3MXOA

Crystal structure oh human phosphoglycerate mutase family member 5 (pgam5)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
202
structure length
188
Chain Sequence
SMDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of PGAM5 Provide Insight into Active Site Plasticity and Multimeric Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase PGAM5, mitochondrial
total genus 70
structure length 188
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3mxoA00
2EKBA 2WNIA 2EKZA 1K6MA 3E9DA 4PZAA 2P77A 3R7AA 1XQ9A 1BQ4A 5HTKA 4PZ9A 5AJVB 4QIHA 1QWOA 2BIFA 5CU7A 1ND5A 1DKMA 1YJXA 1QHFA 3PGMA 5AJWA 1RIIA 2IKQA 2YN2A 1ND6A 3ZHCA 1DKNA 3F2IA 3IT0A 3NFYA 2H52A 1DKQA 1E59A 2HHJA 4GPIB 5PGMA 3MBKA 4E3WA 2H4XA 3NTLA 2P9YA 4PGMA 5CDHA 3D6AA 1V7QA 3FDZA 1UJCA 3F3KA 2ENUA 5AJZA 2P2YA 3DB1A 1FBTA 2ENWA 1DKPA 2P75A 2P9FA 3O0TA 2OWEA 2I1VB 3KKKA 2A9JA 3DCYA 4ODIA 5AK0A 2P2ZA 1C81A 2P6MA 3FJYA 2WNHA 1NT4A 4D4LA 1SKAA 3LL4A 3EZNA 1EBBA 3E9CA 3K4PA 1C7ZA 3GP3A 2RFLA 3IT3A 3GW8A 1RPAA 4FDTA 2P30A 2YN0A 1CVIA 4ARVA 3BIFA 1T8PA 2AXNA 1V37A 1H2FA 3E9EA 3QPWA 2QNIA 2DWPA 4ARSA 4JODA 2P79A 3LG2A 4D4JA 4IJ5A 4EO9A 5AJYA 1SK8A 2EOAA 2HIAA 4JOCA 3IT1A 1DKOA 1BIFA 4AROA 2P6OA 1RPTA 2A6PA 4FDUA 1H2EA 5CX4A 2P78A 1BQ3A 4D4MA 2PA0A 4ARUA 1UJBA 2GFIA 2OWDA 3C7TA 2WU0A 3LNTA 3QPVA 4D4KA 3QPUA 4MA4A 4EMBA 3OI7A 1C80A 2H0QA 1YFKA 1E58A 2F90A 3D8HA 2P9ZA 1QFXA 3D4IA 2DWOA 5AJXA 5HR5A 1FZTA 4HBZA 4TSRA 2HPAA 3EOZA 4GPZA 2H4ZA 3K4QA 3MXOA 1SK9A 1IHPA 3HJGA 4IJ6A 1DKLA 4JOBA 1TIPA 3IT2A 1SKBA 3FDZB 3GP5A
chains in the Genus database with same CATH superfamily
1MJHA 3T0GA 2WDZA 1O8BA 3KBBA 1GO2A 4JI8B 4G4GA 2E9SA 2PX5A 1EK5A 1Z74A 5EWLB 2A9QA 2OHXA 5JJIA 1LA2A 1SVSA 3DOEA 1DFGA 2UKDA 4QIHA 1XWWA 4TMWA 1TQHA 1AD2A 3AHCA 5LXTB 2AXQA 4CHTA 1ML4A 2O5VA 3HN2A 4H16A 5EZYA 3OF5A 3D4LA 4IOLA 4KPEC 4LX0A 1I9CA 1S2OA 2NM0A 2C1XA 2RHDA 2O4CA 4HVLA 4JP5A 2EKQA 5JH7A 1KFEB 5J2UA 3B20A 3HM9A 2ID9A 4XVCA 4E3WA 4BGUA 2N0SA 1DNPA 2Z0MA 3NBXX 2VCEA 4J2OA 2FUG1 4TVBA 2OV1A 1BXRA 1R0BA 2EATA 1M2OA 3RS3A 1CY0A 5FNVB 3WRVA 1H5UA 2MIIA 5G0UA 2Q2VA 1RBMA 4AU1A 2FRDC 1U2DC 1YO6A 3KR1A 2TMGA 4BNDA 1WCYA 4KXNA 4DIUA 1XCOA 1D9XA 4DKJA 4LMRA 3EXHA 3WYDA 2P75A 1X1AA 1JLHA 3B53X 4DQUA 1V5WA 1YUNA 2YMPA 1TYDE 1TYBE 4OIMA 3WL8A 5LQNA 3R0XA 3UJ3X 4TLEA 4ZO6A 2BISA 4FHCA 1FTGA 1PHPA 5ITVA 5DW0A 5J2TF 4D9FA 1C0PA 3LDUA 4X65B 3W5UA 2V6GA 1SKAA 2CK3A 3AERB 4GMHA 2LCFA 1UODA 1U8AA 4NZNA 3RIEA 3WLMA 3ZW7A 5FAKA 5DTEA 3N2YA 4BMXA 5LDDC 4WL0A 1Z4IA 1IWPB 4BBJA 3HB5X 4TL9A 1NDQA 3QWIA 4PWYA 4DLXA 1O5OA 5I8PA 3PEYA 2D3WA 4YUZA 1YVUA 1EXWA 3IXLA 1ZM2A 5EHGA 2QM3A 4EJ0A 1POWA 1FQOA 3PS9A 4K9QA 5JNVA 3KO8A 1L5RA 4R9RA 1ATZA 1J0BA 2AR7A 4KGZA 4Z0NA 4DVGA 5ENDA 4BGDA 2A1UB 3HDVA 4TSFD 2FHPA 1VJ1A 2XUDA 3ESDA 4QLOA 1QYRA 1UBNA 3SZRA 3UO8B 5IX8A 1BRMA 2QRZA 4P2GA 2NU7A 2PL1A 1KJYA 4P2BA 1Z47A 4GWLA 1T0PA 1PJLA 5G0VA 4KWEA 1KI6B 2V03A 3JZMA 1UKZA 1XQWA 4YGXB 4QHYA 3M49A 4GPAA 1XTVA 1TAUA 5I9SA 1KMMA 3QE9Y 1QFJA 2Q6IA 1XJWA 3PG5A 2NNWB 1FMCA 4PWZA 4INAA 2A59A 3OI7A 1C80A 1YDHA 4G8BA 1REQA 1N5DA 1ZJ5A 3ZE6A 1FRNA 3BCSA 2IELA 4U3JA 2CVHA 3OF3A 1NLFA 3SGLA 3CKLA 3JVEA 5IYZF 3GR6A 3V1KA 3GVHA 2XDQB 3O8OA 2XYVA 3BBPA 1Z6ZA 3BB3A 3I92A 1RW4A 4FFWA 2WSIA 4R8SA 2QN2A 5ALYA 1G9XA 3TZHA 1N7HA 3RTGA 3AIKA 5B3LA 1I13A 1LI5A 3OURA 1XE3A 2BEKA 5DNCA 2YW2A 2Y92A 2QYSA 3EOBI 3BMNA 4DB4A 2NUBA 3EW7A 5KEIA 3IH5A 2COKA 1CQWA 4MW2A 2BKXA 3F67A 3OCJA 3OPQA 3OPYI 5EG5A 1XVTA 4B87A 3G8BA 3L6CA 3N58A 4BRSA 5B6JA 5AVRA 3SZUA 3UK7A 4RFSA 1ZSVA 3B2QA 3H6KA 2J4CA 3GFQA 3KLBA 3SZGA 2HJSA 5HTKA 2GLTA 4LJRA 4FN4A 2CW5A 3D3WB 3SQDA 4KWHA 1RACA 4I8IA 1ECCA 4ZXFA 4F96A 2MSNA 3D6VA 3LUKA 1QHFA 4PRKA 1XZAA 4NENB 5B1IA 2JFUA 4RHCA 3GVCA 4CLHA 3TQRA 1I7DA 4O1MA 1RLUA 1C9EA 1NSTA 2WM2A 1ZNQO 3HACA 1JYSA 3TL3A 5ALWA 4V1CA 1V16B 4HZUB 4MV4A 1R6BX 2FUG6 2ONYA 1QFSA 1F06A 4GLOA 4XDGA 4DMLA 3BS4A 3ZV7A 3T5AA 1MEJA 1FFEA 2ZI6A 1GPUA 1C0IA 4A82A 1WHSA 1E89A 1U0HC 3NRCA 1US8B 1SUFA 3EMKA 5K6TA 4BCDA 1E6KA 1NUAA 3G9UA 3JAWA 3B9PA 1RHQA 4QXAA 1LB1B 4RK5A 4YAWA 5KWJA 2DY0A 5CLGA 1PVOA 2BP7A 4IRXA 1F48A 2HJWA 3CLVA 2G1KA 3H4TA 3VZDA 2HNAA 4H2DA 3X1JA 2XHEA 4F3KA 5ADVA 5JY1A 3RCBA 4L22A 4KOEC 5L4SA 2P2LA 4YJDA 5JJLA 4XGQA 3VH2A 5FNVA 2CZGA 4EG6A 2OVBA 4YRQA 1HTBA 3DLPX 1EBBA 4Y3UA 3F3YA 5AVQA 4M9XA 1OTXA 3N6RA 3IJEB 3RGGA 2V7PA 4H7HA 3HA5A 1PR9A 3DZ8A 2C4UA 4RQBA 3F90A 1B14A 2YN0A 3KWFA 4N5IX 4QBGB 2PO5A 3IR7A 1PEDA 5LU8A 1EVLA 2YS6A 1V37A 4DM7A 4JQCA 1QQBA 1MIOA 1RWOA 3C16C 1CSEE 3JARB 5JSZA 2PRJA 2J87A 3RFCA 3EIUA 5TARA 2AJTA 2WJGA 1XNJA 4INPA 4OGFA 3RRFA 4Z7OB 3W77A 3STYA 5I45A 4V1CI 1KAOA 1G5TA 4O4IA 2NPFA 1M6HA 4ZAYA 3HYTA 2WM9B 1NKVA 4RO0A 2IPLA 3L79A 3O3CA 1NBAA 5HFNA 2ODEA 1E8MA 1XRNA 1GG5A 3JZFA 2MR5A 1H9AA 2IP2A 4PZDA 4UE2A 3SSOA 5KHLB 2PWZA 1RI2A 1EK2A 2HO4A 2VJPA 3NPMA 1ORVA 3ZJUA 3DVAB 3Q1KA 5KKAA 2B99A 3EQ9A 3ZZ0A 5CT9A 2HHCA 3AJEA 2WOJA 4MUNA 5GZ6A 4DV1B 1KYTA 3EW9A 1E94E 3LUPA 2C9YA 1P18A 3BIXA 2VH1A 2HLDA 4M0LA 3RV3A 3KX2A 3WO1A 2CNOA 1O7JA 3U9TA 3NBKA 4WDQA 5ECYA 5KYXB 4KUGA 2R7LA 2ZU6A 2QD2A 1PYOA 5IF9A 3AVTA 4ZGGA 1OXVA 3QUTA 1U0EA 2H4ZA 1XMJA 4PX9A 3R3VA 3PUHA 4QUEA 1IHPA 3U48A 2XE4A 1YZYA 3TGLA 1CHNA 1SOMA 2F9MA 1HLFA 4OSEA 4CLDA 1K7YA 5EL0A 3SKXA 1RRGA 3WYBA 4A27A 3IULA 1C7EA 2PH5A 1JG7A 3DJFA 4ZFNA 1UT8A 521PA 1EP2B 1GARA 4TTJA 1W0CA 3D9QX 3QH4A 4H7JA 2GSWA 1LX6A 2RKWA 2GK6A 4PF1A 1KBQA 3E84A 1QH1A 2HZBA 4PPFA 2P27A 3IIEA 3ZY6A 1A5SB 1KMIY 1ONSA 4KQ1A 4UUNA 3E7WA 1ZBQA 4ZQHA 2YXBA 3AV0B 1LRKA 3VOSA 1NWCA 4ND5A 3W6ZA 2F1OA 4X93A 3IRUA 1TVKA 4MB6A 2JJ8A 4EG1A 1O96A 3EVAA 5IJAA 5CDFE 3AKCA 1I10A 1I14A 3K53A 5FWYA 3OT1A 16PKA 1K1EA 3B52X 3T1NA 4DILA 1EIWA 2I1QA 2NVBA 2EYUA 2F9LA 2I1WA 1GTRA 2G71A 1GAXA 3BGWA 1G2OA 1KI3A 1V8ZA 3LT1A 2ZRGA 4Y9TA 3GXOA 4B2LA 4BQEA 5CITA 1GXSA 5SY9A 4RE5A 3UB3A 3VGPA 2DR2A 3C6KA 3V5NA 1R8QA 3A7DA 4D5GA 3W34A 3KKNA 4A16A 4MS3B 3ADCA 5I5EA 1SCUA 3ZCUA 1ZXLA 2HA7A 4HXFB 3KT6A 4U7PB 2X0DA 4MYUA 5T7BA 2GJSA 2VWQA 5KSYA 1WMBA 3BJZA 3GU3A 2QW8A 2A9KA 1UBTS 3CISA 1OXTA 8ATCA 1YHZA 4F2DA 4KDCA 5SZJA 1T3LA 2ZIAA 3H3XA 3NVDA 3AETA 4XWKA 4I1PA 3EPLA 1EFAA 2RGNA 2Q07A 4KLRA 1YV9A 4R6WA 1A8SA 1Q74A 1W88A 4MO2A 3ZGLA 1IQ0A 3C8DA 2CMHA 2R6HA 1INLA 1VRCA 4LC9A 5J40A 3Q8LA 3HYNA 3V8QA 3NIDB 4AO8A 1GNQA 4RADA 1ZPDA 4N0EA 4QE3A 1EDDA 2V7XA 3SXPA 2GD0A 4X1OA 5LZ4A 1U2PA 3JQ9A 4XUCA 2BHRA 3I4LA 2PGDA 3L0PA 4XB1A 1W93A 2R1TA 4Q9KA 3FLBA 4KR2A 1W29A 1UXGA 2OXIA 5T4FA 2ODTX 2A0WA 3DDCA 3TDNA 4UM8B 3K8ZA 1OAAA 4PAOA 2DT5A 5TSDA 1GQ2A 3WK9A 2ET6A 2J9RA 2W5UA 2X23A 4N3AA 5IXJA 3VRHA 1ODJA 4EJ2A 3QX3A 2FWNA 4MKGA 1K68A 3UOAB 5LJIA 4NF2A 2CE2X 2WJYA 5DBEX 4ZAVA 1HTWA 4BIMA 4E22A 3K0KA 5D3ZA 4LZNA 3QIVA 1DB3A 2RCYA 4UOEA 3T3IA 4BO6A 4EUSA 1J8FA 4HX5A 5JD6A 1P1BA 4W82A 5BN1A 1UWVA 1EGVB 4UVIA 1EZ1A 4DIEA 1FFXB 4DC1A 2QROA 4DCOA 4EPYA 4X63A 3NAQA 2CNKA 3ABQB 1G5IA 3B8EA 1FDSA 4ZVQA 2VJQA 1YHYA 1WP9A 1JU3A 4E13A 1X3SA 4HF7A 4RQAA 2FNAA 5B2ZA 2ZS9A 1RYHA 2C0QA 3NXSA 1E6LA 1GYQA 3U49A 1KFCB 4YEDA 4YPFA 1QF7A 3B2NA 2JB9A 3GP5A 1DT5A 2X8LA 1L5SA 3H87A 3M8KA 3QFSA 4OI2A 3TRDA 4I99A 1M5RA 1IZZA 3OM9A 4GI7A 5JCJA 4FXPA 1Y7TA 2NV6A 3BE5A 4NP6A 3FJ1A 4GIBA 4MLDA 5FPQA 3SMQA 3NP7A 2WYHA 2OLJA 4E5DA 2ZYUX 1QTNA 2QRQA 4N6GA 1CY7A 2A5GA 2WZQA 3WYNA 1H8EA 5I7EA 4YRAA 1NY6A 1RAEA 1LF5A 1BDMA 2Y1KA 1HZZA 1PQYA 1LDNA 3C3YA 4AZTA 3E9RA 3N87A 2ZIXA 4BO9A 4Q4JA 1NBWB 3CUKA 4MCIA 4TMVA 3VR0A 3AEKB 2QENA 9MHTA 3RS7A 3FZNA 5HUJA 1U6JA 2O7NA 4CGZA 1GPLA 4NPCA 1N2ZA 4MVJM 1FTNA 3HKCB 3E1GA 1J00A 3SDZA 4MLCA 4ZGWA 4J7UA 2CNDA 1H3EA 1Q1ZA 2XUOA 3X43A 1R18A 3AFIA 3U3OA 2UYGA 1MB0A 1V71A 1SM4A 1PQUA 2XPCA 3EWAA 3UHFA 3PP8A 1E69A 2BRUC 4C2AA 4COOA 2G9QA 2V59A 2VHEA 4CDGA 4Z51A 3O38A 4E2XA 1I6MA 3BXPA 4US2R 1AQNA 1FMLA 2PE5A 2DAPA 3ME5A 3O6VA 4MGEA 2CJYA 2CZCA 4GEKA 5DDIP 3SEQA 3WKEA 1NVUQ 2GWHA 4HAZA 1QHXA 3PZBA 5IASA 1H1LB 2UUBB 2I4NA 2HLPA 3CA8A 1E8DA 4KQIA 2R7NA 5EPUA 2C00A 5L7WA 2EIHA 5J3JA 5GIOE 2CUTA 1IPFA 4FM9A 4GE3A 4U02A 1DDIA 1OE0A 4AQYB 3DKRA 1GAEO 1SU8A 2RFLA 1BHSA 2J5XA 3GROA 4B7AA 2VH5R 5LXTA 1EVEA 2SCUA 4YXWD 1I7NA 3KKZA 1NURA 4XI9A 1FS6A 1P19A 3D3JA 3PFHA 3V6MA 2GBLA 2Q8PA 3AF2A 1QKIA 2J3LA 4YQZA 1OXBB 5K0EA 1FP4A 3ZV4A 3OESA 1WDLA 2YWDA 4OP3A 5KSWB 3T1HB 2BZGA 1ZMTA 2AVDA 4TZ0A 4UDYX 5JIBA 3P2MA 2O0MA 4EO9A 3GJXC 2O5CA 1H2XA 4RD0A 4YCLA 1NUSA 2FKNA 5E6UA 4Q7JB 2HR1A 5DX1A 2B8NA 4EG8A 3LMKA 4YJKA 3H83A 1E1KA 2A6PA 4OHCA 3FYTA 2FSSA 1XDSA 3BGIA 3TW8B 3R0QA 1KS2A 4AG6A 3ZZ1A 2VT3A 2C84A 3IMEA 1NP6A 1Z18A 3EHDA 2IL1A 1JPUA 3DOOA 1T10A 3P9IA 5B3AA 3SJ7A 4CFZA 2QTGA 4BRZA 1VKNA 1BZYA 2I8LA 1Z9BA 3DMDA 1RD4A 3PHBE 4HJRA 1G9SA 2IK8A 4ND8B 1XZHA 4Z8YA 4WMLA 3RTEA 1QFXA 3KOXA 2F1KA 3HJUA 4YDHB 1NT2A 2PRYA 1DHTA 2YZ2A 2CFRA 2QN3A 1JEDA 2EBHX 3HDHA 4WVLA 3TW6A 4DA4A 3T7JA 2HMSA 3Q1LA 1IHOA 3TR6A 3VC2A 3OECA 3K5HA 2WP8J 4UTXA 1RPJA 4H6VA 2DUUA 5HBGA 1AF4A 5A62A 3VNVA 1MJGA 1XLTA 4KJZA 2X2FA 1ZIOA 2G1JA 1KBOA 4DSAA 1RE1A 5MN6A 4L3OA 4WZBE 4YJFB 2G9VA 2Q7DA 3VU9B 2V8BA 1JHMA 1I5OA 2IPMA 1FYEA 3O74A 1SXHA 4Z8XA 4XIIA 4CIDA 2H65A 3ZGZA 4H1VA 3URMA 1XMXA 2GVDC 1VLJA 2RI1A 3W9BA 3U39A 3G82C 1P0IA 3OT5A 4LGMA 4UHEA 1KIAA 3RW9A 1E0KA 3FETA 3KOZA 4JUBA 1EI9A 3MCZA 4YT2A 1YHNA 4YI3A 1NP3A 2GHTA 2J7KA 1ZGAA 5H16A 1EHIA 1THZA 2CHEA 4N8EA 2F4NA 3EPPA 3S2FA 3JW8A 5AKYA 3EEIA 4WK4B 4NYJR 2J9FA 3PDIB 3SJAA 2IUTA 2QTAA 3QVMA 5ALRA 5TNXA 4DWVA 2OSBA 1J2EA 1P2UA 1KYIA 1QGUA 2C4TA 2GGSA 2L18A 2AFIA 3QF4A 4LWPA 4TQGA 5EJEA 1NE7A 1DKPA 4S1OA 5DHQA 3HUUA 5FR2A 3ZDYB 2RGDA 4X66B 4EVQA 1CRZA 3WIDA 1E98A 2BR3A 2BR5A 3AJAA 3RRXA 2AC7A 5IN4A 3CB2A 1CNFA 4RL4A 4XZ3A 5B3JA 3ROGA 1UADA 3GLGE 2VH2A 5EXDA 2RK4A 4PC2A 3B7GA 1UBCA 3CINA 4KLCA 3IHKA 2R48A 1Q1GA 4Q3NA 4NE2A 3AEQB 3R4CA 1EFTA 3JU3A 2ZQZA 4LJSA 4OGLA 3VYVA 1SHLA 3WWCA 3OZUA 1ECJA 1L5VA 5TPZA 5IUJC 2X1LA 3UGKA 5EJ9A 2XI4A 3Q9LA 4HCJA 1E18A 4KRGA 1HOTA 2FOIA 1KFBB 4BEJA 4DJEC 1N2JA 4XR4A 2PUBA 2SHKA 4RJKA 3NO4A 4RCZA 3KJQA 4WGGA 4WOBA 2G83A 5FOVA 1HY3A 4AKIA 2FZVA 2DPXA 2H51A 3C3XA 3MTIA 4Q9JA 3DTYA 4IEIA 5ENVA 1WF6A 1XLTC 2QKYA 2H4YA 4LJ9A 1E96A 3ZWAA 1ZL0A 2C61A 4HDQB 3ZHQA 4ENVA 1KAGA 1M75A 3IBYA 5PNTA 4CKCA 2R1VA 1IY9A 3EISA 4NMWA 1OHHA 1PZHA 4M4SA 4UVGA 3WWEA 4BV8A 1U8EA 1FQJA 1NR5A 1VMKA 5HG0A 5LLTA 1Z56C 5MHTA 2Q1XA 3JAKA 1E9SA 1KKUA 1Q20A 1Y3DE 1O6FA 2W42A 4UBLA 2Z9BA 3IAS1 2OCIA 2VHTA 2QUKA 3OEWA 4KAXA 1FZQA 4CNBA 1WETA 4WJKB 2PA0A 3QPDA 3OSZA 4OHWA 2NOAA 1BMDA 1ZGJA 3TEJA 4C03A 5KVQA 3AUTA 3L6DA 4MRMA 4HX9A 2GHRA 5CLFA 5G4LA 2OGSA 4YJHA 4PIPA 4RIIA 2YKGA 2BUAA 4FZ3A 4RETA 4XUEA 5A0FA 3EC2A 3CG4A 4K9DA 4KXYA 3A70A 2HMAA 3CUEF 4AUKA 2O2YA 2HREA 4MI3A 2AFIB 1C4WA 1L4UA 1ZUIA 3ZCRA 3WSTA 1XU9A 3LHSA 2M2IA 2BGUA 1G21A 1VHDA 3QKRB 3WMWA 2Q41A 1NVMB 2FX2A 4RORA 4YP7A 3B2EA 1XNRB 1ZD9A 1YZNA 5TB5A 1IDOA 3WMEA 4JVNA 4B6OA 2P9EA 3HLYA 5TVKA 3RU3A 2CJWB 3NAGA 1CEYA 2GAFA 1PFUA 3RUCA 2KQUA 4P7BA 4JI3B 3QW4B 1SHJA 1UZLA 2NXCA 1MVLA 3K1ZA 3W2EA 5A3VA 4B44A 1NVFA 4C87A 4B81A 3TS1A 2XVMA 2Q4DA 5G4KB 1TLLA 4JP2A 3GA5A 3ISTA 3TMYA 5BR1A 5C9ZA 3DBLB 1IJFA 2JLYA 1QTQA 2O0LA 1YJBA 4UFOA 4F97A 1M72A 2C31A 3PGKA 4NMMA 1V7ZA 2CLIB 4QDJA 3V2UA 2X9LA 4CU5A 2ZK7A 1HDCA 4A8HA 4B3FX 3E22A 3KL4A 3Q12A 4YJ2A 4JIGA 1K88A 2C5EA 2XB8A 3TZKA 3QXCA 4YJ2F 1YT5A 3K8YA 3DXZA 3FF4A 3OIUA 5DT9A 1J90A 1YRLA 2WFLA 4MUBA 4DYVA 3JYOA 4RA9B 1FJ2A 5P8WA 2YICA 4DSNA 2D6FA 2QW0X 4HGOA 2OC9A 3SWWA 4PNZA 3GEGA 4RABA 3NC0C 5FYQA 4BMDA 2P2YA 1FXSA 3WHKA 3V9PA 3K5IA 3D8RA 3T7RA 1ULBA 3UMVA 1DXYA 2DCMA 3BD7A 5EHIA 1A1VA 2JKZA 1ISJA 1B2LA 1GZ6A 1D4AA 1NIJA 2BDUA 1WVMA 1Z0UA 3K9NA 1KQOA 3OMXA 2ALJA 1RYZA 1YI8A 3JQGA 3PWTA 1FB5A 4YWHA 3Q6IA 5CTJA 3UHJA 3DXYA 3VH3A 2CLOB 3WJ7A 1BVUA 4Q48A 3TPCA 1MAHA 4DCCA 3RUEA 1N8TA 4MQ4A 2A1UA 4W5RA 5AM2A 2FMIA 3NHFA 2C5BA 3HBFA 4YDSA 4BLSA 2QVLA 5K8JB 1CR1A 3HKEA 5FEMA 3V80A 2O6HA 2YJGA 4KP7A 5TMBA 3WYFA 1SUWA 2GEDA 2K6GA 2HQSA 5JNRA 3DH0A 1O8CA 3IUSA 4UE3S 4LDJA 3KQYA 2F55A 1RM4A 2VUHB 1Q0ZA 4FP9A 4HFNA 2WB2A 1N4DA 1PJ4A 1L5WA 3QY0A 4X5OA 2W2LA 2QT1A 5AQEA 5L3SB 2QDKA 1BD3A 3LI2A 4PR0A 1XTPA 1RCTE 4LPKA 3UA4A 1G1AA 4A0GA 5IC4A 5FUVA 5K7SA 1KZHA 3BJRA 5C0OE 4BZPA 2G28A 1K66A 2JLCA 2FZ4A 1J06A 1QVAA 1UIMA 3PI6A 3A3KA 1C7IA 2PRIA 1GPDG 1VYVA 1YFZA 1M0EA 1IONA 1S7GA 5H02A 1W73A 1J7JA 4G65A 4TT3A 4ZHSA 2IHKA 2XB4A 2GN9A 2UZ4A 2HMYB 3EXHB 3A4YA 3Q3GE 5FTKA 3ZX4A 4B47A 3FZYA 1PKXA 1ZSYA 1PKEA 1II9A 1GD1O 2ATIA 2VNKA 5EMNA 5IJ9B 3OU6A 2C7QA 2ZRAA 1GL6A 2QF7A 1A8UA 2VF5X 1Z5ZA 1B8NA 1MX9A 4LVUA 4Y6OA 3G2LA 3TMAA 4LDPA 4MWSA 4QOGA 4CV3A 5FDFA 1NXSA 2GN2A 5JD3A 2WQ7A 4FOLA 3DL0A 3RIGA 1VMEA 4TQUS 3LHKA 4IRMA 1KE1A 4G1FA 1OI2A 1ZOSA 2XE7A 5AH0A 3DMNA 4FC6A 3DBOB 4MKIA 1CVRA 1HYQA 1ORWA 1QIGA 1R8YA 2FV8A 3OUTA 3VZQA 2C1EA 4CLEA 1GCGA 1ZC3A 3VZBA 2P3LA 2XUAA 1U80A 4N6NA 2RKBA 4KCGA 4LI0A 4RK6A 3BOSA 4M0CA 1IZYA 2IHNA 4BNZA 1U4SA 1PEKE 4PS0A 5BW4A 2VA8A 3HY4A 1LF0A 4MUXA 5G1OA 5DU2A 4DZRA 5L3SA 2XVAA 1KXZA 3Q8WA 3HRHA 3UAWA 4YMTA 3KBOA 1PQPA 4LXQA 2OOSA 2J6BA 3QVVA 3AU8A 2YCBA 4FFVA 4B4WA 4LHZA 4IPTA 1XEXA 3VJKA 1IVSA 2C4VA 4D74A 4F85A 4YCBA 2IYZA 4AYTA 4XE5A 4NOKA 3HA7A 2UZ0A 4LOHA 2BFDA 2YVKA 2ZT6A 3DL7A 5D5HA 2GTHA 3DO6A 3A31A 3SIPA 3STXA 4NU0A 3UCXA 3HB4X 4ZIRB 4AMGA 3KKOA 3EASA 4TLBA 3SM3A 5G0SA 2ZBPA 4ITRC 5BY2A 1BJRE 2L42A 3QP9A 3HI4A 2QZ9A 4DR1B 1O95C 2VTVA 2VSNA 3L40A 2BSAA 2EARA 1FSGA 2X0EA 2Z2ZA 3ZH2A 5AJZA 4DM4A 4KIJA 4Z1MD 2JH8A 5F52A 3KZNA 2IHYA 5AKXA 1P1JA 3JYLA 4E12A 2FN8A 4BV9A 1YDEA 4GRDA 4G4JA 3SYMA 3RUHA 1TYCA 3F9CA 4NCIA 4K6MA 2V65A 4Q3EA 3NIGB 3O94A 4MYRA 1QR2A 4CM9D 2FPWA 3ZJVA 3UPUA 3PU6A 3GGGA 4EAQA 1W49A 3LDAA 3ONNA 2ZZKA 4DPLA 1XU7A 3LQ4A 4AZWA 3ABOB 2JK0A 4G56A 4RQUA 1M1YB 1C8KA 5DNVA 3KQUA 1GRRA 2A58A 4L76A 5K51A 3DYIA 3MWFA 3SKYA 5AQ1A 1JR4A 1L1RA 5B64A 4QFBA 1FX1A 1V8DA 3TSAA 3OG9A 1U8TA 1VSVA 3F0TA 3QFCA 4C5AA 3NBAA 2LDBA 3F1LA 5M04A 2EBFX 4YMIA 4Q93A 3TEMA 3QLVA 2PUEA 5EE5B 5A4AA 3E2IA 3NS7A 1CJKC 4I5IA 1JAYA 3SVZA 5TX7A 5AJYA 2O2JA 1CZOA 1E1DA 2FGJA 4MUYA 2CDNA 4ROTA 3GJSA 2EHJA 5KQSA 4IKOA 1S8AA 2ZI7A 4HFRA 1R6TA 5K3FA 4RH1A 3GBVA 2B94A 2AEFA 5AHXA 2BYTA 1AZSC 3H5LA 5KPDA 1T4CA 2P9TA 1YDWA 2YL2A 3AH8A 4GOKA 2GJAA 1EJBA 4FZRA 4DHEA 1E3SA 2PTGA 3D6HA 2WD8A 1XRQA 3PDJA 4I5GA 5BR7A 3HR4A 1W48A 3U1BA 4UEQA 1QCCA 3OEHD 3O5AA 4BWFB 3UUGA 3G9QA 4ZCRA 1SCKA 3RRMA 4IV8A 1L6RA 3KG2A 2RGXA 3HHEA 3PK0A 3SBDA 3DFUA 4DM3A 4DNFA 2EAUA 4UNNA 5F9HA 2Z6VA 3LW7A 4GMFA 2Y1EA 1CLEA 1RZRD 1CG6A 1XZGA 2QRVB 4V0SA 3QTBA 1C9DB 3O2SB 4PHTA 4IDDA 4Y2YA 5AVJA 2WF8A 1FX0A 1T3GA 2R96A 3JWGA 3K6SA 3M82A 3I6IA 3BPSA 4QBIA 4R8MA 5H3CA 1TVKB 3MRSA 4IUBS 3B48A 1F9EA 5B3JC 2BGGA 1EK6A 4JUAA 4ZDJA 2CZQA 1GDDA 2V9CA 4ZO9A 4A92A 4ENTA 1A3CA 1IM8A 4BAZA 3ID6C 1YFLA 2OL4A 3IV6A 2MMGA 3ZGOA 3IVGA 5H59A 3IEPA 4QTZA 3UNXA 4E6EA 4CIYA 1KETA 2NX2A 1QG4A 2CNWD 3LPAA 4HPXB 4MEBA 1YJXA 3RAGA 1XUOA 4OHOA 1E2BA 2XVYA 4M98A 4FX2A 3RSCA 1QRAA 1TL7C 5LP1A 2H52A 1AKEA 4DCPA 3GRFA 3JALB 4WADA 1ODIA 4JI0B 3E0QA 4AKHA 3F73A 3T12A 3FGNA 1ZU5A 3EXEA 1V3VA 3RRNA 3SHFA 1GRCA 2OHIA 4IG9A 2DECA 1ZW6A 4H35A 4Y2GA 3UPDA 4ZCSA 3OQOA 1N2CA 1R6VA 1Z68A 5KYKA 3CJRA 4G67A 3DFFA 3G2JA 4HD8A 4GBED 1D2AA 4L78A 5LWQA 2JGAA 3WBFA 3I2KA 2XNSA 1LDGA 2CNBA 4F06A 3RNOA 1JWAB 1YA4A 1GDHA 2Y6VA 5AKLA 4RIHA 4EUEA 4Z54A 2JL1A 5HOEA 2JFXA 2XMQA 3HNRA 4HO1X 3QENA 2A5JA 5T8KA 3W4KA 4F60A 3SBXA 1W1WA 2GCGA 2J6CA 4K05A 2FJUA 4H6XA 4ZEMA 1VGVA 3WK8A 1JI3A 1TEVA 3PC2A 1KMHA 3TCNA 1TKBA 3E23A 2FI1A 4AX4A 4F21A 4B0PA 1RWPA 1M54A 1AKNA 4NBVA 1XDDA 3GO4A 5TJHA 5FTLA 4YUVA 3DXFA 4LZLA 2QD4A 4R54A 2O4UX 3SR0A 2OCAA 4IRUB 4BO5A 4ESVA 1FBNA 4ER5A 3SHOA 2PX8A 4R2HA 1XMOB 1BFDA 1YE8A 4GOMD 5LPNA 3RTCA 2WTAA 2CNLA 4U39A 4ZT6A 2JFBA 3ZVLA 3E70C 4EY8A 3DE3X 5HUHA 3PUYA 1WRBA 4L2IA 3KPWA 4J7AA 1DWUA 4D4IA 4MQLA 3THWB 4UTNA 2GYUA 3EPHA 1NFQA 1H2YA 1T5TA 1T0IA 5LCXA 4CKXA 1Q0RA 1RRFA 1JFLA 3K3PA 3NJ8A 4EM6A 4WJLA 4RZSA 4YT5A 4F86A 2BDTA 4N0DA 3QKWA 1Q2UA 3VJRA 1OGJA 1EXNA 2X8JB 4MRRA 3ZY3A 4ZAFA 1ECFA 9LDBA 1VMDA 2WFAA 3RYCB 2EJBA 5B58C 4K6KA 4Z0PA 1MC8A 4FGSA 1L7PA 2GNAA 4MARA 3L7YA 3H65A 5AM3A 5IKEA 4TKVB 3ORSA 5KOIA 3UJNA 3U4QB 1SPBS 2XHZA 2QL9A 5CYGA 1TUEA 3BE8A 3SR4A 2VZLA 1O9BA 1AS3A 1EFDN 2O23A 2ECOA 1Z5UA 4YRDA 1YBMA 1SBNE 3QY9A 2DKNA 1WNFA 4NBNA 4QREA 2WC1A 4PHCA 2GZDA 4US1R 2VJAA 4H7EA 2Y0PA 1N2XA 4R31A 3UB2A 3L0ZA 4QUHA 3V2GA 4CEHB 3PNYA 1DCTA 1IWBB 1DG9A 2IXEA 1GNSA 3ECSA 3IQWA 3IVMA 4CMGA 1R8JA 3ANMA 2YXDA 3DD1A 4GZLA 5I4BA 3VNSA 2P77A 1VE7A 4NKRA 2IIVA 5FULA 4FEYA 4QPJC 3ABIA 4RVHA 2IXDA 2XGJA 1IXZA 3EVDA 2ZJFA 1IHDA 4HN9A 2NSHA 5DOZA 5TQ0B 4BVLA 1SZCA 5CCBA 3EBOA 4J94A 3G85A 2XA1A 2HRRA 4LBYA 3IPRA 2IY7A 5C35A 3K31A 2YN2A 4LDAA 1LNZA 1PS8A 4Q1FA 2B7LA 1GZHB 1U1IA 4UAUA 4E1AA 4CT0A 1JH9A 2E87A 6NULA 2DBQA 5FXMA 1QYDA 3WOHA 4CKWB 4N76A 2DH5A 4PGMA 3V48A 5CEJA 3DLHA 3BHMA 2LWIA 3EGDB 2E2WA 3OZEA 3GGOA 3B1KA 1TF7A 2RHTA 4O2BB 1J8QA 2K2WA 2CEKA 1OX4A 2R60A 4YRLA 3KLOA 1L5QA 4OSPA 3OFJA 3ZV3A 2AQHA 1JDPA 2BD0A 1G7CA 1PRYA 4HVCA 1A88A 2QMOA 5MN4A 2JEZA 5JRJA 1C8LA 1RBYA 3ZC3A 4O0MA 4IZ6A 5AI4A 1EWQA 2C07A 2JFOA 3L7IA 3OFNA 1V1MB 3OIYA 3A4MA 1MTOA 2FWAA 4CMIB 4MMYB 1GNRA 4HB2A 4YASA 3V7YA 1ZM3A 2G40A 2X0NA 4TYWA 4QX6A 4YCCA 4YRSA 2POCA 4K1XA 3HXOA 2QK4A 1L1QA 1E3DA 2YXPX 4ZDIA 1Q7EA 2CFCA 2G4VA 4PLWA 5B1DA 4N5HX 1YQWA 1WS6A 1SCDA 2ZLBA 1J9EA 1SFRA 3BH6A 1TM3E 2FPRA 4NMLA 1SVOA 4GI5A 3VR5H 1EWKA 3UT6A 1O6ZA 2CLKB 5FOQA 1RAHA 2ACVA 4C4YA 2XNJA 4AULA 2FFHA 1RJ9A 2QL5A 3K09C 4WK2B 3MHPA 2PNFA 4NFSA 1UQUA 4UZFA 2DWPA 4O2AF 5KDLA 4ZVRA 4O4HA 1ADFA 2CMFA 3LX4A 4ZTUB 1O95A 3HCBA 3WWZA 4LNUB 1W76A 3FFXA 3ZD8A 1C9MA 4TKVA 4B80A 5BNTA 1ESNA 3N3AC 1A7UA 5GAJA 4CEIA 4MPPA 3FKSD 4AYXA 7MDHA 3IUPA 4CMEA 3LVRE 4C0LA 2OFWA 2QL7A 1VIVA 3TGPA 2O7RA 1I24A 2XY4A 3QXGA 4XX0B 4B71A 5LUAA 3L1VA 4Z4QA 4YGYA 2K7FA 3B6EA 1ZQ9A 1DCFA 4LF8B 3LPDA 4JOQA 4EI9A 3AL2A 1WTAA 4FMPA 5TXGA 3RWBA 3HCFA 4C04A 2DRIA 4Q4CA 4F91B 5IVKA 1Y8QB 3IXMA 2WVAA 1GEEA 1UXOA 1YR6A 1RE0A 2XDYA 3HUFA 1AQIA 3NEYA 4KO4S 3PFIA 3R20A 3CG0A 4WWHA 2BPOA 4DG8A 1BJTA 3FKJA 4Q3DA 3O82A 3JD0A 2GPBA 3IOCA 3JSAA 4QU8A 3SYLA 2YJ4A 2BMDA 5A4FS 4MHSA 1TGVA 4LTNA 4TGLA 5DB4A 1KVRA 5KYVA 4OQEA 4BYGA 1RKXA 2ZIXB 1XQ9A 1J8DA 3NOQA 1XMSA 1HYHA 3RIXA 4Z1OA 2ANBA 1QTRA 2ZTVA 3HCNA 3LS2A 2P5TB 4Z4HA 2F43B 2XWBF 2PT6A 3WTBA 4CIAA 3GUZA 5C4GB 1VPDA 4UEKA 3TZEA 2XZPA 2Q9BA 3LCRA 3W05A 5ERGB 2DQ4A 3KZOA 2CN1A 2ZJYA 4YCJA 4J1NA 3ZDAA 1U90A 2QR2A 2VHZA 3FIJA 3M0EA 4ZK6A 3WO0A 3Q7IA 1NVVR 3DKVA 2PX6A 3MNFA 1WHTA 2GASA 4DS3A 1MRNA 4XCQA 5KNCA 5AJHA 3MOSA 4HXGA 4BNYA 3DTTA 5AVVA 1OJLA 2IH2A 1VCMA 1DOZA 1NR7A 4F71A 2MJLA 4GZ6A 2EP7A 1EGHA 1PF7E 1GUBA 1KYXA 4FSDA 1P9LA 2DFTA 1RPZA 1NMSA 3B8HA 3TZCA 1M2VA 2FU5C 3VPFA 2OK8A 4AB1A 4QA9A 1X2BA 3VHQA 1VC2A 4RHUA 4Q37A 1V9LA 3QNWA 2KS6A 2IDJA 2EEPA 4HH3C 5IT5A 4EKIA 4DC0A 5CLJA 1GP2A 3H9QA 1ZOOA 3LLUA 4OQPA 2VJLA 3HPRA 4PNHA 1GQYA 4H3VA 5IZCA 2EP8A 1MQ9A 3KUDA 2LV8A 2BM0A 3PWKA 4MW1A 4Q6BA 4URUR 2X0FA 1IEXA 1R4MA 3U4DA 2JGDA 1Z62A 4EFDA 3R3XA 2NADA 4YMHA 2P4EA 2BGMA 2Z2IA 4JB0A 3GZNB 3F6YA 3C1OA 2UUPA 1XA0A 2ZUDA 3UXMA 5JFGA 2CV2A 1FYWA 1NUPA 3AY7A 5IULC 1VCOA 3KQLA 3INYA 3EZYA 3P9XA 3CRNA 4IO1A 1ICEA 3GUVA 4IMJB 2WE8A 4LAFA 1Z07A 2C5GA 1DV1A 1KPHA 4MV7A 1CRWG 5K2MA 1JA1A 3DE2X 3WHIA 4OAPA 4BLRA 5J1TB 1XYVA 2AZ4A 4MW4A 1ENYA 1O94C 2EIXA 5T6MA 3UKJA 5K1ZA 4EJSB 4RMHA 2GB4A 3GEPA 3TMKA 3T7TA 1YULA 2WJAA 4J7CA 3KQMA 5COAA 5TR9A 1F1BA 2Z3VA 4C0BA 4LJKA 4ND7A 3L7LA 2QGZA 2ZJ6A 2ZRJA 4PAMA 4UU7A 3JPWA 1KYWA 3T0FA 3SS9X 2HSWA 4F4HA 4BGEA 5K99A 1PJSA 3PDIA 3FFWA 3OM0A 1FU4A 5JYEA 3BE4A 3JYQA 4YDRA 3VAYA 1JXAA 2O06A 1FUYB 1NDUA 1X19A 2H4JA 3GVIA 5IN5A 2Z5VA 2PX0A 1I6WA 3D8HA 2OAEA 3OPMA 5FL3A 1G5RA 4FR2A 3RK1A 2OCYC 3ASYA 4LHWA 3LECA 3NRJA 2PGAA 2DWQA 5DZSA 3B3QA 3KKEA 3TQCA 1JR6A 3WWPA 3C8UA 4QXPA 4TKZA 4C2UA 1XTZA 3SI7A 3WISA 3NXKA 2ACKA 4WFKA 4XEUA 4D82A 2ZS7A 3R0VA 4TMFA 3WNZA 2BFBA 4ZOCA 3GLIB 4I4TA 4AL4A 2QVGA 5JSKA 3LA8A 2PNJA 1GTL1 3VNQA 2WHPB 1WCIA 4AK9A 1K6XA 3I5XA 3UBMA 3L4JA 2Y9PB 3EFOA 1Z4QA 4AJHA 2GR9A 3PL5A 1QPBA 3RSLA 1QH1B 3SIWA 1BCRB 3EY9A 4U7JA 3TW4A 5E3HA 3K2QA 3JD1A 1KU0A 1QVWA 1M8PA 1F0YA 1RBZA 2FF7A 2QZSA 2VN8A 2Z8YM 3MLBA 2C7PA 1QZZA 1TJ5A 3I5UA 1N6LA 3WMFA 4MUEA 1WXHA 1ECGA 2ZSJA 2VPZA 1DEOA 1FFWA 1PE0A 1RC1A 2O2XA 1VSQA 4NC9A 2FEMA 3MWKA 3FPCA 4GPIB 2O59A 2R1TB 2JW5A 3T1TA 1OH8A 3CUTA 1JG6A 1E9VA 3PL1A 3N8KA 1TJPB 1KO7A 2HIMA 2JH3A 3C1UA 3LXUX 4R5HA 2QTZA 1DHRA 1ZNWA 4ZPXA 3ZNQA 4EITA 4ZEVA 3SNHA 1M7HA 2Q45A 4EHJA 5CCXA 1MDFA 1IAVA 2ZU0C 2I3BA 4FYXA 3BH7A 4JROA 3GMSA 4NTZA 1C3VA 1NYRA 4N39A 4Q02A 3AJDA 1DPGA 4TTTS 2GPAA 2VDLB 3OP1A 4U7HA 4EF6A 5KTSA 4IIHA 3JQCA 1XC7A 1Z4PX 4GDMA 3PNVA 1TTQB 3TRIA 3FD8A 1JMKC 4ZEOA 4ZQBA 2FG5A 5CFZA 3WNCA 5AK0A 4EELA 3B6MA 4GR9A 5BN3B 1OBCA 1G4UR 2VCHA 2VI5A 3DE5X 2YINC 4FOTA 4RDCA 3WIUA 4E4YA 3VO1A 4LBZA 3LU1A 3ESCA 3COPA 2GVNA 2Y1XA 4IFTA 1L4BA 3IAFA 4OYHA 3B6JA 4HNTA 1ORDA 1UEJA 2RKOA 5BQOA 2HK9A 3DMYA 3BQNB 4M7OA 4CGYA 5T6BA 4YUWA 4NJOA 1L7BA 1D1TA 3OQHA 4QXRA 1U65A 5CLHA 4TTRA 2Y1OA 1SUEA 3FCSB 2YY5A 3NCHA 1E3EA 2NTVA 3QMMA 4FHGA 2C2HA 2QAGC 4QQRA 2FF5A 2OBLA 3KALA 2R68A 3S1SA 1S5PA 3U6KA 1YR1A 3PIIA 2JI8A 2AN1A 1WP4A 1B16A 1NZJA 1HYEA 1RTTA 2JARA 4HAUA 2PXXA 4O08A 1BXKA 1KNQA 4D80A 4ZC1A 3UGJA 1Y9JA 5LQSA 5EMHA 1JSZA 5K8IA 2Y76A 3K9QO 2ON6A 3T3NA 1L7VC 2O48X 4NRDA 3WFIA 1D04A 1UBSB 3CWZA 3BHJA 1L8QA 3AIIA 3F3MA 2G9ZA 4RLHA 3R41A 5D7NA 3E82A 4JI6B 4FUQA 3VOTA 1JEYB 5K45A 4XEHA 1YZLA 3ZQ4A 1QGED 4O02B 4PLPA 3I6ZA 2DQZA 1Y3FE 2P4QA 3CVXA 2PUJA 2HRZA 5L9AA 5JS1A 2D1QA 3F5SA 4DLBA 2BFBB 1I6KA 3G8DA 4X3CA 3FNHA 4XIJA 1E1YA 3CLSC 1AUOA 3IX7A 4L6IA 3PRYA 4NHOA 1ZS9A 4RS4A 2VDUE 1EE9A 1QX3A 2PFGA 2N1MA 3FIUA 2I33A 3PQ6A 1PG2A 3T94A 4CHGA 4CM4A 4GDFA 3V2IA 2PBLA 1FMJA 4EEZA 1V7PC 4YT8A 1MQSA 1FTYA 4CZ2A 1KMCA 1C0LA 3H1AA 4P1ZA 2Q5HA 1H4QA 1JQJC 1IBSA 1GKLA 1JMYA 4GR4A 3N8HA 1P1IA 1ODCA 4FFLA 1ECBA 2WUVA 3HYCA 1ZD5A 2VAMA 3WYAA 1PTJA 4EB8A 3A6KA 3OD5A 4OU4A 2Q5CA 3G88A 3ZHBA 2OP1A 3A28A 1LPSA 1PUJA 1WZCA 3ICWA 1CU1A 1B8OA 2BKUA 1AA9A 2N3ZA 3R6LA 4IIYA 2CMKA 2W6IA 4XGNA 1UFVA 2LBPA 3UJCA 1WUIS 1S01A 3WLPA 3NBFA 1G55A 1EJ6A 2FX5A 1G2QA 3I6QA 3F2VA 3WLQA 1QFMA 2CWDA 3FYCA 4PAGA 3L4BC 1A7AA 5BQ5A 1Z7BA 1U04A 3W5HA 2AJ8A 2F3RA 4DG5A 5ITZB 1NG9A 1YTUA 3QTLA 2V58A 3BAFA 4XDZA 2IA5A 3WXMA 4NAUA 2JJ1A 2IZ0A 1A50B 1IEVA 1RI3A 1NMZA 2FLVA 3OWHA 2A9VA 3MWJA 4UULA 3L0BA 4F7WA 3QEMA 3UW3A 1P81A 1P29A 1UAGA 1Q15A 4KQMA 1JDBC 4X24A 1GQFA 4MUAA 3ZHZA 1J0EA 3CEMA 3P0JA 4GD3Q 2VPTA 4JEMA 5KZMB 1NJ2A 2UVDA 2E1PA 5BMVF 2BMFA 1YQ9A 1KTVA 1TIKA 3EQZA 3DDNA 1U3CA 3F6PA 5JAZA 2RAPA 4RD1A 4NV1A 2ZUTA 4E4RA 4B3MB 5CAEA 2DB3A 1U1DA 4KMMA 5KBYA 5LQAA 1FVFA 1G3IA 2FFQA 3IBCA 3K0FB 3AF3A 3L8HA 1Z5GA 4HWSA 5HIIA 4BYMA 3CYFA 2GPWA 4RJ2A 2A88A 5GONB 2GA9A 4E51A 3V42A 3MEQA 1NRXA 2QTHA 2IYOA 2PS3A 1RJWA 4II2A 5T3YA 4CI9A 3FOEC 3EXIA 1YA8A 1Y7IA 2ZIWB 4P0TA 1RKVA 4MMZB 4NICA 1E3QA 4ZMSA 3QKSA 1YJQA 1GL9B 4MW0A 5BNFA 1E1RA 2C7VA 4R98A 2W2NA 1Q57A 4TVKA 3PXGA 5EOVA 3E58A 4C6TA 5LIPA 4I4CA 3HRIA 4QBTA 3MJSA 1V16A 2GO1A 5GMOA 5E6RA 3EDMA 1PZNA 2MYUA 1YR9A 4KLZA 4MUHA 1BA2A 2FW0A 1A9XA 1SBQA 2CD9A 5CT8A 2VCYA 3D59A 4LJ8A 2C8VA 2NG1A 5LR6A 2Q3HA 2RH9B 3SU8A 4D9GA 2WD7B 4Z2YA 3FSGD 3GD7A 3GHHA 5C1BA 4J4BA 1CT9A 4AQDA 2FOLA 5CFNA 3IESA 4XPIB 2AXEA 5C80A 1VKOA 2AG6A 4G0QA 2ESRA 2QL6A 4GOND 4NYIQ 5AI6A 5EQTA 3RSSA 4F9GA 1U0BB 4MS3A 4PFJA 1G8KA 1Z82A 2BSXA 2EW8A 4GP6A 1Y6GA 1XHEA 1YIAA 2GFIA 2HA0A 2ZE6A 1CEXA 1X3LA 3OIFA 3L7BA 4HDCA 4RF4A 4ZEWA 4BNLA 1WZ2A 1Q21A 1S4MA 1RHKA 3O1LA 1H1LA 5AFSA 1IK4A 4DREA 2JFYA 1D0IA 4OSOA 4QJBA 3HE3A 1JJVA 3Q9UA 2Q5EA 3QU7A 2JLUA 3R8CA 1AURA 1N9KA 1ZUWA 1E7SA 1PGPA 3LUJA 2IYTA 4H17A 4OLBA 2HPHA 5BPHA 4FHEA 1WY7A 2COUA 4JGIA 3W2FA 1SVLA 2V1UA 4XH9B 3CUSA 3B6ZA 4IG4A 4GGPA 3KYDB 4E7OA 3O1HB 5HRUA 1PJ3A 1YU6A 2GH1A 3NHYA 3SEFA 1W0KA 4CIBA 3BRQA 3H2IA 4YV2A 4GP9A 2Q2WA 3D7MA 4CM6A 2GJKA 3MT0A 4AF8A 4C21A 2VPPA 3ZE8A 1CQJA 2PZMA 2GCOB 1O0BA 4M1OA 5A4DA 1JR3E 1UDXA 3ESYA 3O84A 5JRDS 4G01B 3IS3A 4ON9A 5DTIA 4XCXA 1ZH2A 3WLTA 5AJWA 3DW3X 1TTHA 2QZZA 1E6WA 3WL6A 3E05A 2IGTA 3FHOA 4JU8A 4RJIA 2V4MA 3GRAA 4RHEA 1M1NA 2QX6A 3LP8A 4UDNA 3VR6D 1DKQA 5KCMA 4LF9B 3O8QB 2R8EA 4HQLA 4ZYTA 3SG0A 3UGQA 4FGJA 1ORRA 4TWJA 5BQ3A 5JNUA 1R3DA 3AKZA 4LF5B 1QZ3A 3C6YA 1T26A 3PYMA 3WGJA 4FFSA 1C1XA 4JH0A 4IZOA 3ZBQA 3IA2A 5AMXA 1UIRA 3CF4A 3VKUA 5A3RA 2HBZA 2PL5A 1LSUA 5KIAA 2JJ2D 5JARA 1CIPA 3JQQA 4KK4A 5CJ2A 4FGUA 4EB6B 4U2DA 4EY7A 1NTOA 4OVKA 5EFOA 3WGVA 4BE4A 2R1UA 4HZGA 1QWSA 3D7SA 5ALGA 3PB3A 1HUQA 5JI3E 4OREX 2BFCA 2D8MA 1SVKA 2Z8XA 1TM4E 4R1QA 4UHBA 4NPHA 5TMPA 1UC9A 3K35A 1EJ2A 1YR8A 4CFYA 3AVPA 5ALPA 1AK1A 3PQFA 3U5ZB 1JIUA 4U2BA 4FFDA 4BKPA 5FWNA 4IW3B 3PD7A 2X7HA 4IZIA 3I61A 3I2JA 3WKCA 4R2JA 2CJFA 4G0ZA 4DCNA 4O4JA 4WPGA 2BKEA 2H3HA 3L1IA 1E3TA 1T43A 3E18A 1NX9A 1U9CA 2IXGA 2OV6A 4XQEA 5C3MA 1ZJZA 5IYZB 4HQ6A 4ARIA 1QG2A 1QJCA 3D2AA 5LP6C 2ZE7A 1KH2A 1JR3A 3E53A 1OFUX 3L82B 2VS1A 5AVZA 1PVDA 1GTSA 5EJAA 4X8OA 2YS7A 2J3IA 4BPBA 2YV1A 1V9SA 1UOPA 1J8VA 1MPTA 1EZZA 3FAKA 3ZS8A 4DA8A 3IMGA 1CY2A 2GEUA 2H00A 4FZ5A 4J0DA 2QNIA 4KFRA 3RJTA 5AD1A 3H8SA 1N5KA 1I3NA 1IN8A 1XWFA 4P80A 5HF8A 1C1HA 5LQKA 4B3RB 1U4NA 1H2RS 3W9SA 4L0CA 1A96A 2P4HX 1IG0A 3NHRA 4HMQA 1E2LA 2FR1A 2GZSA 4UQOA 5DWVA 4PSCA 3FMPB 3N2LA 3CVWA 1SQFA 2QOEA 3TSWA 4Y9RA 1V11A 4IM7A 1U6KA 1WABA 4M1QA 4MUIA 4C3UA 2IBSA 1EIZA 5I7SA 4BZWA 3GRUA 1EAYA 1OZ0A 4RHTA 4A9AA 3CO5A 4XLLA 4BVJA 4DSUA 5LUBA 1I4TD 5JAOA 3C5CA 5I7AA 5AW8A 1HQYE 1P9OA 2I3DA 1JEEA 4J9UE 1ZP6A 3S2SA 2A5LA 3L1JA 5KYWB 3OJOA 4D8WA 3HJHA 1VIAA 1ZN2A 3BAZA 5L53A 3AEZA 4TS4A 5BRNA 3MN1A 4KIFA 5HKKD 1YDGA 1EVKA 4W99A 1TU4A 3V1YA 4DDKA 3BK1A 2YC2C 4EGQA 2KE5A 1HZZC 1JG3A 4DGSA 1S89A 3CNQS 5DM2A 1J33A 2OBNA 4XQCA 1VFPA 3MF4A 3IVAA 1J49A 3EVEA 1SN7A 1QBGA 2A33A 2ETXA 3U40A 3WNDA 3H1FA 2P68A 5KQGA 2A7XA 3OIWA 4EPWA 4ESHA 3NTVA 2CWWA 1CQZA 2DHCA 3T9AA 3ZWCA 4MWCA 4GXRA 2R5NA 1PI3A 2WAOA 2Q9UA 3G1TA 3FDFA 3TLXA 3P0EA 2Y4NA 2QUJA 3R3UA 1ETHA 2X9NA 4LHVA 4LRWA 4OXRA 3GEHA 4KNWA 1SELA 1DIGA 4OLFA 1E5XA 5EERA 2O0JA 1IXRC 5FPYA 3SICE 3T4UA 4JR2A 4L5JA 3TNFA 3UGTA 7MHTA 2PZ8A 1R6XA 2VHWA 2R44A 1JS1X 1DAGA 1NJGA 2HHJA 2BKVA 3AHGA 3O4GA 1DBQA 1Z38A 2QP4A 3QPCA 4R1MA 4ZZ1A 4QJ4A 3KOMA 3RABA 2QU8A 3LC1O 2R8BA 1SXJE 1VCIA 1P0CA 4XSHA 4Q82A 1N8SA 1VLQA 3FNRA 4DMMA 2HUNA 3GD5A 3PC7A 1NI3A 4RAQA 3EH1A 4I5EA 3UMMA 3QU9A 1BAPA 1DTWA 4F6RB 2XWQA 3GZJA 4MQMA 2ZZNA 2WAAA 3H2HA 3VU1A 4DG9A 5FQNA 1V47A 2NU9A 1CULC 2XOKA 3S0JA 3QBEA 1O5IA 4AIIA 4CTNA 4F5YA 3QSYA 4R1NA 3U44A 1WB6A 2ROQA 3C8HA 1SAYA 1NMQA 1VG1A 2XODA 1O89A 3KEMA 3GFGA 4R01A 3OSUA 5ECGC 1IBRA 1N5MA 2L19A 2X5NA 2V45A 3OOWA 3KQNA 3DT8A 2DUJA 1Z45A 1U7OA 4KV7A 1RKBA 5AKZA 4AKTA 2JGFA 3KOYA 5F9FA 3BSWA 3VMFA 1QSGA 2YJ6A 2ZULA 3ROFA 1AGYA 2HJGA 3ECAA 4TXLA 4DRXB 5CURA 3GW8A 3UA3A 5K8TA 3KE9A 4ENRA 2ZG6A 3C3EA 5CA0A 3TLKA 3BIFA 4OI1A 1GSAA 1KJIA 2BZ0A 3UXYA 2VPYA 4ZOAA 1SGWA 1XEAA 3ZHUA 1PZFA 4UPDA 1A9SA 4BEBA 1E5QA 3L0CA 4ZQIA 3CX4A 4OUKX 5IJ0A 4NCJA 3SE0A 1SVWA 1NN3A 4MR8A 1TZJA 3ZJYA 4I0WB 4YMVA 1NNI1 1I4DD 1CS0B 1T5OA 1XDGA 1KPIA 4ZARA 1ZO8A 1XRSB 1JR3D 2PLFA 3WJAA 3ZK9A 3R9KA 3OZBA 1R37A 1X7ZA 4HDMA 4A10A 1ZN7A 1DBIA 1SXJA 2ZSBA 2LZ0A 1CWUA 4MVCA 3K1TA 4G97A 1SCNE 1NYTA 1SZPA 1ZHHA 3JQFA 5DF1A 4L8FA 3ZDCA 3NETA 2PKQP 3BB1A 1C7QA 1GNLA 3M6WA 4TTQA 4ZOLF 4P4UA 2ODAA 4OB7A 1KVSA 2QTLA 1F17A 3F47A 3M6VA 3AUXA 4AMBA 3KCNA 1MU0A 4GBMA 1R0CA 4Y2JA 1MO2A 1C7JA 4D25A 3O93A 2SKEA 4UBMA 3SC3A 3UMBA 5J4KA 2BLNA 4YMSA 3KU4A 3OOSA 4HRYA 3ZG6A 5BV2P 1IB6A 5AXBA 1BMQA 4H31A 4I81A 2AUTA 1KRWA 5IT9A 2FEOA 1CJSA 3GMTA 1CDOA 3OIDA 5F64A 3H11B 3KAJA 3D2LA 3IE2A 4ZMRA 2Z6QA 3TOCA 1MHTA 4DR6B 2GZAA 1LLCA 1Y4AE 3BMOA 3ON5A 2ZSFA 1ZVQA 4R2LA 4BKOA 1FDRA 5E6UB 1ZIYA 4EHNA 3U56A 3DFMA 2ZM6B 1A8QA 2G6TA 7YASA 3BMQB 4G5QA 5HDBB 5K0CA 4COKA 3QLJA 4M1ZA 2NT4A 4CKBA 4M36A 1FW6A 4CEHA 2ZR8A 4PINA 1BKSB 4MEAA 1QPZA 2OK7A 3ZXIA 4CDRA 2E37A 3CKKA 4FDAA 1T36B 7AT1A 2J9YB 5DBOA 3DZKA 1DQNA 3K30A 1GGVA 4WLEA 3C41J 3GFFA 4MP6A 3UK2A 3P9SA 4PG6A 3IQHX 1WUYA 4HGZA 5A3QA 4KDRA 4EG7A 2NWQA 2PXHA 4KKXB 2ZVPX 2NQTA 3GFTA 4Q7LA 3S29A 4HNGA 1UPUA 4RV5A 4WD3A 1HPLA 1WXFA 1O9HA 3K2EA 1PL0A 1T8WA 5BUCA 2WZBA 2X3YA 1CUCA 1BX3A 3EEBA 4HDNA 4M53A 1W59A 2X8JA 1E77A 4K87A 4L07A 4W8HA 5TQ2A 2M6RA 4UNRA 1DAHA 5AWFC 2OQ2A 3V1TC 5JQWA 4A0HA 2OZLB 2WJWA 5FBVB 4KWCA 3FVWA 4ILEA 4XUGB 4WXYB 3RTDA 4JKYA 5DTRA 1ZRHA 5FOWA 3WL3A 1ZK0A 3ZWMA 1FPQA 2GKGA 3I04M 3LV8A 3RFUA 3K70B 3KLMX 4EF4A 5SYMA 1JU9A 2OSVA 1REQB 4A91A 5I51A 5CP8A 3SR3A 1RAAA 1NLMA 3O1IC 5ALNA 1HI9A 3TZQA 2R8XA 2AW5A 1CUXA 2CCGA 2OGTA 4I4TF 4UJ5A 3VH4A 5CBPB 1KKMA 3BSFA 5IXYA 1GYPA 1XFAA 1XZLA 4MCHA 2IWRA 1D8AA 1EVJA 4QXQA 3IDZA 3W8NA 3DZIA 1RPAA 3PNLA 5AKJA 1QUEA 3W3ZB 4RLSA 4V24A 2JFFA 1NMXA 1L5MA 2YW9A 2GM4A 4H08A 1WBBA 2REQA 3A1NA 2Q0SA 2OD9A 2YFHA 1DP4A 2DPLA 4HPJB 3UJHA 1XZDA 4JUCA 4EYKA 4G63A 3FZQA 4DBLE 4NMXB 3H5OA 2BWJA 4NI5A 4V02A 1P91A 3H9GA 2VF2A 4KQEA 1JYFA 5LNK6 5IDVA 5ELLA 1ONNA 4RNDB 4B74A 3QE3A 4PVCA 1HH4A 1F6WA 1GFSA 5C5EA 1DC7A 4TOIA 1CZNA 4V3CA 4UPEA 3A6PC 2Q4TA 2CSXA 4HRXA 3G2PA 2DJIA 5ICEA 2Q5LA 3OMLA 4Z4GA 2ABWA 3E27A 3OQMA 3KHSA 1FW8A 1LY1A 2C94A 2VJMA 5DHTA 1V6SA 4QG3A 2WWIA 2XUJA 3GUUA 4MPDA 3GHYA 1XNHA 4OV6B 1PW7A 3ZIUA 2RK6A 2Z8YA 5KNBD 1SXJD 3EIWA 3JRXA 4Q7KA 3KJIA 3QHAA 4A73A 5HYVA 4YJGA 4EDFA 2FPPA 1FZTA 2WU8A 2ZRQA 4HBZA 1JAZA 1FP6A 2Y1FA 4P3PA 2FGKA 2J0VA 1DO8A 1GPMA 3VNAA 1SK9A 2KW5A 3CVOA 3ZE0B 3AXTA 5DHPA 2OFFA 3TIVA 2WHQA 5FQOA 2VSOA 3PXAA 2A4KA 3OBIA 4IIVA 3QX7A 1YS7A 2GCIA 4W9RA 5H7XA 3PXDA 1FYDA 4NCKA 3K5PA 3EXAA 1JW9B 3ETNA 3EWSA 4DIMA 1QIHA 4JHXA 3VPCA 3HA2A 1GG8A 3CR3C 2HSZA 3AB8A 3NDRA 1E2GA 2WDPA 4CKWA 4UREA 2WYVA 5TIIA 4L4XA 4Y2PA 1C3LA 2ZDQA 4X7PA 3UKDA 3MJRA 4Q47A 5JSYA 4WACA 2VQEB 4ARCA 3H99A 3C7CB 1E4EB 4M22A 4X92A 3LD9A 3U4HA 2FPMA 5KJCA 3CWCA 4PBRA 1JLLA 3JAMA 4BVEA 4ZODA 3ZDBA 1ANKA 2EQBA 4N0QA 1YFJA 4KNYA 4D4GA 4CV2A 4FE7A 4E14A 1QQAA 5K0TA 4M21A 3WA6A 1NC3A 2JFHA 5JYCA 3Q98A 4OAQA 3M83A 2O3RA 1WHSB 2CF6A 4OXYA 4CN9A 4ZN6A 4JQSA 4OXXA 3QKRA 2IWHA 4EHAA 4RKWA 3JYHA 2IQIA 2G17A 3FFAA 2XCTB 4M99A 1SXPA 2X42A 1DS6A 1P4GA 1MTZA 4P32A 3R24A 3U4CA 5IRCD 1FBTA 2P9FA 2ZRLA 1XVLA 4OHUA 3K70D 1SC3A 1N5IA 2BFWA 3GLQA 1FSFA 4RMJA 4RK4A 3BE6A 5JW6A 3CF6R 4EG4A 3AINA 2CF5A 3BL8A 2BUBA 3G68A 3LSYA 4MR9B 1N0HA 3AO0B 4QTUB 3TQHA 4ZANA 3WRXC 5BWOA 1TJ3A 1ULHA 4LCEA 4L4UA 2CBZA 4BAGA 2E4AA 3U09A 3CC8A 5BSEA 1IEQA 2LR0A 2C8LA 4G26A 4URFA 3CH4B 1AKWA 3RC9A 3X1DA 4WEOA 4LVOA 7ADHA 1A5ZA 4HGPA 4YO7A 3O8DA 3Q41A 2V6BA 1T2CA 3LYUA 5KJEA 2XE8A 4NOJA 5LXTF 2WSSA 2ZTLA 4C4XA 4AJKA 4RZXA 5FFFA 2LIVA 3ZWYA 5IS2A 4C7OA 1ZH4A 1R64A 1NVEA 1ZWLA 4P36A 4BXOA 1N78A 4W9NC 2YV2A 1ZYUA 4J1TA 1SVUA 3FAZA 1HE8B 1G41A 1WG8A 2M1ZA 3K70C 1OR8A 1WM1A 4E2FA 1ULSA 1ZCAA 2ZSKA 1NLUA 1X7XB 2UAGA 1P0MA 5LP6A 2GBPA 2ECQA 4ZI3A 2VNSA 4HY3A 5A5VA 3OBBA 5CX4A 1M2NA 2CUZA 1P3DA 2P2NA 3LWDA 5KNDH 2IIBA 2VP9A 5BWCA 3WAJA 1SCQA 5D5PA 2B4AA 3NWBA 5K6AC 1PFGA 2H08A 3OM1A 3PIDA 3NAMA 2NO0A 3WRYA 3W5JA 4V2IA 3QITA 3OZGA 4HTAA 1BC5A 1M0SA 4C29A 3TQQA 5FLXA 3A9CA 2IOHA 5F9MA 2XXJA 1TB4A 1XZBA 2ACEA 1S8OA 2LUOA 3UC5A 2GI4A 1CR6A 3S2GA 3UJDA 5KWSA 2YNMC 4YDQA 1MAAA 3KEOA 1HE3A 1PFWA 2OBMA 1JAXA 1WULS 2WIFA 4MRAA 3ZY4A 1XSEA 1F4LA 2VDWA 1T0JB 2DLDA 5LLSA 1P5JA 4KXLA 3SNKA 5B2FA 2HCTA 2HU8A 1U2TA 3DC2A 3IVXA 3O8QA 3TVDA 2PL3A 3G9XA 1XMVA 2H4FA 3DAOA 1AA6A 3THYB 2H11A 1A9XB 4MHTA 1ADJA 1B3BA 4HV4A 4NCBA 1OAKA 4HAXA 4JMPA 3UICA 2FPIB 4OTZA 3SJCA 3K94A 4RCYA 4MVJF 5TEVA 2YHSA 3EGXA 4M1EA 1WF3A 2FSVC 3DMGA 4G8DA 1M34E 2GBGA 1UKBA 3NDBB 4AY5A 3IKTA 1KVQA 2PM8A 1BHQ1 1G63A 1QYXA 3A9SA 1JN0A 3HN6A 4I9GA 1GHTA 4QQFA 2BI8A 1XA3A 5G0WA 4BVFA 4EI7A 3CUWA 1OROA 4OKSA 1YL5A 4YP0A 4F11A 2VDRB 5IP5A 2DBZA 1LPNA 1S8FA 3KZ1E 2XJ4A 2YZNA 1MVNA 2BHTA 2HQ1A 5EE1A 1GM5A 1QK3A 4EOGA 4NU8X 3TLMA 3PDCA 2XW6A 4N47A 1QCDA 2FEWB 4DTCA 1OWMA 4M0KA 3UOGA 3I30X 3AZOA 3F4KA 1Z6PA 3EVGA 3KVOA 5LM3A 2AD5A 4N6OA 4JJAA 2GPJA 2R85A 4KSBA 5FA5A 3WXBA 4FILA 1J23A 5A04A 3PRKE 3F4BA 1USKA 2CFTA 3Q11A 4IDAA 4R69A 5K0NA 1SEVA 2DUMA 5CXSA 4U0JA 1JDVA 1P6QA 1W4AA 2AE2A 3D0KA 1I4OA 1A7KA 2EFJA 3T3OA 2DFVA 2J30A 3G2HA 1EFVA 2DERA 4ZC8A 2YVLA 4FT4A 5I9LA 4AZSA 4O1HA 4DSTA 4MS1B 4YUXA 2YCLA 2OM6A 1JPNA 2WE7A 2CBXA 1SBIA 2WSSD 1JKMA 5IFLA 2OEPA 4H4CA 4GMGA 3E8XA 3HL0A 1JBEA 4BNFA 1AN9A 2IODA 3B9RA 1ICIA 1EWTA 2X4GA 4J16A 1DTSA 4DNOA 2BFFB 4DSZA 2WG0A 3IEMA 1V3QE 2A5YB 3EGXB 1T4CB 2CYBA 5EY5B 4X91A 5DYTA 5E95A 1XXHA 3HXLA 1J2YA 4Q66C 2L0XA 3LDFA 2QZ4A 3MTEA 3MW8A 4O63O 3ZZMA 1OZGA 1C8BA 2G1UA 3NHJA 4XPZA 4D3FA 5AHRA 1E0AA 1XJ0A 3OPXA 3UG6A 1OVGA 4FNAA 4ZXPA 1ZRNA 5IU6A 2PUHA 3P9RA 4FCCA 5IVHA 2YHIB 2VP5A 2XQIA 2EF0A 3GP8A 2NYVA 3SN6A 4S2UA 3GPCA 1KKLA 3F78A 4MPRA 1QRDA 1EFLA 1ZUHA 3AP2A 1FDUA 4JENA 2FRVA 2JI9A 4MWDA 4PO3X 5CFOA 2C9OA 2CMDA 1JAIA 4L9AA 3DOHA 3C43A 1LXCA 5JU6A 2LTAA 3INRA 5A5GA 2BM1A 3ZNPA 5K6RA 1XD2A 4RF3A 2IHZA 1SO8A 1GGJA 1UZMA 1ORIA 2QRGA 3I76A 3WDMA 3CLKA 3VKGA 5CBPA 5FPSA 3A4IA 2R00C 4CMIA 5ABPA 5JC1A 1WBDA 5CVEA 1T1EA 4IDEA 5A05A 1VM6A 1SMKA 2DSNA 3G7SA 4HUQA 2C3UA 1X7DA 3QQPA 4ARZB 4M6WB 4DR5B 3AONB 1EXDA 1TEZA 5LB2A 4HYEA 2VUUA 4PXYA 5AJXA 3ZPXA 2GM9A 4QOJA 2YX1A 3I05A 3PICA 1SXIA 2Z58A 4GPZA 1JFTA 3KJFA 2VO1A 4B7CA 1SXGA 1J42A 2GN8A 4FS3A 1OCEA 5E8RA 4CLOA 3AX6A 3F9IA 4CQLB 4LXUA 3Q3EA 1LTHR 4JQYA 1SWVA 4H27A 3COYA 4TZTA 1XRRA 3VNUA 4EBFA 3KSUA 1IXSB 1OF1A 1W581 1T2FA 1FA9A 1XZPA 3D7NA 1F6DA 2BY4A 1CCWA 2HM7A 2CE7A 3CPSA 2I6QA 3EQ2A 4IUYA 4MUJA 3SMVA 3LHFA 3KKLA 2C88A 2C58A 4J1SA 3C3JA 1NI4B 3N76A 1WMFA 3V1MA 5JS8A 3LE8A 1ULUA 3MGBA 3ZOKA 4BP1A 1D03A 2QPLA 2BGRA 5DVZA 4YXFA 2E5FA 4MLZA 3C97A 1DKNA 3MUEA 4UXJA 4QDUA 5AI5A 4X54A 3WJ2A 3ZR4B 2ZJ8A 2BTQA 2EJCA 4JVOA 4UEWA 3I62A 3ZCSA 1LBQA 3ZW8A 5C34B 5DGXA 1L5YA 2ZPUA 1J09A 3D6UA 5KTKA 1II8A 4AIRA 1MC4A 4IF6A 1YVPA 5AM0A 3R76A 2OY0A 1EFVB 3D4PA 5TVGA 1MD9A 3INGA 3IPAA 3NONA 4RLQA 3UAZA 2ORWA 2Y93A 3P9KA 2DSTA 4QOFA 2IUFA 4K3VA 4US0R 3ULKA 4DLVA 3RAPR 4QYWA 1QIMA 4WOCA 3GFOA 3MQFA 3ICVA 3EWNA 4MS4A 1I32A 1R0KA 4N9WA 1FNMA 5EJIA 2VDQB 1WCWA 2NSLA 4V0OA 1IHXA 5TPWB 2O1SA 3GJZA 4GWGA 4EMSA 3DWGA 5JBQA 1HKUA 4G1EB 3KT0A 2FG6C 4FMCF 5DI9A 1LRJA 3R7BA 3HEMA 1FTQA 3I9JA 1ZKMA 4WJZA 4BWVA 1SUDA 4IMRA 2IOYA 4P9NA 2XNCA 3SQWA 4ZI5A 3SC6A 1DDOA 2QE7D 3EXHC 2A3NA 4B6GA 5J2UF 4YALA 1ENZA 4L57A 1VSTA 4YAGA 3UPTA 1G4HA 2YJNA 5DM4A 3HUEA 1N1MA 4Y0VA 2Z8ZA 3V8RA 2ZGVA 2EJUA 2A1TR 5JWRA 3EULA 1M2WA 1Y8AA 2CNWA 3F98A 1PR6A 3DR5A 4XSVA 5KAPA 5C31A 2G9UA 3TPZA 4A5SA 5J23A 4UTVA 1V2GA 4MAAA 1XZIA 1PZEA 3EFEA 4LWZA 3D5TA 3Q3JB 4DV4B 3ZQUA 4IGEA 4EHKA 3NW9A 4EGCB 2APJA 4RY2A 1G66A 4WV3A 3HRKA 3W0LB 1XK6A 4EUHA 2A0XA 3F7OA 6LDHA 2D5LA 4S24A 3JY6A 1H6AA 3JZDA 3H16A 3RU7A 2E1RA 2BMJA 3PE4A 3USCS 4BAUA 4DDUA 3JQBA 1SKMA 2EXXA 4JVMA 3VUEA 5IPFA 5SV2A 13PKA 5HXAA 1T6YA 1U7TA 2JHCA 2O8CA 3SCZA 3COJA 4U7TB 1L7RA 5DLPA 4CUJA 3GYBA 1Z6YA 3I09A 3FOCA 2HRCA 3OZTA 3Q40A 3MG9A 3S28A 3IQFA 3B9BA 4AY3A 1KP9A 4MV9A 4DQXA 3DFIA 2X8WA 2FPOA 5EJMA 2O6LA 3MWDB 4OQFA 2ZI5A 1IUKA 2QRUA 1KY2A 1TT5A 3NU1A 3CZPA 5JZOA 1DKLA 2GVZC 3ZVRA 8LDHA 3GLKA 2OV4A 1VPTA 2JIZD 3K1AA 3CXUA 4Y1RB 3WRXA 4BEWA 4S2EA 4YR7A 3GFSA 3H1GA 1QVRA 1T8RA 2O7VA 4FGZA 2W70A 3GCZA 1L5LA 1RZUA 3WWOA 4MEJA 3ZD7A 1KZ4A 3S99A 2OR3A 2HF9A 4IL5A 4QBKA 4ER0A 2BN4A 2NN3C 1BCRA 3IODA 3N0TA 2PKQO 4ENWA 3BORA 3WK6A 1IJBA 1HDRA 3UJ7A 2C7BA 5CA1B 5ESDA 3FTNA 1XF9A 3HTXA 5HILA 2HHLA 2FW8A 4RVNA 5E0OA 3JTEA 1F7VA 2FEXA 1LPAB 1VG9B 3F9RA 5AKIA 2IUSA 4I19A 4IIBA 4KPUA 4W9NA 4RTQA 4KQHA 3KV3O 3DM5A 2RG1A 1DJQA 3NAZA 1T8YA 3FVVA 1BROA 2AN3A 4LFCB 1JBKA 1MXHA 4R9SA 1DEHA 4C07A 2C5SA 1IXYA 1EX9A 3UWOA 3R9WA 2J46A 4LG1A 1OV6A 1BMFA 1WQ1R 2XA2A 1H3FA 5JVDF 2QA5A 2YWGA 3VYRB 1MUUA 1UKVY 2W6PA 3H5WA 4N03A 5E4TA 1M2VB 3CPJB 4KN6A 3AHDA 1TC1A 3A8TA 1U0NA 3II6X 3N5CA 2QLFA 3SP1A 1JQBA 2WNSA 3D0OA 4IOKA 3HBJA 1N34B 2Q4RA 3H2GA 2JFZA 1A7JA 5ELXA 2HF7A 3H1BA 1FU7A 1T6ZA 3WB9A 1JL3A 3SS8A 1EX6A 2O2ZA 4JEUA 3RWOA 3LM8A 3UAYA 1HL7A 2VSYA 3UQZA 1KDYA 3WLKX 4CMHA 1OX5A 2QUBA 5EHXA 4TXJA 1G5FA 3DV9A 1W46A 4BASA 2YV3A 3LPMA 5IT0A 3CH7A 2Q2QA 1Y7PA 1HQKA 1QORA 2L82A 1UPBA 3LVQE 3AJ8A 1KI8A 1EFCA 2W2KB 5EIWA 1VHTA 1GLVA 2AJBA 1OT3A 3IJ5A 3TW0A 3LZ6A 3IDSA 5EWMB 1U2ZA 2HNBA 3HY6A 5EKUA 4LYEA 1X1TA 1OIXA 1ZOPA 3QPWA 2YQ4A 2SECE 1U0LA 4QTYA 2GEFA 2VDKB 4LDNA 4F3NA 2AA3A 2D0OB 3L8ZA 3AKDA 1TRHA 1Q0HA 3TCXB 2NV0A 3FY4A 4MW9A 4XD7D 4YRFA 2PT9A 2PKXA 3AY3A 1G2PA 3SFTA 4QRHA 3JASA 3MS2A 1ABEA 5TLSA 3P9ZA 2WLSA 4KXMA 3WLRA 1NULA 2FFAA 2O2HA 4CNQA 5DCUA 5EP1A 5B1YA 3IALA 2WU0A 3P9PA 2X9GA 4FYHA 4MA4A 3NUZA 1KQPA 4FE3A 4Y1RA 2ZYVX 4FJ0A 3RVNA 4FTWA 3ZWPA 5LZ2A 3QUBA 2WSYB 1HFJA 1QVZA 1T3HA 3R77A 4GPD1 4KR9A 1H05A 3G9ZA 4J8PA 1U28A 3GN1A 1NJFA 4WXEA 5JEEA 4FNGA 2VUIB 4RTOA 2YBDA 4BX3A 1L1EA 4GOXA 1S0UA 4AJPA 4C4ZA 5LDHA 4PN7A 3LY8A 4OBXA 3L8DA 3LVFO 1J4AA 4I1IA 1EUDA 1VJRA 3EIFA 2IVZA 2QX8A 5K0JA 3MINA 4NENA 1Y6FA 5JNTA 1USWA 3LYLA 3P2YA 4Q4LA 2XSZA 4JJGA 3KVNA 4JBLA 2D0DA 1GSIA 2FOXA 3TM5A 2Y0CA 4G9BA 4V0QA 3RT9A 4M87A 1GA1A 4E94A 2QJWA 3K0CC 4RPJA 3QNMA 2AOUB 2MSEB 4B4DA 2JJMA 2ZQ5A 3B38A 2A9FA 3H2ZA 4D0LB 2RE8A 3FDIA 2CFSA 4MJ7A 1NZDA 1OXXK 2XUPA 2JANA 3DWIA 1FRQA 5HJEA 2AS0A 2OG2A 5IJWA 5CG2A 3UAVA 2ZAYA 4WCFC 4EW1A 4D99A 4R83A 5BRJA 4PSVA 4UUAA 5EPEA 2CL0X 1ZD1A 3ZJTA 4IDHA 2HA6A 4K88A 1O4WA 2YWFA 4ZVVA 4LXHA 3BCHA 3W8RA 3A32A 3T41A 4LQDA 4OXNA 4Y6SA 1Y8QA 3VU3A 4ZYZA 2XCRB 4ZOLB 1KDOA 1WDTA 5TE9A 5EXSA 1HGXA 2BI7A 1NW3A 1D4FA 1Z7GA 2LPMA 2X5JO 4E46A 4NYIR 4QM7A 1YQGA 5CXXA 4MK4A 4PN3A 1SKYE 1X39A 3S1AB 3A1FA 2XTJA 4OQLA 5DYNA 5LYJB 5KNCD 1PZXA 4HDSA 4EKYA 3KTAB 1CR2A 1W36D 1A9YA 4I4IA 4QYTA 2QG4A 4R2KA 1ZNYA 2VF8A 3PSHA 1HQDA 5CB4A 2ZI9A 1YWGO 1XD9A 1UM9B 3GCWA 4GGOA 2H16A 4PYLA 4XYBA 2UVPA 1DCKA 1EZ4A 1PX0A 1XL1A 3WDKA 4LNUA 3QG1A 2OAP1 5CB6A 3IKMB 3WHPA 1HNZB 1RXYA 2A92A 2PZGA 4AKEA 1SBCA 4BFYA 1KERA 2VVTA 3PEEA 1WZUA 2O1XA 2XEXA 4M9QA 3RFXA 2FZWA 4BCCA 5A9SB 4Q1VA 5TT0A 1NNEA 2IHUA 5FUMA 1F7UA 5DP2A 2G5TA 1ECPA 2I4LA 4PLZA 4YCDA 3ZHVA 1IH8A 2O07A 3DKIA 3L7NA 4B75A 2Q9CA 5MDHA 3G5UA 3JD4A 4CKBB 4LRYA 3IC5A 3V7FA 1PEAA 2NSJA 3CX7A 3P0RA 4JLNA 5I4IA 3C74A 4LOIA 1A5AB 1KP3A 2KLHA 2EL7A 4LSZA 2ZTUA 3FCUB 3P19A 4RHXA 4NZOA 1E2QA 2A5FA 2HIAA 5FBRB 2XZDA 4F1JA 2UU9B 5H8WA 1T4GA 2G67A 5CK5A 3MM4A 4G89A 1LK0A 3IKLA 4A2WA 5JDIA 3U3ZA 4ER6A 2D8AA 3WDLA 4IUDS 1GADO 1THTA 3CONA 4OY3A 4ZI7A 3AESB 1P73A 3LCUA 4K5QA 5JXJA 4UW9A 3SDSA 5B3KA 1Y5RA 3WB0A 3GQBA 4FR0A 4Q9LA 1E79D 2BKLA 1XF1A 4G5SA 4B4KA 4EJMA 3C4JA 4L8YA 3L7OA 2IH5A 5FNZA 2VT2A 2WR8A 4TL7A 1ZCBA 2HFJA 4HH0A 1B6SA 4KN5A 4M9SA 2P9GA 3LIIA 1K6EA 2IDMA 4Q4AB 4WAUA 3ZXUB 4ENPA 2IS4A 3NGLA 3UHPA 4M9CA 1M2OB 4LXYA 4DNXA 6PFKA 1L3IA 2V54A 2WKWA 4V3BA 4UQLA 1ST3A 1FFDA 2X6RA 4WOPA 1ZOLA 3F49S 3H4MA 1K7FB 3NFRA 3RDPA 4B45A 4KITB 5U9CA 5FV4A 1AGPA 1Y9DA 2GNPA 2WMDA 4ZEXA 4AWXA 3ZWVA 6GPBA 2MYNA 2Q2OA 3HWRA 1HL3A 3IV9A 1K6MA 3HKCA 9ATCA 3LUBA 1OLXA 2H92A 3M7IA 2O9JA 3NZEA 1NXOA 5EJGA 3GNTA 3PQ7A 1FSZA 3A6HA 3DBLA 4YPVA 2R79A 5EIOA 3TPFA 5EZYF 1U8XX 1BEEA 3JWEA 2HWUA 4UAGA 5CVCA 1JHZA 2CKMA 2WWRA 1DUVG 1ND6A 1IN6A 2ZJ4A 4Y2SA 1K8RA 2DFNA 1VMIA 4KQ9A 2YH2A 4I7EA 2BELA 4W6QA 3FGOA 1RZRA 3ROPA 3S7TA 2DFPA 2HSGA 1C9JA 3AR4A 3HC7A 3C15C 3I73A 4KFSA 3FX2A 3U19A 2I6UA 3DV2A 1JLKA 1R9JA 3G1WA 4MGHA 1H85A 2LP4Y 4HZIA 5DI3A 5KJ6A 2IZ1A 3LBHA 4HWTA 1OKKA 4KI7A 3F3KA 4B3BA 4B8YA 4DQLA 5I9TA 1Z39A 4EKNB 3BEDA 5J4LA 3I4CA 1L5HB 3DUFB 3I2YX 4F5DA 5IAKA 1UP6A 1T6NA 1T0BA 3PGVA 3PUJA 1KZ1A 1MF7A 2EW2A 4TL6A 4HLUC 3MQ4A 3QI2A 4UM5A 4YRZA 2DFLA 4Z9XA 4RFVA 2RIPA 2IOQA 5AKHA 1M67A 5JSHA 2JBAA 1X80B 2ODPA 2WTEA 3L84A 2ZS8A 1PS0A 3ILYA 3M4XA 4G3XA 1T1IA 1U4OA 3RIHA 4EB3A 3ADOA 4BU0A 1GUFA 5EXEA 4G0PA 4KMRA 1YA6A 5IANA 1XOIA 4WXPA 5AK6A 4Q1DA 1KO1A 3IT3A 3KQQA 4JYAB 3HLKA 4W63A 2GZHA 1MOQA 4UUQA 1J24A 2LCIA 2EZ4A 4LY9A 3WKAA 2Q6VA 3H6GA 4OFWA 5HKOA 4L1KA 2DMRA 2F8SA 1TM1E 1IY0A 1YB1A 4WN9A 3RQIA 2CVPA 3TAXA 2PLWA 3GEIA 4IDNA 1T9GS 2A4MA 2RHGB 3F8WA 4TWAA 2YRXA 3THXA 3KQVA 1Y8RB 1L7XA 3BFVA 4EY5A 1WTCA 2VF4X 2ZSEA 1GQRA 4IILA 3THSA 4DWWA 3KSBC 3UMCA 1H2EA 1GGMA 4D45A 2P78A 3IAHA 5CJJA 5AM4A 2FFJA 2EKDA 3OZWA 3HVHA 3FGZA 1YASA 4HBGA 4LSGA 4UUPA 3LP6A 4CQMA 2HQRA 3LNTA 3SXJA 1QKKA 2X9VA 4OMCA 4JC4A 2AOTB 2H5EA 3VBCA 2AEEA 3E8SA 2ZVDA 3DBIA 4KYIB 1GQOA 3WQBA 3JYPA 1JTVA 2IP1A 2NW6A 1N2CB 1NN0A 4IWXA 1SH7A 1P7YA 3CKMA 2C9ZA 1QV9A 3C48A 2ZJ3A 2DBVO 4AS1A 4MSUA 3T7IA 4TSRA 2XQKA 3LKDA 4RGVA 3URKA 4CL8A