HIM A;  4HJ8 A;  5M5X H;  1AE2 A;  3BU2 A;  2PQA A;  3ULL A;  2MNA A;  3HOY H;  3J80 i;  2RHQ B;  1KC8 C;  4QIW E;  4GKK Q;  1PH4 A;  2VY3 A;  4JI7 Q;  4A75 A;  1E7Z A;  1G6P A;  2VZA A;  2CWP A;  2D62 A;  2JA8 G;  1WYD A;  1HJP A;  1N34 L;  4DR3 L;  3S1N H;  3HOX H;  1XMQ L;  3GTK H;  2IX0 A;  3S2H H;  1VQJ A;  5IP7 G;  4A3K G;  1VQ4 A;  2F4V Q;  4DR2 L;  1NMG A;  3RLN A;  1YHQ A;  4LF6 Q;  1PH8 A;  1R9T H;  3GTJ H;  4X66 Q;  3S15 H;  2VS1 A;  2QA4 A;  1OXS C;  4MTN A;  5K36 G;  4BXX G;  3FKI G;  1IXR A;  4IFD J;  3CAM A;  3KOJ A;  1B70 B;  1S3O A;  3PCO B;  3H15 A;  3M4P A;  4DR5 L;  2B63 H;  4X64 Q;  3PO3 H;  2H5X A;  4IO9 A;  1QZG A;  1PH5 A;  1UE5 A;  1OTC A;  1EFW A;  2HIV A;  4AIM A;  2JEB I;  4JI1 L;  2ZTE A;  4LFC Q;  4DR7 Q;  4B3R Q;  1L1O A;  1A8V A;  4QGU A;  4QL5 A;  5LMN Q;  2JA6 G;  4LF9 L;  5IYB G;  5FLM G;  1Y1W G;  5C4X G;  3OTO Q;  4A3B G;  4PZ8 A;  4GN5 A;  4NXN L;  3CCU A;  5IYD G;  4JI7 L;  1EUJ A;  4OO1 I;  4DV0 L;  1SLJ A;  1QUQ A;  3CCM A;  1I3Q H;  1ASZ A;  2UUA Q;  3PIO A;  3PUW A;  1TWG H;  3DLL A;  2PI2 E;  1KRS A;  4R4I A;  4QQB X;  4LF7 Q;  1YHB A;  2RF4 A;  2YU9 H;  4QJF A;  2YYZ A;  1KD1 C;  2R7D A;  1I50 H;  3VDY A;  5ELO A;  1HNZ Q;  4P75 A;  4DR1 Q;  4B3M Q;  1YIT A;  4JI6 Q;  3BJU A;  1DGS A;  1ASY A;  2I5H A;  4DUZ L;  3D31 A;  3S24 A;  3HOV H;  1WCM H;  3BZC A;  5IWA L;  3KFU A;  1YBY A;  3EIV A;  1J5E L;  1RIP A;  1K3R A;  2Q2U A;  1WOC A;  4IJH A;  3ICE A;  2F3I A;  3M4Q A;  4IPG A;  5M3M H;  2VQF Q;  3S1M H;  4HIO A;  5IP9 G;  1MJE A;  1AH9 A;  4R4Q A;  1X6O A;  3KLW A;  1KRT A;  4JI5 L;  3FHW A;  4LFC L;  3A5U A;  3FP9 A;  4NXM L;  2IX1 A;  4DK3 C;  1KIX A;  4NPS A;  5LMN L;  3RLO A;  3CCL A;  1VS0 A;  4K0K L;  1PH3 A;  4C3J H;  3CC7 A;  1S72 A;  1XMO L;  2HIX A;  2WAQ G;  5H1S E;  4A3D G;  1YNX A;  3CW2 C;  3NEN A;  3H3V I;  2Y0S E;  2VUM H;  3CMA A;  2KCT A;  5LMN W;  5JJI A;  1EIY B;  3S1R H;  4B3S L;  4HIK A;  4Y7N H;  1NBW A;  3HKZ G;  3KDF A;  2VQE L;  2CCZ A;  1I5F A;  2D0O A;  2I5M X;  3AFP A;  5FJ8 H;  4JI0 Q;  3PO3 G;  3HOZ H;  1HR0 L;  1IBL Q;  3PF4 A;  2VW9 A;  1BBU A;  2OWO A;  4DUY Q;  1HNX Q;  2Q2T A;  4PZ6 A;  1WI5 A;  4RMF A;  1Q8K A;  4P73 A;  3I4N H;  3KYH C;  3CXC A;  2L15 A;  5AJ3 Q;  2PI2 A;  3AFQ A;  1HR0 W;  3M9B A;  4OWX B;  3T1H L;  2N8N A;  4LW1 A;  4UY8 C;  1VQI A;  2AWN A;  3A0J A;  1XNQ L;  4BBS G;  4OX9 Q;  3UDG A;  1LTL A;  3AQQ A;  2R7F A;  1QVF A;  3KF8 B;  1YEZ A;  1C9O A;  2E2J H;  2K5V A;  1GO3 E;  4NB3 A;  4GLX A;  4DR7 L;  4B3R L;  1SR3 A;  3GDE A;  2YTX A;  4ALP A;  2Z0S A;  3CP0 A;  2R92 H;  4JOI A;  3K80 C;  1Q7Y C;  4Y52 H;  2EIF A;  5IE8 A;  1T9H A;  3MXN B;  3U58 A;  4L5Q A;  1Q81 C;  1N34 Q;  4DR3 Q;  4IOA A;  3F1Z A;  4DR4 L;  1L2F A;  1I6H H;  2UXB L;  4FDB A;  3CCV A;  1GKH A;  2E8G A;  1GM5 A;  1N32 Q;  1WCM G;  1Q1E A;  1YJW A;  5C3E G;  3CC2 A;  4A93 G;  1CUK A;  3CCR A;  1KXL A;  4AYB G;  2BH8 A;  1XJV A;  1E22 A;  1SRO A;  4LF4 Q;  4A3J H;  1JJ2 A;  2R93 G;  4YWK A;  4BBR H;  4AQY Q;  1M1K C;  1E24 A;  1Y1V H;  4KHZ A;  3JAM c;  2F52 A;  4A3E H;  1IBK L;  1CKN A;  4JBJ A;  4WJ3 M;  1X55 A;  4OO1 G;  5IT9 c;  2NVQ H;  1RL2 A;  4JI1 Q;  2XTI A;  1TWC H;  4DV4 L;  4LF9 Q;  1PVO A;  4A3F H;  3PUZ A;  2PMZ E;  3J80 c;  2D0P A;  1UE6 A;  2K75 A;  3HFZ B;  1UE7 A;  4GLV B;  2AMC B;  4BA2 I;  1OXU A;  4NXN Q;  1IBM L;  1JJG A;  4P72 A;  3I4M H;  4DV0 Q;  4YHH L;  1IYJ B;  2CKZ B;  2N49 A;  2ATW A;  1N36 L;  4DV3 Q;  1XNR L;  3J81 j;  4JI3 L;  4A3L H;  4A3C G;  3CPW A;  1W2B A;  1N32 L;  1FVI A;  4GNX A;  2NN6 I;  3J7A 5;  5JEA G;  2R7Z H;  4PG3 A;  2MQH A;  3M4O H;  3JC6 6;  4L5R C;  2UUB Q;  1HZB A;  3EN2 A;  2ID0 A;  5E7N A;  4JBW A;  2WAQ E;  2E2H H;  4YWM A;  4DUZ Q;  4LF4 L;  2JA5 G;  1X3F A;  5IWA Q;  4X65 L;  4AQY L;  3KJP A;  4JYA L;  2GVB A;  4B3T L;  3HOU H;  1J5E Q;  3E9H A;  3LGJ A;  1C0A A;  1TXY A;  1VQH A;  2NVY H;  3HKZ E;  3UDF A;  2JJQ A;  3S1Q H;  2KEN A;  3E0E A;  4JI5 Q;  1NY4 A;  4UP8 A;  4YCV A;  4NXM Q;  2VNU D;  2VL6 A;  4DV2 L;  3RN5 A;  4K0K Q;  5GAG C;  2DUD A;  3HKS A;  2Z6K C;  1JE5 A;  4PZ7 A;  4HJ5 A;  4JI8 Q;  2NVX H;  4DV5 L;  4DKA C;  4KI0 A;  1XMO Q;  5JJL A;  1FL0 A;  2AWO A;  4GOP C;  1XPO A;  4LF5 L;  1TWA H;  2MO0 A;  3M3Y H;  1M90 C;  4X6A H;  2EXD A;  2E2I H;  3U4Z A;  1VQB A;  3ZJY C;  4EX5 A;  1EQR A;  2UXD L;  2YTV A;  2GN5 A;  1VQP A;  4B3S Q;  4DV3 L;  1Q82 C;  3W1G A;  2VQE Q;  3H0G H;  2JA7 G;  4BY7 G;  4X62 L;  1Y1V G;  3CCS A;  2AHO B;  1YJ9 A;  3PUX A;  4A3E G;  2IT1 A;  4YWL A;  1HR0 Q;  4JBK A;  4A3M G;  3TS0 A;  2ZJP A;  3KF6 B; 
#chains in the Genus database with same CATH topology
 5JEA J;  2A6H C;  3D8G A;  3HOW G;  5C44 G;  1I4R A;  3SE0 A;  2HT1 A;  3PO2 H;  4GOP B;  4H13 C;  3HOY G;  1ET6 A;  2F03 A;  1E3P A;  1YJN A;  1EWI A;  3EVQ A;  1TKW B;  4ME3 A;  1ET9 A;  1BBW A;  3K0X A;  3WOF A;  2VB3 X;  5ELC A;  2SNS A;  4AYB E;  3HOX G;  4JI8 L;  4ZYS A;  2HHH L;  4LMQ D;  3T53 B;  4BY1 H;  4GNX B;  3DWA A;  3TDQ A;  1C4Q A;  3Q23 A;  4BBR B;  2TSS A;  3C3L A;  2MUY A;  4YCW A;  2KHJ A;  4R8N A;  2EVB A;  3TBI B;  4IN3 A;  5COR A;  5CBA E;  1ENC A;  1PH2 A;  1LTT D;  1KQS A;  3PIP A;  1J8I A;  1K28 A;  4A3F B;  1XYI A;  3UI2 A;  5C4H A;  3RZO H;  1AFP A;  2B2W A;  3J7Z C;  5GAD C;  2ZM6 L;  1J6Q A;  3TEH B;  2ALY B;  4ZUJ A;  5HUR A;  5AFW A;  4DV4 Q;  1ILP A;  2K01 A;  2UU9 Q;  1YVC A;  3ULJ A;  5M3F B;  3S14 H;  1S4Z A;  2NN6 G;  3BYT B;  1IBM Q;  3E9I A;  2R7Z B;  1DM0 B;  2LFN A;  1GJX A;  4GN4 B;  4JI3 Q;  5I4D A;  4A3K H;  1V9P A;  2I5L X;  2LXK A;  1K8G A;  4I7A A;  2KBN A;  2K28 A;  2D9U A;  3UDX A;  5EKK A;  3OYY A;  1HA5 A;  3W5O A;  5BR8 L;  1HUM A;  3TQY A;  5IYC G;  3KBX A;  2E2I B;  3DWQ A;  1BOS A;  1TS3 A;  5EJW A;  2RDF A;  5IYB H;  5FLM H;  4DV5 Q;  1Y1W H;  5C4X H;  2UU9 L;  4IUT A;  4DV1 Q;  1IKL A;  3VA7 A;  2OTL A;  3KDF B;  3SK6 A;  1BCP F;  3ONA B;  3C46 A;  1MJC A;  3K7U C;  3A54 A;  1X56 A;  2Z9H A;  3NWS A;  5M3F H;  2Z6K A;  2I07 B;  3CQZ H;  4Z9C B;  4JOI C;  1SNM A;  5C0X I;  3GTQ B;  2F0U A;  3T1Y Q;  3AMU A;  2B8F A;  2K5H A;  1O7I A;  1EY9 A;  3L0O A;  1STA A;  3VR5 A;  3NEM A;  1ML0 D;  3TS2 A;  5IP9 H;  1A62 A;  5GQO A;  4KHP Q;  1S5F D;  4A76 A;  2EPB A;  3MEF A;  3H09 A;  1WFQ A;  4WJW A;  1B1Z A;  4Q0F A;  1I94 Q;  5FLX c;  2NTS A;  2SOB A;  4DV1 L;  3I73 A;  3H91 A;  4ODG A;  1ZKO A;  3I3C A;  4GKJ L;  1EU3 A;  2NYZ D;  3Q8D A;  4C2M B;  1D8L A;  4XQJ A;  5FLX L;  4KJN A;  3R93 A;  4H7B A;  4A4I A;  4N9P A;  4GNX C;  4GKK L;  2E5L Q;  1QCB D;  1AW7 A;  3I4M G;  4C3I B;  1F2L A;  3G7L A;  3CME A;  2OQK A;  4KHP L;  2CW0 C;  2XN9 C;  2WV6 D;  1EYD A;  4ME5 A;  1JMC A;  2K03 A;  3IAY A;  1S5E D;  1XPR A;  4UP9 A;  2PPB C;  2KVM A;  4U68 A;  2N55 A;  4RAU C;  3H94 A;  1EY0 A;  3GV3 A;  3BVZ A;  1UE1 A;  2B29 A;  5A2Q L;  4MNO A;  1Q12 A;  1F2M A;  4JG2 A;  1EOV A;  4AH6 A;  2JA6 B;  4LFB Q;  4A3B B;  3J81 c;  3OTO L;  2EXZ A;  4DV6 Q;  1F9P A;  3SK5 A;  1STH A;  2D5D A;  3M85 A;  3DEP A;  4JK1 C;  2UUA L;  2UUC Q;  4OGQ C;  5TSS A;  5LMU Q;  5DM6 3;  2IHF A;  1K9M C;  3PUY A;  3J81 L;  3ERO A;  1HNZ L;  4JI6 L;  4A3C H;  3PO2 G;  1HNW Q;  4TQU S;  1SE2 A;  2ZTD A;  5JEA H;  5I9O A;  1YZ6 A;  3PUV A;  4R4T A;  3W3A A;  3Q24 A;  3A55 A;  2CFM A;  2QDL A;  1XX8 A;  3QOJ A;  2KCM A;  1BXT A;  5IGE A;  2JA5 H;  2SEB D;  1A3V A;  1SSO A;  4V0B A;  1N8R C;  1SYF A;  2WAQ B;  3I4O A;  1VQA A;  4FO2 A;  3H3V H;  1B4O A;  4BY1 G;  2B2T A;  4ZRZ A;  4DV6 L;  4NKL A;  4LUO A;  3LX0 A;  2MO1 A;  2PO4 A;  2F0V A;  2RVL A;  1G51 A;  2XWJ B;  5LMU L;  2B3G A;  1VQ8 A;  2KCC A;  4IJL A;  4BY7 H;  1KNA A;  3NWT A;  4IPC A;  4DR5 Q;  2ICE C;  5AJ3 L;  2DGY A;  3ZYY X;  3U9S A;  1HQR D;  4H02 A;  4BBS B;  4GOP A;  4QY7 A;  2CWA A;  1BVS A;  5M5X H;  2QIL A;  3ULL A;  1F2Z A;  2PZU A;  2MNA A;  2RDH A;  1KC8 C;  1TII D;  4H44 C;  2VY3 A;  4JI7 Q;  2RKS A;  4EVO A;  4A75 A;  2VZA A;  1DYQ A;  1WYD A;  1TWH B;  4DR3 L;  3S1N H;  3GTK H;  2IX0 A;  3S2H H;  1VQJ A;  4MIU A;  1BCP D;  4A3K G;  3VYT A;  3GTP B;  1NMG A;  4AYB B;  4CDD C;  1PH8 A;  1X3Q A;  2KED A;  3GTJ H;  4X66 Q;  4X3T A;  2QA4 A;  4TRD A;  2BDO A;  2NWG A;  3PCO B;  3TP8 A;  4DR5 L;  2B63 H;  3PO3 H;  4KN4 C;  1EFW A;  2HIV A;  4JI1 L;  3BG3 A;  2A73 B;  5IYB G;  4QUC A;  2QW7 A;  5FLM G;  1Y1W G;  5C4X G;  4PZ8 A;  3NHH A;  2XWB B;  4JI7 L;  1EY7 A;  1GUS A;  1HCZ A;  1JC7 A;  5KIX A;  3D4W A;  1W6K A;  3DLL A;  3NXW A;  5CGK A;  2PI2 E;  3KLR A;  1EYA A;  3GTM B;  2YU9 H;  1EOT A;  4QJF A;  3Q0A A;  2SDF A;  3VA5 A;  4KD4 A;  1S5C D;  5CV7 A;  4B3M Q;  2F0Q A;  3BJU A;  3D31 A;  3KLS X;  2KCN A;  3GTL B;  1IYV A;  2F3I A;  4J6H A;  5IP9 G;  4R4Q A;  3D4D A;  3L9A X;  3OIP A;  3FP9 A;  3S17 H;  3HZX A;  4DK3 C;  2EY5 A;  2F0K A;  2EJM A;  4C3H B;  2R61 A;  1PH3 A;  1K8O A;  4E6I A;  1SYC A;  3NEN A;  3H3V I;  1NR2 A;  4PMC A;  1LAC A;  3EA6 A;  4K14 A;  1EIY B;  4N8F A;  4B3S L;  4HIK A;  3KDF A;  2CHB D;  4A3M B;  4ULL A;  1HTL D;  1U4R A;  2LKV A;  4OHJ A;  3HOW B;  4IFD H;  5C44 B;  1V1P B;  2Q2T A;  4PZ6 A;  1PRT F;  4P73 A;  3DM1 A;  3KYH C;  3I4N H;  3HOY B;  4OWX B;  4LW1 A;  1MD2 D;  1LO5 D;  1AP0 A;  4X3K A;  1RHP A;  3A0J A;  1XNQ L;  4OX9 Q;  3AQQ A;  5JVH 3;  1PTO F;  1TS2 A;  2E2J H;  5EQ0 A;  2O4X A;  4NB3 A;  3HOX B;  3WOE A;  4GLX A;  2NTT A;  1DCZ A;  2RDG A;  1IW7 C;  4Y52 H;  1Q81 C;  4L5Q A;  1R9T B;  2VXW A;  3S15 B;  2KA7 A;  4IOA A;  4DR4 L;  1H9S B;  2E2D C;  1I6H H;  1X32 A;  1N32 Q;  1TY2 A;  5BN5 A;  3NP8 A;  1CUK A;  4HSV A;  5EBD A;  2FFK B;  3CCR A;  2AQ1 B;  5CMD A;  1SRO A;  3NTK A;  4A3J H;  4YWK A;  4C56 C;  4AQY Q;  1E24 A;  1O7L A;  1G6Z A;  1JIC A;  1JQY D;  5IT9 c;  1D6E C;  5IIF A;  1TWC H;  1VMC A;  1PVO A;  1I3Q B;  1TWG B;  1UE6 A;  1NCV A;  2CH4 W;  3MTS A;  4KKU A;  2DY8 A;  4DV0 Q;  4YHH L;  2ATW A;  2K33 A;  1XNR L;  3J81 j;  4A3C G;  3CPW A;  5IT9 L;  1WCM B;  1N32 L;  3P7J A;  5JEA G;  1KLU D;  3M4O H;  3JC6 6;  2ID0 A;  3S1M B;  2E2H H;  5G3L F;  4WRD A;  4QF4 A;  2JA5 G;  4AQY L;  3HOU H;  3SEB A;  4K5X A;  2JJQ A;  1NAP A;  3S1R B;  1SEB D;  4K0K Q;  4Y7N B;  2RSO A;  5IGB A;  1LTS D;  3NUC A;  4KI0 A;  1XMO Q;  1CZW A;  5JJL A;  4LF5 L;  1TWA H;  2KJX A;  3M3Y H;  1XWE A;  2YTV A;  1STB A;  4BY7 G;  1Y1V G;  1O80 A;  4FP5 D;  1S5B D;  1YNN D;  1H9M A;  4A3E G;  5EPL A;  2MPM A;  3TS0 A;  4JBM A;  1CM9 A;  1I4G A;  3LWU A;  1NMF A;  2ES2 A;  2O5J C;  1HA6 A;  1U4L A;  4J15 A;  2A1A A;  1LT3 D;  2PQA B;  5CR3 A;  1D1I A;  4HID A;  1B9M A;  3K6O A;  5LHY 1;  2A6E D;  5HGQ A;  3PQI A;  4DNR B;  4KLK A;  4FF1 A;  5IYC H;  2RCF A;  2A69 C;  4LFA L;  2WP8 J;  5LL6 S;  3MXP A;  1EY8 A;  2KHS A;  1JWS D;  1ILQ A;  1CKM A;  2B63 G;  1K83 H;  4DAY B;  3V96 A;  3U4V A;  3GV6 A;  1X9N A;  1EFI D;  1IBK Q;  5C3X A;  1L1O B;  3E3X A;  5FO9 B;  2JK8 A;  3I4M B;  3GTG H;  3UE1 A;  2Q8I B;  1FNW A;  3VYR A;  1HHV A;  2N3S A;  5I6Y A;  4FF3 A;  4LWC A;  4XTC S;  1W6J A;  2FXQ A;  1IHZ A;  1BUV T;  4WJ4 A;  4HCE A;  2F0T A;  4HSP A;  4PV1 C;  2JA8 H;  3NTH A;  2VB2 X;  3U50 C;  1HXY D;  3NBH B;  3A8K E;  3HP3 A;  4O2D A;  2NVY B;  1OXV A;  2E76 C;  1B7Y B;  3DXJ C;  1HZA A;  1PRT D;  2RCN A;  1LLR D;  4MN3 A;  3I2Z A;  4CBV A;  2A8V A;  4BXX H;  1CA6 A;  3MEH A;  1A2U A;  2Z1C A;  4B3T Q;  2NVX B;  1IZ6 A;  1LAB A;  4NP5 A;  1PTO D;  5CYU A;  4JI4 L;  4C1N I;  5CV6 A;  1STE A;  1FR3 A;  4HMJ A;  1VQO A;  2B39 A;  1Y8P B;  4ZAI A;  3PMF A;  2VNU D;  2DN8 A;  2L1B A;  3EBE A;  4JVZ A;  2UXD Q;  2JP1 A;  2MGS A;  4IFD G;  3RR5 A;  1BO0 A;  1MGS A;  1K8A C;  3PO2 B;  3I4N G;  4X62 Q;  4I65 A;  1F9Q A;  2JA9 A;  4KY7 A;  2BE5 D;  2F1M A;  4JV5 Q;  5EKI A;  2K32 A;  5ELF A;  2Z4H A;  5GAH C;  1PFB A;  3I4L A;  1XTD A;  5HY6 A;  1A63 A;  4HJ7 A;  1WD0 A;  4BY1 B;  5EPK A;  4IPD A;  3BS1 A;  3K57 A;  2CQO A;  3OPO A;  1CA5 A;  5FOB B;  3M4Y A;  3K7A H;  4KK7 A;  3I7F A;  2XRS D;  2HHH Q;  2MFI A;  1STY A;  1PH1 A;  2RHS B;  3NBI A;  1KNE A;  3H6M A;  4DR6 Q;  5T1I A;  1JCK B;  4YY3 L;  3RMH A;  4A3J G;  5I2X A;  1D5X C;  1IKM A;  2L9H A;  5KNC A;  1V1P A;  2OF1 A;  3RZO B;  1G2S A;  1CTM A;  2BA1 A;  2R6G A;  2X69 A;  5G3L D;  5M9O A;  1E1T A;  3MHB A;  4TVA B;  1CKN B;  4RFB A;  4MTK A;  1U9R A;  3EJI A;  4JV5 L;  3WWV A;  2QGQ A;  1SMX A;  3S14 B;  1SJE D;  2ZM6 Q;  1JWM D;  2Q2H A;  1WTX A;  1Z6H A;  1KDB A;  3ERS X;  3RZD H;  3PIO 3;  3CPF A;  3DWP A;  1S40 A;  3OOC A;  1YHA A;  3AYH B;  4A3K B;  3GTO H;  4O0A A;  4ZCK A;  1H9S A;  2ENB A;  2F4V L;  3ND9 A;  4KTA A;  2YV5 A;  3G71 A;  4LF6 L;  1L1O C;  4ZQ3 A;  2L55 A;  4DR6 L;  1IL2 A;  1PZI D;  2O2L D;  2ZT9 C;  1EEI D;  2AQ3 B;  1IL8 A;  1Y14 B;  3HOU G;  2QDB A;  3KBG A;  5C3E H;  4A93 H;  4X64 L;  3TZU A;  2Z8L A;  1Q3L A;  3CRK C;  4G7H C;  4CKB A;  1EIH A;  1Y1W B;  5BR8 Q;  5C4X B;  2N78 A;  2HCC A;  3RUZ A;  4OO1 H;  3EFX D;  5I6W A;  1VQN A;  1WJJ A;  1IYU A;  4MZ9 A;  3QB3 A;  2JEA I;  1SE4 A;  3IRB A;  3CQZ B;  2KQ3 A;  1RJT A;  4IPH A;  1GVP A;  3FDT A;  4LF7 L;  3TRZ A;  2JE6 I;  1FNU A;  4K2L A;  4DR1 L;  4X3U A;  4FF2 A;  1LTA D;  4EQO A;  1SFO H;  1PFS A;  1WTV A;  2K7V A;  5IOC A;  2G9D A;  1JB3 A;  2EY6 A;  1RTO A;  1UEA B;  3OMC A;  5EAY A;  2ZJQ A;  5DAU A;  4A3M G;  2B2V C;  2KEC A;  1CI3 M;  2GVA A;  3HEJ A;  2K04 A;  5ELN A;  4DPG A;  1VCI A;  5FK9 C;  4BA1 I;  5J1Z A;  4P74 A;  2IW3 A;  4OWT B;  3VR4 A;  1XMQ Q;  3CCE A;  3F2C A;  2EYP A;  4LUZ A;  4DR2 Q;  1BCP C;  1GUT A;  1E2V A;  5DEH A;  1IBL L;  2F0G A;  4GKJ Q;  4L5S A;  4XXE A;  3HG9 A;  4DUY L;  1HNX L;  1A3T A;  2OCE A;  1P16 A;  1SE8 A;  2Y0S G;  1CFM A;  1E1O A;  3L7Z C;  3UE0 A;  2ASB A;  1A3U A;  5COY A;  3A8I E;  1AE2 A;  3BU2 A;  2PQA A;  2BDN A;  2O5I C;  3T4A C;  4GKK Q;  2Q8T A;  2WII B;  4G4K A;  1LTG D;  1WTR A;  1G6P A;  2D62 A;  2JA8 G;  1T5E A;  1RDP D;  4HR7 B;  1LT5 D;  4F7X A;  2DNE A;  2JYO A;  1XMQ L;  1AZQ A;  2F0I A;  5D3I B;  3P1H A;  4DR2 L;  1L0X B;  2FHT A;  1LT6 D;  4M1U B;  3RLN A;  1YHQ A;  2A68 D;  2G5D A;  1OXS C;  3KLS A;  4MTN A;  4I7Z C;  4BXX G;  3FKI G;  1IXR A;  3X3M A;  4DAY A;  5BN3 A;  4IFD J;  4DFA A;  4IO9 A;  4K8I A;  1UE5 A;  1T5X D;  3F2U A;  4JPB W;  4EQN A;  2JEB I;  2HDM A;  2EYJ A;  1L1O A;  1A8V A;  5LMN Q;  3VYU A;  4LF9 L;  1QWY A;  3URY A;  3OTO Q;  4DK1 A;  1FGB D;  4NXN L;  1CQF A;  1EUJ A;  4OO1 I;  2F0F A;  3K5O A;  3E6Z X;  2MHV A;  1HUN A;  2IJ0 A;  2X6G A;  3CCM A;  2UUA Q;  3PIO A;  3PUW A;  2F0D A;  1LTI D;  1STG A;  5EGT A;  1YHB A;  2RF4 A;  3OHX C;  1KD1 C;  2R7D A;  3MA2 B;  1HNZ Q;  4P75 A;  4DU9 A;  1YIT A;  3NBH A;  3T13 A;  4JI6 Q;  1HFN A;  2JA5 B;  1ASY A;  2IL8 A;  3HOV H;  5IWA L;  1M4V A;  1DON A;  1RIP A;  1K3R A;  4K5W A;  5FO7 B;  4IPG A;  3M4Q A;  5M3M H;  5ELD A;  4JI5 L;  1KRT A;  4NXM L;  3FHW A;  3A5U A;  4NPS A;  5LMN L;  3RLO A;  1GUW A;  1VS0 A;  3D4R A;  1D2B A;  3CC7 A;  3C1E A;  2ZXP A;  1PXU A;  2L11 A;  1F9S A;  2Y0S E;  2VUM H;  2DY7 A;  2E75 C;  2KCT A;  1A15 A;  4CJ0 B;  5JJI A;  4BY7 B;  3HKZ G;  2B2V A;  2CCZ A;  1F2Y A;  1I5F A;  2XRQ D;  3AFP A;  1HR0 L;  1SNC A;  2OWO A;  2NVQ B;  5M5X B;  1H9J A;  2EE1 A;  4RMF A;  3MVV A;  4R9W A;  2PI2 A;  5AJ3 Q;  3OSO A;  3T1H L;  2N8N A;  5D14 A;  1KDC A;  1GXD C;  3KF8 B;  4CKC A;  1YEZ A;  4CHT B;  2K5V A;  1GO3 E;  4CKE A;  3S1N B;  3GTK B;  3S2H B;  4ALP A;  2PW5 A;  1NUC A;  1PYW D;  2R92 H;  4JOI A;  3K80 C;  4BWG B;  2EIF A;  5IE8 A;  3MXN B;  4QIW B;  3GTJ B;  1SE3 A;  4DR3 Q;  5D3D A;  1L2F A;  2V4D A;  2UXB L;  4FDB A;  1PTO B;  3NE5 B;  3T56 B;  2B63 B;  2M9V A;  5IT9 E;  3PO3 B;  1B2T A;  3AU7 A;  5C3E G;  4A93 G;  1KXL A;  1AN8 A;  2RA4 A;  1E22 A;  3O13 A;  3R8B A;  4LF4 Q;  4CJ2 C;  1M1K C;  2F0H A;  1HRJ A;  1Y1V H;  4A3E H;  4CDE C;  1CKN A;  1EYC A;  1RCV D;  4OO1 G;  2A74 C;  2NVQ H;  1RL2 A;  4JI1 Q;  2BCO A;  1G8Z D;  4CDF C;  1JOK A;  3TME A;  4GLV B;  4BA2 I;  1Q90 A;  2AMC B;  1OXU A;  2YU9 B;  4OEL B;  3SVM A;  2CKZ B;  2CH4 A;  2N49 A;  1N36 L;  4DV3 Q;  4A3L H;  4V19 0;  4J8Q A;  2H4O A;  4GNX A;  2HD3 A;  5A35 A;  2AUJ D;  3EN2 A;  1CT1 D;  4JBW A;  3MXU A;  1JOR A;  3S17 B;  4LF4 L;  4JYA L;  1X3F A;  4X65 L;  1PTO H;  1F9R A;  2NZ1 D;  2GVB A;  4IZ8 A;  3KJP A;  3MZ5 A;  3DHQ A;  3E9H A;  3LGJ A;  1C0A A;  1TXY A;  1VQH A;  5IOD A;  3HKZ E;  3UDF A;  3S1Q H;  4XYQ A;  1ICF B;  3E0E A;  4YCV A;  4DV2 L;  3RN5 A;  3V05 A;  5CV9 A;  3S9W A;  3WDN A;  4PZ7 A;  1JE5 A;  4RA8 A;  5E4X A;  3NQI A;  3SK8 A;  1XPO A;  1M90 C;  4X6A H;  1L0Y B;  2EXD A;  3U4Z A;  1EQR A;  3H3V C;  1RD9 D;  4B3S Q;  4DV3 L;  3I4N B;  1JOQ A;  1SND A;  3H0G H;  4EGV A;  3D6W A;  1YJ9 A;  2F0J A;  3PUX A;  2IT1 A;  2JXM B;  2ZJP A;  2BOS A;  4DV7 L;  1DZ1 A;  1UWV A;  2UXC L;  1EY4 A;  2E2J B;  5KGU A;  1BR9 A;  4QB4 A;  1XNQ Q;  4YIJ A;  2F4I A;  2NB0 A;  1E0B A;  2IPK D;  4RGO S;  3SGI A;  5C3W A;  4LF8 L;  1I6H B;  1PZJ D;  1VQD A;  5KYL A;  4N8X 1;  2P5Z X;  3OWE B;  4NW2 A;  3RN2 A;  1MSG A;  4TSS A;  4JI2 L;  1JB7 A;  4QUF A;  1EWC A;  1A2T A;  2K1B A;  4EQP A;  3PSI A;  4DR4 Q;  1SJH D;  1CHQ D;  4DK6 C;  1BDO A;  4A3J B;  4R4C A;  1OXX K;  1YIJ A;  4WOR A;  5ELE A;  3VR2 A;  3K5M A;  2A19 A;  4A3I H;  2OXP A;  2TMP A;  1YNJ C;  1TQO A;  1ZXT A;  1PRT C;  2DJG C;  4RG1 A;  1TWC B;  2V1C C;  1R4Q B;  3S2D H;  1PYS B;  2XGT A;  1VQ7 A;  1X54 A;  1PFM A;  1PTO C;  2WIN B;  2NVT H;  4KN7 C;  1PH9 A;  3BDL A;  1EQV A;  4JW0 A;  1VMP A;  4RGT A;  3K81 C;  3TZD A;  1VQK A;  3VR6 A;  1SRU A;  3M4O B;  1QUQ B;  2LXJ A;  3P75 A;  4OXP A;  4RHS A;  4HJ9 A;  4YHH Q;  4OL7 A;  5T1G A;  4GN3 B;  1XNR Q;  2E2H B;  3JAM E;  2F0E A;  5JJZ A;  2JSO A;  3BDC A;  1Q86 C;  4XYO A;  1H9R A;  3HOV G;  3HOU B;  1DJR D;  5GAE C;  3F2D A;  2B2Y C;  3W1B A;  1JWU D;  1SN8 A;  1II3 A;  3DM3 A;  4JC0 A;  5M3M G;  5JOB A;  4RH6 A;  3J80 E;  1B8A A;  3KJO A;  3AEV A;  4N9T A;  3PV0 A;  1ONL A;  1TU2 B;  3M3Y B;  1TWA B;  2L5T A;  2K52 A;  5IGF A;  2EY1 A;  2VUM G;  2L12 A;  1V1Q A;  4RGN A;  2CVR A;  2HQL A;  1LUZ A;  3G4S A;  1HZC A;  4DAV A;  4LF5 Q;  5IYD H;  1TS5 A;  3CF5 A;  4HJA A;  1K73 C;  3L3O C;  2IY5 B;  1QNU A;  1EY6 A;  4L8J A;  2L0C A;  1ESR A;  1KAW A;  1KL9 A;  3UDI A;  1PH6 A;  4UP7 A;  2F0M A;  1D5M C;  1SNQ A;  2XSC A;  2CQA A;  2IHE A;  3GQB A;  5JPN C;  3BYY B;  1N33 Q;  2K6A A;  2MJ8 A;  2R92 G;  2WB1 G;  3RLF A;  1Y69 U;  3A5Z B;  2J0T D;  3A56 A;  2KOL A;  3R3O A;  1VQ6 A;  1NJI C;  4A3D H;  1K83 B;  1ZYR D;  5E1F A;  4LFA Q;  1PHJ A;  3T16 A;  4XT3 B;  4BS9 A;  5DLQ E;  2EDG A;  3LNN A;  1I6V C;  2F3W A;  2WKD A;  1PZK D;  2Y0S B;  2BH2 A;  3TP7 A;  3G48 A;  2Q8R E;  1BF4 A;  2F0N A;  2K5N A;  1P8L A;  1PA6 A;  3GTG B;  4UHV A;  5C4J H;  4A3G G;  4IFD I;  4DGZ A;  1EIF A;  2BA0 A;  4APV A;  4UPA A;  3KF8 A;  2ICI A;  4R1J A;  1N33 L;  2JA8 B;  3MFG A;  1QVG A;  3D3R A;  4A3L G;  5C4Z A;  1UEB A;  3MXN A;  3STB D;  1DOM A;  1BKB A;  3HS0 C;  2YTY A;  3B6Y A;  3GO5 A;  5KND A;  1EQQ A;  2MP1 A;  4K5V A;  3OW7 A;  3G6E A;  3FKI B;  4KKS A;  1PYB A;  4LAA A;  3P20 A;  3I55 A;  1O7Y A;  3PF5 A;  1ROD A;  2R93 H;  1SYB A;  1JT8 A;  5GRO A;  5M5W H;  2OEO A;  4JI4 Q;  4ID6 A;  1VQ9 A;  1B50 A;  2KUM A;  1Q1B A;  2D2C C;  1QZH A;  2B2U C;  2F0L A;  2WFW A;  3H0G G;  1DOK A;  1XPU A;  4R8I A;  5HGT A;  2M00 A;  2FMC A;  4RCN A;  1PH7 A;  3IL8 A;  2Q2I A;  1VDZ A;  4POG A;  2WB1 E;  2DJF C;  3MC0 B;  1D5Z C;  1FGU A;  4M8A A;  4ZLT F;  1BNZ A;  4CJ1 B;  3NPP A;  3FMC A;  2VQF L;  1U4P A;  1Y8O B;  3TRE A;  1MKH A;  1H95 A;  3FKI H;  3BZK A;  3CU7 A;  3K7A B;  3M7G A;  4HMI A;  1EY5 A;  3GD7 A;  1N9W A;  5I9P A;  3HKZ B;  4FXK C;  2B2W C;  4DA2 A;  4A3I G;  5JPM C;  1LYL A;  3IFT A;  4OON A;  4JI0 L;  1TWF H;  4XT1 B;  2K50 A;  3NSW A;  3ULP A;  4YY3 Q;  2OTJ A;  3CCQ A;  4R4O A;  2JA7 H;  1JE4 A;  3JAM i;  2XIW A;  3AB9 A;  3Q22 A;  2X6L A;  1VQL A;  3RZD B;  1V43 A;  4PQX A;  1BCP B;  5FLX E;  3J80 i;  4HCS A;  3QG1 A;  4QIW E;  3GTO B;  1PH4 A;  1E7Z A;  1K0S A;  4KY5 A;  2WAC A;  1GOZ A;  1N34 L;  1ICW A;  1VQ4 A;  5C3E B;  2F4V Q;  4B9X A;  4A93 B;  1EU4 A;  4KHV A;  1CZG A;  4LF6 Q;  4FVM A;  1XTC D;  3ND8 A;  3J7A F;  1B70 B;  1S3O A;  3H15 A;  4X64 Q;  1SNP A;  1KLG D;  5A2Q E;  1PMR A;  1QZG A;  1ZEQ X;  4DR7 Q;  4B3R Q;  1WTW A;  3G6J B;  4QGU A;  4QL5 A;  3BDO A;  1NSN S;  5IYD G;  2ZXO A;  3MFY A;  2J4X A;  5DM7 3;  4OIJ A;  2EZV A;  1M8A A;  1QUQ A;  5KNB A;  1ASZ A;  1SFO B;  5FKA C;  4LF7 Q;  5IGD A;  3VDY A;  5ELO A;  1SAP A;  3QWN A;  4DR1 Q;  1TS4 A;  3J81 E;  2B2U A;  4DUZ L;  3KFU A;  2RBM A;  1J5E L;  2Q2U A;  1HTP A;  2QKI C;  4IJH A;  1LTB D;  1XXG A;  1MJE A;  4ABN A;  1X6O A;  4DR7 L;  4B3R L;  1KIX A;  3CCL A;  3DMU A;  4LFB L;  4C3J H;  2HIX A;  1QE6 A;  4A3D G;  3CMA A;  3QOL A;  1LT4 D;  1EL0 A;  2QEJ C;  4MHE A;  5LMN W;  1U4M A;  5DNF A;  5ELB A;  1QNK A;  1NBW A;  3C1F A;  4G7Z C;  2VQE L;  2Z4I A;  2D0O A;  1Q8I A;  2I5M X;  5FJ8 H;  3HOZ H;  1IBL Q;  2VW9 A;  5ISR A;  1BBU A;  2HCI A;  4DUY Q;  1HNX Q;  5J39 A;  1BBX C;  4K2K A;  1WI5 A;  4C1N K;  1Q8K A;  2L15 A;  3TP5 A;  1NR4 A;  1HR0 W;  3M9B A;  1B3A A;  4UY8 C;  1LTR D;  1VQI A;  2AWN A;  1K8M A;  1LTL A;  2H1E A;  3SXH A;  1C9O A;  5C6A A;  3HRZ C;  2OT2 A;  3D6C A;  3RD4 A;  1SR3 A;  2PW7 A;  3GDE A;  2YTX A;  4OEM B;  2A69 D;  4IAL A;  3CP0 A;  1Q7Y C;  1K3B C;  3U58 A;  1T9H A;  1KAA A;  5I2Y A;  2LY7 A;  3DUZ A;  1GM5 A;  1GKH A;  2E8G A;  1WCM G;  1YJW A;  3CC2 A;  5KYI A;  1HFG A;  2A5H A;  1XJV A;  1GUN A;  3FPP A;  1KTK A;  1JJ2 A;  2R93 G;  3KUP A;  4H0L C;  4BBR H;  4KHZ A;  4JBJ A;  4WJ3 M;  1EZ8 A;  1X55 A;  1EZ6 A;  2I46 A;  3SK4 A;  3ITP A;  1WTH A;  4DV4 L;  1J9O A;  4LF9 Q;  4A3F H;  2PMZ E;  2D0P A;  3W2D A;  1UE7 A;  4NXN Q;  1IBM L;  4NMZ A;  1TY0 A;  2J7Z A;  1IYJ B;  1TVX A;  4JI3 L;  3I8Z A;  1W2B A;  3HOV B;  1FVI A;  3J7A 5;  2R7Z H;  4PG3 A;  2MQH A;  4L5R C;  2UUB Q;  5M3M B;  1HZB A;  2B2T C;  1I4Q A;  4YWM A;  5K5P A;  1SYD A;  5IWA Q;  4CDC C;  2PZT A;  3FEW X;  4IUQ A;  2VUM B;  3A8J E;  2EYL A;  4JI5 Q;  1NY4 A;  2FMM A;  4LK1 C;  4NXM Q;  2VL6 A;  1X3P A;  2DUD A;  3HKS A;  4G57 A;  4FF4 A;  1CHP D;  1NNX A;  4DKA C;  4DV5 L;  3TP6 A;  4GOP C;  2E2I H;  1VQB A;  3ZJY C;  2EJG C;  2LMC B;  3OMG A;  4WFN 3;  4XQN A;  3E5S A;  2JA7 G;  1SMY D;  1ENA A;  2AHO B;  2EJF C;  3NTI A;  1HR0 Q;  4YWL A;  4DN4 M;  1CQV A;  3KF6 B;  4KMU C;  1AE3 A;  2UUB L;  1GHK A;  3T1Y L;  3A74 A;  1UUP A;  1D7Q A;  3MXG A;  3VYS A;  3BZD B;  3T1H Q;  2C35 B;  4O1N A;  4UDU C;  1G2T A;  2R92 B;  1VQM A;  2F0P A;  3GTQ H;  2WB1 B;  4J1M A;  1L0W A;  2NZH A;  3I72 A;  2NZO A;  4Q5V A;  5C5M A;  1S5D D;  1JJC B;  3MWY W;  2ZJR A;  1I94 L;  4QMG A;  4IUN A;  4K6L A;  1A0I A;  1X3E A;  2XNA C;  4IOC A;  1OXT A;  2UXB Q;  3N52 A;  4POF A;  1Y1V B;  5KEE A;  4A3E B;  1C7Y A;  1Q46 A;  4LNQ A;  4A3G B;  4OWW B;  1PV4 A;  2A6H D;  1CKO A;  2K05 A;  1X3G A;  1QVC A;  1V1O A;  2IX3 A;  1U5K A;  4YCU A;  1LV9 A;  3F2B A;  4PMB A;  3J81 i;  1QIL A;  3SHL A;  1MI2 A;  4C2M H;  1I4X A;  3EQL C;  3K8A A;  2N88 A;  2EYO A;  2E5L L;  3S16 B;  1B3Q A;  4X3S A;  2EYF A;  3J7Y W;  2PNR C;  1SDF A;  1V8Q A;  2IWH A;  1VQE A;  4GZY C;  1PRT B;  3BVM A;  3M7N A;  5C0X G;  1VQC A;  4FNF A;  5C5L A;  4C3I H;  1N36 Q;  4FXD A;  3C2P A;  1W3S A;  2G9H D;  5IP7 H;  1I4P A;  1NE3 A;  1U0L A;  5M5Y B;  1AEX A;  2EY2 A;  3K5L A;  4GS3 A;  3PGZ A;  5E4W C;  3S1Q B;  1QOH A;  2AKW B;  5K36 H;  4JYA Q;  4X65 Q;  4F8M A;  1E2Z A;  2RSN A;  3R2T A;  4RKB A;  4GLA C;  4C3J G;  5JVG 3;  1CSP A;  5J3B A;  2EOT A;  1G29 1;  4A3G H;  1GUO A;  2QCP X;  4EQ5 A;  4DV2 Q;  2JA6 H;  2QF7 A;  2K14 A;  3H0G B;  1STN A;  4A3B H;  2UUC L;  4DAM A;  5FJ8 G;  1Z9F A;  1JR0 D;  1ZYR C;  3NEL A;  3HOZ G;  3CD6 A;  3D0F A;  3QIA A;  3S16 H;  1GUG A;  1NTG A;  1Z7T A;  1HNW L;  1Y8N B;  3VR3 A;  5JJK A;  3CCJ A;  1YNN C;  4K8J A;  1GHJ A;  2R3Z A;  4DV7 Q;  2UXC Q;  3RNU A;  4LUV A;  1VQG A;  1ENF A;  3TSS A;  1WTO A;  5M5Y H;  1WVL A;  4L5T A;  3TN2 A;  4FXG C;  4DNI A;  2LSS A;  1VQF A;  1EWH A;  4LF8 Q;  4F88 A;  3FRP B;  2A6E C;  4KJO A;  2M2L A;  5LL6 X;  4A3I B;  3STB C;  4JI2 Q;  2C5C A;  1Z47 A;  3S2D B;  4B08 A;  4BBR G;  1FJG Q;  3L2P A;  5CBE E;  2PCF B;  3OW2 A;  3X3N A;  2C9O A;  2NVT B;  4RGM A;  1SYG A;  1QG7 A;  1RF2 D;  1K0R A;  4A3F G;  2AQ2 B;  1HQM C;  4KV6 A;  1A6X A;  1C48 A;  4BBS H;  3F8T A;  1WD1 A;  1JOO A;  4FYD A;  4XQQ A;  1HH2 P;  3K59 A;  5M3F G;  2R7Z G;  1EYG A;  2I0Q A;  1LM0 A;  1EEF D;  1F77 A;  2KEE A;  1C8C A;  1PLF A;  2HDL A;  5L37 A;  3IKJ A;  2PYK A;  2E74 C;  2K4K A;  3CKI B;  4ZKB B;  1TWH H;  4X66 L;  3HGB A;  1WTQ A;  1R4P B;  3E0J A;  1FJG L;  1FNV A;  3BVG A;  4O42 A;  3GTP H;  4OIK A;  1I4H A;  3KK7 A;  5IY0 A;  3ERQ A;  1X65 A;  4PMW A;  2EQS A;  2PNH A;  3CRL C;  4RHR A;  3NK9 A;  1YI2 A;  3SR1 A;  2CW0 D;  2OQ0 A;  4JCV E;  2EYH A;  3LWE A;  3CC4 A;  3DEO A;  3J7A V;  2PQE A;  1MHW C;  2PMZ B;  1HZ9 A;  1VQ5 A;  2QEX A;  1CK1 A;  4B3M L;  3I56 A;  1MIU A;  2F0S A;  2KHI A;  3GTM H;  3I70 A;  3OWF A;  3ER0 A;  2BE5 C;  1CSQ A;  5D65 A;  1O7Z A;  2ZXR A;  4KY6 A;  3T51 B;  5E3F A;  4DK0 A;  3N6R A;  2JQO A;  4A3D B;  3K58 A;  4ZKC B;  3GTL H;  5EKL A;  1MBY A;  1PDQ A;  4S3S A;  4P71 A;  4C3H H;  2LS0 1;  4DF7 A;  4P2C B;  1GD7 A;  1G91 A;  2F0O A;  3V2T A;  4KD3 A;  4XIG S;  5C4J B;  1VF5 C;  5C0X J;  3KF6 A;  5F2D A;  2Z6B A;  2ZTC A;  4IUV A;  4K6D A;  4A3M H;  1KHI A;  3I90 A;  4L6T B;  2AUK A;  4IUR A;  4OX9 L;  3HOW H;  5C44 H;  4HIM A;  4HJ8 A;  2HQE A;  3MAQ A;  3HOY H;  1RTN A;  2RHQ B;  1H9K A;  4ZUI A;  1AZP A;  1I50 B;  1E2W A;  2CWP A;  4C3I G;  1SYE A;  1HJP A;  5IGC A;  3HOX H;  1B9N A;  2NBF A;  5IP7 G;  3I91 A;  1EIG A;  4IQZ A;  1R9T H;  4UAI A;  3S15 H;  2VS1 A;  2R93 B;  5K36 G;  3FPU B;  3CAM A;  2XVS A;  3KOJ A;  5M5W B;  3M4P A;  2H5X A;  1PH5 A;  4KKT A;  1OTC A;  4AIM A;  4DNT B;  4L63 B;  3CHB D;  2ZTE A;  4LFC Q;  2JA6 G;  2NUC A;  4PNY A;  4A3B G;  3K5N A;  4HN7 A;  1KAB A;  4GN5 A;  3CCU A;  2WKC A;  5KRU A;  1TT2 A;  5CV4 A;  4DV0 L;  1DXM A;  1SLJ A;  1TR5 A;  2K5W A;  4TKO B;  1ESF A;  5FO8 B;  1I3Q H;  1TWG H;  3GP7 A;  2NN6 H;  1KRS A;  4R4I A;  5CV8 A;  4QQB X;  4DXF A;  2YYZ A;  4CGY B;  1B44 D;  1I50 H;  3K0Y A;  4IUP A;  5CV5 A;  3QJY A;  2F0W A;  1DGS A;  1FYC A;  1D1K A;  2GA4 B;  2I5H A;  3S24 A;  1WCM H;  3BZC A;  4DAP A;  5BN4 A;  1YBY A;  2FIN B;  3EIV A;  3A7A B;  1WOC A;  3ICE A;  2VQF Q;  5J22 A;  4HIO A;  3S1M H;  1WTP A;  1AH9 A;  2PZW A;  3KLW A;  1PFN A;  4LFC L;  3OIQ A;  1FD7 D;  3SDZ A;  2IX1 A;  4K0K L;  1SNO A;  2B8G A;  1S72 A;  1XMO L;  2K5Q A;  2WAQ G;  5H1S E;  1TWF B;  3CW2 C;  1YNX A;  2B2Y A;  3IFD A;  2HUG A;  3S1R H;  2JA7 B;  4Y7N H;  1DD2 A;  3QR8 A;  4DXG A;  4NDX A;  4JI0 Q;  3PO3 G;  3PIP 3;  3PF4 A;  5NUC A;  1B53 A;  1MSH A;  3CXC A;  3AFQ A;  1UAP A;  4RKL A;  2F3V A;  4BBS G;  3UDG A;  1QVF A;  2R7F A;  1BQQ T;  1UNS A;  4LJZ C;  2Z0S A;  3U9O A;  1O78 A;  3Q6S A;  1N34 Q;  3F1Z A;  1HPC A;  2SNM A;  3CCV A;  4ILW A;  2RQX A;  5EPJ A;  1Q1E A;  1YNJ D;  1SXT A;  4AYB G;  2BH8 A;  2A68 C;  4B9W A;  1OO9 B;  2JN4 A;  3QO2 A;  3JAM c;  2F52 A;  1RKN A;  5IGG A;  1IBK L;  1QB5 D;  2XTI A;  4HED A;  3PUZ A;  3J80 c;  1QJO A;  2K75 A;  3HFZ B;  1JJG A;  1IW7 D;  4P72 A;  1DOL A;  3I4M H;  2EYM A;  3JAM L;  2K5D A;  1SBB B;  4RWS C;  4RCO A;  1SMY C;  2NN6 I;  4QCL A;  3J80 L;  5E7N A;  4G7O C;  2WAQ E;  4U67 3;  4DUZ Q;  4C3J B;  1KDA A;  4B3T L;  4XDX A;  1J5E Q;  2FJ2 A;  2NVY H;  4ZK9 B;  3NQT A;  4F87 A;  2KEN A;  3A7L A;  5CC4 A;  4UP8 A;  4IUU A;  5GAG C;  3FVQ A;  2Z6K C;  4HJ5 A;  2NVX H;  4JI8 Q;  4C3H G;  5JAV A;  5EBC A;  3HOZ B;  1FL0 A;  2AWO A;  2MO0 A;  1VF7 A;  4HTH A;  4EX5 A;  2DNC A;  2UXD L;  4HAE A;  1VQP A;  2GN5 A;  1Q82 C;  3W1G A;  2VQE Q;  2L4N A;  4X62 L;  3CCS A;  3R2I A;  1EQT A;  4JBK A;  5C0X H; 
#chains in the Genus database with same CATH homology
 1AE3 A;  1NMF A;  2UUB L;  5JEA J;  3T1Y L;  3A74 A;  2ES2 A;  4DV7 L;  3HOW G;  5C44 G;  1UWV A;  2UXC L;  1D7Q A;  2HT1 A;  3PO2 H;  4GOP B;  4J15 A;  2A1A A;  3HOY G;  3T1H Q;  2C35 B;  2PQA B;  1XNQ Q;  1E3P A;  1YJN A;  1EWI A;  1VQM A;  4ME3 A;  3GTQ H;  1BBW A;  3K0X A;  4HID A;  1L0W A;  3SGI A;  4LF8 L;  2NZH A;  5HGQ A;  2NZO A;  1VQD A;  4AYB E;  4KLK A;  1JJC B;  3HOX G;  4JI8 L;  2ZJR A;  1I94 L;  3RN2 A;  5IYC H;  2HHH L;  4JI2 L;  1JB7 A;  1A0I A;  1X3E A;  4IOC A;  4LFA L;  4BY1 H;  2WP8 J;  4GNX B;  3PSI A;  1OXT A;  4DR4 Q;  2UXB Q;  4DK6 C;  4R4C A;  4POF A;  1OXX K;  1YIJ A;  1CKM A;  2A19 A;  2KHJ A;  4YCW A;  4A3I H;  1C7Y A;  1Q46 A;  2B63 G;  1K83 H;  4LNQ A;  4DAY B;  4OWW B;  1PV4 A;  1CKO A;  1PH2 A;  1X3G A;  1QVC A;  4RG1 A;  3U4V A;  3PIP A;  3F2D A;  2V1C C;  1U5K A;  1KQS A;  3S2D H;  1X9N A;  4YCU A;  1PYS B;  3F2B A;  1IBK Q;  3J81 i;  2XGT A;  1VQ7 A;  3RZO H;  1X54 A;  1L1O B;  4C2M H;  2JK8 A;  3J7Z C;  5GAD C;  2ZM6 L;  1J6Q A;  3K8A A;  3UE1 A;  3GTG H;  3TEH B;  2E5L L;  2ALY B;  2NVT H;  2N3S A;  1PH9 A;  4LWC A;  4XTC S;  4DV4 Q;  2FXQ A;  3K81 C;  4WJ4 A;  1VQK A;  1YVC A;  3ULJ A;  2UU9 Q;  3S14 H;  1VQE A;  1SRU A;  2NN6 G;  1IBM Q;  3S17 H;  3E9I A;  1QUQ B;  2LXJ A;  4OXP A;  4HJ9 A;  3M7N A;  5C0X G;  1VQC A;  4YHH Q;  2JA8 H;  4C3I H;  1N36 Q;  1XNR Q;  4GN4 B;  4GN3 B;  4JI3 Q;  3U50 C;  4JBM A;  1W3S A;  1Q86 C;  5IP7 H;  3HOV G;  1NE3 A;  1U0L A;  4A3K H;  3NBH B;  4O2D A;  5GAE C;  1OXV A;  1V9P A;  2I5L X;  3W1B A;  4GS3 A;  1B7Y B;  2LXK A;  3PGZ A;  1SN8 A;  1HZA A;  1K8G A;  3DM3 A;  4JC0 A;  5M3M G;  2KBN A;  2RCN A;  3UDX A;  3I2Z A;  2AKW B;  2A8V A;  4BXX H;  4JYA Q;  3OYY A;  4X65 Q;  1B8A A;  4B3T Q;  3KJO A;  3W5O A;  1IZ6 A;  3AEV A;  5BR8 L;  4LFB L;  3PV0 A;  4GLA C;  3TQY A;  1CSP A;  5J3B A;  2K52 A;  5IYC G;  1G29 1;  4JI4 L;  4A3G H;  2VUM G;  4EQ5 A;  4DV2 Q;  2JA6 H;  1V1Q A;  2K14 A;  2HQL A;  1LUZ A;  5IYB H;  3G4S A;  5FLM H;  4DV5 Q;  1VQO A;  5C4X H;  1Y1W H;  2UU9 L;  4A3B H;  1HZC A;  4DV1 Q;  4LF5 Q;  2UUC L;  4DAM A;  5IYD H;  5FJ8 G;  1Z9F A;  3NEL A;  3CF5 A;  4HJA A;  2OTL A;  3KDF B;  3CD6 A;  3HOZ G;  3EBE A;  3D0F A;  1K73 C;  2UXD Q;  4IFD G;  3S16 H;  3RR5 A;  2IY5 B;  1MJC A;  1K8A C;  3K7U C;  1NTG A;  3I4N G;  4X62 Q;  1X56 A;  1HNW L;  5M3F H;  2Z6K A;  3CQZ H;  5JJK A;  3CCJ A;  2JA9 A;  4JOI C;  1KAW A;  5C0X I;  3T1Y Q;  4DV7 Q;  1KL9 A;  2K5H A;  2UXC Q;  3UDI A;  3RNU A;  4UP7 A;  1PH6 A;  4LUV A;  4JV5 Q;  1VQG A;  1O7I A;  3L0O A;  5GAH C;  3NEM A;  2IHE A;  5M5Y H;  1N33 Q;  4L5T A;  4DNI A;  1XTD A;  5HY6 A;  1A63 A;  4HJ7 A;  2LSS A;  2R92 G;  3TS2 A;  1VQF A;  5IP9 H;  1A62 A;  2WB1 G;  4IPD A;  5GQO A;  3RLF A;  4LF8 Q;  4KHP Q;  4A76 A;  3A5Z B;  3MEF A;  2CQO A;  1WFQ A;  1VQ6 A;  3K7A H;  1I94 Q;  3I7F A;  3STB C;  5FLX c;  1NJI C;  2HHH Q;  4A3D H;  4DV1 L;  4JI2 Q;  2MFI A;  4LFA Q;  1PHJ A;  1PH1 A;  2RHS B;  1Z47 A;  5DLQ E;  4DR6 Q;  4GKJ L;  4YY3 L;  4A3J G;  3Q8D A;  2BH2 A;  4BBR G;  3G48 A;  3L2P A;  1FJG Q;  2K5N A;  3OW2 A;  1P8L A;  2BA1 A;  1D8L A;  1PA6 A;  2R6G A;  5C4J H;  4A3G G;  4IFD I;  1E1T A;  4TVA B;  1CKN B;  4A4I A;  4JV5 L;  1K0R A;  1EIF A;  2BA0 A;  4A3F G;  3WWV A;  2QGQ A;  1SMX A;  4APV A;  4GNX C;  4UPA A;  4GKK L;  2ZM6 Q;  2Q2H A;  4R1J A;  3F8T A;  4BBS H;  2E5L Q;  1N33 L;  3ERS X;  3RZD H;  3I4M G;  1QVG A;  3CME A;  2OQK A;  3CPF A;  4KHP L;  4A3L G;  1S40 A;  1YHA A;  1UEB A;  3AYH B;  3STB D;  1HH2 P;  4O0A A;  5M3F G;  1BKB A;  1JMC A;  2YTY A;  3GTO H;  3B6Y A;  2R7Z G;  3GO5 A;  1EYG A;  1LM0 A;  2I0Q A;  1XPR A;  2F4V L;  1EQQ A;  4UP9 A;  2YV5 A;  3G71 A;  4LF6 L;  2K4K A;  1L1O C;  1TWH H;  4X66 L;  3G6E A;  4DR6 L;  1IL2 A;  1UE1 A;  1PYB A;  1Y14 B;  2B29 A;  1FJG L;  4MNO A;  3HOU G;  5C3E H;  1Q12 A;  3I55 A;  4A93 H;  4JG2 A;  4X64 L;  1EOV A;  3GTP H;  4AH6 A;  3PF5 A;  2R93 H;  1JT8 A;  5IY0 A;  5GRO A;  1X65 A;  5BR8 Q;  4LFB Q;  4PMW A;  2EQS A;  5M5W H;  2N78 A;  2PNH A;  3J81 c;  3OTO L;  4JI4 Q;  1VQ9 A;  1YI2 A;  4DV6 Q;  1WJJ A;  1VQN A;  1Q1B A;  4MZ9 A;  1QZH A;  2OQ0 A;  2JEA I;  4JCV E;  3M85 A;  3IRB A;  2WFW A;  3H0G G;  2UUA L;  3CC4 A;  1XPU A;  2UUC Q;  4IPH A;  1GVP A;  4LF7 L;  5LMU Q;  1HZ9 A;  2IHF A;  1K9M C;  2QEX A;  2JE6 I;  3PUY A;  1VQ5 A;  3TRZ A;  1PH7 A;  1HNZ L;  4B3M L;  2Q2I A;  4DR1 L;  4JI6 L;  4A3C H;  3I56 A;  1MIU A;  4POG A;  3PO2 G;  1HNW Q;  2KHI A;  2WB1 E;  4TQU S;  1SFO H;  1PFS A;  1FGU A;  2ZTD A;  3GTM H;  1YZ6 A;  3PUV A;  4R4T A;  3ER0 A;  1CSQ A;  2VQF L;  2CFM A;  5EAY A;  1MKH A;  3TRE A;  1H95 A;  2KCM A;  2ZJQ A;  3FKI H;  3BZK A;  2JA5 H;  2GVA A;  2JQO A;  1N8R C;  3I4O A;  1VQA A;  3H3V H;  3GTL H;  5ELN A;  4DPG A;  1VCI A;  3GD7 A;  1N9W A;  4BA1 I;  4BY1 G;  4DV6 L;  4LUO A;  4OWT B;  4P74 A;  4P71 A;  1XMQ Q;  3CCE A;  3F2C A;  4C3H H;  2MO1 A;  1GD7 A;  4LUZ A;  4DR2 Q;  4A3I G;  1G51 A;  1LYL A;  4OON A;  4JI0 L;  1TWF H;  4XIG S;  5LMU L;  2K50 A;  1IBL L;  3ULP A;  2B3G A;  4L5S A;  4GKJ Q;  4DUY L;  1HNX L;  1VQ8 A;  4YY3 Q;  5C0X J;  3CCQ A;  2OTJ A;  4IJL A;  2OCE A;  4R4O A;  3KF6 A;  3JAM i;  2JA7 H;  4BY7 H;  4IPC A;  1P16 A;  1SE8 A;  2Y0S G;  2ZTC A;  4DR5 Q;  5AJ3 L;  2DGY A;  4A3M H;  1KHI A;  1E1O A;  3L7Z C;  4H02 A;  3UE0 A;  2ASB A;  4GOP A;  4QY7 A;  1VQL A;  2CWA A;  1V43 A;  4OX9 L;  3HOW H;  1BVS A;  5C44 H;  4HIM A;  4HJ8 A;  5M5X H;  1AE2 A;  3BU2 A;  2PQA A;  3ULL A;  2MNA A;  3HOY H;  3J80 i;  2RHQ B;  1KC8 C;  4QIW E;  4GKK Q;  1PH4 A;  2VY3 A;  4JI7 Q;  4A75 A;  1E7Z A;  1G6P A;  2VZA A;  2CWP A;  2D62 A;  2JA8 G;  1WYD A;  1HJP A;  1N34 L;  4DR3 L;  3S1N H;  3HOX H;  1XMQ L;  3GTK H;  2IX0 A;  3S2H H;  1VQJ A;  5IP7 G;  4A3K G;  1VQ4 A;  2F4V Q;  4DR2 L;  1NMG A;  3RLN A;  1YHQ A;  4LF6 Q;  1PH8 A;  1R9T H;  3GTJ H;  4X66 Q;  3S15 H;  2VS1 A;  2QA4 A;  1OXS C;  4MTN A;  5K36 G;  4BXX G;  3FKI G;  1IXR A;  4IFD J;  3CAM A;  3KOJ A;  1B70 B;  1S3O A;  3PCO B;  3H15 A;  3M4P A;  4DR5 L;  2B63 H;  4X64 Q;  3PO3 H;  2H5X A;  4IO9 A;  1QZG A;  1PH5 A;  1UE5 A;  1OTC A;  1EFW A;  2HIV A;  4AIM A;  2JEB I;  4JI1 L;  2ZTE A;  4LFC Q;  4DR7 Q;  4B3R Q;  1L1O A;  1A8V A;  4QGU A;  4QL5 A;  5LMN Q;  2JA6 G;  4LF9 L;  5IYB G;  5FLM G;  1Y1W G;  5C4X G;  3OTO Q;  4A3B G;  4PZ8 A;  4GN5 A;  4NXN L;  3CCU A;  5IYD G;  4JI7 L;  1EUJ A;  4OO1 I;  4DV0 L;  1SLJ A;  1QUQ A;  3CCM A;  1I3Q H;  1ASZ A;  2UUA Q;  3PIO A;  3PUW A;  1TWG H;  3DLL A;  2PI2 E;  1KRS A;  4R4I A;  4QQB X;  4LF7 Q;  1YHB A;  2RF4 A;  2YU9 H;  4QJF A;  2YYZ A;  1KD1 C;  2R7D A;  1I50 H;  3VDY A;  5ELO A;  1HNZ Q;  4P75 A;  4DR1 Q;  4B3M Q;  1YIT A;  4JI6 Q;  3BJU A;  1DGS A;  1ASY A;  2I5H A;  4DUZ L;  3D31 A;  3S24 A;  3HOV H;  1WCM H;  3BZC A;  5IWA L;  3KFU A;  1YBY A;  3EIV A;  1J5E L;  1RIP A;  1K3R A;  2Q2U A;  1WOC A;  4IJH A;  3ICE A;  2F3I A;  3M4Q A;  4IPG A;  5M3M H;  2VQF Q;  3S1M H;  4HIO A;  5IP9 G;  1MJE A;  1AH9 A;  4R4Q A;  1X6O A;  3KLW A;  1KRT A;  4JI5 L;  3FHW A;  4LFC L;  3A5U A;  3FP9 A;  4NXM L;  2IX1 A;  4DK3 C;  1KIX A;  4NPS A;  5LMN L;  3RLO A;  3CCL A;  1VS0 A;  4K0K L;  1PH3 A;  4C3J H;  3CC7 A;  1S72 A;  1XMO L;  2HIX A;  2WAQ G;  5H1S E;  4A3D G;  1YNX A;  3CW2 C;  3NEN A;  3H3V I;  2Y0S E;  2VUM H;  3CMA A;  2KCT A;  5LMN W;  5JJI A;  1EIY B;  3S1R H;  4B3S L;  4HIK A;  4Y7N H;  1NBW A;  3HKZ G;  3KDF A;  2VQE L;  2CCZ A;  1I5F A;  2D0O A;  2I5M X;  3AFP A;  5FJ8 H;  4JI0 Q;  3PO3 G;  3HOZ H;  1HR0 L;  1IBL Q;  3PF4 A;  2VW9 A;  1BBU A;  2OWO A;  4DUY Q;  1HNX Q;  2Q2T A;  4PZ6 A;  1WI5 A;  4RMF A;  1Q8K A;  4P73 A;  3I4N H;  3KYH C;  3CXC A;  2L15 A;  5AJ3 Q;  2PI2 A;  3AFQ A;  1HR0 W;  3M9B A;  4OWX B;  3T1H L;  2N8N A;  4LW1 A;  4UY8 C;  1VQI A;  2AWN A;  3A0J A;  1XNQ L;  4BBS G;  4OX9 Q;  3UDG A;  1LTL A;  3AQQ A;  2R7F A;  1QVF A;  3KF8 B;  1YEZ A;  1C9O A;  2E2J H;  2K5V A;  1GO3 E;  4NB3 A;  4GLX A;  4DR7 L;  4B3R L;  1SR3 A;  3GDE A;  2YTX A;  4ALP A;  2Z0S A;  3CP0 A;  2R92 H;  4JOI A;  3K80 C;  1Q7Y C;  4Y52 H;  2EIF A;  5IE8 A;  1T9H A;  3MXN B;  3U58 A;  4L5Q A;  1Q81 C;  1N34 Q;  4DR3 Q;  4IOA A;  3F1Z A;  4DR4 L;  1L2F A;  1I6H H;  2UXB L;  4FDB A;  3CCV A;  1GKH A;  2E8G A;  1GM5 A;  1N32 Q;  1WCM G;  1Q1E A;  1YJW A;  5C3E G;  3CC2 A;  4A93 G;  1CUK A;  3CCR A;  1KXL A;  4AYB G;  2BH8 A;  1XJV A;  1E22 A;  1SRO A;  4LF4 Q;  4A3J H;  1JJ2 A;  2R93 G;  4YWK A;  4BBR H;  4AQY Q;  1M1K C;  1E24 A;  1Y1V H;  4KHZ A;  3JAM c;  2F52 A;  4A3E H;  1IBK L;  1CKN A;  4JBJ A;  4WJ3 M;  1X55 A;  4OO1 G;  5IT9 c;  2NVQ H;  1RL2 A;  4JI1 Q;  2XTI A;  1TWC H;  4DV4 L;  4LF9 Q;  1PVO A;  4A3F H;  3PUZ A;  2PMZ E;  3J80 c;  2D0P A;  1UE6 A;  2K75 A;  3HFZ B;  1UE7 A;  4GLV B;  2AMC B;  4BA2 I;  1OXU A;  4NXN Q;  1IBM L;  1JJG A;  4P72 A;  3I4M H;  4DV0 Q;  4YHH L;  1IYJ B;  2CKZ B;  2N49 A;  2ATW A;  1N36 L;  4DV3 Q;  1XNR L;  3J81 j;  4JI3 L;  4A3L H;  4A3C G;  3CPW A;  1W2B A;  1N32 L;  1FVI A;  4GNX A;  2NN6 I;  3J7A 5;  5JEA G;  2R7Z H;  4PG3 A;  2MQH A;  3M4O H;  3JC6 6;  4L5R C;  2UUB Q;  1HZB A;  3EN2 A;  2ID0 A;  5E7N A;  4JBW A;  2WAQ E;  2E2H H;  4YWM A;  4DUZ Q;  4LF4 L;  2JA5 G;  1X3F A;  5IWA Q;  4X65 L;  4AQY L;  3KJP A;  4JYA L;  2GVB A;  4B3T L;  3HOU H;  1J5E Q;  3E9H A;  3LGJ A;  1C0A A;  1TXY A;  1VQH A;  2NVY H;  3HKZ E;  3UDF A;  2JJQ A;  3S1Q H;  2KEN A;  3E0E A;  4JI5 Q;  1NY4 A;  4UP8 A;  4YCV A;  4NXM Q;  2VNU D;  2VL6 A;  4DV2 L;  3RN5 A;  4K0K Q;  5GAG C;  2DUD A;  3HKS A;  2Z6K C;  1JE5 A;  4PZ7 A;  4HJ5 A;  4JI8 Q;  2NVX H;  4DV5 L;  4DKA C;  4KI0 A;  1XMO Q;  5JJL A;  1FL0 A;  2AWO A;  4GOP C;  1XPO A;  4LF5 L;  1TWA H;  2MO0 A;  3M3Y H;  1M90 C;  4X6A H;  2EXD A;  2E2I H;  3U4Z A;  1VQB A;  3ZJY C;  4EX5 A;  1EQR A;  2UXD L;  2YTV A;  2GN5 A;  1VQP A;  4B3S Q;  4DV3 L;  1Q82 C;  3W1G A;  2VQE Q;  3H0G H;  2JA7 G;  4BY7 G;  4X62 L;  1Y1V G;  3CCS A;  2AHO B;  1YJ9 A;  3PUX A;  4A3E G;  2IT1 A;  4YWL A;  1HR0 Q;  4JBK A;  4A3M G;  3TS0 A;  2ZJP A;  3KF6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...