3MXNB

Crystal structure of the rmi core complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
131
structure length
131
Chain Sequence
LPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and cellular roles of the RMI core complex from the bloom syndrome dissolvasome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords RecQ-mediated genome instability protein 1
total genus 31
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16100 RMI2 RecQ-mediated genome instability protein 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3mxnB00
1PH9A 1N33L 2OTJA 3CXCA 2F52A 2VZAA 1QVFA 1Q86C 2NN6G 1RL2A 2NZOA 1HH2P 1MJEA 2K14A 4NXML 1R9TH 2JEAI 4YHHQ 1FJGL 2JA8G 4DR7Q 2K52A 2Y0SG 3RNUA 1YHBA 2IT1A 5IP9H 3KFUA 1H95A 4KHZA 1WOCA 4R4CA 2JA6G 1HNWQ 2ID0A 4B3MQ 1S40A 4DV0L 1ASZA 1Y14B 4A3IH 2FXQA 1PH8A 5ELNA 1X65A 2HIXA 3I7FA 3L2PA 1I3QH 4LUZA 3GTGH 5JJIA 2B63H 2R6GA 4K0KQ 5C44G 2JA8H 1CKNB 3D31A 4YCUA 1S72A 5FJ8G 2OWOA 2KBNA 2ZM6L 4C3HH 3ULPA 2JA9A 1L1OB 2KENA 3J81i 1MJCA 1I50H 3FKIG 4JOIC 2E2HH 2YU9H 2HIVA 4NXMQ 4NB3A 3RN2A 4A3EH 1EIYB 2HHHL 1VQJA 4B3RQ 4A3BG 5GAHC 2UXCQ 2VNUD 3E0EA 3RN5A 1FL0A 2WAQG 4DAMA 1EQQA 4B3SQ 3K80C 4HJ7A 4LFCL 2MNAA 3GTOH 1XTDA 1VQAA 1YHQA 5H1SE 1WCMG 3KF8B 5BR8L 3G6EA 1KC8C 3HOWH 1CUKA 3S2DH 4P72A 1UEBA 4WJ4A 1JT8A 3OYYA 4JI1Q 3I4MG 1L2FA 1QVCA 3PF5A 1S3OA 1I5FA 4DR2Q 1MKHA 2F4VQ 4UP9A 2OQKA 4JI8L 3JAMi 2LXKA 3BZCA 1YVCA 3CCEA 1HR0W 5GAGC 4IFDI 4L5QA 2IX1A 1XMOQ 1YEZA 3UDGA 3GTJH 1L1OC 2VUMH 2ZTEA 1NMGA 1N9WA 4GLVB 1SR3A 4EX5A 1P16A 2EIFA 4B3RL 1Y1VH 3M3YH 1VQOA 3MEFA 4YY3L 1SFOH 1C9OA 1LYLA 4LF5L 5IP7G 1XPUA 4GN3B 3CAMA 2VS1A 4X65L 3H15A 1QZGA 4LF7L 2D0OA 1Q12A 4HJ5A 4NPSA 3GD7A 5FJ8H 3PCOB 2E5LL 5LMUQ 1Y1VG 1XNRL 2Z6KC 1E1TA 1V9PA 5IE8A 3T1HL 4BA2I 3RZDH 1YJNA 1SE8A 3CCJA 3PIPA 2F4VL 3WWVA 1NBWA 1E3PA 1VQHA 2JA5H 2VQFL 4P75A 2YTVA 4DUYQ 3MXNB 5C4XH 4A3MH 2IHEA 3S1RH 1IYJB 5AJ3Q 5IYBH 5IP9G 1I94Q 2WB1G 3K0XA 1SN8A 2NZHA 3NELA 3ULLA 3PUWA 4HJ9A 1V43A 3S16H 2JK8A 4PMWA 4A4IA 4DR4Q 1D7QA 3HOZG 5C44H 3CPWA 3I4MH 4DV1L 4BXXH 4JOIA 1NE3A 1VQ7A 2B63G 1GKHA 2GN5A 2ZJQA 2CWAA 1HNWL 2ZTDA 1Q8KA 4AYBG 3AEVA 4JBMA 4IPCA 3RZOH 4QIWE 4R4IA 2Q2IA 2H5XA 1J6QA 1TWGH 4DV7Q 1XNQQ 3ICEA 2D0PA 3TEHB 1XMQL 4KHPL 3F2CA 4DUZQ 4GKKL 2Y0SE 3HKZG 4LWCA 4K0KL 3FHWA 4C2MH 5IYCG 4APVA 3UDIA 3OTOQ 1KXLA 1HZAA 3SGIA 3I56A 1E22A 1CKNA 1PH4A 4PZ6A 3RR5A 1HJPA 4H02A 3U58A 2UUCL 1E7ZA 3M4QA 4LUVA 5LMNQ 4BY7G 3HOVH 1KL9A 2UUAL 3T1YQ 4JBKA 3K7AH 1OXTA 3K81C 1XMQQ 1JB7A 1EFWA 1K8AC 4KHPQ 3A5ZB 1OXXK 4LUOA 4DV3L 4A3JH 4DV3Q 3M7NA 1TWFH 4YHHL 1FJGQ 2UUBL 4DR7L 1EIFA 4MNOA 2VW9A 4P71A 1QVGA 4LNQA 3UDXA 4J15A 4OX9L 1X3EA 5M5WH 2ZJPA 2VQEL 1X54A 1Q82C 1PHJA 1N33Q 1K0RA 1BKBA 2KHIA 1KHIA 3AFQA 5IWAL 5IT9c 3HOVG 1PYBA 1JE5A 3STBD 1PH7A 3CCQA 3HOXH 2UU9Q 4JI3Q 4FDBA 1JJGA 4YCVA 4DUZL 1Z9FA 3CC2A 3KDFB 4JI4L 3F1ZA 5AJ3L 3NENA 2LXJA 1XNQL 3DM3A 2E8GA 1EUJA 5M5XH 1C0AA 4ME3A 3G48A 2PI2E 1VQGA 2GVAA 2LSSA 4O0AA 1HR0L 2K50A 4DR3Q 1IBML 1QUQB 2HQLA 4R4OA 4JI2Q 1FVIA 1TWHH 4JV5Q 1X56A 2NN6I 1NMFA 4BXXG 3PV0A 1VS0A 5HGQA 3T1HQ 1HZBA 3ERSX 3H3VI 4JBJA 5HY6A 1CKOA 2D62A 4A3LG 2C35B 4EQ5A 1KRTA 4LF4L 1FGUA 1Z47A 1YZ6A 4X65Q 3GTQH 2E2JH 1WCMH 2PQAA 1XPOA 1VQCA 3AQQA 1TXYA 4LFAL 1AH9A 3RLNA 2K75A 5C4XG 1Q46A 4HIOA 1KRSA 5E7NA 2JA5G 2PNHA 1N8RC 2MO1A 1VQBA 3H0GG 4X64Q 5M3FG 1K73C 4TVAB 5LMNW 2YYZA 5C0XJ 1SLJA 1KD1C 2ZTCA 1AE2A 3HKZE 2NVYH 2RCNA 3HFZB 5DLQE 3CCUA 3RLOA 1DGSA 2WFWA 5JEAG 4A3DH 2Q2HA 1OXUA 3U4ZA 2AWOA 1U5KA 5GROA 4DV4Q 4JI7Q 4A3FH 4IOAA 4RG1A 4A3EG 4LF5Q 3HKSA 4NXNL 2IHFA 3PUZA 2IY5B 2VL6A 4DR5L 2RHSB 3S2HH 2OCEA 1W2BA 2B3GA 1PH6A 1K9MC 5M3MH 5FLXc 2UXCL 1WJJA 3GO5A 3GDEA 1AE3A 4IJHA 1X3FA 4O2DA 4R4QA 5EAYA 3G4SA 4GOPC 5C4JH 1MIUA 1K83H 4JI2L 4OX9Q 4DR6L 2UXDQ 4JI8Q 1NTGA 3CF5A 3J80c 1JMCA 4A3GH 3HOYH 3U50C 4ALPA 4IOCA 4A3LH 2N49A 1K3RA 1E24A 3J7A5 5BR8Q 2Q2UA 4OXPA 2CKZB 2UUCQ 4JI0Q 2N8NA 1V1QA 4GOPA 2AHOB 4UPAA 4AIMA 1VQ9A 1RIPA 2UU9L 4QGUA 3CCSA 4A3CH 1J5EQ 3EN2A 3I4NG 1WFQA 2QEXA 3GTMH 3S14H 4UP7A 2RHQB 1TWAH 4AQYQ 1PH2A 2B29A 3H3VH 3W5OA 1M90C 2JA6H 3W1GA 2R92G 2OQ0A 3KJOA 5IYDH 1A0IA 4LF9Q 2CFMA 4IFDG 2Z0SA 4GOPB 1G291 3T1YL 2UUAQ 5C0XI 2AKWB 4LF6Q 4GNXC 5LMNL 1T9HA 4Y52H 4JI5Q 4KI0A 1A63A 3I4NH 1VQNA 2MO0A 1ASYA 3CMEA 4POGA 4LFBQ 5K36G 4JI5L 5IYBG 2WP8J 3J80i 3K8AA 4PZ8A 4BY1G 4A75A 4IPDA 1N32L 2VQFQ 4DUYL 4IFDJ 1YJWA 4P74A 1B8AA 3PGZA 4AQYL 4HIMA 3PO2H 5ELOA 4DR6Q 1UE5A 4AYBE 1UWVA 5M3MG 2ASBA 3BU2A 1VQ4A 2Z6KA 3L0OA 4DK3C 4A3GG 1EOVA 1PVOA 3K7UC 3CCVA 4A93H 4XIGS 4OO1I 3KF6B 1D8LA 1IBLQ 1K8GA 2E5LQ 4DV5L 2NVQH 1PFSA 4IO9A 4LF7Q 3LGJA 3PSIA 4PG3A 2KCMA 4GNXB 3E9IA 2I5LX 3KOJA 4B3TQ 4JC0A 1HNZQ 2KCTA 3PUYA 4DV4L 1VQLA 4OWWB 4PZ7A 4GKJQ 4YWMA 4A3CG 4R1JA 2MFIA 1YIJA 2K4KA 1O7IA 1B7YB 1VCIA 1X55A 2GVBA 4A3FG 4BBSG 3GTPH 4JI6L 4QJFA 3GTKH 3S1QH 1L0WA 2UXDL 2V1CC 3TREA 1WYDA 2YTYA 1VQPA 2PQAB 5GQOA 1W3SA 3EIVA 1GD7A 4JI6Q 3M4OH 2UXBQ 3U4VA 1IBKQ 5JJKA 4DKAC 2A1AA 3JAMc 4LFAQ 5C3EG 2AWNA 2CWPA 3J7ZC 4HIKA 2R93G 1I6HH 1U0LA 3PUXA 2RF4A 4X66L 4HIDA 3CD6A 2WAQE 1PV4A 3FKIH 1A62A 2CCZA 2YTXA 4X62L 1X9NA 2DGYA 2JQOA 2R7ZH 4DV5Q 3OW2A 4LFCQ 1IBKL 1VQ8A 2N78A 3TRZA 3J81c 5J3BA 2K5HA 2JA7G 3EBEA 1N34L 3I2ZA 4TQUS 2HHHQ 4X64L 1Q1BA 3RLFA 4IPGA 5FLMH 1IBMQ 3KDFA 1BBWA 1SROA 4DR2L 3UE0A 4QQBX 2F3IA 1HR0Q 1EYGA 4QY7A 3M9BA 1OTCA 1YBYA 1PYSB 2IX0A 2VUMG 2QGQA 3PO2G 4BBRG 1HZ9A 1Y1WH 2I5MX 1IBLL 4JI3L 3TS2A 2A19A 4GNXA 3A5UA 4LFBL 4BA1I 4LW1A 1N36Q 3KYHC 4DV0Q 3M4PA 4LF6L 1P8LA 4JYAL 2YV5A 4OWTB 3UDFA 1PA6A 4A3BH 3KF6A 4RMFA 1X6OA 1YITA 3KJPA 4A3KH 5M5YH 2UUBQ 1N32Q 4BY1H 1SRUA 2DUDA 1VQKA 4IJLA 2NVXH 2BH2A 1B70B 2XGTA 4Y7NH 2PI2A 2WB1E 1CSPA 3NEMA 4JBWA 4UY8C 4YWLA 3TQYA 3UE1A 4IPHA 3E9HA 4BY7H 3OTOL 4DNIA 4JI0L 1CSQA 3BJUA 4A93G 1CKMA 2ALYB 4A3IG 2BA1A 4B3ML 2R92H 3HOUG 1YJ9A 1XPRA 3M85A 4LF9L 1Q81C 3FP9A 1HNXQ 1SMXA 1WI5A 3VDYA 1IL2A 2VY3A 1NY4A 4MTNA 3DLLA 4YWKA 4HJ8A 1YI2A 3G71A 1HNXL 3L7ZC 4P73A 1JJ2A 4OWXB 2Q2TA 1OXSC 4UP8A 4A3KG 3S17H 1J5EL 1VQDA 3HOYG 2ZJRA 2KHJA 3I55A 4DV2L 2JJQA 5FLMG 3HOZH 2ES2A 4DR5Q 3PO3H 2K5NA 1UE1A 5GADC 4WJ3M 4GKKQ 3CC4A 4X6AH 3F2BA 1I94L 1XJVA 5JEAJ 2CQOA 4DR1L 1VQFA 4L5TA 1E1OA 4GLXA 4NXNQ 4XTCS 3D0FA 4DV7L 1Y1WG 1QZHA 4JI7L 3PIOA 3S1MH 2A8VA 4KLKA 1NJIC 2EQSA 1VQEA 2E2IH 3CPFA 4MZ9A 4DK6C 5GAEC 4A3MG 2R7DA 4C3IH 1C7YA 4JYAQ 4DV1Q 3KLWA 1HZCA 3ULJA 1PH1A 1N36L 4DR4L 4JG2A 1N34Q 1UE6A 4AH6A 1XNRQ 3F8TA 2AMCB 3ZJYC 1VQIA 4L5SA 1EQRA 3CC7A 2JA7H 3CP0A 4X62Q 4POFA 3PUVA 4LF8L 4DV6L 2XTIA 1PH3A 1KQSA 3PF4A 1OXVA 1X3GA 4DV6Q 1VQMA 2QA4A 3BZKA 1YHAA 3CCMA 3CCLA 1GVPA 4LF4Q 1GO3E 2JEBI 3H0GH 4JCVE 5M3FH 3B6YA 3CW2C 4OONA 3ER0A 3F2DA 2UXBL 1EWIA 3CQZH 2L15A 1Q7YC 2R93H 2I0QA 4BBSH 4BBRH 4A3DG 1LUZA 1VQ5A 1JJCB 3W1BA 3TS0A 2JE6I 3STBC 4JV5L 2PMZE 5LMUL 3IRBA 1G51A 1Q1EA 4QL5A 2BH8A 5C3EH 1A8VA 2R7FA 4GN5A 4GS3A 4YCWA 1PH5A 2NVTH 3S1NH 4JI1L 4HJAA 4X66Q 4R4TA 2N3SA 4YY3Q 1GM5A 4DR1Q 4LF8Q 1VQ6A 1UE7A 2OTLA 1G6PA 1BVSA 1YNXA 3A74A 3Q8DA 4A3JG 4DAYB 4A76A 2ATWA 1KAWA 1XMOL 3S15H 2R7ZG 3I4OA 2EXDA 5IWAQ 3S24A 3AYHB 1L1OA 1TWCH 2I5HA 2VQEQ 4GLAC 1M1KC 5IP7H 5IYDG 3JC66 4DR3L 1LM0A 1BBUA 3AFPA 3NBHB 4GN4B 3GTLH 2ZM6Q 3HOWG 4GKJL 2BA0A 5JJLA 1HNZL 4B3TL 3HOXG 1IZ6A 1QUQA 4JI4Q 5IY0A 4DPGA 2MQHA 3CMAA 3CCRA 3A0JA 2HT1A 3HOUH 4L5RC 5C0XG 4B3SL 2K5VA 5IYCH 4DV2Q 1IXRA 4C3JH 1LTLA 3PO3G 1KIXA 3J81j 4OO1G
chains in the Genus database with same CATH superfamily
4U673 1TS3A 1STHA 4ZKCB 1QVFA 5EGTA 2NZOA 2JEAI 4G7ZC 2Y0SG 1LTBD 1YHBA 2IT1A 4KHZA 1WOCA 1PFMA 3GTKB 4DNTB 4A3IH 2FXQA 1UAPA 3L2PA 3I7FA 2E2HB 4LUZA 2NN6H 1FGBD 5C44G 3NBHA 1LTAD 1Q8IA 2TSSA 1WTWA 3ULPA 1K28A 2DNEA 1UUPA 3NSWA 2J4XA 1VQJA 2VNUD 3OWFA 4DAMA 4WJWA 2F3WA 3SHLA 4B3SQ 3K80C 2NWGA 1TU2B 1I4PA 3G6EA 1KC8C 3S2DH 4P72A 3J80E 1UEBA 4WJ4A 4MIUA 3OYYA 4JI1Q 1SNOA 2KEDA 4NP5A 2F4VQ 4JI8L 2OQKA 1G6ZA 2PZWA 2LXKA 3CCEA 1SYEA 2X69A 4L5QA 5CYUA 1XMOQ 3GTJH 1L1OC 4GLVB 1P16A 3IAYA 4OHJA 4RGOS 1TY0A 2WV6D 1C9OA 2A73B 5IP7G 4GN3B 4LF7L 2Q8IB 5FJ8H 3H0GB 5LMUQ 1Y1VG 2EYHA 4JK1C 3A8IE 1CA6A 1YJNA 4KV6A 2PQEA 1SE8A 3PIPA 2RSNA 5ELCA 1E3PA 4PNYA 1CHPD 3IFTA 1A3UA 4DUYQ 1STGA 2IHEA 3S1RH 2VXWA 5IP9G 5M5XB 2A6HD 5D65A 1B4OA 3ULLA 3PUWA 4HJ9A 4QMGA 5C5LA 2JK8A 2DJGC 4DR4Q 3PO3B 3CPWA 3I4MH 1O7LA 4JOIA 4BXXH 2GN5A 1Q8KA 2JYOA 4X3TA 4IPCA 3ICEA 1TS2A 1WCMB 4DUZQ 2KCNA 4GKKL 4C2MH 3SGIA 4A3EB 2UUCL 5LMNQ 2HQEA 3DEPA 3CHBD 3R3OA 2UUAL 3T1YQ 1JB7A 3K81C 3CKIB 3A5ZB 1OXXK 4L8JA 1WVLA 1TWFH 4DR7L 2UUBL 4MNOA 3GV6A 3KLSA 3RZDB 5M5WH 1N33Q 1X54A 2B2YC 1BKBA 3AFQA 3K7AB 1JE5A 2UU9Q 1YNNC 1SNPA 3A7AB 3IL8A 1V1PA 5M9OA 1D5XC 4B9XA 1Z9FA 3V05A 2BCOA 2LXJA 1B9MA 3G48A 5CV9A 2LSSA 2EE1A 1BUVT 1ONLA 1SFOB 2HQLA 4C3IB 3WOFA 1GOZA 1TWCB 3PV0A 3TN2A 1U9RA 1HZBA 3H3VI 3L9AX 3SXHA 4LF4L 1FGUA 4XQQA 1Z47A 1PRTD 1YZ6A 3QJYA 1EY4A 3NWSA 1WCMH 2PQAA 3M7GA 5E7NA 2JA5G 2PNHA 2F0DA 1PRTC 3EROA 1SLJA 2EYMA 1SYFA 2F3VA 1KD1C 3HFZB 2XSCA 3HKZE 3FDTA 1DGSA 3HKZB 4YIJA 1R9TB 1DZ1A 3MXPA 2A6ED 4DV4Q 1HUNA 4KTAA 2WB1B 2O5IC 5ELBA 1NAPA 2RHSB 4IQZA 1W2BA 2B3GA 3S15B 4ID6A 5M3MH 5EAYA 4LMQD 1HA6A 1X3FA 3HZXA 3OOCA 4FF2A 1PTOB 1SE3A 3T16A 1Y8OB 3OWEB 1JMCA 3NXWA 2RA4A 1UNSA 5LL6X 4KJNA 2L0CA 4BWGB 2EZVA 2N49A 1L0XB 2Q2UA 4OXPA 3I90A 2XN9C 4E6IA 1HHVA 1V1QA 4GOPA 4UPAA 2UU9L 4AIMA 1RIPA 4K5WA 2BOSA 3HEJA 5CBEE 4FF4A 1AN8A 3MHBA 1DOMA 1MSGA 4IUNA 2B29A 3H3VH 1M90C 4LF9Q 2LY7A 2CFMA 4RHSA 2Z0SA 4GOPB 1G291 1KABA 3T1YL 2UUAQ 2AKWB 3A8KE 4GNXC 5LMNL 1T9HA 1TIID 4KI0A 4QUFA 2B2TA 3Q24A 4QB4A 4HEDA 1SYGA 4RAUC 2WP8J 4J1MA 5IT9E 1O80A 4PZ8A 1DXMA 5IGDA 3NP8A 1PYWD 4IPDA 2VQFQ 4IFDJ 3DM1A 3PGZA 3DUZA 5ELOA 2RCFA 4DR6Q 2CW0D 1VQ4A 2Z6KA 3L0OA 3CCVA 1D8LA 2PW7A 4DV5L 1GUSA 4XQJA 2F0QA 3GTMB 1EYDA 4HCSA 5T1IA 1HNZQ 2KCTA 4PZ7A 3OSOA 4YWMA 4A3CG 4KK7A 2MFIA 2RKSA 5C3WA 2V1CC 1B9NA 3TREA 1WYDA 2YTYA 1ILQA 3U4VA 2H4OA 4DKAC 2R93G 5KNCA 2NVXB 2AUJD 2AWNA 5JPNC 4X66L 4CJ1B 5A35A 3OW2A 2E76C 2N78A 4RFBA 3TRZA 1B3QA 3EBEA 4UDUC 3RUZA 2HHHQ 5E1FA 1Q1BA 5FLXL 1AEXA 5FLMH 3KDFA 1BBWA 1SROA 2AUKA 1PFBA 1HR0Q 1BO0A 1V1PB 1S4ZA 2WACA 1WTOA 2QGQA 3PO2G 3CU7A 1BCPD 1NCVA 2O2LD 1IBLL 3EFXD 4BA1I 3E0JA 4HTHA 3KYHC 2M00A 2V4DA 3M4PA 5C4ZA 3MFGA 4V0BA 1TY2A 4OWTB 4A3BH 1EY8A 1G2SA 3KJPA 4A3KH 1KLGD 1Q3LA 3T53B 4BY1H 1N32Q 4IJLA 1YNJC 1WTRA 3C1EA 1B70B 4Y7NH 5IGGA 4JBWA 2E75C 5D3IB 4K5XA 3OTOL 3NQTA 1ESFA 1CKMA 4BBSB 2SNSA 4PMCA 3GTQB 1WI5A 4O42A 4MTNA 2JA6B 1EYAA 1ET6A 3S1RB 3L7ZC 1OXSC 4UP8A 2H1EA 3P7JA 1HFGA 4N8FA 1J5EL 2F03A 1HRJA 2ZJRA 2KHJA 2JJQA 4QIWB 4DR5Q 3PO3H 1UE1A 4X6AH 1BR9A 4ZCKA 2MP1A 2CQOA 1Z6HA 2BE5D 4NXNQ 3R93A 2DY8A 5CV8A 4JI7L 2A8VA 4KLKA 5FO7B 2EYOA 1GXDC 3I70A 1QB5D 3F2UA 5GAEC 2B63B 1STEA 1TWHB 3KLWA 1HZCA 4DV1Q 3BVMA 1PH1A 3LWUA 2D2CC 2EJGC 4JG2A 5EKLA 3VA7A 1UE6A 4K6DA 3CC7A 2K01A 3CP0A 1D6EC 2N55A 4POFA 4LF8L 4N9TA 3Q0AA 3PF4A 3JAML 3DHQA 1F2ZA 5JJZA 1VQMA 5C6AA 3E3XA 4R8IA 1OO9B 2K33A 5M3FH 1PTOF 4OONA 3ER0A 1XX8A 2UXBL 2I0QA 2R92B 1LUZA 4JV5L 2JE6I 3M4OB 3H3VC 5IOCA 1S5BD 3GTGB 1A3VA 4QL5A 2IX3A 3V2TA 1A8VA 1PH5A 2NVTH 1RJTA 4G4KA 4A3BB 4R4TA 2Z4IA 2JXMB 3VR4A 3A74A 4DAYB 1TS4A 3MTSA 2R7ZG 3SVMA 1L1OA 4Y7NB 1D1IA 1TWCH 3NK9A 4CHTB 2VQEQ 3M4YA 4ZYSA 5ISRA 3HOYB 4A3GB 3GTLH 3HOWG 5JJLA 2ZM6Q 2BA0A 4PQXA 4DPGA 3CMAA 3A0JA 1BOSA 1STAA 4C2MB 5C0XG 3NTKA 4RWSC 1IXRA 1LTLA 1KIXA 4B3RL 5ELDA 2OTJA 4CDEC 3CXCA 4EGVA 2K05A 2VZAA 3S2DB 5C4XB 2NN6G 1K0SA 1HH2P 4K14A 4NXML 1FJGL 2JA8G 1TWFB 2Y0SB 1HNWQ 2EY1A 1EU3A 4A3KB 1Y14B 3I72A 1ZEQX 5ELNA 1X65A 4BY7B 2R6GA 5IT9L 2RSOA 3J7AV 2X6LA 1CKNB 3KBGA 1X32A 3D31A 2KOLA 2KBNA 2ZM6L 4C3HH 3J81i 2A5HA 1I50H 2F0GA 1LT3D 3FKIG 2E2HH 5FOBB 3J7YW 4NXMQ 4DAYA 1O7YA 2HHHL 3HOVB 4B3RQ 1EL0A 3EJIA 1ILPA 3CQZB 3GTOH 1XTDA 1VQAA 1YNND 5H1SE 5BR8L 1YHQA 2EYLA 1CUKA 2WKDA 4XT3B 3QB3A 3VYRA 3HOUB 1L2FA 4KY7A 1XTCD 4MTKA 1S3OA 1I5FA 2NBFA 1MKHA 1PLFA 1SNQA 1PZKD 3R8BA 5GAGC 3BG3A 2IX1A 4A3DB 1YEZA 3GP7A 2K28A 2ZTEA 1N9WA 1VF7A 1SR3A 2EIFA 1Y1VH 1A2TA 1FR3A 2RBMA 1LYLA 4IUVA 1AFPA 4X65L 1CFMA 1Q12A 3DMUA 4NPSA 4HJ5A 2QEJC 3PCOB 5DNFA 1ESRA 1O7ZA 1E1TA 5IE8A 1BCPB 4BA2I 4F8MA 3SE0A 2F0WA 1VQHA 4H13C 2VQFL 5AFWA 4K8JA 3EQLC 1IYJB 2QDBA 1CTMA 1PZID 1SN8A 3DXJC 3RZOB 1CZGA 2NZHA 3NELA 1H9RA 1V43A 3S16H 1DM0B 1D7QA 3HOZG 4DV1L 1FNWA 4A3MB 1VQ7A 4C1NI 2ZJQA 2XVSA 3SEBA 4QIWE 2H5XA 2HUGA 5JOBA 1IYUA 4OELB 1XMQL 2E2IB 2RDFA 4B08A 1AP0A 5A2QL 4K0KL 5EPJA 5IYCG 2AQ2B 3H91A 4EQPA 4FF1A 2A6HC 2EOTA 3OTOQ 1KXLA 1HZAA 3BYTB 5HURA 3I56A 1PH4A 4H02A 2QCPX 3M4QA 2QF7A 3K7AH 4A3JH 4DV3Q 1EEFD 3C2PA 4YHHL 2XRQD 4P71A 4K6LA 3UDXA 5A2QE 4J15A 5ELFA 2ZJPA 2IWHA 5LHY1 1Q82C 1K0RA 2KHIA 5IWAL 5IT9c 1PYBA 3CCQA 4NKLA 1EFID 3MZ5A 1JOKA 1B53A 2ZXOA 2F4IA 3KDFB 5AJ3L 1XNQL 2E8GA 4ME3A 1HR0L 2K50A 4DR3Q 4R4OA 1H9MA 5M3MB 4JI2Q 1FVIA 4EVOA 5ELEA 1VS0A 5HGQA 1XWEA 3ERSX 1Y69U 4JBJA 5HY6A 1CKOA 3VYUA 1HTPA 3TP6A 1KRTA 1E2WA 2L55A 3FRPB 2XWJB 2Z8LA 1JOOA 1V1OA 1XPOA 1ET9A 5JEAH 1SJHD 1Q46A 3VYTA 2K5DA 3H0GG 4DK0A 4TVAB 1KLUD 2YYZA 1W6JA 3Q23A 1X3QA 5JEAG 4O1NA 4WFN3 3U4ZA 1RTOA 3S1NB 4RG1A 4A3EG 4LF5Q 2IY5B 3MWYW 4HSVA 3S2HH 3J80L 2UXCL 3GDEA 5C4JH 1MIUA 1K83H 4DR6L 1NTGA 5M5YB 4ALPA 4IOCA 1ENAA 3NHHA 3K0YA 2CH4W 2L4NA 1LT5D 3J7A5 5I9PA 1DCZA 1ML0D 1H9SB 2UUCQ 4JI0Q 3SK5A 3CCSA 4A3CH 5I4DA 3I4NG 1WFQA 4KN7C 2QEXA 2F0LA 3GTMH 3S14H 4BS9A 1HQRD 1R4QB 5CV4A 1LV9A 4ZAIA 1ICWA 3W1GA 3BZDB 4OGQC 2TMPA 2R92G 2OQ0A 3KJOA 1A0IA 2EYJA 4EQOA 2KECA 2FMCA 2EPBA 5C0XI 2F0MA 5DM63 4Y52H 3IKJA 1EY9A 4LFBQ 3CMEA 4POGA 3G7LA 3URYA 4FF3A 5TSSA 1STYA 4A75A 1DONA 2CH4A 4DUYL 3DWAA 3PO2H 4XYQA 2ASBA 1EZ6A 1CA5A 1EQVA 4KKUA 4DK3C 3OPOA 1JORA 3HP3A 1PVOA 4MN3A 4A93H 4XIGS 4CKEA 1WTVA 2NVQH 2WINB 4FP5D 3OMGA 4IO9A 2ZXPA 2G9DA 4LF7Q 2ICIA 4KJOA 4PG3A 4ABNA 1LO5D 2I5LX 1R4PB 4DV4L 3PUYA 4OWWB 4GKJQ 1K8OA 4ZRZA 2K4KA 5IGEA 4A3FB 1B7YB 3PQIA 4A3FG 4JI6L 3A54A 4JI6Q 2PQAB 5GQOA 1W3SA 2G5DA 2QILA 1K83B 3X3MA 3M4OH 1IBKQ 5C3EB 5C3EG 1EIHA 3QO2A 4ULLA 1IKLA 5EPKA 4HIDA 3ERQA 1AZQA 2ZT9C 1PV4A 2YTXA 1DOLA 4X62L 2DGYA 1GUOA 2ENBA 5CV7A 3MEHA 1IBKL 2PZUA 1VQ8A 4DFAA 4IALA 2K5HA 4RKBA 2K04A 2B2YA 1J9OA 1U4LA 4QQBX 3UE0A 1EIGA 2F3IA 3M9BA 3EA6A 1RHPA 2CHBD 2IX0A 4M8AA 2K7VA 3X3NA 5KEEA 3SDZA 4BBRG 2X6GA 3TP8A 5I6YA 4LFBL 3A5UA 1IL8A 3K58A 1PA6A 1RCVD 4RMFA 1YITA 2UUBQ 1SRUA 1SNCA 1VQKA 1TWGB 2NVXH 2EJMA 1JE4A 2WB1E 3UE1A 3NBIA 4BY7H 4F88A 4JI0L 1CSQA 2JP1A 3GQBA 4B3ML 4KD4A 2F0PA 5CR3A 3VDYA 1IL2A 4R9WA 3LX0A 1NY4A 5DAUA 4YWKA 1YI2A 2L11A 4P73A 1JJ2A 4OWXB 5HGTA 2Q2TA 5J39A 1CQFA 2F0HA 1PFNA 4V190 1VQDA 4TSSA 1I6VC 5C0XH 3FPPA 2ES2A 4WJ3M 3S1QB 4GKKQ 1EZ8A 3S9WA 2PCFB 3I4LA 3F2BA 4DR1L 1A2UA 4GLXA 4G7OC 3D0FA 1QZHA 3S1MH 4RCOA 3PIOA 3AB9A 4NMZA 3HG9A 1VQEA 4QF4A 1KDCA 2E2IH 1I6HB 1NR4A 3BVGA 4XT1B 1VMCA 4DR4L 2WAQB 4CJ2C 4OL7A 1N34Q 5KIXA 1KNEA 2B8FA 1I4HA 1SMYC 1VQIA 1JC7A 5KRUA 2DN8A 1F2LA 3O13A 3SR1A 2RQXA 1OXVA 4I65A 1FNUA 3CCMA 1GO3E 2JEBI 5IGBA 3CW2C 3F2DA 1I4QA 1EEID 2F0OA 4WORA 4HMJA 5LMUL 3IRBA 1I3QB 2Z4HA 2R7FA 4GS3A 3S1NH 4JI1L 2KEEA 2XNAC 1GM5A 1VQ6A 1QE6A 1YNXA 3Q8DA 4A3JG 4A76A 1ZYRC 1KAWA 1XMOL 3S15H 3I4OA 5IWAQ 1G2TA 1TQOA 4NDXA 4H7BA 2I5HA 4GLAC 5IP7H 3W3AA 3FEWX 4DR3L 4M1UB 1BBUA 4DXFA 4GKJL 2F0UA 3HOXG 2MQHA 4FXGC 2OEOA 3SK6A 5D3DA 1J8IA 2FHTA 4B3SL 1I4XA 3I3CA 1T5EA 2FMMA 4DV2Q 2DJFC 4ZKBB 4OO1G 2NTTA 1HPCA 1JWUD 3MXGA 1Q86C 1MJEA 4FO2A 2K14A 2OF1A 4YHHQ 2K52A 3RNUA 3MC0B 4ZLTF 3KFUA 4R4CA 2ID0A 4K2LA 4DV0L 1ASZA 5JPMC 1I4RA 1PH8A 2YU9B 5JJIA 2B2VC 1I3QH 2B2WC 4ODGA 1WTQA 4K0KQ 4Q0FA 2JA8H 2A6EC 4YCUA 1S72A 1GUGA 2B2UA 1JQYD 2JA9A 1L1OB 1MJCA 1Y8NB 2HIVA 1IKMA 1GUNA 4A3EH 1EIYB 3A7LA 2WKCA 5GAHC 4ILWA 1EQQA 2MNAA 1QNKA 5K36G 3HOWH 1C48A 1WCMG 3KF8B 1SXTA 5CMDA 1HA5A 1JT8A 1F77A 2L12A 1JR0D 3PF5A 2NZ1D 1STBA 1WD1A 4DR2Q 4UP9A 5D14A 3KLRA 3BZCA 1YVCA 1HR0W 5DEHA 4GZYC 2RVLA 3QG1A 1NMGA 4X3KA 4EX5A 3QOLA 1IW7C 4J6HA 3K5LA 1VQOA 1RTNA 4YY3L 1SFOH 3VR5A 4IUPA 4LF5L 1S5ED 2KUMA 4A3IB 2D0OA 3GD7A 2E5LL 2K5WA 5M3FB 1XNRL 2Z6KC 1V9PA 3T1HL 4RGMA 3RZDH 4DF7A 3D4DA 2E2JB 1NBWA 4C3IG 3VYSA 2JA5H 2YTVA 3P1HA 3MXNB 5F2DA 4A3MH 1SBBB 3D3RA 1I94Q 2WB1G 4CKCA 2DNCA 3D4RA 1Y1WB 3GTPB 3KUPA 2OT2A 4A4IA 4B9WA 5C44H 1GHKA 2A68C 1NE3A 1GKHA 4RGNA 1GHJA 1HNWL 5BN4A 2ZTDA 4X3SA 2LMCB 2KVMA 4JBMA 3RZOH 2JA8B 1PTOD 3QIAA 1J6QA 2Q2IA 5DM73 1TWGH 4DV7Q 1XNQQ 4KHPL 3F2CA 1D2BA 1BQQT 1AZPA 2B39A 4IUTA 1FD7D 3P20A 1VF5C 3FHWA 4APVA 3HOUG 4PZ6A 1E7ZA 4LUVA 3GV3A 3DEOA 1KL9A 2F0SA 4XYOA 4JBKA 1OXTA 4KKTA 3Q22A 4KHPQ 4LUOA 2K03A 4DV3L 1FJGQ 1EIFA 1KDBA 1MD2D 2VW9A 3R2TA 4LNQA 1K3BC 1TR5A 1X3EA 2SOBA 5K5PA 2VQEL 1VMPA 4RH6A 3STBD 1PH7A 1LTGD 3HOXH 3GTJB 4FDBA 3S16B 4YCVA 3L3OC 3K5OA 3F1ZA 3NENA 2K32A 3DM3A 1C0AA 5M5XH 4TRDA 3TSSA 5KNDA 4HR7B 1IBML 1QUQB 2PNRC 1QILA 4JV5Q 1X56A 2EY2A 1NMFA 2NN6I 3MXUA 4BXXG 5I9OA 3T1HQ 1KNAA 2IL8A 4C56C 4A3LG 2C35B 1LABA 2Z1CA 3GTLB 1TT2A 1MBYA 2E2JH 4I7AA 2GA4B 3RLNA 2K75A 1KRSA 2PPBC 2MO1A 5C0XJ 3VR3A 4RCNA 2HD3A 5DLQE 2NVYH 3CCUA 4A3DH 1EY5A 2WFWA 2J7ZA 1OXUA 3A56A 4UHVA 1U5KA 2M2LA 3I73A 5LL6S 3FVQA 4JI7Q 4IOAA 4C1NK 2B2UC 2E74C 4NXNL 2IHFA 3PUZA 4EQNA 3DWPA 3MAQA 4DR5L 5J1ZA 1K9MC 1WTXA 1WJJA 2B2WA 3GO5A 2UXDQ 2B2VA 4GOPC 4OX9Q 4QUCA 3NTHA 3CF5A 5CV6A 4FXDA 3J80c 3C46A 4A3GH 5EBCA 3PO2B 3S14B 1BNZA 3I8ZA 1Z7TA 2B8GA 5FO9B 1E24A 5BR8Q 2ZXRA 4LJZC 2LKVA 2N8NA 2AHOB 1VQ9A 3H6MA 4QGUA 3J81E 1J5EQ 1LLRD 3BYYB 3EN2A 1F9PA 3I4NB 2A74C 2RHQB 4DNRB 1CHQD 2NTSA 4CDCC 4K5VA 4RHRA 1IW7D 3W5OA 1O78A 5IYDH 1LT4D 1PTOC 2L5TA 1H9SA 1Y8PB 5KYIA 3D6WA 1A63A 4HAEA 4CDDC 2MO0A 1ASYA 4JI5L 1SMYD 2EVBA 4KHVA 3PMFA 4IUUA 1Y1VB 3J80i 3M3YB 1V8QA 1F2MA 1N32L 2F0TA 1YJWA 1B8AA 4AQYL 4HIMA 1MI2A 2CQAA 1GUTA 2HCCA 1AW7A 1EY6A 3BU2A 4A3GG 1RODA 1EOVA 3K7UC 2PO4A 3K57A 2NVYB 3KF6B 1H9JA 1IBLQ 4HCEA 4OO1I 1WTPA 1IYVA 3A55A 3HRZC 3G6JB 4XQNA 3LGJA 3PSIA 5J22A 4GNXB 3KOJA 2AQ3B 1VQLA 5NUCA 4UAIA 1TKWB 3H09A 1MHWC 4A93B 5EQ0A 3A8JE 1II3A 1O7IA 1VCIA 1X55A 4OIKA 4AYBB 4BBSG 4QJFA 3PIP3 3GTKH 1L0WA 3HS0C 4QCLA 1VQPA 3EIVA 1GD7A 1B50A 5JJKA 4LFAQ 3J7ZC 4HIKA 1PXUA 2RF4A 4DAPA 5E4XA 2WAQE 2EY5A 2Z9HA 1S5FD 2C5CA 4DV5Q 4LFCQ 4J8QA 3J81c 5J3BA 2JA7G 1N34L 4RKLA 1QOHA 3D4WA 4TQUS 4X64L 3BS1A 4IPGA 1DJRD 1EY7A 5I2XA 4DR2L 1EYGA 4QY7A 1OTCA 1YBYA 1PYSB 1RKNA 2VUMG 4DGZA 2MGSA 2F0FA 4CJ0B 4ZQ3A 3R2IA 4CKBA 4G57A 1BBXC 3TS2A 1E0BA 2I5MX 4JI3L 1QG7A 4IUQA 4OO1H 1B2TA 1WTHA 3ND8A 5EKIA 5CGKA 1X6OA 5M5YH 2DUDA 2BH2A 2XGTA 5FK9C 3P75A 2PI2A 4UY8C 4YWLA 3TQYA 4IPHA 3E9HA 2E2DC 4DNIA 5CC4A 5BN5A 3BJUA 2R92H 1YJ9A 1XPRA 3M85A 4LF9L 1Q81C 1EQTA 3FP9A 3PIO3 3BVZA 3NWTA 2VY3A 3K6OA 2Z6BA 4HJ8A 3DLLA 3G71A 4C3JG 4C3JB 4A3KG 3S1MB 4XXEA 4Q5VA 1JOQA 3HOYG 2NYZD 1Q90A 1RD9D 3I55A 4DV2L 3ZYYX 5FLMG 2FINB 5C44B 5GADC 3CC4A 5JEAJ 3U9OA 3MVVA 3OIQA 1PDQA 2F0NA 2EJFC 2EQSA 5C3XA 1HQMC 4A3MG 4C3IH 1C7YA 3S2HB 2QW7A 3ULJA 3KK7A 1C8CA 4LAAA 3T13A 1JICA 5IIFA 1ZKOA 2AMCB 4L5SA 1EQRA 5L37A 4X62Q 3PUVA 4DV6L 2XTIA 1LACA 4OIJA 2F0KA 1X3GA 5G3LD 4WRDA 4DV6Q 2QA4A 2EYFA 2O4XA 4LF4Q 5CORA 3H0GH 2R61A 4H0LC 3WOEA 5M5WB 3CQZH 2L15A 3AU7A 1DD2A 2R93H 4BBSH 4BBRH 2B2TC 4A3DG 2NUCA 3N6RA 4IURA 1JJCB 5IGFA 3TS0A 1VQ5A 2O5JC 2KQ3A 3Q6SA 1STNA 1Q1EA 1YNJD 3T51B 3E6ZX 2BH8A 3QOJA 5C3EH 4YCWA 3JAME 4HJAA 4X66Q 2IW3A 3J81L 1G6PA 1BVSA 1LTID 2HDMA 4BY1B 2ATWA 1SNDA 3S24A 2JSOA 3LNNA 3I91A 4PV1C 1M1KC 3JC66 1TVXA 3C3LA 4C3HG 1LM0A 1B1ZA 4GN4B 1HNZL 2A68D 5IY0A 1SJED 2KHSA 3CCRA 1L0YB 5I6WA 3HOUH 2K5QA 4L5RC 2EY6A 2K5VA 4C3JH 3PO3G 1B3AA 2OXPA 5JAVA 1PH9A 1N33L 2F52A 1MGSA 1RL2A 2RDGA 1R9TH 4DR7Q 4S3SA 3QR8A 1RDPD 5IP9H 1H95A 4H44C 2JA6G 1WD0A 4B3MQ 4RA8A 1S40A 2R93B 3NQIA 5KGUA 1KTKA 1F9RA 3LWEA 2HIXA 3GTGH 5CBAE 2B63H 1QWYA 2CVRA 5FJ8G 2MUYA 2OWOA 3TP7A 1C4QA 2KENA 4HN7A 4JOIC 2YU9H 4NB3A 3RN2A 3VR2A 4A3BG 4KY6A 2UXCQ 3E0EA 3RN5A 1FL0A 2WAQG 4OEMB 4HJ7A 4LFCL 4A3JB 1U4MA 1JWMD 4NW2A 3KLSX 3I4MG 1QVCA 3TMEA 1DYQA 2PYKA 1M4VA 1NUCA 3ITPA 5FLXE 1QNUA 3OIPA 4KN4C 3JAMi 4IFDI 4TKOB 2SDFA 5I2YA 3UDGA 2VUMH 2EXZA 1LT6D 4F87A 3M3YH 3MEFA 1XPUA 2VB2X 3CAMA 3CRLC 2VS1A 3H15A 1QZGA 3NTIA 2JA5B 2IJ0A 4RGTA 5EKKA 1BF4A 4CGYB 1DOKA 3CCJA 4HMIA 2F4VL 1SE2A 3ONAB 3WWVA 2WIIB 4P75A 3NE5B 3HOWB 5C4XH 3QWNA 5AJ3Q 5IYBH 1CQVA 3EVQA 3K0XA 5KYLA 4DN4M 2Q8RE 4FYDA 1A3TA 3E5SA 4KKSA 4PMWA 1U4PA 2B63G 1SYCA 5JVH3 1EU4A 2CWAA 1KDAA 1NSNS 4AYBG 3AEVA 2PZTA 4R4IA 2A69D 1K8MA 2D0PA 2EDGA 3H94A 3TEHB 1D1KA 2Y0SE 3HKZG 4LWCA 5FKAC 2KA7A 1SSOA 3UDIA 2OTLA 1SAPA 1E22A 1CKNA 1SE4A 3RR5A 1HJPA 1M8AA 1NR2A 3U58A 4BY7G 5C4JB 3HOVH 1EFWA 1XMQQ 1PZJD 1K8AC 3VR6A 3GTOB 3M7NA 4DAVA 1CK1A 1QVGA 4OX9L 2F1MA 1EWCA 1SYBA 1PHJA 1KHIA 3HOVG 2FFKB 2RDHA 1SYDA 4JI3Q 2VUMB 5COYA 1JJGA 4DK1A 4DUZL 2HCIA 3CC2A 4JI4L 1EUJA 3D8GA 4IFDH 4N8X1 2PI2E 2I46A 1VQGA 2GVAA 2KJXA 4O0AA 3T56B 5IODA 1G91A 3DWQA 1TWHH 3BDCA 1PTOH 2EYPA 4HSPA 1EY0A 4FXKC 2LFNA 4LK1C 3C1FA 2D62A 4FNFA 4EQ5A 4X65Q 4L63B 3GTQH 4P2CB 1VQCA 1TWAB 3AQQA 1TXYA 4LFAL 1AH9A 1JWSD 1KAAA 1MSHA 4HIOA 5C4XG 1T5XD 4CBVA 2F0JA 2SEBD 5CV5A 1NNXA 1N8RC 5EPLA 1VQBA 5M3FG 4X64Q 1K73C 5E3FA 5LMNW 1W6KA 4DA2A 2ZTCA 5T1GA 1AE2A 1F9SA 2L1BA 2RCNA 5G3LF 3RLOA 2Q2HA 2AWOA 5GROA 1FYCA 4A3FH 3KBXA 1BCPF 1A15A 4JW0A 3HKSA 4G7HC 2I07B 2VL6A 3TZDA 2OCEA 1PH6A 5EJWA 5FLXc 1AE3A 4IJHA 4O2DA 4R4QA 3G4SA 3N52A 4JI2L 4MHEA 1HXYD 4JI8Q 2F0EA 3HOYH 3U50C 4A3LH 2ICEC 4FVMA 1K3RA 2CKZB 3K59A 1BXTA 2K1BA 4L6TB 2KCCA 3OMCA 4UP7A 1TWAH 4AQYQ 1PH2A 2NVTB 3MFYA 2MJ8A 3AMUA 2JA6H 4IFDG 1F9QA 1JB3A 3TP5A 4LF6Q 1XXGA 4JI5Q 1ICFB 1SDFA 3I4NH 1VQNA 1ENFA 2XRSD 1H9KA 5IYBG 2XWBB 4BY1G 3K8AA 3CRKC 4IZ8A 3VA5A 4P74A 4K2KA 1HTLD 4R8NA 1GJXA 4X3UA 1UE5A 4AYBE 1UWVA 5M3MG 3UI2A 1X3PA 2JN4A 1A6XA 3HOXB 1K8GA 2E5LQ 3K5MA 4Z9CB 1PFSA 3W2DA 4PMBA 1E2VA 3MA2B 1F2YA 1UEAB 2KCMA 3E9IA 1LTTD 4B3TQ 4JC0A 4JVZA 4R1JA 1SNMA 2R3ZA 1YIJA 4N9PA 3NPPA 2GVBA 3HGBA 3GTPH 1HUMA 3S17B 3S1QH 2HDLA 2UXDL 4ME5A 4KY5A 2G9HD 2UXBQ 2A1AA 3JAMc 2CWPA 1I6HH 1U0LA 3PUXA 3CD6A 3FKIH 1A62A 2CCZA 1X9NA 1I50B 1S5CD 2JQOA 2R7ZH 1IHZA 4ZUIA 3I2ZA 4I7ZC 2JA7B 3ND9A 1SEBD 5IGCA 3FMCA 2M9VA 3RLFA 1B44D 2XIWA 1IBMQ 2DY7A 3D6CA 4ZK9B 1BCPC 4U68A 5E4WC 3IFDA 2AQ1B 3FPUB 2LS01 3V96A 1HZ9A 1Y1WH 2A19A 4GNXA 4LW1A 1N36Q 3I4MB 4DV0Q 4LF6L 1P8LA 4JYAL 2YV5A 3UDFA 3KF6A 1ZYRD 3TBIB 1D5MC 2BE5C 4DU9A 2NB0A 1CSPA 3NEMA 1ENCA 4CDFC 5JVG3 2C9OA 5FO8B 3K5NA 4A93G 2ALYB 4A3IG 2BA1A 1EOTA 1HNXQ 1SMXA 2NVQB 2R7ZB 1HCZA 2F0IA 2QKIC 1HNXL 2VB3X 3S17H 2FJ2A 1JCKB 3NUCA 2F0VA 2BDNA 2MHVA 1ZXTA 4K8IA 4KD3A 5C4HA 3HOZH 1GUWA 3MXNA 2K5NA 5EBDA 4F7XA 1I94L 1XJVA 4IN3A 1EWHA 1PRTB 1E1OA 1VQFA 2IPKD 4L5TA 2L9HA 2SNMA 4XTCS 4DV7L 1Y1WG 5C5MA 1NJIC 3FKIB 3T4AC 1I4GA 3CPFA 4MZ9A 4DK6C 1LTSD 2R7DA 4JYAQ 2D5DA 1LTRD 1N36L 3OW7A 2K6AA 4AH6A 1XNRQ 2MPMA 3F8TA 3ZJYC 1HFNA 1BDOA 1U4RA 2JA7H 3BDOA 3SK4A 5BN3A 3BDLA 3WDNA 1PH3A 1KQSA 2N88A 1S5DD 2A69C 1CM9A 3BZKA 1YHAA 2BDOA 3OHXC 3CCLA 1GVPA 4JCVE 3B6YA 1EWIA 1Q7YC 3SK8A 5K36H 3W1BA 1TS5A 1CI3M 1RF2D 3STBC 1XYIA 2PMZE 1G51A 2Q8TA 3TDQA 1CT1D 1QJOA 2P5ZX 3KF8A 1PRTF 4GN5A 3J7AF 1D5ZC 2QDLA 3TZUA 2N3SA 4YY3Q 4DXGA 4DR1Q 4LF8Q 5KNBA 1UE7A 4BBRB 3U9SA 1EYCA 1G8ZD 2PW5A 2J0TD 3RD4A 2EXDA 3AYHB 4ZUJA 5IYDG 4C3HB 4KMUC 3AFPA 3NBHB 1PMRA 1VDZA 4B3TL 1QCBD 1IZ6A 1QUQA 4JI4Q 1CZWA 4XDXA 4JPBW 2HT1A 2D9UA 3RMHA 1E2ZA 1FNVA 2CW0C 5IYCH 2PMZB 3HOZB 3J81j
chains in the Genus database with same CATH topology
1PH9A 1N33L 2OTJA 3CXCA 2F52A 2VZAA 1QVFA 1Q86C 2NN6G 1RL2A 2NZOA 1HH2P 1MJEA 2K14A 4NXML 1R9TH 2JEAI 4YHHQ 1FJGL 2JA8G 4DR7Q 2K52A 2Y0SG 3RNUA 1YHBA 2IT1A 5IP9H 3KFUA 1H95A 4KHZA 1WOCA 4R4CA 2JA6G 1HNWQ 2ID0A 4B3MQ 1S40A 4DV0L 1ASZA 1Y14B 4A3IH 2FXQA 1PH8A 5ELNA 1X65A 2HIXA 3I7FA 3L2PA 1I3QH 4LUZA 3GTGH 5JJIA 2B63H 2R6GA 4K0KQ 5C44G 2JA8H 1CKNB 3D31A 4YCUA 1S72A 5FJ8G 2OWOA 2KBNA 2ZM6L 4C3HH 3ULPA 2JA9A 1L1OB 2KENA 3J81i 1MJCA 1I50H 3FKIG 4JOIC 2E2HH 2YU9H 2HIVA 4NXMQ 4NB3A 3RN2A 4A3EH 1EIYB 2HHHL 1VQJA 4B3RQ 4A3BG 5GAHC 2UXCQ 2VNUD 3E0EA 3RN5A 1FL0A 2WAQG 4DAMA 1EQQA 4B3SQ 3K80C 4HJ7A 4LFCL 2MNAA 3GTOH 1XTDA 1VQAA 1YHQA 5H1SE 1WCMG 3KF8B 5BR8L 3G6EA 1KC8C 3HOWH 1CUKA 3S2DH 4P72A 1UEBA 4WJ4A 1JT8A 3OYYA 4JI1Q 3I4MG 1L2FA 1QVCA 3PF5A 1S3OA 1I5FA 4DR2Q 1MKHA 2F4VQ 4UP9A 2OQKA 4JI8L 3JAMi 2LXKA 3BZCA 1YVCA 3CCEA 1HR0W 5GAGC 4IFDI 4L5QA 2IX1A 1XMOQ 1YEZA 3UDGA 3GTJH 1L1OC 2VUMH 2ZTEA 1NMGA 1N9WA 4GLVB 1SR3A 4EX5A 1P16A 2EIFA 4B3RL 1Y1VH 3M3YH 1VQOA 3MEFA 4YY3L 1SFOH 1C9OA 1LYLA 4LF5L 5IP7G 1XPUA 4GN3B 3CAMA 2VS1A 4X65L 3H15A 1QZGA 4LF7L 2D0OA 1Q12A 4HJ5A 4NPSA 3GD7A 5FJ8H 3PCOB 2E5LL 5LMUQ 1Y1VG 1XNRL 2Z6KC 1E1TA 1V9PA 5IE8A 3T1HL 4BA2I 3RZDH 1YJNA 1SE8A 3CCJA 3PIPA 2F4VL 3WWVA 1NBWA 1E3PA 1VQHA 2JA5H 2VQFL 4P75A 2YTVA 4DUYQ 3MXNB 5C4XH 4A3MH 2IHEA 3S1RH 1IYJB 5AJ3Q 5IYBH 5IP9G 1I94Q 2WB1G 3K0XA 1SN8A 2NZHA 3NELA 3ULLA 3PUWA 4HJ9A 1V43A 3S16H 2JK8A 4PMWA 4A4IA 4DR4Q 1D7QA 3HOZG 5C44H 3CPWA 3I4MH 4DV1L 4BXXH 4JOIA 1NE3A 1VQ7A 2B63G 1GKHA 2GN5A 2ZJQA 2CWAA 1HNWL 2ZTDA 1Q8KA 4AYBG 3AEVA 4JBMA 4IPCA 3RZOH 4QIWE 4R4IA 2Q2IA 2H5XA 1J6QA 1TWGH 4DV7Q 1XNQQ 3ICEA 2D0PA 3TEHB 1XMQL 4KHPL 3F2CA 4DUZQ 4GKKL 2Y0SE 3HKZG 4LWCA 4K0KL 3FHWA 4C2MH 5IYCG 4APVA 3UDIA 3OTOQ 1KXLA 1HZAA 3SGIA 3I56A 1E22A 1CKNA 1PH4A 4PZ6A 3RR5A 1HJPA 4H02A 3U58A 2UUCL 1E7ZA 3M4QA 4LUVA 5LMNQ 4BY7G 3HOVH 1KL9A 2UUAL 3T1YQ 4JBKA 3K7AH 1OXTA 3K81C 1XMQQ 1JB7A 1EFWA 1K8AC 4KHPQ 3A5ZB 1OXXK 4LUOA 4DV3L 4A3JH 4DV3Q 3M7NA 1TWFH 4YHHL 1FJGQ 2UUBL 4DR7L 1EIFA 4MNOA 2VW9A 4P71A 1QVGA 4LNQA 3UDXA 4J15A 4OX9L 1X3EA 5M5WH 2ZJPA 2VQEL 1X54A 1Q82C 1PHJA 1N33Q 1K0RA 1BKBA 2KHIA 1KHIA 3AFQA 5IWAL 5IT9c 3HOVG 1PYBA 1JE5A 3STBD 1PH7A 3CCQA 3HOXH 2UU9Q 4JI3Q 4FDBA 1JJGA 4YCVA 4DUZL 1Z9FA 3CC2A 3KDFB 4JI4L 3F1ZA 5AJ3L 3NENA 2LXJA 1XNQL 3DM3A 2E8GA 1EUJA 5M5XH 1C0AA 4ME3A 3G48A 2PI2E 1VQGA 2GVAA 2LSSA 4O0AA 1HR0L 2K50A 4DR3Q 1IBML 1QUQB 2HQLA 4R4OA 4JI2Q 1FVIA 1TWHH 4JV5Q 1X56A 2NN6I 1NMFA 4BXXG 3PV0A 1VS0A 5HGQA 3T1HQ 1HZBA 3ERSX 3H3VI 4JBJA 5HY6A 1CKOA 2D62A 4A3LG 2C35B 4EQ5A 1KRTA 4LF4L 1FGUA 1Z47A 1YZ6A 4X65Q 3GTQH 2E2JH 1WCMH 2PQAA 1XPOA 1VQCA 3AQQA 1TXYA 4LFAL 1AH9A 3RLNA 2K75A 5C4XG 1Q46A 4HIOA 1KRSA 5E7NA 2JA5G 2PNHA 1N8RC 2MO1A 1VQBA 3H0GG 4X64Q 5M3FG 1K73C 4TVAB 5LMNW 2YYZA 5C0XJ 1SLJA 1KD1C 2ZTCA 1AE2A 3HKZE 2NVYH 2RCNA 3HFZB 5DLQE 3CCUA 3RLOA 1DGSA 2WFWA 5JEAG 4A3DH 2Q2HA 1OXUA 3U4ZA 2AWOA 1U5KA 5GROA 4DV4Q 4JI7Q 4A3FH 4IOAA 4RG1A 4A3EG 4LF5Q 3HKSA 4NXNL 2IHFA 3PUZA 2IY5B 2VL6A 4DR5L 2RHSB 3S2HH 2OCEA 1W2BA 2B3GA 1PH6A 1K9MC 5M3MH 5FLXc 2UXCL 1WJJA 3GO5A 3GDEA 1AE3A 4IJHA 1X3FA 4O2DA 4R4QA 5EAYA 3G4SA 4GOPC 5C4JH 1MIUA 1K83H 4JI2L 4OX9Q 4DR6L 2UXDQ 4JI8Q 1NTGA 3CF5A 3J80c 1JMCA 4A3GH 3HOYH 3U50C 4ALPA 4IOCA 4A3LH 2N49A 1K3RA 1E24A 3J7A5 5BR8Q 2Q2UA 4OXPA 2CKZB 2UUCQ 4JI0Q 2N8NA 1V1QA 4GOPA 2AHOB 4UPAA 4AIMA 1VQ9A 1RIPA 2UU9L 4QGUA 3CCSA 4A3CH 1J5EQ 3EN2A 3I4NG 1WFQA 2QEXA 3GTMH 3S14H 4UP7A 2RHQB 1TWAH 4AQYQ 1PH2A 2B29A 3H3VH 3W5OA 1M90C 2JA6H 3W1GA 2R92G 2OQ0A 3KJOA 5IYDH 1A0IA 4LF9Q 2CFMA 4IFDG 2Z0SA 4GOPB 1G291 3T1YL 2UUAQ 5C0XI 2AKWB 4LF6Q 4GNXC 5LMNL 1T9HA 4Y52H 4JI5Q 4KI0A 1A63A 3I4NH 1VQNA 2MO0A 1ASYA 3CMEA 4POGA 4LFBQ 5K36G 4JI5L 5IYBG 2WP8J 3J80i 3K8AA 4PZ8A 4BY1G 4A75A 4IPDA 1N32L 2VQFQ 4DUYL 4IFDJ 1YJWA 4P74A 1B8AA 3PGZA 4AQYL 4HIMA 3PO2H 5ELOA 4DR6Q 1UE5A 4AYBE 1UWVA 5M3MG 2ASBA 3BU2A 1VQ4A 2Z6KA 3L0OA 4DK3C 4A3GG 1EOVA 1PVOA 3K7UC 3CCVA 4A93H 4XIGS 4OO1I 3KF6B 1D8LA 1IBLQ 1K8GA 2E5LQ 4DV5L 2NVQH 1PFSA 4IO9A 4LF7Q 3LGJA 3PSIA 4PG3A 2KCMA 4GNXB 3E9IA 2I5LX 3KOJA 4B3TQ 4JC0A 1HNZQ 2KCTA 3PUYA 4DV4L 1VQLA 4OWWB 4PZ7A 4GKJQ 4YWMA 4A3CG 4R1JA 2MFIA 1YIJA 2K4KA 1O7IA 1B7YB 1VCIA 1X55A 2GVBA 4A3FG 4BBSG 3GTPH 4JI6L 4QJFA 3GTKH 3S1QH 1L0WA 2UXDL 2V1CC 3TREA 1WYDA 2YTYA 1VQPA 2PQAB 5GQOA 1W3SA 3EIVA 1GD7A 4JI6Q 3M4OH 2UXBQ 3U4VA 1IBKQ 5JJKA 4DKAC 2A1AA 3JAMc 4LFAQ 5C3EG 2AWNA 2CWPA 3J7ZC 4HIKA 2R93G 1I6HH 1U0LA 3PUXA 2RF4A 4X66L 4HIDA 3CD6A 2WAQE 1PV4A 3FKIH 1A62A 2CCZA 2YTXA 4X62L 1X9NA 2DGYA 2JQOA 2R7ZH 4DV5Q 3OW2A 4LFCQ 1IBKL 1VQ8A 2N78A 3TRZA 3J81c 5J3BA 2K5HA 2JA7G 3EBEA 1N34L 3I2ZA 4TQUS 2HHHQ 4X64L 1Q1BA 3RLFA 4IPGA 5FLMH 1IBMQ 3KDFA 1BBWA 1SROA 4DR2L 3UE0A 4QQBX 2F3IA 1HR0Q 1EYGA 4QY7A 3M9BA 1OTCA 1YBYA 1PYSB 2IX0A 2VUMG 2QGQA 3PO2G 4BBRG 1HZ9A 1Y1WH 2I5MX 1IBLL 4JI3L 3TS2A 2A19A 4GNXA 3A5UA 4LFBL 4BA1I 4LW1A 1N36Q 3KYHC 4DV0Q 3M4PA 4LF6L 1P8LA 4JYAL 2YV5A 4OWTB 3UDFA 1PA6A 4A3BH 3KF6A 4RMFA 1X6OA 1YITA 3KJPA 4A3KH 5M5YH 2UUBQ 1N32Q 4BY1H 1SRUA 2DUDA 1VQKA 4IJLA 2NVXH 2BH2A 1B70B 2XGTA 4Y7NH 2PI2A 2WB1E 1CSPA 3NEMA 4JBWA 4UY8C 4YWLA 3TQYA 3UE1A 4IPHA 3E9HA 4BY7H 3OTOL 4DNIA 4JI0L 1CSQA 3BJUA 4A93G 1CKMA 2ALYB 4A3IG 2BA1A 4B3ML 2R92H 3HOUG 1YJ9A 1XPRA 3M85A 4LF9L 1Q81C 3FP9A 1HNXQ 1SMXA 1WI5A 3VDYA 1IL2A 2VY3A 1NY4A 4MTNA 3DLLA 4YWKA 4HJ8A 1YI2A 3G71A 1HNXL 3L7ZC 4P73A 1JJ2A 4OWXB 2Q2TA 1OXSC 4UP8A 4A3KG 3S17H 1J5EL 1VQDA 3HOYG 2ZJRA 2KHJA 3I55A 4DV2L 2JJQA 5FLMG 3HOZH 2ES2A 4DR5Q 3PO3H 2K5NA 1UE1A 5GADC 4WJ3M 4GKKQ 3CC4A 4X6AH 3F2BA 1I94L 1XJVA 5JEAJ 2CQOA 4DR1L 1VQFA 4L5TA 1E1OA 4GLXA 4NXNQ 4XTCS 3D0FA 4DV7L 1Y1WG 1QZHA 4JI7L 3PIOA 3S1MH 2A8VA 4KLKA 1NJIC 2EQSA 1VQEA 2E2IH 3CPFA 4MZ9A 4DK6C 5GAEC 4A3MG 2R7DA 4C3IH 1C7YA 4JYAQ 4DV1Q 3KLWA 1HZCA 3ULJA 1PH1A 1N36L 4DR4L 4JG2A 1N34Q 1UE6A 4AH6A 1XNRQ 3F8TA 2AMCB 3ZJYC 1VQIA 4L5SA 1EQRA 3CC7A 2JA7H 3CP0A 4X62Q 4POFA 3PUVA 4LF8L 4DV6L 2XTIA 1PH3A 1KQSA 3PF4A 1OXVA 1X3GA 4DV6Q 1VQMA 2QA4A 3BZKA 1YHAA 3CCMA 3CCLA 1GVPA 4LF4Q 1GO3E 2JEBI 3H0GH 4JCVE 5M3FH 3B6YA 3CW2C 4OONA 3ER0A 3F2DA 2UXBL 1EWIA 3CQZH 2L15A 1Q7YC 2R93H 2I0QA 4BBSH 4BBRH 4A3DG 1LUZA 1VQ5A 1JJCB 3W1BA 3TS0A 2JE6I 3STBC 4JV5L 2PMZE 5LMUL 3IRBA 1G51A 1Q1EA 4QL5A 2BH8A 5C3EH 1A8VA 2R7FA 4GN5A 4GS3A 4YCWA 1PH5A 2NVTH 3S1NH 4JI1L 4HJAA 4X66Q 4R4TA 2N3SA 4YY3Q 1GM5A 4DR1Q 4LF8Q 1VQ6A 1UE7A 2OTLA 1G6PA 1BVSA 1YNXA 3A74A 3Q8DA 4A3JG 4DAYB 4A76A 2ATWA 1KAWA 1XMOL 3S15H 2R7ZG 3I4OA 2EXDA 5IWAQ 3S24A 3AYHB 1L1OA 1TWCH 2I5HA 2VQEQ 4GLAC 1M1KC 5IP7H 5IYDG 3JC66 4DR3L 1LM0A 1BBUA 3AFPA 3NBHB 4GN4B 3GTLH 2ZM6Q 3HOWG 4GKJL 2BA0A 5JJLA 1HNZL 4B3TL 3HOXG 1IZ6A 1QUQA 4JI4Q 5IY0A 4DPGA 2MQHA 3CMAA 3CCRA 3A0JA 2HT1A 3HOUH 4L5RC 5C0XG 4B3SL 2K5VA 5IYCH 4DV2Q 1IXRA 4C3JH 1LTLA 3PO3G 1KIXA 3J81j 4OO1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH9 A;  1N33 L;  2OTJ A;  3CXC A;  2F52 A;  2VZA A;  1QVF A;  1Q86 C;  2NN6 G;  1RL2 A;  2NZO A;  1HH2 P;  1MJE A;  2K14 A;  4NXM L;  1R9T H;  2JEA I;  4YHH Q;  1FJG L;  2JA8 G;  4DR7 Q;  2K52 A;  2Y0S G;  3RNU A;  1YHB A;  2IT1 A;  5IP9 H;  3KFU A;  1H95 A;  4KHZ A;  1WOC A;  4R4C A;  2JA6 G;  1HNW Q;  2ID0 A;  4B3M Q;  1S40 A;  4DV0 L;  1ASZ A;  1Y14 B;  4A3I H;  2FXQ A;  1PH8 A;  5ELN A;  1X65 A;  2HIX A;  3I7F A;  3L2P A;  1I3Q H;  4LUZ A;  3GTG H;  5JJI A;  2B63 H;  2R6G A;  4K0K Q;  5C44 G;  2JA8 H;  1CKN B;  3D31 A;  4YCU A;  1S72 A;  5FJ8 G;  2OWO A;  2KBN A;  2ZM6 L;  4C3H H;  3ULP A;  2JA9 A;  1L1O B;  2KEN A;  3J81 i;  1MJC A;  1I50 H;  3FKI G;  4JOI C;  2E2H H;  2YU9 H;  2HIV A;  4NXM Q;  4NB3 A;  3RN2 A;  4A3E H;  1EIY B;  2HHH L;  1VQJ A;  4B3R Q;  4A3B G;  5GAH C;  2UXC Q;  2VNU D;  3E0E A;  3RN5 A;  1FL0 A;  2WAQ G;  4DAM A;  1EQQ A;  4B3S Q;  3K80 C;  4HJ7 A;  4LFC L;  2MNA A;  3GTO H;  1XTD A;  1VQA A;  1YHQ A;  5H1S E;  1WCM G;  3KF8 B;  5BR8 L;  3G6E A;  1KC8 C;  3HOW H;  1CUK A;  3S2D H;  4P72 A;  1UEB A;  4WJ4 A;  1JT8 A;  3OYY A;  4JI1 Q;  3I4M G;  1L2F A;  1QVC A;  3PF5 A;  1S3O A;  1I5F A;  4DR2 Q;  1MKH A;  2F4V Q;  4UP9 A;  2OQK A;  4JI8 L;  3JAM i;  2LXK A;  3BZC A;  1YVC A;  3CCE A;  1HR0 W;  5GAG C;  4IFD I;  4L5Q A;  2IX1 A;  1XMO Q;  1YEZ A;  3UDG A;  3GTJ H;  1L1O C;  2VUM H;  2ZTE A;  1NMG A;  1N9W A;  4GLV B;  1SR3 A;  4EX5 A;  1P16 A;  2EIF A;  4B3R L;  1Y1V H;  3M3Y H;  1VQO A;  3MEF A;  4YY3 L;  1SFO H;  1C9O A;  1LYL A;  4LF5 L;  5IP7 G;  1XPU A;  4GN3 B;  3CAM A;  2VS1 A;  4X65 L;  3H15 A;  1QZG A;  4LF7 L;  2D0O A;  1Q12 A;  4HJ5 A;  4NPS A;  3GD7 A;  5FJ8 H;  3PCO B;  2E5L L;  5LMU Q;  1Y1V G;  1XNR L;  2Z6K C;  1E1T A;  1V9P A;  5IE8 A;  3T1H L;  4BA2 I;  3RZD H;  1YJN A;  1SE8 A;  3CCJ A;  3PIP A;  2F4V L;  3WWV A;  1NBW A;  1E3P A;  1VQH A;  2JA5 H;  2VQF L;  4P75 A;  2YTV A;  4DUY Q;  3MXN B;  5C4X H;  4A3M H;  2IHE A;  3S1R H;  1IYJ B;  5AJ3 Q;  5IYB H;  5IP9 G;  1I94 Q;  2WB1 G;  3K0X A;  1SN8 A;  2NZH A;  3NEL A;  3ULL A;  3PUW A;  4HJ9 A;  1V43 A;  3S16 H;  2JK8 A;  4PMW A;  4A4I A;  4DR4 Q;  1D7Q A;  3HOZ G;  5C44 H;  3CPW A;  3I4M H;  4DV1 L;  4BXX H;  4JOI A;  1NE3 A;  1VQ7 A;  2B63 G;  1GKH A;  2GN5 A;  2ZJQ A;  2CWA A;  1HNW L;  2ZTD A;  1Q8K A;  4AYB G;  3AEV A;  4JBM A;  4IPC A;  3RZO H;  4QIW E;  4R4I A;  2Q2I A;  2H5X A;  1J6Q A;  1TWG H;  4DV7 Q;  1XNQ Q;  3ICE A;  2D0P A;  3TEH B;  1XMQ L;  4KHP L;  3F2C A;  4DUZ Q;  4GKK L;  2Y0S E;  3HKZ G;  4LWC A;  4K0K L;  3FHW A;  4C2M H;  5IYC G;  4APV A;  3UDI A;  3OTO Q;  1KXL A;  1HZA A;  3SGI A;  3I56 A;  1E22 A;  1CKN A;  1PH4 A;  4PZ6 A;  3RR5 A;  1HJP A;  4H02 A;  3U58 A;  2UUC L;  1E7Z A;  3M4Q A;  4LUV A;  5LMN Q;  4BY7 G;  3HOV H;  1KL9 A;  2UUA L;  3T1Y Q;  4JBK A;  3K7A H;  1OXT A;  3K81 C;  1XMQ Q;  1JB7 A;  1EFW A;  1K8A C;  4KHP Q;  3A5Z B;  1OXX K;  4LUO A;  4DV3 L;  4A3J H;  4DV3 Q;  3M7N A;  1TWF H;  4YHH L;  1FJG Q;  2UUB L;  4DR7 L;  1EIF A;  4MNO A;  2VW9 A;  4P71 A;  1QVG A;  4LNQ A;  3UDX A;  4J15 A;  4OX9 L;  1X3E A;  5M5W H;  2ZJP A;  2VQE L;  1X54 A;  1Q82 C;  1PHJ A;  1N33 Q;  1K0R A;  1BKB A;  2KHI A;  1KHI A;  3AFQ A;  5IWA L;  5IT9 c;  3HOV G;  1PYB A;  1JE5 A;  3STB D;  1PH7 A;  3CCQ A;  3HOX H;  2UU9 Q;  4JI3 Q;  4FDB A;  1JJG A;  4YCV A;  4DUZ L;  1Z9F A;  3CC2 A;  3KDF B;  4JI4 L;  3F1Z A;  5AJ3 L;  3NEN A;  2LXJ A;  1XNQ L;  3DM3 A;  2E8G A;  1EUJ A;  5M5X H;  1C0A A;  4ME3 A;  3G48 A;  2PI2 E;  1VQG A;  2GVA A;  2LSS A;  4O0A A;  1HR0 L;  2K50 A;  4DR3 Q;  1IBM L;  1QUQ B;  2HQL A;  4R4O A;  4JI2 Q;  1FVI A;  1TWH H;  4JV5 Q;  1X56 A;  2NN6 I;  1NMF A;  4BXX G;  3PV0 A;  1VS0 A;  5HGQ A;  3T1H Q;  1HZB A;  3ERS X;  3H3V I;  4JBJ A;  5HY6 A;  1CKO A;  2D62 A;  4A3L G;  2C35 B;  4EQ5 A;  1KRT A;  4LF4 L;  1FGU A;  1Z47 A;  1YZ6 A;  4X65 Q;  3GTQ H;  2E2J H;  1WCM H;  2PQA A;  1XPO A;  1VQC A;  3AQQ A;  1TXY A;  4LFA L;  1AH9 A;  3RLN A;  2K75 A;  5C4X G;  1Q46 A;  4HIO A;  1KRS A;  5E7N A;  2JA5 G;  2PNH A;  1N8R C;  2MO1 A;  1VQB A;  3H0G G;  4X64 Q;  5M3F G;  1K73 C;  4TVA B;  5LMN W;  2YYZ A;  5C0X J;  1SLJ A;  1KD1 C;  2ZTC A;  1AE2 A;  3HKZ E;  2NVY H;  2RCN A;  3HFZ B;  5DLQ E;  3CCU A;  3RLO A;  1DGS A;  2WFW A;  5JEA G;  4A3D H;  2Q2H A;  1OXU A;  3U4Z A;  2AWO A;  1U5K A;  5GRO A;  4DV4 Q;  4JI7 Q;  4A3F H;  4IOA A;  4RG1 A;  4A3E G;  4LF5 Q;  3HKS A;  4NXN L;  2IHF A;  3PUZ A;  2IY5 B;  2VL6 A;  4DR5 L;  2RHS B;  3S2H H;  2OCE A;  1W2B A;  2B3G A;  1PH6 A;  1K9M C;  5M3M H;  5FLX c;  2UXC L;  1WJJ A;  3GO5 A;  3GDE A;  1AE3 A;  4IJH A;  1X3F A;  4O2D A;  4R4Q A;  5EAY A;  3G4S A;  4GOP C;  5C4J H;  1MIU A;  1K83 H;  4JI2 L;  4OX9 Q;  4DR6 L;  2UXD Q;  4JI8 Q;  1NTG A;  3CF5 A;  3J80 c;  1JMC A;  4A3G H;  3HOY H;  3U50 C;  4ALP A;  4IOC A;  4A3L H;  2N49 A;  1K3R A;  1E24 A;  3J7A 5;  5BR8 Q;  2Q2U A;  4OXP A;  2CKZ B;  2UUC Q;  4JI0 Q;  2N8N A;  1V1Q A;  4GOP A;  2AHO B;  4UPA A;  4AIM A;  1VQ9 A;  1RIP A;  2UU9 L;  4QGU A;  3CCS A;  4A3C H;  1J5E Q;  3EN2 A;  3I4N G;  1WFQ A;  2QEX A;  3GTM H;  3S14 H;  4UP7 A;  2RHQ B;  1TWA H;  4AQY Q;  1PH2 A;  2B29 A;  3H3V H;  3W5O A;  1M90 C;  2JA6 H;  3W1G A;  2R92 G;  2OQ0 A;  3KJO A;  5IYD H;  1A0I A;  4LF9 Q;  2CFM A;  4IFD G;  2Z0S A;  4GOP B;  1G29 1;  3T1Y L;  2UUA Q;  5C0X I;  2AKW B;  4LF6 Q;  4GNX C;  5LMN L;  1T9H A;  4Y52 H;  4JI5 Q;  4KI0 A;  1A63 A;  3I4N H;  1VQN A;  2MO0 A;  1ASY A;  3CME A;  4POG A;  4LFB Q;  5K36 G;  4JI5 L;  5IYB G;  2WP8 J;  3J80 i;  3K8A A;  4PZ8 A;  4BY1 G;  4A75 A;  4IPD A;  1N32 L;  2VQF Q;  4DUY L;  4IFD J;  1YJW A;  4P74 A;  1B8A A;  3PGZ A;  4AQY L;  4HIM A;  3PO2 H;  5ELO A;  4DR6 Q;  1UE5 A;  4AYB E;  1UWV A;  5M3M G;  2ASB A;  3BU2 A;  1VQ4 A;  2Z6K A;  3L0O A;  4DK3 C;  4A3G G;  1EOV A;  1PVO A;  3K7U C;  3CCV A;  4A93 H;  4XIG S;  4OO1 I;  3KF6 B;  1D8L A;  1IBL Q;  1K8G A;  2E5L Q;  4DV5 L;  2NVQ H;  1PFS A;  4IO9 A;  4LF7 Q;  3LGJ A;  3PSI A;  4PG3 A;  2KCM A;  4GNX B;  3E9I A;  2I5L X;  3KOJ A;  4B3T Q;  4JC0 A;  1HNZ Q;  2KCT A;  3PUY A;  4DV4 L;  1VQL A;  4OWW B;  4PZ7 A;  4GKJ Q;  4YWM A;  4A3C G;  4R1J A;  2MFI A;  1YIJ A;  2K4K A;  1O7I A;  1B7Y B;  1VCI A;  1X55 A;  2GVB A;  4A3F G;  4BBS G;  3GTP H;  4JI6 L;  4QJF A;  3GTK H;  3S1Q H;  1L0W A;  2UXD L;  2V1C C;  3TRE A;  1WYD A;  2YTY A;  1VQP A;  2PQA B;  5GQO A;  1W3S A;  3EIV A;  1GD7 A;  4JI6 Q;  3M4O H;  2UXB Q;  3U4V A;  1IBK Q;  5JJK A;  4DKA C;  2A1A A;  3JAM c;  4LFA Q;  5C3E G;  2AWN A;  2CWP A;  3J7Z C;  4HIK A;  2R93 G;  1I6H H;  1U0L A;  3PUX A;  2RF4 A;  4X66 L;  4HID A;  3CD6 A;  2WAQ E;  1PV4 A;  3FKI H;  1A62 A;  2CCZ A;  2YTX A;  4X62 L;  1X9N A;  2DGY A;  2JQO A;  2R7Z H;  4DV5 Q;  3OW2 A;  4LFC Q;  1IBK L;  1VQ8 A;  2N78 A;  3TRZ A;  3J81 c;  5J3B A;  2K5H A;  2JA7 G;  3EBE A;  1N34 L;  3I2Z A;  4TQU S;  2HHH Q;  4X64 L;  1Q1B A;  3RLF A;  4IPG A;  5FLM H;  1IBM Q;  3KDF A;  1BBW A;  1SRO A;  4DR2 L;  3UE0 A;  4QQB X;  2F3I A;  1HR0 Q;  1EYG A;  4QY7 A;  3M9B A;  1OTC A;  1YBY A;  1PYS B;  2IX0 A;  2VUM G;  2QGQ A;  3PO2 G;  4BBR G;  1HZ9 A;  1Y1W H;  2I5M X;  1IBL L;  4JI3 L;  3TS2 A;  2A19 A;  4GNX A;  3A5U A;  4LFB L;  4BA1 I;  4LW1 A;  1N36 Q;  3KYH C;  4DV0 Q;  3M4P A;  4LF6 L;  1P8L A;  4JYA L;  2YV5 A;  4OWT B;  3UDF A;  1PA6 A;  4A3B H;  3KF6 A;  4RMF A;  1X6O A;  1YIT A;  3KJP A;  4A3K H;  5M5Y H;  2UUB Q;  1N32 Q;  4BY1 H;  1SRU A;  2DUD A;  1VQK A;  4IJL A;  2NVX H;  2BH2 A;  1B70 B;  2XGT A;  4Y7N H;  2PI2 A;  2WB1 E;  1CSP A;  3NEM A;  4JBW A;  4UY8 C;  4YWL A;  3TQY A;  3UE1 A;  4IPH A;  3E9H A;  4BY7 H;  3OTO L;  4DNI A;  4JI0 L;  1CSQ A;  3BJU A;  4A93 G;  1CKM A;  2ALY B;  4A3I G;  2BA1 A;  4B3M L;  2R92 H;  3HOU G;  1YJ9 A;  1XPR A;  3M85 A;  4LF9 L;  1Q81 C;  3FP9 A;  1HNX Q;  1SMX A;  1WI5 A;  3VDY A;  1IL2 A;  2VY3 A;  1NY4 A;  4MTN A;  3DLL A;  4YWK A;  4HJ8 A;  1YI2 A;  3G71 A;  1HNX L;  3L7Z C;  4P73 A;  1JJ2 A;  4OWX B;  2Q2T A;  1OXS C;  4UP8 A;  4A3K G;  3S17 H;  1J5E L;  1VQD A;  3HOY G;  2ZJR A;  2KHJ A;  3I55 A;  4DV2 L;  2JJQ A;  5FLM G;  3HOZ H;  2ES2 A;  4DR5 Q;  3PO3 H;  2K5N A;  1UE1 A;  5GAD C;  4WJ3 M;  4GKK Q;  3CC4 A;  4X6A H;  3F2B A;  1I94 L;  1XJV A;  5JEA J;  2CQO A;  4DR1 L;  1VQF A;  4L5T A;  1E1O A;  4GLX A;  4NXN Q;  4XTC S;  3D0F A;  4DV7 L;  1Y1W G;  1QZH A;  4JI7 L;  3PIO A;  3S1M H;  2A8V A;  4KLK A;  1NJI C;  2EQS A;  1VQE A;  2E2I H;  3CPF A;  4MZ9 A;  4DK6 C;  5GAE C;  4A3M G;  2R7D A;  4C3I H;  1C7Y A;  4JYA Q;  4DV1 Q;  3KLW A;  1HZC A;  3ULJ A;  1PH1 A;  1N36 L;  4DR4 L;  4JG2 A;  1N34 Q;  1UE6 A;  4AH6 A;  1XNR Q;  3F8T A;  2AMC B;  3ZJY C;  1VQI A;  4L5S A;  1EQR A;  3CC7 A;  2JA7 H;  3CP0 A;  4X62 Q;  4POF A;  3PUV A;  4LF8 L;  4DV6 L;  2XTI A;  1PH3 A;  1KQS A;  3PF4 A;  1OXV A;  1X3G A;  4DV6 Q;  1VQM A;  2QA4 A;  3BZK A;  1YHA A;  3CCM A;  3CCL A;  1GVP A;  4LF4 Q;  1GO3 E;  2JEB I;  3H0G H;  4JCV E;  5M3F H;  3B6Y A;  3CW2 C;  4OON A;  3ER0 A;  3F2D A;  2UXB L;  1EWI A;  3CQZ H;  2L15 A;  1Q7Y C;  2R93 H;  2I0Q A;  4BBS H;  4BBR H;  4A3D G;  1LUZ A;  1VQ5 A;  1JJC B;  3W1B A;  3TS0 A;  2JE6 I;  3STB C;  4JV5 L;  2PMZ E;  5LMU L;  3IRB A;  1G51 A;  1Q1E A;  4QL5 A;  2BH8 A;  5C3E H;  1A8V A;  2R7F A;  4GN5 A;  4GS3 A;  4YCW A;  1PH5 A;  2NVT H;  3S1N H;  4JI1 L;  4HJA A;  4X66 Q;  4R4T A;  2N3S A;  4YY3 Q;  1GM5 A;  4DR1 Q;  4LF8 Q;  1VQ6 A;  1UE7 A;  2OTL A;  1G6P A;  1BVS A;  1YNX A;  3A74 A;  3Q8D A;  4A3J G;  4DAY B;  4A76 A;  2ATW A;  1KAW A;  1XMO L;  3S15 H;  2R7Z G;  3I4O A;  2EXD A;  5IWA Q;  3S24 A;  3AYH B;  1L1O A;  1TWC H;  2I5H A;  2VQE Q;  4GLA C;  1M1K C;  5IP7 H;  5IYD G;  3JC6 6;  4DR3 L;  1LM0 A;  1BBU A;  3AFP A;  3NBH B;  4GN4 B;  3GTL H;  2ZM6 Q;  3HOW G;  4GKJ L;  2BA0 A;  5JJL A;  1HNZ L;  4B3T L;  3HOX G;  1IZ6 A;  1QUQ A;  4JI4 Q;  5IY0 A;  4DPG A;  2MQH A;  3CMA A;  3CCR A;  3A0J A;  2HT1 A;  3HOU H;  4L5R C;  5C0X G;  4B3S L;  2K5V A;  5IYC H;  4DV2 Q;  1IXR A;  4C3J H;  1LTL A;  3PO3 G;  1KIX A;  3J81 j;  4OO1 G; 
#chains in the Genus database with same CATH topology
 4U67 3;  1TS3 A;  1STH A;  4ZKC B;  1QVF A;  5EGT A;  2NZO A;  2JEA I;  4G7Z C;  2Y0S G;  1LTB D;  1YHB A;  2IT1 A;  4KHZ A;  1WOC A;  1PFM A;  3GTK B;  4DNT B;  4A3I H;  2FXQ A;  1UAP A;  3L2P A;  3I7F A;  2E2H B;  4LUZ A;  2NN6 H;  1FGB D;  5C44 G;  3NBH A;  1LTA D;  1Q8I A;  2TSS A;  1WTW A;  3ULP A;  1K28 A;  2DNE A;  1UUP A;  3NSW A;  2J4X A;  1VQJ A;  2VNU D;  3OWF A;  4DAM A;  4WJW A;  2F3W A;  3SHL A;  4B3S Q;  3K80 C;  2NWG A;  1TU2 B;  1I4P A;  3G6E A;  1KC8 C;  3S2D H;  4P72 A;  3J80 E;  1UEB A;  4WJ4 A;  4MIU A;  3OYY A;  4JI1 Q;  1SNO A;  2KED A;  4NP5 A;  2F4V Q;  4JI8 L;  2OQK A;  1G6Z A;  2PZW A;  2LXK A;  3CCE A;  1SYE A;  2X69 A;  4L5Q A;  5CYU A;  1XMO Q;  3GTJ H;  1L1O C;  4GLV B;  1P16 A;  3IAY A;  4OHJ A;  4RGO S;  1TY0 A;  2WV6 D;  1C9O A;  2A73 B;  5IP7 G;  4GN3 B;  4LF7 L;  2Q8I B;  5FJ8 H;  3H0G B;  5LMU Q;  1Y1V G;  2EYH A;  4JK1 C;  3A8I E;  1CA6 A;  1YJN A;  4KV6 A;  2PQE A;  1SE8 A;  3PIP A;  2RSN A;  5ELC A;  1E3P A;  4PNY A;  1CHP D;  3IFT A;  1A3U A;  4DUY Q;  1STG A;  2IHE A;  3S1R H;  2VXW A;  5IP9 G;  5M5X B;  2A6H D;  5D65 A;  1B4O A;  3ULL A;  3PUW A;  4HJ9 A;  4QMG A;  5C5L A;  2JK8 A;  2DJG C;  4DR4 Q;  3PO3 B;  3CPW A;  3I4M H;  1O7L A;  4JOI A;  4BXX H;  2GN5 A;  1Q8K A;  2JYO A;  4X3T A;  4IPC A;  3ICE A;  1TS2 A;  1WCM B;  4DUZ Q;  2KCN A;  4GKK L;  4C2M H;  3SGI A;  4A3E B;  2UUC L;  5LMN Q;  2HQE A;  3DEP A;  3CHB D;  3R3O A;  2UUA L;  3T1Y Q;  1JB7 A;  3K81 C;  3CKI B;  3A5Z B;  1OXX K;  4L8J A;  1WVL A;  1TWF H;  4DR7 L;  2UUB L;  4MNO A;  3GV6 A;  3KLS A;  3RZD B;  5M5W H;  1N33 Q;  1X54 A;  2B2Y C;  1BKB A;  3AFQ A;  3K7A B;  1JE5 A;  2UU9 Q;  1YNN C;  1SNP A;  3A7A B;  3IL8 A;  1V1P A;  5M9O A;  1D5X C;  4B9X A;  1Z9F A;  3V05 A;  2BCO A;  2LXJ A;  1B9M A;  3G48 A;  5CV9 A;  2LSS A;  2EE1 A;  1BUV T;  1ONL A;  1SFO B;  2HQL A;  4C3I B;  3WOF A;  1GOZ A;  1TWC B;  3PV0 A;  3TN2 A;  1U9R A;  1HZB A;  3H3V I;  3L9A X;  3SXH A;  4LF4 L;  1FGU A;  4XQQ A;  1Z47 A;  1PRT D;  1YZ6 A;  3QJY A;  1EY4 A;  3NWS A;  1WCM H;  2PQA A;  3M7G A;  5E7N A;  2JA5 G;  2PNH A;  2F0D A;  1PRT C;  3ERO A;  1SLJ A;  2EYM A;  1SYF A;  2F3V A;  1KD1 C;  3HFZ B;  2XSC A;  3HKZ E;  3FDT A;  1DGS A;  3HKZ B;  4YIJ A;  1R9T B;  1DZ1 A;  3MXP A;  2A6E D;  4DV4 Q;  1HUN A;  4KTA A;  2WB1 B;  2O5I C;  5ELB A;  1NAP A;  2RHS B;  4IQZ A;  1W2B A;  2B3G A;  3S15 B;  4ID6 A;  5M3M H;  5EAY A;  4LMQ D;  1HA6 A;  1X3F A;  3HZX A;  3OOC A;  4FF2 A;  1PTO B;  1SE3 A;  3T16 A;  1Y8O B;  3OWE B;  1JMC A;  3NXW A;  2RA4 A;  1UNS A;  5LL6 X;  4KJN A;  2L0C A;  4BWG B;  2EZV A;  2N49 A;  1L0X B;  2Q2U A;  4OXP A;  3I90 A;  2XN9 C;  4E6I A;  1HHV A;  1V1Q A;  4GOP A;  4UPA A;  2UU9 L;  4AIM A;  1RIP A;  4K5W A;  2BOS A;  3HEJ A;  5CBE E;  4FF4 A;  1AN8 A;  3MHB A;  1DOM A;  1MSG A;  4IUN A;  2B29 A;  3H3V H;  1M90 C;  4LF9 Q;  2LY7 A;  2CFM A;  4RHS A;  2Z0S A;  4GOP B;  1G29 1;  1KAB A;  3T1Y L;  2UUA Q;  2AKW B;  3A8K E;  4GNX C;  5LMN L;  1T9H A;  1TII D;  4KI0 A;  4QUF A;  2B2T A;  3Q24 A;  4QB4 A;  4HED A;  1SYG A;  4RAU C;  2WP8 J;  4J1M A;  5IT9 E;  1O80 A;  4PZ8 A;  1DXM A;  5IGD A;  3NP8 A;  1PYW D;  4IPD A;  2VQF Q;  4IFD J;  3DM1 A;  3PGZ A;  3DUZ A;  5ELO A;  2RCF A;  4DR6 Q;  2CW0 D;  1VQ4 A;  2Z6K A;  3L0O A;  3CCV A;  1D8L A;  2PW7 A;  4DV5 L;  1GUS A;  4XQJ A;  2F0Q A;  3GTM B;  1EYD A;  4HCS A;  5T1I A;  1HNZ Q;  2KCT A;  4PZ7 A;  3OSO A;  4YWM A;  4A3C G;  4KK7 A;  2MFI A;  2RKS A;  5C3W A;  2V1C C;  1B9N A;  3TRE A;  1WYD A;  2YTY A;  1ILQ A;  3U4V A;  2H4O A;  4DKA C;  2R93 G;  5KNC A;  2NVX B;  2AUJ D;  2AWN A;  5JPN C;  4X66 L;  4CJ1 B;  5A35 A;  3OW2 A;  2E76 C;  2N78 A;  4RFB A;  3TRZ A;  1B3Q A;  3EBE A;  4UDU C;  3RUZ A;  2HHH Q;  5E1F A;  1Q1B A;  5FLX L;  1AEX A;  5FLM H;  3KDF A;  1BBW A;  1SRO A;  2AUK A;  1PFB A;  1HR0 Q;  1BO0 A;  1V1P B;  1S4Z A;  2WAC A;  1WTO A;  2QGQ A;  3PO2 G;  3CU7 A;  1BCP D;  1NCV A;  2O2L D;  1IBL L;  3EFX D;  4BA1 I;  3E0J A;  4HTH A;  3KYH C;  2M00 A;  2V4D A;  3M4P A;  5C4Z A;  3MFG A;  4V0B A;  1TY2 A;  4OWT B;  4A3B H;  1EY8 A;  1G2S A;  3KJP A;  4A3K H;  1KLG D;  1Q3L A;  3T53 B;  4BY1 H;  1N32 Q;  4IJL A;  1YNJ C;  1WTR A;  3C1E A;  1B70 B;  4Y7N H;  5IGG A;  4JBW A;  2E75 C;  5D3I B;  4K5X A;  3OTO L;  3NQT A;  1ESF A;  1CKM A;  4BBS B;  2SNS A;  4PMC A;  3GTQ B;  1WI5 A;  4O42 A;  4MTN A;  2JA6 B;  1EYA A;  1ET6 A;  3S1R B;  3L7Z C;  1OXS C;  4UP8 A;  2H1E A;  3P7J A;  1HFG A;  4N8F A;  1J5E L;  2F03 A;  1HRJ A;  2ZJR A;  2KHJ A;  2JJQ A;  4QIW B;  4DR5 Q;  3PO3 H;  1UE1 A;  4X6A H;  1BR9 A;  4ZCK A;  2MP1 A;  2CQO A;  1Z6H A;  2BE5 D;  4NXN Q;  3R93 A;  2DY8 A;  5CV8 A;  4JI7 L;  2A8V A;  4KLK A;  5FO7 B;  2EYO A;  1GXD C;  3I70 A;  1QB5 D;  3F2U A;  5GAE C;  2B63 B;  1STE A;  1TWH B;  3KLW A;  1HZC A;  4DV1 Q;  3BVM A;  1PH1 A;  3LWU A;  2D2C C;  2EJG C;  4JG2 A;  5EKL A;  3VA7 A;  1UE6 A;  4K6D A;  3CC7 A;  2K01 A;  3CP0 A;  1D6E C;  2N55 A;  4POF A;  4LF8 L;  4N9T A;  3Q0A A;  3PF4 A;  3JAM L;  3DHQ A;  1F2Z A;  5JJZ A;  1VQM A;  5C6A A;  3E3X A;  4R8I A;  1OO9 B;  2K33 A;  5M3F H;  1PTO F;  4OON A;  3ER0 A;  1XX8 A;  2UXB L;  2I0Q A;  2R92 B;  1LUZ A;  4JV5 L;  2JE6 I;  3M4O B;  3H3V C;  5IOC A;  1S5B D;  3GTG B;  1A3V A;  4QL5 A;  2IX3 A;  3V2T A;  1A8V A;  1PH5 A;  2NVT H;  1RJT A;  4G4K A;  4A3B B;  4R4T A;  2Z4I A;  2JXM B;  3VR4 A;  3A74 A;  4DAY B;  1TS4 A;  3MTS A;  2R7Z G;  3SVM A;  1L1O A;  4Y7N B;  1D1I A;  1TWC H;  3NK9 A;  4CHT B;  2VQE Q;  3M4Y A;  4ZYS A;  5ISR A;  3HOY B;  4A3G B;  3GTL H;  3HOW G;  5JJL A;  2ZM6 Q;  2BA0 A;  4PQX A;  4DPG A;  3CMA A;  3A0J A;  1BOS A;  1STA A;  4C2M B;  5C0X G;  3NTK A;  4RWS C;  1IXR A;  1LTL A;  1KIX A;  4B3R L;  5ELD A;  2OTJ A;  4CDE C;  3CXC A;  4EGV A;  2K05 A;  2VZA A;  3S2D B;  5C4X B;  2NN6 G;  1K0S A;  1HH2 P;  4K14 A;  4NXM L;  1FJG L;  2JA8 G;  1TWF B;  2Y0S B;  1HNW Q;  2EY1 A;  1EU3 A;  4A3K B;  1Y14 B;  3I72 A;  1ZEQ X;  5ELN A;  1X65 A;  4BY7 B;  2R6G A;  5IT9 L;  2RSO A;  3J7A V;  2X6L A;  1CKN B;  3KBG A;  1X32 A;  3D31 A;  2KOL A;  2KBN A;  2ZM6 L;  4C3H H;  3J81 i;  2A5H A;  1I50 H;  2F0G A;  1LT3 D;  3FKI G;  2E2H H;  5FOB B;  3J7Y W;  4NXM Q;  4DAY A;  1O7Y A;  2HHH L;  3HOV B;  4B3R Q;  1EL0 A;  3EJI A;  1ILP A;  3CQZ B;  3GTO H;  1XTD A;  1VQA A;  1YNN D;  5H1S E;  5BR8 L;  1YHQ A;  2EYL A;  1CUK A;  2WKD A;  4XT3 B;  3QB3 A;  3VYR A;  3HOU B;  1L2F A;  4KY7 A;  1XTC D;  4MTK A;  1S3O A;  1I5F A;  2NBF A;  1MKH A;  1PLF A;  1SNQ A;  1PZK D;  3R8B A;  5GAG C;  3BG3 A;  2IX1 A;  4A3D B;  1YEZ A;  3GP7 A;  2K28 A;  2ZTE A;  1N9W A;  1VF7 A;  1SR3 A;  2EIF A;  1Y1V H;  1A2T A;  1FR3 A;  2RBM A;  1LYL A;  4IUV A;  1AFP A;  4X65 L;  1CFM A;  1Q12 A;  3DMU A;  4NPS A;  4HJ5 A;  2QEJ C;  3PCO B;  5DNF A;  1ESR A;  1O7Z A;  1E1T A;  5IE8 A;  1BCP B;  4BA2 I;  4F8M A;  3SE0 A;  2F0W A;  1VQH A;  4H13 C;  2VQF L;  5AFW A;  4K8J A;  3EQL C;  1IYJ B;  2QDB A;  1CTM A;  1PZI D;  1SN8 A;  3DXJ C;  3RZO B;  1CZG A;  2NZH A;  3NEL A;  1H9R A;  1V43 A;  3S16 H;  1DM0 B;  1D7Q A;  3HOZ G;  4DV1 L;  1FNW A;  4A3M B;  1VQ7 A;  4C1N I;  2ZJQ A;  2XVS A;  3SEB A;  4QIW E;  2H5X A;  2HUG A;  5JOB A;  1IYU A;  4OEL B;  1XMQ L;  2E2I B;  2RDF A;  4B08 A;  1AP0 A;  5A2Q L;  4K0K L;  5EPJ A;  5IYC G;  2AQ2 B;  3H91 A;  4EQP A;  4FF1 A;  2A6H C;  2EOT A;  3OTO Q;  1KXL A;  1HZA A;  3BYT B;  5HUR A;  3I56 A;  1PH4 A;  4H02 A;  2QCP X;  3M4Q A;  2QF7 A;  3K7A H;  4A3J H;  4DV3 Q;  1EEF D;  3C2P A;  4YHH L;  2XRQ D;  4P71 A;  4K6L A;  3UDX A;  5A2Q E;  4J15 A;  5ELF A;  2ZJP A;  2IWH A;  5LHY 1;  1Q82 C;  1K0R A;  2KHI A;  5IWA L;  5IT9 c;  1PYB A;  3CCQ A;  4NKL A;  1EFI D;  3MZ5 A;  1JOK A;  1B53 A;  2ZXO A;  2F4I A;  3KDF B;  5AJ3 L;  1XNQ L;  2E8G A;  4ME3 A;  1HR0 L;  2K50 A;  4DR3 Q;  4R4O A;  1H9M A;  5M3M B;  4JI2 Q;  1FVI A;  4EVO A;  5ELE A;  1VS0 A;  5HGQ A;  1XWE A;  3ERS X;  1Y69 U;  4JBJ A;  5HY6 A;  1CKO A;  3VYU A;  1HTP A;  3TP6 A;  1KRT A;  1E2W A;  2L55 A;  3FRP B;  2XWJ B;  2Z8L A;  1JOO A;  1V1O A;  1XPO A;  1ET9 A;  5JEA H;  1SJH D;  1Q46 A;  3VYT A;  2K5D A;  3H0G G;  4DK0 A;  4TVA B;  1KLU D;  2YYZ A;  1W6J A;  3Q23 A;  1X3Q A;  5JEA G;  4O1N A;  4WFN 3;  3U4Z A;  1RTO A;  3S1N B;  4RG1 A;  4A3E G;  4LF5 Q;  2IY5 B;  3MWY W;  4HSV A;  3S2H H;  3J80 L;  2UXC L;  3GDE A;  5C4J H;  1MIU A;  1K83 H;  4DR6 L;  1NTG A;  5M5Y B;  4ALP A;  4IOC A;  1ENA A;  3NHH A;  3K0Y A;  2CH4 W;  2L4N A;  1LT5 D;  3J7A 5;  5I9P A;  1DCZ A;  1ML0 D;  1H9S B;  2UUC Q;  4JI0 Q;  3SK5 A;  3CCS A;  4A3C H;  5I4D A;  3I4N G;  1WFQ A;  4KN7 C;  2QEX A;  2F0L A;  3GTM H;  3S14 H;  4BS9 A;  1HQR D;  1R4Q B;  5CV4 A;  1LV9 A;  4ZAI A;  1ICW A;  3W1G A;  3BZD B;  4OGQ C;  2TMP A;  2R92 G;  2OQ0 A;  3KJO A;  1A0I A;  2EYJ A;  4EQO A;  2KEC A;  2FMC A;  2EPB A;  5C0X I;  2F0M A;  5DM6 3;  4Y52 H;  3IKJ A;  1EY9 A;  4LFB Q;  3CME A;  4POG A;  3G7L A;  3URY A;  4FF3 A;  5TSS A;  1STY A;  4A75 A;  1DON A;  2CH4 A;  4DUY L;  3DWA A;  3PO2 H;  4XYQ A;  2ASB A;  1EZ6 A;  1CA5 A;  1EQV A;  4KKU A;  4DK3 C;  3OPO A;  1JOR A;  3HP3 A;  1PVO A;  4MN3 A;  4A93 H;  4XIG S;  4CKE A;  1WTV A;  2NVQ H;  2WIN B;  4FP5 D;  3OMG A;  4IO9 A;  2ZXP A;  2G9D A;  4LF7 Q;  2ICI A;  4KJO A;  4PG3 A;  4ABN A;  1LO5 D;  2I5L X;  1R4P B;  4DV4 L;  3PUY A;  4OWW B;  4GKJ Q;  1K8O A;  4ZRZ A;  2K4K A;  5IGE A;  4A3F B;  1B7Y B;  3PQI A;  4A3F G;  4JI6 L;  3A54 A;  4JI6 Q;  2PQA B;  5GQO A;  1W3S A;  2G5D A;  2QIL A;  1K83 B;  3X3M A;  3M4O H;  1IBK Q;  5C3E B;  5C3E G;  1EIH A;  3QO2 A;  4ULL A;  1IKL A;  5EPK A;  4HID A;  3ERQ A;  1AZQ A;  2ZT9 C;  1PV4 A;  2YTX A;  1DOL A;  4X62 L;  2DGY A;  1GUO A;  2ENB A;  5CV7 A;  3MEH A;  1IBK L;  2PZU A;  1VQ8 A;  4DFA A;  4IAL A;  2K5H A;  4RKB A;  2K04 A;  2B2Y A;  1J9O A;  1U4L A;  4QQB X;  3UE0 A;  1EIG A;  2F3I A;  3M9B A;  3EA6 A;  1RHP A;  2CHB D;  2IX0 A;  4M8A A;  2K7V A;  3X3N A;  5KEE A;  3SDZ A;  4BBR G;  2X6G A;  3TP8 A;  5I6Y A;  4LFB L;  3A5U A;  1IL8 A;  3K58 A;  1PA6 A;  1RCV D;  4RMF A;  1YIT A;  2UUB Q;  1SRU A;  1SNC A;  1VQK A;  1TWG B;  2NVX H;  2EJM A;  1JE4 A;  2WB1 E;  3UE1 A;  3NBI A;  4BY7 H;  4F88 A;  4JI0 L;  1CSQ A;  2JP1 A;  3GQB A;  4B3M L;  4KD4 A;  2F0P A;  5CR3 A;  3VDY A;  1IL2 A;  4R9W A;  3LX0 A;  1NY4 A;  5DAU A;  4YWK A;  1YI2 A;  2L11 A;  4P73 A;  1JJ2 A;  4OWX B;  5HGT A;  2Q2T A;  5J39 A;  1CQF A;  2F0H A;  1PFN A;  4V19 0;  1VQD A;  4TSS A;  1I6V C;  5C0X H;  3FPP A;  2ES2 A;  4WJ3 M;  3S1Q B;  4GKK Q;  1EZ8 A;  3S9W A;  2PCF B;  3I4L A;  3F2B A;  4DR1 L;  1A2U A;  4GLX A;  4G7O C;  3D0F A;  1QZH A;  3S1M H;  4RCO A;  3PIO A;  3AB9 A;  4NMZ A;  3HG9 A;  1VQE A;  4QF4 A;  1KDC A;  2E2I H;  1I6H B;  1NR4 A;  3BVG A;  4XT1 B;  1VMC A;  4DR4 L;  2WAQ B;  4CJ2 C;  4OL7 A;  1N34 Q;  5KIX A;  1KNE A;  2B8F A;  1I4H A;  1SMY C;  1VQI A;  1JC7 A;  5KRU A;  2DN8 A;  1F2L A;  3O13 A;  3SR1 A;  2RQX A;  1OXV A;  4I65 A;  1FNU A;  3CCM A;  1GO3 E;  2JEB I;  5IGB A;  3CW2 C;  3F2D A;  1I4Q A;  1EEI D;  2F0O A;  4WOR A;  4HMJ A;  5LMU L;  3IRB A;  1I3Q B;  2Z4H A;  2R7F A;  4GS3 A;  3S1N H;  4JI1 L;  2KEE A;  2XNA C;  1GM5 A;  1VQ6 A;  1QE6 A;  1YNX A;  3Q8D A;  4A3J G;  4A76 A;  1ZYR C;  1KAW A;  1XMO L;  3S15 H;  3I4O A;  5IWA Q;  1G2T A;  1TQO A;  4NDX A;  4H7B A;  2I5H A;  4GLA C;  5IP7 H;  3W3A A;  3FEW X;  4DR3 L;  4M1U B;  1BBU A;  4DXF A;  4GKJ L;  2F0U A;  3HOX G;  2MQH A;  4FXG C;  2OEO A;  3SK6 A;  5D3D A;  1J8I A;  2FHT A;  4B3S L;  1I4X A;  3I3C A;  1T5E A;  2FMM A;  4DV2 Q;  2DJF C;  4ZKB B;  4OO1 G;  2NTT A;  1HPC A;  1JWU D;  3MXG A;  1Q86 C;  1MJE A;  4FO2 A;  2K14 A;  2OF1 A;  4YHH Q;  2K52 A;  3RNU A;  3MC0 B;  4ZLT F;  3KFU A;  4R4C A;  2ID0 A;  4K2L A;  4DV0 L;  1ASZ A;  5JPM C;  1I4R A;  1PH8 A;  2YU9 B;  5JJI A;  2B2V C;  1I3Q H;  2B2W C;  4ODG A;  1WTQ A;  4K0K Q;  4Q0F A;  2JA8 H;  2A6E C;  4YCU A;  1S72 A;  1GUG A;  2B2U A;  1JQY D;  2JA9 A;  1L1O B;  1MJC A;  1Y8N B;  2HIV A;  1IKM A;  1GUN A;  4A3E H;  1EIY B;  3A7L A;  2WKC A;  5GAH C;  4ILW A;  1EQQ A;  2MNA A;  1QNK A;  5K36 G;  3HOW H;  1C48 A;  1WCM G;  3KF8 B;  1SXT A;  5CMD A;  1HA5 A;  1JT8 A;  1F77 A;  2L12 A;  1JR0 D;  3PF5 A;  2NZ1 D;  1STB A;  1WD1 A;  4DR2 Q;  4UP9 A;  5D14 A;  3KLR A;  3BZC A;  1YVC A;  1HR0 W;  5DEH A;  4GZY C;  2RVL A;  3QG1 A;  1NMG A;  4X3K A;  4EX5 A;  3QOL A;  1IW7 C;  4J6H A;  3K5L A;  1VQO A;  1RTN A;  4YY3 L;  1SFO H;  3VR5 A;  4IUP A;  4LF5 L;  1S5E D;  2KUM A;  4A3I B;  2D0O A;  3GD7 A;  2E5L L;  2K5W A;  5M3F B;  1XNR L;  2Z6K C;  1V9P A;  3T1H L;  4RGM A;  3RZD H;  4DF7 A;  3D4D A;  2E2J B;  1NBW A;  4C3I G;  3VYS A;  2JA5 H;  2YTV A;  3P1H A;  3MXN B;  5F2D A;  4A3M H;  1SBB B;  3D3R A;  1I94 Q;  2WB1 G;  4CKC A;  2DNC A;  3D4R A;  1Y1W B;  3GTP B;  3KUP A;  2OT2 A;  4A4I A;  4B9W A;  5C44 H;  1GHK A;  2A68 C;  1NE3 A;  1GKH A;  4RGN A;  1GHJ A;  1HNW L;  5BN4 A;  2ZTD A;  4X3S A;  2LMC B;  2KVM A;  4JBM A;  3RZO H;  2JA8 B;  1PTO D;  3QIA A;  1J6Q A;  2Q2I A;  5DM7 3;  1TWG H;  4DV7 Q;  1XNQ Q;  4KHP L;  3F2C A;  1D2B A;  1BQQ T;  1AZP A;  2B39 A;  4IUT A;  1FD7 D;  3P20 A;  1VF5 C;  3FHW A;  4APV A;  3HOU G;  4PZ6 A;  1E7Z A;  4LUV A;  3GV3 A;  3DEO A;  1KL9 A;  2F0S A;  4XYO A;  4JBK A;  1OXT A;  4KKT A;  3Q22 A;  4KHP Q;  4LUO A;  2K03 A;  4DV3 L;  1FJG Q;  1EIF A;  1KDB A;  1MD2 D;  2VW9 A;  3R2T A;  4LNQ A;  1K3B C;  1TR5 A;  1X3E A;  2SOB A;  5K5P A;  2VQE L;  1VMP A;  4RH6 A;  3STB D;  1PH7 A;  1LTG D;  3HOX H;  3GTJ B;  4FDB A;  3S16 B;  4YCV A;  3L3O C;  3K5O A;  3F1Z A;  3NEN A;  2K32 A;  3DM3 A;  1C0A A;  5M5X H;  4TRD A;  3TSS A;  5KND A;  4HR7 B;  1IBM L;  1QUQ B;  2PNR C;  1QIL A;  4JV5 Q;  1X56 A;  2EY2 A;  1NMF A;  2NN6 I;  3MXU A;  4BXX G;  5I9O A;  3T1H Q;  1KNA A;  2IL8 A;  4C56 C;  4A3L G;  2C35 B;  1LAB A;  2Z1C A;  3GTL B;  1TT2 A;  1MBY A;  2E2J H;  4I7A A;  2GA4 B;  3RLN A;  2K75 A;  1KRS A;  2PPB C;  2MO1 A;  5C0X J;  3VR3 A;  4RCN A;  2HD3 A;  5DLQ E;  2NVY H;  3CCU A;  4A3D H;  1EY5 A;  2WFW A;  2J7Z A;  1OXU A;  3A56 A;  4UHV A;  1U5K A;  2M2L A;  3I73 A;  5LL6 S;  3FVQ A;  4JI7 Q;  4IOA A;  4C1N K;  2B2U C;  2E74 C;  4NXN L;  2IHF A;  3PUZ A;  4EQN A;  3DWP A;  3MAQ A;  4DR5 L;  5J1Z A;  1K9M C;  1WTX A;  1WJJ A;  2B2W A;  3GO5 A;  2UXD Q;  2B2V A;  4GOP C;  4OX9 Q;  4QUC A;  3NTH A;  3CF5 A;  5CV6 A;  4FXD A;  3J80 c;  3C46 A;  4A3G H;  5EBC A;  3PO2 B;  3S14 B;  1BNZ A;  3I8Z A;  1Z7T A;  2B8G A;  5FO9 B;  1E24 A;  5BR8 Q;  2ZXR A;  4LJZ C;  2LKV A;  2N8N A;  2AHO B;  1VQ9 A;  3H6M A;  4QGU A;  3J81 E;  1J5E Q;  1LLR D;  3BYY B;  3EN2 A;  1F9P A;  3I4N B;  2A74 C;  2RHQ B;  4DNR B;  1CHQ D;  2NTS A;  4CDC C;  4K5V A;  4RHR A;  1IW7 D;  3W5O A;  1O78 A;  5IYD H;  1LT4 D;  1PTO C;  2L5T A;  1H9S A;  1Y8P B;  5KYI A;  3D6W A;  1A63 A;  4HAE A;  4CDD C;  2MO0 A;  1ASY A;  4JI5 L;  1SMY D;  2EVB A;  4KHV A;  3PMF A;  4IUU A;  1Y1V B;  3J80 i;  3M3Y B;  1V8Q A;  1F2M A;  1N32 L;  2F0T A;  1YJW A;  1B8A A;  4AQY L;  4HIM A;  1MI2 A;  2CQA A;  1GUT A;  2HCC A;  1AW7 A;  1EY6 A;  3BU2 A;  4A3G G;  1ROD A;  1EOV A;  3K7U C;  2PO4 A;  3K57 A;  2NVY B;  3KF6 B;  1H9J A;  1IBL Q;  4HCE A;  4OO1 I;  1WTP A;  1IYV A;  3A55 A;  3HRZ C;  3G6J B;  4XQN A;  3LGJ A;  3PSI A;  5J22 A;  4GNX B;  3KOJ A;  2AQ3 B;  1VQL A;  5NUC A;  4UAI A;  1TKW B;  3H09 A;  1MHW C;  4A93 B;  5EQ0 A;  3A8J E;  1II3 A;  1O7I A;  1VCI A;  1X55 A;  4OIK A;  4AYB B;  4BBS G;  4QJF A;  3PIP 3;  3GTK H;  1L0W A;  3HS0 C;  4QCL A;  1VQP A;  3EIV A;  1GD7 A;  1B50 A;  5JJK A;  4LFA Q;  3J7Z C;  4HIK A;  1PXU A;  2RF4 A;  4DAP A;  5E4X A;  2WAQ E;  2EY5 A;  2Z9H A;  1S5F D;  2C5C A;  4DV5 Q;  4LFC Q;  4J8Q A;  3J81 c;  5J3B A;  2JA7 G;  1N34 L;  4RKL A;  1QOH A;  3D4W A;  4TQU S;  4X64 L;  3BS1 A;  4IPG A;  1DJR D;  1EY7 A;  5I2X A;  4DR2 L;  1EYG A;  4QY7 A;  1OTC A;  1YBY A;  1PYS B;  1RKN A;  2VUM G;  4DGZ A;  2MGS A;  2F0F A;  4CJ0 B;  4ZQ3 A;  3R2I A;  4CKB A;  4G57 A;  1BBX C;  3TS2 A;  1E0B A;  2I5M X;  4JI3 L;  1QG7 A;  4IUQ A;  4OO1 H;  1B2T A;  1WTH A;  3ND8 A;  5EKI A;  5CGK A;  1X6O A;  5M5Y H;  2DUD A;  2BH2 A;  2XGT A;  5FK9 C;  3P75 A;  2PI2 A;  4UY8 C;  4YWL A;  3TQY A;  4IPH A;  3E9H A;  2E2D C;  4DNI A;  5CC4 A;  5BN5 A;  3BJU A;  2R92 H;  1YJ9 A;  1XPR A;  3M85 A;  4LF9 L;  1Q81 C;  1EQT A;  3FP9 A;  3PIO 3;  3BVZ A;  3NWT A;  2VY3 A;  3K6O A;  2Z6B A;  4HJ8 A;  3DLL A;  3G71 A;  4C3J G;  4C3J B;  4A3K G;  3S1M B;  4XXE A;  4Q5V A;  1JOQ A;  3HOY G;  2NYZ D;  1Q90 A;  1RD9 D;  3I55 A;  4DV2 L;  3ZYY X;  5FLM G;  2FIN B;  5C44 B;  5GAD C;  3CC4 A;  5JEA J;  3U9O A;  3MVV A;  3OIQ A;  1PDQ A;  2F0N A;  2EJF C;  2EQS A;  5C3X A;  1HQM C;  4A3M G;  4C3I H;  1C7Y A;  3S2H B;  2QW7 A;  3ULJ A;  3KK7 A;  1C8C A;  4LAA A;  3T13 A;  1JIC A;  5IIF A;  1ZKO A;  2AMC B;  4L5S A;  1EQR A;  5L37 A;  4X62 Q;  3PUV A;  4DV6 L;  2XTI A;  1LAC A;  4OIJ A;  2F0K A;  1X3G A;  5G3L D;  4WRD A;  4DV6 Q;  2QA4 A;  2EYF A;  2O4X A;  4LF4 Q;  5COR A;  3H0G H;  2R61 A;  4H0L C;  3WOE A;  5M5W B;  3CQZ H;  2L15 A;  3AU7 A;  1DD2 A;  2R93 H;  4BBS H;  4BBR H;  2B2T C;  4A3D G;  2NUC A;  3N6R A;  4IUR A;  1JJC B;  5IGF A;  3TS0 A;  1VQ5 A;  2O5J C;  2KQ3 A;  3Q6S A;  1STN A;  1Q1E A;  1YNJ D;  3T51 B;  3E6Z X;  2BH8 A;  3QOJ A;  5C3E H;  4YCW A;  3JAM E;  4HJA A;  4X66 Q;  2IW3 A;  3J81 L;  1G6P A;  1BVS A;  1LTI D;  2HDM A;  4BY1 B;  2ATW A;  1SND A;  3S24 A;  2JSO A;  3LNN A;  3I91 A;  4PV1 C;  1M1K C;  3JC6 6;  1TVX A;  3C3L A;  4C3H G;  1LM0 A;  1B1Z A;  4GN4 B;  1HNZ L;  2A68 D;  5IY0 A;  1SJE D;  2KHS A;  3CCR A;  1L0Y B;  5I6W A;  3HOU H;  2K5Q A;  4L5R C;  2EY6 A;  2K5V A;  4C3J H;  3PO3 G;  1B3A A;  2OXP A;  5JAV A;  1PH9 A;  1N33 L;  2F52 A;  1MGS A;  1RL2 A;  2RDG A;  1R9T H;  4DR7 Q;  4S3S A;  3QR8 A;  1RDP D;  5IP9 H;  1H95 A;  4H44 C;  2JA6 G;  1WD0 A;  4B3M Q;  4RA8 A;  1S40 A;  2R93 B;  3NQI A;  5KGU A;  1KTK A;  1F9R A;  3LWE A;  2HIX A;  3GTG H;  5CBA E;  2B63 H;  1QWY A;  2CVR A;  5FJ8 G;  2MUY A;  2OWO A;  3TP7 A;  1C4Q A;  2KEN A;  4HN7 A;  4JOI C;  2YU9 H;  4NB3 A;  3RN2 A;  3VR2 A;  4A3B G;  4KY6 A;  2UXC Q;  3E0E A;  3RN5 A;  1FL0 A;  2WAQ G;  4OEM B;  4HJ7 A;  4LFC L;  4A3J B;  1U4M A;  1JWM D;  4NW2 A;  3KLS X;  3I4M G;  1QVC A;  3TME A;  1DYQ A;  2PYK A;  1M4V A;  1NUC A;  3ITP A;  5FLX E;  1QNU A;  3OIP A;  4KN4 C;  3JAM i;  4IFD I;  4TKO B;  2SDF A;  5I2Y A;  3UDG A;  2VUM H;  2EXZ A;  1LT6 D;  4F87 A;  3M3Y H;  3MEF A;  1XPU A;  2VB2 X;  3CAM A;  3CRL C;  2VS1 A;  3H15 A;  1QZG A;  3NTI A;  2JA5 B;  2IJ0 A;  4RGT A;  5EKK A;  1BF4 A;  4CGY B;  1DOK A;  3CCJ A;  4HMI A;  2F4V L;  1SE2 A;  3ONA B;  3WWV A;  2WII B;  4P75 A;  3NE5 B;  3HOW B;  5C4X H;  3QWN A;  5AJ3 Q;  5IYB H;  1CQV A;  3EVQ A;  3K0X A;  5KYL A;  4DN4 M;  2Q8R E;  4FYD A;  1A3T A;  3E5S A;  4KKS A;  4PMW A;  1U4P A;  2B63 G;  1SYC A;  5JVH 3;  1EU4 A;  2CWA A;  1KDA A;  1NSN S;  4AYB G;  3AEV A;  2PZT A;  4R4I A;  2A69 D;  1K8M A;  2D0P A;  2EDG A;  3H94 A;  3TEH B;  1D1K A;  2Y0S E;  3HKZ G;  4LWC A;  5FKA C;  2KA7 A;  1SSO A;  3UDI A;  2OTL A;  1SAP A;  1E22 A;  1CKN A;  1SE4 A;  3RR5 A;  1HJP A;  1M8A A;  1NR2 A;  3U58 A;  4BY7 G;  5C4J B;  3HOV H;  1EFW A;  1XMQ Q;  1PZJ D;  1K8A C;  3VR6 A;  3GTO B;  3M7N A;  4DAV A;  1CK1 A;  1QVG A;  4OX9 L;  2F1M A;  1EWC A;  1SYB A;  1PHJ A;  1KHI A;  3HOV G;  2FFK B;  2RDH A;  1SYD A;  4JI3 Q;  2VUM B;  5COY A;  1JJG A;  4DK1 A;  4DUZ L;  2HCI A;  3CC2 A;  4JI4 L;  1EUJ A;  3D8G A;  4IFD H;  4N8X 1;  2PI2 E;  2I46 A;  1VQG A;  2GVA A;  2KJX A;  4O0A A;  3T56 B;  5IOD A;  1G91 A;  3DWQ A;  1TWH H;  3BDC A;  1PTO H;  2EYP A;  4HSP A;  1EY0 A;  4FXK C;  2LFN A;  4LK1 C;  3C1F A;  2D62 A;  4FNF A;  4EQ5 A;  4X65 Q;  4L63 B;  3GTQ H;  4P2C B;  1VQC A;  1TWA B;  3AQQ A;  1TXY A;  4LFA L;  1AH9 A;  1JWS D;  1KAA A;  1MSH A;  4HIO A;  5C4X G;  1T5X D;  4CBV A;  2F0J A;  2SEB D;  5CV5 A;  1NNX A;  1N8R C;  5EPL A;  1VQB A;  5M3F G;  4X64 Q;  1K73 C;  5E3F A;  5LMN W;  1W6K A;  4DA2 A;  2ZTC A;  5T1G A;  1AE2 A;  1F9S A;  2L1B A;  2RCN A;  5G3L F;  3RLO A;  2Q2H A;  2AWO A;  5GRO A;  1FYC A;  4A3F H;  3KBX A;  1BCP F;  1A15 A;  4JW0 A;  3HKS A;  4G7H C;  2I07 B;  2VL6 A;  3TZD A;  2OCE A;  1PH6 A;  5EJW A;  5FLX c;  1AE3 A;  4IJH A;  4O2D A;  4R4Q A;  3G4S A;  3N52 A;  4JI2 L;  4MHE A;  1HXY D;  4JI8 Q;  2F0E A;  3HOY H;  3U50 C;  4A3L H;  2ICE C;  4FVM A;  1K3R A;  2CKZ B;  3K59 A;  1BXT A;  2K1B A;  4L6T B;  2KCC A;  3OMC A;  4UP7 A;  1TWA H;  4AQY Q;  1PH2 A;  2NVT B;  3MFY A;  2MJ8 A;  3AMU A;  2JA6 H;  4IFD G;  1F9Q A;  1JB3 A;  3TP5 A;  4LF6 Q;  1XXG A;  4JI5 Q;  1ICF B;  1SDF A;  3I4N H;  1VQN A;  1ENF A;  2XRS D;  1H9K A;  5IYB G;  2XWB B;  4BY1 G;  3K8A A;  3CRK C;  4IZ8 A;  3VA5 A;  4P74 A;  4K2K A;  1HTL D;  4R8N A;  1GJX A;  4X3U A;  1UE5 A;  4AYB E;  1UWV A;  5M3M G;  3UI2 A;  1X3P A;  2JN4 A;  1A6X A;  3HOX B;  1K8G A;  2E5L Q;  3K5M A;  4Z9C B;  1PFS A;  3W2D A;  4PMB A;  1E2V A;  3MA2 B;  1F2Y A;  1UEA B;  2KCM A;  3E9I A;  1LTT D;  4B3T Q;  4JC0 A;  4JVZ A;  4R1J A;  1SNM A;  2R3Z A;  1YIJ A;  4N9P A;  3NPP A;  2GVB A;  3HGB A;  3GTP H;  1HUM A;  3S17 B;  3S1Q H;  2HDL A;  2UXD L;  4ME5 A;  4KY5 A;  2G9H D;  2UXB Q;  2A1A A;  3JAM c;  2CWP A;  1I6H H;  1U0L A;  3PUX A;  3CD6 A;  3FKI H;  1A62 A;  2CCZ A;  1X9N A;  1I50 B;  1S5C D;  2JQO A;  2R7Z H;  1IHZ A;  4ZUI A;  3I2Z A;  4I7Z C;  2JA7 B;  3ND9 A;  1SEB D;  5IGC A;  3FMC A;  2M9V A;  3RLF A;  1B44 D;  2XIW A;  1IBM Q;  2DY7 A;  3D6C A;  4ZK9 B;  1BCP C;  4U68 A;  5E4W C;  3IFD A;  2AQ1 B;  3FPU B;  2LS0 1;  3V96 A;  1HZ9 A;  1Y1W H;  2A19 A;  4GNX A;  4LW1 A;  1N36 Q;  3I4M B;  4DV0 Q;  4LF6 L;  1P8L A;  4JYA L;  2YV5 A;  3UDF A;  3KF6 A;  1ZYR D;  3TBI B;  1D5M C;  2BE5 C;  4DU9 A;  2NB0 A;  1CSP A;  3NEM A;  1ENC A;  4CDF C;  5JVG 3;  2C9O A;  5FO8 B;  3K5N A;  4A93 G;  2ALY B;  4A3I G;  2BA1 A;  1EOT A;  1HNX Q;  1SMX A;  2NVQ B;  2R7Z B;  1HCZ A;  2F0I A;  2QKI C;  1HNX L;  2VB3 X;  3S17 H;  2FJ2 A;  1JCK B;  3NUC A;  2F0V A;  2BDN A;  2MHV A;  1ZXT A;  4K8I A;  4KD3 A;  5C4H A;  3HOZ H;  1GUW A;  3MXN A;  2K5N A;  5EBD A;  4F7X A;  1I94 L;  1XJV A;  4IN3 A;  1EWH A;  1PRT B;  1E1O A;  1VQF A;  2IPK D;  4L5T A;  2L9H A;  2SNM A;  4XTC S;  4DV7 L;  1Y1W G;  5C5M A;  1NJI C;  3FKI B;  3T4A C;  1I4G A;  3CPF A;  4MZ9 A;  4DK6 C;  1LTS D;  2R7D A;  4JYA Q;  2D5D A;  1LTR D;  1N36 L;  3OW7 A;  2K6A A;  4AH6 A;  1XNR Q;  2MPM A;  3F8T A;  3ZJY C;  1HFN A;  1BDO A;  1U4R A;  2JA7 H;  3BDO A;  3SK4 A;  5BN3 A;  3BDL A;  3WDN A;  1PH3 A;  1KQS A;  2N88 A;  1S5D D;  2A69 C;  1CM9 A;  3BZK A;  1YHA A;  2BDO A;  3OHX C;  3CCL A;  1GVP A;  4JCV E;  3B6Y A;  1EWI A;  1Q7Y C;  3SK8 A;  5K36 H;  3W1B A;  1TS5 A;  1CI3 M;  1RF2 D;  3STB C;  1XYI A;  2PMZ E;  1G51 A;  2Q8T A;  3TDQ A;  1CT1 D;  1QJO A;  2P5Z X;  3KF8 A;  1PRT F;  4GN5 A;  3J7A F;  1D5Z C;  2QDL A;  3TZU A;  2N3S A;  4YY3 Q;  4DXG A;  4DR1 Q;  4LF8 Q;  5KNB A;  1UE7 A;  4BBR B;  3U9S A;  1EYC A;  1G8Z D;  2PW5 A;  2J0T D;  3RD4 A;  2EXD A;  3AYH B;  4ZUJ A;  5IYD G;  4C3H B;  4KMU C;  3AFP A;  3NBH B;  1PMR A;  1VDZ A;  4B3T L;  1QCB D;  1IZ6 A;  1QUQ A;  4JI4 Q;  1CZW A;  4XDX A;  4JPB W;  2HT1 A;  2D9U A;  3RMH A;  1E2Z A;  1FNV A;  2CW0 C;  5IYC H;  2PMZ B;  3HOZ B;  3J81 j; 
#chains in the Genus database with same CATH homology
 1PH9 A;  1N33 L;  2OTJ A;  3CXC A;  2F52 A;  2VZA A;  1QVF A;  1Q86 C;  2NN6 G;  1RL2 A;  2NZO A;  1HH2 P;  1MJE A;  2K14 A;  4NXM L;  1R9T H;  2JEA I;  4YHH Q;  1FJG L;  2JA8 G;  4DR7 Q;  2K52 A;  2Y0S G;  3RNU A;  1YHB A;  2IT1 A;  5IP9 H;  3KFU A;  1H95 A;  4KHZ A;  1WOC A;  4R4C A;  2JA6 G;  1HNW Q;  2ID0 A;  4B3M Q;  1S40 A;  4DV0 L;  1ASZ A;  1Y14 B;  4A3I H;  2FXQ A;  1PH8 A;  5ELN A;  1X65 A;  2HIX A;  3I7F A;  3L2P A;  1I3Q H;  4LUZ A;  3GTG H;  5JJI A;  2B63 H;  2R6G A;  4K0K Q;  5C44 G;  2JA8 H;  1CKN B;  3D31 A;  4YCU A;  1S72 A;  5FJ8 G;  2OWO A;  2KBN A;  2ZM6 L;  4C3H H;  3ULP A;  2JA9 A;  1L1O B;  2KEN A;  3J81 i;  1MJC A;  1I50 H;  3FKI G;  4JOI C;  2E2H H;  2YU9 H;  2HIV A;  4NXM Q;  4NB3 A;  3RN2 A;  4A3E H;  1EIY B;  2HHH L;  1VQJ A;  4B3R Q;  4A3B G;  5GAH C;  2UXC Q;  2VNU D;  3E0E A;  3RN5 A;  1FL0 A;  2WAQ G;  4DAM A;  1EQQ A;  4B3S Q;  3K80 C;  4HJ7 A;  4LFC L;  2MNA A;  3GTO H;  1XTD A;  1VQA A;  1YHQ A;  5H1S E;  1WCM G;  3KF8 B;  5BR8 L;  3G6E A;  1KC8 C;  3HOW H;  1CUK A;  3S2D H;  4P72 A;  1UEB A;  4WJ4 A;  1JT8 A;  3OYY A;  4JI1 Q;  3I4M G;  1L2F A;  1QVC A;  3PF5 A;  1S3O A;  1I5F A;  4DR2 Q;  1MKH A;  2F4V Q;  4UP9 A;  2OQK A;  4JI8 L;  3JAM i;  2LXK A;  3BZC A;  1YVC A;  3CCE A;  1HR0 W;  5GAG C;  4IFD I;  4L5Q A;  2IX1 A;  1XMO Q;  1YEZ A;  3UDG A;  3GTJ H;  1L1O C;  2VUM H;  2ZTE A;  1NMG A;  1N9W A;  4GLV B;  1SR3 A;  4EX5 A;  1P16 A;  2EIF A;  4B3R L;  1Y1V H;  3M3Y H;  1VQO A;  3MEF A;  4YY3 L;  1SFO H;  1C9O A;  1LYL A;  4LF5 L;  5IP7 G;  1XPU A;  4GN3 B;  3CAM A;  2VS1 A;  4X65 L;  3H15 A;  1QZG A;  4LF7 L;  2D0O A;  1Q12 A;  4HJ5 A;  4NPS A;  3GD7 A;  5FJ8 H;  3PCO B;  2E5L L;  5LMU Q;  1Y1V G;  1XNR L;  2Z6K C;  1E1T A;  1V9P A;  5IE8 A;  3T1H L;  4BA2 I;  3RZD H;  1YJN A;  1SE8 A;  3CCJ A;  3PIP A;  2F4V L;  3WWV A;  1NBW A;  1E3P A;  1VQH A;  2JA5 H;  2VQF L;  4P75 A;  2YTV A;  4DUY Q;  3MXN B;  5C4X H;  4A3M H;  2IHE A;  3S1R H;  1IYJ B;  5AJ3 Q;  5IYB H;  5IP9 G;  1I94 Q;  2WB1 G;  3K0X A;  1SN8 A;  2NZH A;  3NEL A;  3ULL A;  3PUW A;  4HJ9 A;  1V43 A;  3S16 H;  2JK8 A;  4PMW A;  4A4I A;  4DR4 Q;  1D7Q A;  3HOZ G;  5C44 H;  3CPW A;  3I4M H;  4DV1 L;  4BXX H;  4JOI A;  1NE3 A;  1VQ7 A;  2B63 G;  1GKH A;  2GN5 A;  2ZJQ A;  2CWA A;  1HNW L;  2ZTD A;  1Q8K A;  4AYB G;  3AEV A;  4JBM A;  4IPC A;  3RZO H;  4QIW E;  4R4I A;  2Q2I A;  2H5X A;  1J6Q A;  1TWG H;  4DV7 Q;  1XNQ Q;  3ICE A;  2D0P A;  3TEH B;  1XMQ L;  4KHP L;  3F2C A;  4DUZ Q;  4GKK L;  2Y0S E;  3HKZ G;  4LWC A;  4K0K L;  3FHW A;  4C2M H;  5IYC G;  4APV A;  3UDI A;  3OTO Q;  1KXL A;  1HZA A;  3SGI A;  3I56 A;  1E22 A;  1CKN A;  1PH4 A;  4PZ6 A;  3RR5 A;  1HJP A;  4H02 A;  3U58 A;  2UUC L;  1E7Z A;  3M4Q A;  4LUV A;  5LMN Q;  4BY7 G;  3HOV H;  1KL9 A;  2UUA L;  3T1Y Q;  4JBK A;  3K7A H;  1OXT A;  3K81 C;  1XMQ Q;  1JB7 A;  1EFW A;  1K8A C;  4KHP Q;  3A5Z B;  1OXX K;  4LUO A;  4DV3 L;  4A3J H;  4DV3 Q;  3M7N A;  1TWF H;  4YHH L;  1FJG Q;  2UUB L;  4DR7 L;  1EIF A;  4MNO A;  2VW9 A;  4P71 A;  1QVG A;  4LNQ A;  3UDX A;  4J15 A;  4OX9 L;  1X3E A;  5M5W H;  2ZJP A;  2VQE L;  1X54 A;  1Q82 C;  1PHJ A;  1N33 Q;  1K0R A;  1BKB A;  2KHI A;  1KHI A;  3AFQ A;  5IWA L;  5IT9 c;  3HOV G;  1PYB A;  1JE5 A;  3STB D;  1PH7 A;  3CCQ A;  3HOX H;  2UU9 Q;  4JI3 Q;  4FDB A;  1JJG A;  4YCV A;  4DUZ L;  1Z9F A;  3CC2 A;  3KDF B;  4JI4 L;  3F1Z A;  5AJ3 L;  3NEN A;  2LXJ A;  1XNQ L;  3DM3 A;  2E8G A;  1EUJ A;  5M5X H;  1C0A A;  4ME3 A;  3G48 A;  2PI2 E;  1VQG A;  2GVA A;  2LSS A;  4O0A A;  1HR0 L;  2K50 A;  4DR3 Q;  1IBM L;  1QUQ B;  2HQL A;  4R4O A;  4JI2 Q;  1FVI A;  1TWH H;  4JV5 Q;  1X56 A;  2NN6 I;  1NMF A;  4BXX G;  3PV0 A;  1VS0 A;  5HGQ A;  3T1H Q;  1HZB A;  3ERS X;  3H3V I;  4JBJ A;  5HY6 A;  1CKO A;  2D62 A;  4A3L G;  2C35 B;  4EQ5 A;  1KRT A;  4LF4 L;  1FGU A;  1Z47 A;  1YZ6 A;  4X65 Q;  3GTQ H;  2E2J H;  1WCM H;  2PQA A;  1XPO A;  1VQC A;  3AQQ A;  1TXY A;  4LFA L;  1AH9 A;  3RLN A;  2K75 A;  5C4X G;  1Q46 A;  4HIO A;  1KRS A;  5E7N A;  2JA5 G;  2PNH A;  1N8R C;  2MO1 A;  1VQB A;  3H0G G;  4X64 Q;  5M3F G;  1K73 C;  4TVA B;  5LMN W;  2YYZ A;  5C0X J;  1SLJ A;  1KD1 C;  2ZTC A;  1AE2 A;  3HKZ E;  2NVY H;  2RCN A;  3HFZ B;  5DLQ E;  3CCU A;  3RLO A;  1DGS A;  2WFW A;  5JEA G;  4A3D H;  2Q2H A;  1OXU A;  3U4Z A;  2AWO A;  1U5K A;  5GRO A;  4DV4 Q;  4JI7 Q;  4A3F H;  4IOA A;  4RG1 A;  4A3E G;  4LF5 Q;  3HKS A;  4NXN L;  2IHF A;  3PUZ A;  2IY5 B;  2VL6 A;  4DR5 L;  2RHS B;  3S2H H;  2OCE A;  1W2B A;  2B3G A;  1PH6 A;  1K9M C;  5M3M H;  5FLX c;  2UXC L;  1WJJ A;  3GO5 A;  3GDE A;  1AE3 A;  4IJH A;  1X3F A;  4O2D A;  4R4Q A;  5EAY A;  3G4S A;  4GOP C;  5C4J H;  1MIU A;  1K83 H;  4JI2 L;  4OX9 Q;  4DR6 L;  2UXD Q;  4JI8 Q;  1NTG A;  3CF5 A;  3J80 c;  1JMC A;  4A3G H;  3HOY H;  3U50 C;  4ALP A;  4IOC A;  4A3L H;  2N49 A;  1K3R A;  1E24 A;  3J7A 5;  5BR8 Q;  2Q2U A;  4OXP A;  2CKZ B;  2UUC Q;  4JI0 Q;  2N8N A;  1V1Q A;  4GOP A;  2AHO B;  4UPA A;  4AIM A;  1VQ9 A;  1RIP A;  2UU9 L;  4QGU A;  3CCS A;  4A3C H;  1J5E Q;  3EN2 A;  3I4N G;  1WFQ A;  2QEX A;  3GTM H;  3S14 H;  4UP7 A;  2RHQ B;  1TWA H;  4AQY Q;  1PH2 A;  2B29 A;  3H3V H;  3W5O A;  1M90 C;  2JA6 H;  3W1G A;  2R92 G;  2OQ0 A;  3KJO A;  5IYD H;  1A0I A;  4LF9 Q;  2CFM A;  4IFD G;  2Z0S A;  4GOP B;  1G29 1;  3T1Y L;  2UUA Q;  5C0X I;  2AKW B;  4LF6 Q;  4GNX C;  5LMN L;  1T9H A;  4Y52 H;  4JI5 Q;  4KI0 A;  1A63 A;  3I4N H;  1VQN A;  2MO0 A;  1ASY A;  3CME A;  4POG A;  4LFB Q;  5K36 G;  4JI5 L;  5IYB G;  2WP8 J;  3J80 i;  3K8A A;  4PZ8 A;  4BY1 G;  4A75 A;  4IPD A;  1N32 L;  2VQF Q;  4DUY L;  4IFD J;  1YJW A;  4P74 A;  1B8A A;  3PGZ A;  4AQY L;  4HIM A;  3PO2 H;  5ELO A;  4DR6 Q;  1UE5 A;  4AYB E;  1UWV A;  5M3M G;  2ASB A;  3BU2 A;  1VQ4 A;  2Z6K A;  3L0O A;  4DK3 C;  4A3G G;  1EOV A;  1PVO A;  3K7U C;  3CCV A;  4A93 H;  4XIG S;  4OO1 I;  3KF6 B;  1D8L A;  1IBL Q;  1K8G A;  2E5L Q;  4DV5 L;  2NVQ H;  1PFS A;  4IO9 A;  4LF7 Q;  3LGJ A;  3PSI A;  4PG3 A;  2KCM A;  4GNX B;  3E9I A;  2I5L X;  3KOJ A;  4B3T Q;  4JC0 A;  1HNZ Q;  2KCT A;  3PUY A;  4DV4 L;  1VQL A;  4OWW B;  4PZ7 A;  4GKJ Q;  4YWM A;  4A3C G;  4R1J A;  2MFI A;  1YIJ A;  2K4K A;  1O7I A;  1B7Y B;  1VCI A;  1X55 A;  2GVB A;  4A3F G;  4BBS G;  3GTP H;  4JI6 L;  4QJF A;  3GTK H;  3S1Q H;  1L0W A;  2UXD L;  2V1C C;  3TRE A;  1WYD A;  2YTY A;  1VQP A;  2PQA B;  5GQO A;  1W3S A;  3EIV A;  1GD7 A;  4JI6 Q;  3M4O H;  2UXB Q;  3U4V A;  1IBK Q;  5JJK A;  4DKA C;  2A1A A;  3JAM c;  4LFA Q;  5C3E G;  2AWN A;  2CWP A;  3J7Z C;  4HIK A;  2R93 G;  1I6H H;  1U0L A;  3PUX A;  2RF4 A;  4X66 L;  4HID A;  3CD6 A;  2WAQ E;  1PV4 A;  3FKI H;  1A62 A;  2CCZ A;  2YTX A;  4X62 L;  1X9N A;  2DGY A;  2JQO A;  2R7Z H;  4DV5 Q;  3OW2 A;  4LFC Q;  1IBK L;  1VQ8 A;  2N78 A;  3TRZ A;  3J81 c;  5J3B A;  2K5H A;  2JA7 G;  3EBE A;  1N34 L;  3I2Z A;  4TQU S;  2HHH Q;  4X64 L;  1Q1B A;  3RLF A;  4IPG A;  5FLM H;  1IBM Q;  3KDF A;  1BBW A;  1SRO A;  4DR2 L;  3UE0 A;  4QQB X;  2F3I A;  1HR0 Q;  1EYG A;  4QY7 A;  3M9B A;  1OTC A;  1YBY A;  1PYS B;  2IX0 A;  2VUM G;  2QGQ A;  3PO2 G;  4BBR G;  1HZ9 A;  1Y1W H;  2I5M X;  1IBL L;  4JI3 L;  3TS2 A;  2A19 A;  4GNX A;  3A5U A;  4LFB L;  4BA1 I;  4LW1 A;  1N36 Q;  3KYH C;  4DV0 Q;  3M4P A;  4LF6 L;  1P8L A;  4JYA L;  2YV5 A;  4OWT B;  3UDF A;  1PA6 A;  4A3B H;  3KF6 A;  4RMF A;  1X6O A;  1YIT A;  3KJP A;  4A3K H;  5M5Y H;  2UUB Q;  1N32 Q;  4BY1 H;  1SRU A;  2DUD A;  1VQK A;  4IJL A;  2NVX H;  2BH2 A;  1B70 B;  2XGT A;  4Y7N H;  2PI2 A;  2WB1 E;  1CSP A;  3NEM A;  4JBW A;  4UY8 C;  4YWL A;  3TQY A;  3UE1 A;  4IPH A;  3E9H A;  4BY7 H;  3OTO L;  4DNI A;  4JI0 L;  1CSQ A;  3BJU A;  4A93 G;  1CKM A;  2ALY B;  4A3I G;  2BA1 A;  4B3M L;  2R92 H;  3HOU G;  1YJ9 A;  1XPR A;  3M85 A;  4LF9 L;  1Q81 C;  3FP9 A;  1HNX Q;  1SMX A;  1WI5 A;  3VDY A;  1IL2 A;  2VY3 A;  1NY4 A;  4MTN A;  3DLL A;  4YWK A;  4HJ8 A;  1YI2 A;  3G71 A;  1HNX L;  3L7Z C;  4P73 A;  1JJ2 A;  4OWX B;  2Q2T A;  1OXS C;  4UP8 A;  4A3K G;  3S17 H;  1J5E L;  1VQD A;  3HOY G;  2ZJR A;  2KHJ A;  3I55 A;  4DV2 L;  2JJQ A;  5FLM G;  3HOZ H;  2ES2 A;  4DR5 Q;  3PO3 H;  2K5N A;  1UE1 A;  5GAD C;  4WJ3 M;  4GKK Q;  3CC4 A;  4X6A H;  3F2B A;  1I94 L;  1XJV A;  5JEA J;  2CQO A;  4DR1 L;  1VQF A;  4L5T A;  1E1O A;  4GLX A;  4NXN Q;  4XTC S;  3D0F A;  4DV7 L;  1Y1W G;  1QZH A;  4JI7 L;  3PIO A;  3S1M H;  2A8V A;  4KLK A;  1NJI C;  2EQS A;  1VQE A;  2E2I H;  3CPF A;  4MZ9 A;  4DK6 C;  5GAE C;  4A3M G;  2R7D A;  4C3I H;  1C7Y A;  4JYA Q;  4DV1 Q;  3KLW A;  1HZC A;  3ULJ A;  1PH1 A;  1N36 L;  4DR4 L;  4JG2 A;  1N34 Q;  1UE6 A;  4AH6 A;  1XNR Q;  3F8T A;  2AMC B;  3ZJY C;  1VQI A;  4L5S A;  1EQR A;  3CC7 A;  2JA7 H;  3CP0 A;  4X62 Q;  4POF A;  3PUV A;  4LF8 L;  4DV6 L;  2XTI A;  1PH3 A;  1KQS A;  3PF4 A;  1OXV A;  1X3G A;  4DV6 Q;  1VQM A;  2QA4 A;  3BZK A;  1YHA A;  3CCM A;  3CCL A;  1GVP A;  4LF4 Q;  1GO3 E;  2JEB I;  3H0G H;  4JCV E;  5M3F H;  3B6Y A;  3CW2 C;  4OON A;  3ER0 A;  3F2D A;  2UXB L;  1EWI A;  3CQZ H;  2L15 A;  1Q7Y C;  2R93 H;  2I0Q A;  4BBS H;  4BBR H;  4A3D G;  1LUZ A;  1VQ5 A;  1JJC B;  3W1B A;  3TS0 A;  2JE6 I;  3STB C;  4JV5 L;  2PMZ E;  5LMU L;  3IRB A;  1G51 A;  1Q1E A;  4QL5 A;  2BH8 A;  5C3E H;  1A8V A;  2R7F A;  4GN5 A;  4GS3 A;  4YCW A;  1PH5 A;  2NVT H;  3S1N H;  4JI1 L;  4HJA A;  4X66 Q;  4R4T A;  2N3S A;  4YY3 Q;  1GM5 A;  4DR1 Q;  4LF8 Q;  1VQ6 A;  1UE7 A;  2OTL A;  1G6P A;  1BVS A;  1YNX A;  3A74 A;  3Q8D A;  4A3J G;  4DAY B;  4A76 A;  2ATW A;  1KAW A;  1XMO L;  3S15 H;  2R7Z G;  3I4O A;  2EXD A;  5IWA Q;  3S24 A;  3AYH B;  1L1O A;  1TWC H;  2I5H A;  2VQE Q;  4GLA C;  1M1K C;  5IP7 H;  5IYD G;  3JC6 6;  4DR3 L;  1LM0 A;  1BBU A;  3AFP A;  3NBH B;  4GN4 B;  3GTL H;  2ZM6 Q;  3HOW G;  4GKJ L;  2BA0 A;  5JJL A;  1HNZ L;  4B3T L;  3HOX G;  1IZ6 A;  1QUQ A;  4JI4 Q;  5IY0 A;  4DPG A;  2MQH A;  3CMA A;  3CCR A;  3A0J A;  2HT1 A;  3HOU H;  4L5R C;  5C0X G;  4B3S L;  2K5V A;  5IYC H;  4DV2 Q;  1IXR A;  4C3J H;  1LTL A;  3PO3 G;  1KIX A;  3J81 j;  4OO1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...