3MXOA

Crystal structure oh human phosphoglycerate mutase family member 5 (pgam5)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
202
structure length
188
Chain Sequence
SMDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of PGAM5 Provide Insight into Active Site Plasticity and Multimeric Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Serine/threonine-protein phosphatase PGAM5, mitochondrial
total genus 70
structure length 188
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3mxoA00
4ODIA 1T8PA 2PA0A 1BQ3A 3FDZB 4MA4A 1CVIA 4JOBA 2GFIA 1SK8A 2OWDA 1V37A 1RPTA 2P6OA 3E9DA 2P30A 3BIFA 3IT2A 1DKMA 3QPWA 2IKQA 2AXNA 3LL4A 1DKQA 3EOZA 1H2FA 3FJYA 4FDTA 4JODA 4IJ6A 2EKZA 3F2IA 1YJXA 2ENWA 4PGMA 2WNHA 3MBKA 3LNTA 3LG2A 4D4JA 3E9EA 1TIPA 2WNIA 2RFLA 4D4LA 3DCYA 1C7ZA 2EKBA 4JOCA 5AJXA 4EMBA 2EOAA 3MXOA 3QPUA 3GP5A 1YFKA 2A6PA 4PZAA 1BIFA 1FZTA 5AJVB 2HHJA 5AK0A 5AJYA 3EZNA 1DKPA 3R7AA 1ND6A 4QIHA 1SKAA 3E9CA 2WU0A 2P6MA 2P77A 1QWOA 2P9ZA 3IT0A 5HTKA 4FDUA 4GPZA 4EO9A 1SKBA 1SK9A 3HJGA 1QFXA 3OI7A 3GW8A 3ZHCA 3O0TA 3IT1A 1RPAA 5AJZA 4D4KA 1EBBA 1K6MA 1NT4A 2OWEA 3QPVA 1DKLA 4E3WA 2P9YA 2BIFA 2YN2A 3FDZA 1ND5A 1C81A 2H0QA 2ENUA 1XQ9A 3NTLA 5CU7A 4PZ9A 5PGMA 2P78A 2P2ZA 1FBTA 3K4PA 2QNIA 1DKOA 2YN0A 3D4IA 3D8HA 2I1VB 2HIAA 5CDHA 1H2EA 2DWOA 3GP3A 3D6AA 2H52A 3DB1A 3K4QA 3KKKA 1UJCA 4TSRA 1BQ4A 1IHPA 4ARSA 1E58A 4IJ5A 4ARUA 2A9JA 2HPAA 2H4ZA 2F90A 2P2YA 2H4XA 2P9FA 4AROA 2P75A 3C7TA 1C80A 3IT3A 1UJBA 1V7QA 1E59A 5AJWA 4D4MA 5HR5A 3NFYA 1DKNA 4GPIB 5CX4A 4ARVA 1RIIA 3F3KA 2P79A 1QHFA 3PGMA 4HBZA 2DWPA
chains in the Genus database with same CATH superfamily
1Y3HA 2J46A 2EERA 4RJLA 3QELA 5JH7F 2OE2A 4J3NA 3PJGA 1CJCA 2XGMA 1H2RS 3OJOA 1IBLB 1VBFA 1FTSA 3R7WB 1F1BA 5T8KA 1KMMA 3G1UA 4O4HF 3L0ZA 2Q3LA 1G8MA 3QF4B 1YOBA 2OT3B 2Q3JA 3L8CA 5FNZA 3SOZA 1WV0A 3AB8A 1H93A 2AFIB 1DEAA 5EIFA 4X63A 1JQLB 5JADA 4B4UA 1EQ2A 2EARA 3DP9A 3C3CA 1KO4A 4RTLA 2FF5A 3VU8A 2C98A 4ITVA 2QX6A 1KGDA 2O57A 4F96A 5EQFA 5DX0A 1SXGA 2RHHA 4IDEA 1G66A 4MRSA 3RFCA 4IMRA 1XU4A 2PS3A 4B74A 1YJCA 2ZJ2A 4TV9A 1N34B 3ANSA 3MCZA 2AQIA 1JHQA 4WZAA 4XD7A 5LP6A 1AXEA 2JD2A 1YDMA 2HTEA 3BH7A 1YS9A 2IU6A 3IDAA 4HD8A 1R4MB 2KI5A 4AF8A 4BNKA 1N2HA 3GVHA 4OSOA 5LFAA 5MGBA 3DMGA 1P5FA 1MIHA 3A1DA 2QRQA 4PGFA 1JDBC 3CLUC 4MKXA 1R10A 4TTJA 4UZSA 2IRWA 3K71B 4BV8A 1NE2A 4TKVA 2PV0A 2V7PA 5FL3A 4DL9A 1MVOA 2V8BA 1FLDA 1SUBA 1WOMA 4P7JA 4QFCA 1N6NA 3KSBC 3NNDA 1SXIA 1AXRA 3GLFE 5DGCA 4JDPA 1W0JA 1RPAA 4PF1A 5ALOA 5ERYA 3UKJA 4G0PA 1RBMA 2BFOA 2QAGA 3H9GA 1Z4NA 3DM5A 1D0IA 3OOJA 3QU5A 4LKOA 3V1LA 3G7SA 1F6BA 1L5HA 3MBOA 4NG5A 4ZI5A 2BFDA 3NGMA 3ZJUA 3R5KA 1DIOB 4TQGA 4X1IA 5IF9A 2EKDA 3RVQA 2B69A 3JZDA 2QJWA 3UPDA 2QIPA 1Q0LA 4FDAA 1H94A 1ZITA 5EJ9A 3ZE9A 3ZTTA 1DXQA 2R6GA 5AVKA 4FI3C 4HGZA 1BQEA 4EG7A 1F2TA 1WETA 2FMXA 2CVQA 1C9NA 1K66A 4MV9A 2WV7A 1SR8A 1GWNA 3SSOA 1I6LA 5IEBA 4PAMA 3UATA 4QDKA 3WSWA 2OFWA 5IP5A 4JVSB 3MMXA 1KE1A 2PD6A 2DLCX 1M7HA 3BCUA 1Y7IA 1E2LA 2CCGA 5FQNA 4BWYA 3L93A 5FX2A 5FPHA 4LNUA 4P4SB 4Z4CA 2ZROA 3IUJA 2P2DA 1CE8B 1EG7A 1O4VA 2HF2A 3BA1A 3LZ6A 5LJLA 2OAEA 2CFTA 3L0OA 3HUTA 5ILGA 3OQIB 1KDRA 4Q3AA 5TNXA 4LC1A 3RIYA 4ZGWA 2O06A 2ZUTA 4REQA 2Y4OA 3GEHA 1KF0A 1VZ3A 1T36A 3GY0A 5JSQA 4EJFA 3P7MA 2VHVA 3F7NA 1Y8AA 3RSSA 3LRTA 5AVRA 3LX4A 5JNUA 1AZWA 2FW8A 2VDKB 4DXAA 1COZA 4FS8A 3A3PA 1POXA 1JU4A 4DPMA 1OBHA 4JEUA 4TLMB 3RSHA 3U5ZB 3GAFA 4TTAA 2XQFA 4FOTA 5DRTA 1BCSA 421PA 1DEKA 5B55A 2BFNA 4MROA 4P2BA 1XZNA 1QVRA 5DV9A 4JBWA 2VDUE 3Q3VA 4FKMA 2UUAB 1Z62A 1V2HE 3HQ4O 1VP9A 3B51X 2ETXA 3AM5A 3DSRA 1Z0UA 2WILA 3GLVA 4PG4A 4PO3X 2IHNA 3AR2A 4EJ6A 1AN0A 1PR2A 4KXQA 4LMRA 3NKLA 3LQQA 1XCMA 1DG3A 1W88A 4RKQA 3I34X 3OEED 4TROA 4A6DA 5JSZB 2OHVA 4F06A 3AW8A 1HETA 1MG0A 3HJTA 3OO1A 3PUJA 4WOJA 4JI6B 2BSQA 4HDMA 3JXEA 4LGVA 1MOZA 1M6WA 1R12A 2B2NA 2VSFA 4RDHA 3RV3A 5EFOA 4E30A 3SBXA 2WVGA 1JAYA 3BFVA 4WV3A 1X1QA 3RLFA 1EXWA 1NVAA 2DT5A 3UA4A 5L6LB 4Y2UA 2CN1A 1OIXA 3RVLA 3SS8A 3IV9A 4WX2B 2WNIA 4L5CA 4UU1A 5BUQA 3DCYA 4NXNB 2EBFX 4G8JA 4PIVA 4J91A 4GYJA 3JQ9A 1MT3A 1DPFA 1FRVA 4GAEA 4DCVA 4F4IA 5LQAA 1UKEA 3UIEA 4EVSA 1F8FA 4IDPA 2G4VA 3OF5A 4US0R 2XT9A 3H16A 3SKXA 2V58A 3GARA 5HRUA 1O95C 4ERNA 4RSRA 1WZ2A 3QFCA 2NNWB 3K94A 1IHYA 2VEOA 1JT9A 3TRIA 3JYPA 3UPTA 2IXBA 1MN6A 2IYQA 4TV9B 5AI0A 1ZCBA 4FJ2A 2DBRA 3F96A 2PX6A 3N5CA 4EKNB 1KDTA 1A95A 2QSYA 2CVPA 4RV9A 5LQUA 3TPFA 3IT1A 5KTTA 2GSDA 1SZDA 1JI0A 4H3VA 3LP6A 4R9VA 3SM3A 2XSZA 1Q1EA 3NNNA 1QQTA 4LYDA 2ZP1A 2AG0A 4L4YA 5IVIA 4YEDA 4C4PA 4M1YA 3I5XA 4NH0A 2QXUA 2C2XA 5CD9A 5L3SB 2PU5A 4RY0A 6CHYA 4GKAA 1AKVA 2FVYA 1KJNA 1DPGA 3KOUA 4KXWA 2WFLA 4Q3OA 3ECCA 1DKOA 1M5UA 3CR8A 4KQXA 3REQB 2VDQB 2HR1A 2ZB8A 1U7HA 5AI9A 3LJKA 4PX5A 3KPUA 4LHZA 5DI3A 3HBNA 4LDJA 4RLHA 3SPXA 1VKZA 1UT6A 5CM2Z 2CL6X 3ZWCA 3EFOB 4N0QA 2FETA 3N05A 2AYZA 2ZVDA 1QK5A 4QJ5A 3PD0A 3BFXA 3WIDA 5KYYB 3SVLA 4Z9YA 2AX3A 3IHTA 3UXYA 3V2UA 1TO1E 5JQGA 1DLIA 3AVOA 1FDOA 3VDQA 4ZI7A 4US1R 4E5MA 1E1QD 2P2CA 4MGHA 3KK0A 4Y98A 4CLOA 5T67A 1XDSA 3AR5A 3C1TA 1K27A 3ENVA 3ZQKA 4WUVA 1N6IA 1YR2A 1FK8A 1JPUA 4UPEA 3EEOA 1VCHA 5DULA 2DZDA 3FUTA 1MNQA 3DOHA 4DQDA 3L7IA 2I65A 4DG5A 5DH9A 3EASA 1UEXC 1CJMA 1QIEA 1XZ8A 2ZE5A 3GFOA 3G7NA 3R09A 4LJKA 2FB9A 3H9BA 1JR2A 2WZDA 4OXNA 4Z99A 1NRJB 1M0WA 1FMCA 1PUXA 3IKLA 1DAPA 4UMDA 4N0DA 4MRAA 1XWIA 4QYXA 1F8YA 4ZEMA 5LP6F 2Q1YA 2YW9A 3R0XA 5ENZA 3V80A 4A92A 4JP5A 2H1LA 1PGQA 4L4UA 3IP7A 4FYIA 2LVBA 1DAEA 2A9OA 4YVFA 4ZCRA 2D74A 1HEIA 1TAQA 1DC6A 3QV2A 3N9IA 1T6XA 1YK1A 2WJ6A 5DGTA 4AKGA 3U3OA 3L7BA 4DCOA 2Q1WA 2PUFA 4WBNB 1VHLA 1XROA 2C7BA 4XUDA 2W71A 1T4CA 5B1EA 1T5LA 2G4CA 2WPDD 3SEZA 4LGYA 3LGSA 2VYVA 4K3VA 3W7BA 1THTA 4JCCA 4L95C 1JALA 5E7MA 3CURA 3RUDA 3L1VA 3DF9A 1QFSA 2HDOA 2WTEA 2ZYHA 5EUBA 4JI7B 4N3CA 5EE5B 4YJFB 4BX2A 4I0WB 3DTVB 1K8YB 3BK1A 3GVIA 3QE4A 5JLJA 2OESA 5AKXA 3ZGLA 4JBXA 1M2EA 2F43B 2ZYGA 2C4NA 1KVRA 3WLLA 3ZZ0A 4F12A 5DWVA 2DYKA 2HRBA 2IL1A 3NDRA 1ZD1A 4FX2A 1OAOC 4Y6RA 4QJ3A 2A78A 1VLMA 3GLRA 3E58A 5JAUA 4IVNA 1NXWA 4FMCF 3TH5A 4D7AA 1VYUA 3S2SA 4TMVA 5AW3A 2M98A 2O2CA 3BD9A 3B85A 3DPIA 5BPFA 4U2EA 1Z0IA 5D3MB 4DCGA 5DCLA 2ZIXB 3RQIA 5LA6F 1QWOA 1FTGA 3HCOA 5B1HA 4J9UE 1OYYA 2B3TA 1HWYA 2PS1A 1QFXA 1HDCA 1NV9A 1DUIA 2AVDA 3KUXA 4HMOA 1D7OA 1QPGA 3GW8A 4WLOA 3ZHSA 5EIHA 2ZG6A 2JFOA 3P2JA 3P5SA 1C41A 2XYRA 4ZKEA 2G71A 2PD4A 3BVPA 4L9WA 3UY4A 3RANA 4JJAA 3ZHBA 4CL8A 4YUZA 1H6CA 1BVUA 1THMA 1NIJA 3ELUA 5ICEA 5GOZA 1VOTA 4NG4A 3IMGA 4IFIA 2J8ZA 2JPDA 2X9LA 1ISJA 5EXDA 2HYDA 4LRSB 3W0LB 2ZI3A 3EH1A 1HT2E 5FKJA 1W49A 1IOWA 3BMNA 4GBGA 4CI9A 1V2GA 1QHEA 1PCXA 2B6HA 2FMKA 2WAAA 1LPPA 1JQ5A 1L7VC 3G2QA 2WWTA 3I4LA 4J1NA 1PT8A 4JR2A 3DOFA 2ZI5A 2LZ0A 1U5BA 2X8JA 3R3ZA 3LIIA 3WTCA 1CEQA 1O94D 5M2QA 4RY9A 1R1DA 2VG8A 1B3RA 5B4VA 1MAUA 3IUBA 4AN0A 2VJCA 2PQ0A 3DOOA 4J1TA 1BE0A 3WO1A 3KKOA 3OZWA 3KOMA 4NAVA 3DKPA 5ES3A 1YJAA 4MB6A 4EHDA 3KWJA 3LBAA 3PPVA 3EH2A 1ZY2A 5T41A 1CCWA 2AQKA 2I1WA 3O9MA 4OQYA 1V3TA 3B1WA 4ACAA 1CX9B 2II6A 4NYIQ 2UZ0A 2B83A 5C7LO 3K30A 4KXNA 1V26A 2GO1A 3WV4A 3ID6C 2V9PA 3MJRA 4JLMA 1ZISA 1EFCA 3WQHA 1ODTC 3JASA 2BGGA 3L4EA 3ETJA 2RHMA 1NYQA 3B3JA 4KL8S 5B2FA 4KQ9A 4ZJUA 5AJWA 2XCOA 2C5EA 4DQVA 3ZWBA 5EJFA 3KJXA 4Y2GA 3PA6A 1KYZA 2BFBB 1RDFA 3N8DA 4R2LA 3PUXA 3VBCA 4L8LA 4O6VA 1DBIA 1JG6A 1E1RD 3D7LA 4KTVE 4IQ4A 1OLUA 4P22A 5DX1A 1HYBA 1ZN7A 3B52X 3DGFC 3GEBA 5EWJB 1VLJA 5CDGA 4W99A 4LOLA 2YOHA 1DQSA 1ZM2A 2KS6A 1XD8A 2ONYA 3PC4A 4JEHA 4R9NA 2H5JA 1U1CA 1BHQ1 1WQ4A 3MS4A 2Q8QA 2AEEA 1P17A 2H0AA 4MR9B 1BDIA 4UDOA 4ARIA 1Y9DA 1N0VC 1R37A 2WD8A 4FW8A 2HDNB 1C0IA 4TXHA 4A91A 4BNDA 5KKAA 3DLIA 1ZJ5A 2ZAGA 1Z0AA 1Z13A 3ZH2A 4NV1A 1LI4A 1BX0A 2XE8A 1U9CA 3R6LA 1Q57A 2IUFA 2YOFA 3KJNA 1KAMA 2JGMA 4GMGA 1BGWA 3OZ7A 1HRDA 3COWA 3KOYA 2IUUA 5AW1A 3EZXA 4XOIA 7ABPA 1O03A 2OQRA 1KPGA 3DZDA 4EMBA 4I50B 1MB2A 1NFRA 1YS1X 3EGIA 4MW4A 2DQKA 4CMIB 2IHJA 4AP5A 5I48A 1KMIY 3DVRX 3O95A 1QOQB 5CP8A 1T9CA 3HA2A 1E3WB 4PVCA 3AJEA 4W1QA 3UMBA 4AMZA 1IK4A 3TQSA 2OSBA 3IP5A 4HWRA 5EMNA 1VGVA 4Z7OB 3HRIA 1K7CA 5B4UA 2ZTLA 3IIIA 4MEBA 3TB6A 2J0UB 3QM1A 4Z7NB 2OTCA 4LXGA 3GRVA 5MDHA 1JFVA 1XTKA 4KIFA 4V39A 3I1YA 2D2IA 5FI1B 5MFPA 3LDGA 1MJFA 4FYMA 2QY6A 3AEQB 1G9TA 1ZC3A 4ECEA 4DSTA 5HW0A 5GIOE 2OKGA 3DTNA 1E79A 1ZJJA 2ONCA 4FT2A 4QOFA 4MLCA 1DQRA 3KJHA 5CEFA 2GZ3A 2G7ZA 5C80A 4XYEA 2P9YA 4OP1A 2YRWA 1R0KA 5HUHA 1TE2A 1Y6GA 5BOSB 5KUTA 1XX6A 5B7GA 1BDMA 2AMLA 4JIMA 2AE2A 2O6HA 2VLIA 4H7FA 3CZRA 1XV5A 4RKEA 3QE9Y 3R1IA 1EDBA 3VPFA 5CLLA 5A6VA 4LNAA 5CCEA 1VC2A 2OB2A 2LIVA 3P0EA 4YRPA 1VB5A 2Q1UA 1L5QA 3Q7IA 3HU1A 3R6TA 4UD2A 4U9UA 5EERA 3EBOA 2H7VA 3FWYA 4HNRA 4GH5A 1E3TA 1WMBA 3U9SA 4JYAB 1VLVA 1Y4SA 4Q1EA 2JD0A 4Z4IA 2O8EA 3UJ8A 4WRRA 1G18A 5KSWB 4ARZB 3JRWA 4RLSA 3MTEA 2B5OA 1N5IA 4KDRA 3KE8A 1RADA 1IN8A 1L7XA 4DCUA 1NURA 4ESVA 3OU6A 1Q5PA 5ISMA 1A9ZA 3UB3A 2PT9A 1QZZA 2BI7A 3VC1A 2WKWA 3IUNA 4EY4A 2VF7A 2IYEA 3A36A 3O4RA 3OU7A 4IDQA 3O8OA 4RS4A 2RKBA 3C1OA 3TM5A 5IN4A 2J9FA 2ADOA 4KRYA 5LDGA 5SZHB 1SURA 1M9NA 1KMHB 2E4ZA 2XLBA 3UT5B 1ONOA 1ZVKA 3D6FA 3BOSA 4MCIA 1QVVA 1U3WA 3FBTA 3IPYA 4UCFA 3FRHA 4EB8A 5JECA 5JROA 2YZ2A 1KI7A 1IWOA 1X7WB 1WCXA 1WO8A 2QM3A 2ZANA 2DWPA 4HBZA 4NWIA 2ACWA 1TJPB 2XUHA 3D81A 1QRDA 4NBSA 5KB3A 3EZ7A 2PSEA 3GT7A 4NK5A 1CF2O 4TV8A 4CG0A 1RPJA 2ZE6A 3A05A 2DJ5A 1DADA 1HQCA 2PR2A 3ENQA 1HMPA 2I2XB 1PZHA 5GGXA 4PZCA 3PC3A 3KBBA 2FF7A 4KWEA 4LVOA 2VZ8A 5DYGA 4UE3S 3L79A 2DHEA 1KZ7B 3VX3A 1LPBB 2E18A 4M21A 1MAWA 3SHTA 1L5KA 1L3BA 3L8YA 1XRRA 4EI2A 5FWYA 1C9EA 2BC9A 4FJ1A 5LNK1 1RM0A 1G3RA 1U80A 3CTMA 2BCEA 1KJWA 7ADHA 4F5ZA 2ZRBA 4XWAA 4D25A 2WU8A 3FDXA 5AVZA 3S1AB 1NR7A 2ZRLA 4N3NA 3U2QA 5IM5A 5EKDA 5FTKA 1H2WA 2PMWB 5IF3A 8ADHA 1KFCB 4NE2A 2H7YA 3ZVKA 2PUWA 1QLHA 5I5GA 2VBIA 4RVOA 4H17A 4ZAYA 1E6WA 1RCUA 4RLFA 2P3LA 3AM3A 4QU0A 1UP4A 2AH5A 1X1SA 1J1ZA 3G2LA 2OSVA 3ER8A 4DQKA 1RJFA 1I7LA 2HJVA 2LXNA 4I6EA 1KU6A 5DK4A 3ZIAD 2MIIA 1OGIA 3KFVA 3FR8A 1C9DB 5IC6A 1DG1G 1C30A 1OA1A 3E9YA 2BR5A 3WK7A 3LDFA 3KEOA 4AZ3A 2VKTA 3ZHYA 4AJHA 2XBUA 3AGPA 3LX5A 4P7GA 1U7ZA 1X7WA 4CUZA 4G1UC 2PVSA 1MP0A 1BW9B 2ECKA 1IJEA 4R1SA 5DHPA 4M9QA 5FO0A 3LA6A 3NBAA 1W88B 1X0XA 2YVAA 4BVLA 2Y8EA 2HQOA 2CB9A 2RBGA 1CF9A 1L7QA 2C0PA 2FI1A 1R5NA 2F1RA 1MV8A 2JHAA 2CNLA 1GG9A 2QN9A 4GVLA 2N0SA 1EYZA 4FFVA 2H1RA 1RM4A 4UTPA 2YZKA 2P3QA 4WGGA 3SIPA 2PX8A 4CEJA 3ABOB 2WWGA 1YOVA 2YDYA 3A28A 2H18A 4DCTA 5IT0A 1UXJA 1F2TB 1IOVA 2J3EA 2N46A 1U0RA 4S1NA 4NCIA 1DGQA 3WMGA 5FFNA 2F8MA 3PRHA 4DOMA 3ER9A 1OX4B 2HQRA 1ZXBA 4N7MA 3TBFA 3PEEA 5HKAA 4GRIA 1DEOA 2R62A 1SU7A 2H4ZA 3EOAI 4JNKA 5HKBA 5IXYA 2SCUA 4Z0TA 4GZMA 2EW2A 4RIFA 1W76A 1YVRA 1W0CA 3CLHA 4I4CA 4X00A 7MHTA 2G6TA 1RZRA 1TI7A 1YRLA 3L04A 1W4RA 1G0NA 4FFNA 1DFHA 1U5AA 3U0VA 2QJFA 5AXCA 4E88A 3CR3C 4C4TA 2WB4A 2XX3A 2OUKA 3QVTA 3N87A 4N76A 1VSBA 4L6CA 3TZBA 1VBKA 1XMVA 5E4TA 4G89A 2B4RO 2O05A 2FRXA 3HJRA 3OPYI 5JW6A 1AQIA 1GRVA 4RFSA 5AKLA 5JDIA 1O9GA 2NO0A 4L8YA 3C5EA 3K05A 1QWSA 2A9KA 2X7XA 3IRVA 5ECDA 3B70A 2PUGA 3IUYA 2FUNB 1G42A 3C41J 4JSRA 3VZDA 1BNCA 2CXSA 1X19A 1XZJA 3ISVA 3R44A 4M6WA 2R96A 5DCYA 5DYWA 5C53B 3T1QA 1BROA 1F0NA 9MHTA 1CB7A 2J9GA 3L0PA 4JOBA 3C48A 4L1KA 1LVHA 2B99A 4L76A 4EITA 3ZUGA 4G8BA 2BFAA 4XGNA 5D7BA 1ZG3A 3QSGA 2PKCA 1UFQA 4LQCA 4Q82A 4GKVA 1D2CA 4B46A 1PBNA 2EIHA 3KAJA 3UHAA 4PPNA 1QHNA 3DOCA 1E9AA 2V3CC 1CDZA 3A9CA 4KMMA 3ZCVA 2EKZA 5DE3A 2O1SA 4PC1A 1FS4A 3UQYS 1TF5A 4XVRA 1C4KA 1KI6A 3NANA 3LNTA 2WE7A 1JA9A 4FN5A 4II2A 2QRZA 2QRLA 4ZVTA 1W94A 4O02B 4GMXA 1FE8A 3HWRA 2BEUB 3OMWA 3G17A 2P7HA 1NJFA 2D1FA 1Q44A 1V7CA 2HPHA 2NU6B 2DBVO 1GM5A 1RYHA 2A6PA 2JVJA 3QYJA 4J0QA 4EJ2A 1MW8X 4P5DA 3DFZA 2VAMA 4O3FA 1RAHA 3T95A 5C0OE 5KYNA 5F21A 1XBTA 1GSHA 2BMFA 5F5XA 3N8NA 4KO8A 4NAHA 3IV6A 4H7HA 1U4SA 4PYMA 5A6SB 4FWIB 1T1RA 5B3JA 4Z3DA 4EY8A 3U4QA 2L17A 1FUEA 1V5IA 3KDSE 4ENUA 1JUDA 2J0QA 4C6TA 1Z4LA 3H84A 4RA9B 5AUNB 3O73A 4XSHA 1E3QA 1TM3E 1UBCA 1VJ1A 2YJ4A 1XNJA 1J0CA 1HE2A 1T3LA 3VPGA 2AMVA 1TC1A 1FFSA 2O8FB 4IIEA 4UBKA 2B9EA 4HH1A 3WYDA 4ANFA 3A1NA 1Q77A 1H2HA 2QP9X 5FHQA 3BKWA 2VIIA 2A5YB 1JT2A 3QV1A 3M9WA 3LUHA 4J0IA 1LFAA 2DLNA 3EEQA 1IB0A 1R8JA 4GXTA 3GL9A 1CUCA 2I4OA 2J41A 2R79A 2ZRMA 3T3HA 5JASA 1RBYA 2XOKA 1HZZA 3VHRA 3SJBA 2C77A 3ROMA 5J58A 3BD7A 1NKTA 2EW8A 1TA4A 1OVMA 1W35A 3QFSA 3ESQA 1TGVA 1IOLA 3F8SA 3QI7A 5FL7D 3STVA 5K6TA 1W36C 2O19A 3RKUA 2IU0A 3AZQA 3PXAA 1KI6B 3OWHA 1IY2A 4I36A 3T0IA 3AJ9A 3REQA 1O6GA 4IDCA 1G8YA 1TF2A 2E4XA 1IG0A 2OLJA 4HDAA 4N7JA 4DJJA 1PFUA 1QGYA 2BEUA 2IXTA 3I5UA 3UPUA 1V5WA 3I62A 1UC5B 3NBMA 1OAOA 3PIIA 4JC8A 5F7ZA 3HP4A 2Q62A 1T34A 3QTLA 4U3JB 1M8JA 1DJPA 5B4TA 3HM9A 1F20A 4JN6B 5A4AA 5B58T 2IHKA 3TCKA 4IF6A 1WBJB 2PXAA 4PSUA 2RIPA 3B3FA 1J0AA 3I3SR 4XTRA 2CLDX 4IDNA 3GLUA 2WEKA 1GTVA 4QTXA 4IJKA 8ATCA 1XHLA 4DT1A 1INLA 1CD5A 2VXYA 3FVTA 3GJ4A 5TGDA 2PZ8A 4O33A 4TYQA 4YUYA 4YT2A 5COAA 3SYLA 5EZYF 4C7OA 1W36D 1KPIA 5LXTA 5HCIA 3CLUD 4BLSA 4QUJA 1KYTA 4W4TA 3EF1A 1Y6RA 1UBRS 4B8ZA 2BKEA 3GZTB 3AW9A 1PWHA 2ZUUA 3WBFA 5IM4A 8AT1A 1UOEA 4RD1A 4CM3A 4KI0A 4ZCSA 1SN7A 3AF2A 3Q3HA 1USWA 3HEBA 2C31A 2X7JA 4XIJA 3LBNA 1LB1B 4CU5A 3JTEA 1DRWA 5EKXA 3U7JA 1QYIA 2C8LA 2P65A 4ZQGA 3ZNOA 2G40A 2WJ4A 4OMFG 5CURA 3WGNA 2OORA 1KMCA 4BJ1A 2Q28A 1MABA 4GO1A 3FZGA 4LEIA 4I4TA 3K9LA 3ZD8A 2QWXA 3JV7A 1JDVA 3TE7A 1A97A 1TAGA 5JI3E 3D3NA 4G0UA 1NYRA 1GGMA 1X1TA 2HZBA 4PPQA 5JCJA 1YCFA 2IT1A 2WDZA 4MQUA 1IOZA 2ZBUA 5BV1A 1IBCA 4ALMA 1V8BA 4PU0A 5IS2A 1KI2A 3AETB 5A0VA 1C8LA 1XAIA 4XVHA 4CV3A 3FCOA 4O08A 4HEJA 5JZOA 4PHCA 5IW8A 3TTSA 4NHEA 4MDFA 4UNPA 3L4BC 2W6ZA 3K0AB 4P3OA 3KLPX 4ZOLF 2LDBA 1L4EA 2F43A 1Y7HA 1Z06A 3ETCA 2PMBA 2AVNA 3KE9A 3FCEA 2UAGA 4AWXA 2GBLC 3KCQA 4W1SA 4F11A 4FILA 1FYXA 3PNOA 1ESEA 3D1JA 4L2IA 3BJEA 4KN5A 4P3PA 1EESA 1SBQA 2QA5A 4WN9A 4GOLD 1HTBA 4ZAGA 5EJIA 4DLYA 4YBZA 5C2JB 4AKEA 5DB4A 3SVZA 1ESCA 4MUMA 3KYCA 4XYMA 2X0JA 3GLIE 3TBHA 1RVV1 3O5AA 3RK0A 1CSEE 2WC1A 4AECA 4HNUA 4IVQA 1CRZA 4LN1A 3VU3A 3GLKA 1E98A 3EDMA 3NH6A 4G8DA 4GR9A 5IANA 3U7QA 1L3CA 2AMYA 1MQSA 1N5KA 2IW1A 5JJKA 2OHOA 1YB1A 5DBIA 3AKZA 5LP6B 2C4HA 3MD9A 2Y71A 2OPBA 4BVHA 5FTNA 2PEZA 1BRMA 4JROA 4EA9A 3EMBA 1X0VA 3WY9A 3D6NB 4MEJA 4MIOA 5GM2A 1YB5A 3UWPA 1GV0A 4OBXA 5BWLA 2PRIA 4X7MA 5G0UA 1AT1A 1P61B 4URYR 2B8WA 2QUAA 3T9EA 3SYRA 1P5RA 4CE6A 1O97D 4YRTA 4DUZB 4U7JA 4C6RA 2CHFA 2FPPB 3OESA 4J4HA 4G5GA 3VR0A 2BDTA 4O2RA 5LXTF 1W19A 5TMDA 4CLHA 3IXMA 3FIUA 4JC4A 1JG2A 1RYNA 1FFXA 3KD3A 3ZOZA 4B31A 3Q98A 3NBUA 3X2EA 3C6YA 2JIOA 1JMKC 4GX1A 4MQ5A 4TWBA 4U6QA 3GGOA 1WY5A 3OZFA 4X1IB 4D45A 1BCRB 1WXEA 5FBRB 4G9EA 4X90A 5F9FA 4HDRA 3D9QX 2GPTA 3M2TA 4BLRA 1BMQA 2FUCA 2UYQA 4FSHA 4IXWA 4PZDA 7YASA 4CJXA 1Q12A 1IXKA 4XFKA 5A1TA 1KEEB 3H2SA 4WINA 1QM5A 2YV2A 3P9IA 4PQEA 2RBEA 3SHFA 3G0IA 5AQEA 3SHWA 2I4TA 4OAQA 3CXUA 5G41A 2ZSUA 4X20A 3HUFA 1J1IA 2HWKA 1OWLA 3EARA 3K0BA 3O9ZA 1T8PA 3W79A 5J1TB 1SVNA 3ON5A 2GFIA 3PWSA 4TTIA 4CNBA 3ULKA 2XLCA 3PQ6A 1F06A 3D2AA 5EIXA 1NJ8A 3DOJA 1WUTA 4UBNA 2YXPX 3HGMA 4OATA 1E0JA 2X77A 3VR6A 3QW2A 1BMFA 2FRDC 2NQTA 4JKOA 3ZN2A 2ZRCA 5LQNA 3EPLA 1QF7A 1XRNA 2P0YA 3R9XB 2Y6UA 5DI9A 4DAEA 1W1IA 2NQ8A 2VP3A 4JJIA 3MBKA 1GZUA 5GADl 4ALIA 2QRHA 1OMOA 1ONBA 1Z4PX 3O92A 4LTDA 1T9ZA 1R66A 1IM5A 1M1NA 2V6BA 5EXTA 2ZM5A 1J7KA 3ELWA 1JFSA 1Q6YA 3GUZA 4TL6A 3RROA 3UT6A 1XPJA 4BUZA 5KQSA 1QDEA 2YYSA 2H2IA 4YS6A 1MH9A 3VVBA 3C3JA 5A3RA 2G77B 2ZKIA 4LTNA 3QNUA 3QRWA 4V0LA 1IB6A 3O2QB 4HXYA 1WU8A 3AH8A 2L0XA 5COBA 2GCNA 2R7MA 5FWAA 1XEWX 1E69A 1ZNYA 4QQRA 2QBYA 3FYDA 1NKVA 1ZSVA 4Z49A 1E2FA 2O7VA 4D9MA 3ZDZB 1HE1C 1XMIA 3Q12A 3F5FA 5JO0A 3BXZA 5CDYA 3RARA 1L8AA 3R2JA 3NLLA 1XO1A 3BQMB 4M0MA 4NCAA 4YDQA 4X1OA 4PNPA 4XVQA 3NAGA 4MINA 3DAGA 2ZZNA 2CXNA 1IHUA 2X6QA 3NEAA 3OO0A 4DLPA 1QFZA 4EF5A 1S8FA 1F0KA 4Y9DA 1BJKA 4X92A 3AVTA 3K0KA 2BTOA 4KXFB 4OO3A 4EYOA 3A3YA 2B4AA 3VKVA 4KE9A 5B1SA 4D9IA 1BX1A 1YE5A 1CZOA 1M34B 2NNLD 2XCRB 3OCXA 4R41A 4D8VA 4YJ3B 4R8MA 4HPWA 3WDSA 4Y6PA 1XTVA 4HRYA 3COPA 2CNDA 3A70A 2A5GA 3CZ9A 1RJ9B 2ZTUA 3ROQA 4DA7A 2P4EA 2Q6LA 4RYLA 5H68A 4X7PA 5JY6A 1ILWA 1LX7A 5E0OA 3IAM1 1NVUQ 4CLRA 2E9SA 1QYXA 1AKWA 1SCDA 3W5AA 2QUBA 1YB2A 1HX7A 4B40A 3M4YA 3CZ5A 2O5CA 4YJHA 1LBIA 3Q2OA 2PPVA 2BM8A 1J9GA 4BO7A 4FHEA 3ZVLA 1YS4A 3G2KA 3K9NA 1N4AA 4EG3A 4GLLA 4MVJE 2FP4B 1CJSA 4Z1MA 3UENA 4QECA 4LY3A 2P2YA 4EKDA 4RNDB 5ABPA 1RYFA 1L7MA 3QKIA 4QPPA 3GFVA 4KQFA 1Z4JA 4TTPA 2FUG6 1U0LA 3N2YA 1HT0A 1HEYA 4QLAA 4R2WA 5THXA 1JDBB 3WG9A 2EHJA 4D9KA 3ORHA 2B78A 3U3JA 2XDYA 5IJXA 3W5BA 2NXCA 2KPOA 3D4LA 4KO3S 5CX4A 2BGIA 2WP8J 3HVJA 3KKZA 1Z8HA 5EG5A 4A8JC 2QUJA 1Z26A 4HAUA 5JANA 5K0GA 3BQNB 3W5VA 2H48A 2JAOA 5EE3A 3STHA 4CI0B 4RD0A 3S29A 1K68A 1C1DB 1VIDA 3EVBA 3REOA 5HUQA 3QXHA 2Q2WA 3QA3E 2R9VA 1T5DX 2HIHA 2QX9A 4K8OA 5SY6A 1W4LA 4L8WB 1AS0A 3EVTA 4I3HA 3HADA 2QRMA 1RRGA 4GHWA 1U2SA 1U04A 3UWDA 3O90A 1SU8A 1DB3A 1OXUA 3HYTA 4QYIA 5EIBC 4A3SA 1SEPA 1SUWA 2Z1MA 1FDRA 4AB1A 2H2AA 2MHCA 1KO7A 2IBTA 3B3GA 1G5IA 3DAFA 3NALA 1YS7A 2Z95A 3JQ6A 1TQ8A 2G36A 1Z83A 3TQHA 5KJ6A 3SVTA 1NZJA 3SBOA 4MKHA 4O4JB 1CNFA 1WRBA 5K8TA 1DWPA 5JDCA 1QTIA 1L4GA 5A5FA 3UGJA 4P3NA 1M2GA 4LY0A 1ZM7A 2RGRA 3PQCA 4OJMX 4X85A 2ABWA 3O2SB 2D1TA 2X15A 3RWBA 1K3UB 1MGOA 4P7BA 3TZQA 1GADO 1QLJA 3KSMA 3VNRA 4KRFA 1AHPA 2FPOA 1KETA 4J2OA 3SWWA 4CG3A 3E8SA 1RZRD 3ZYCA 4RWEA 1V16A 4LCJA 2XMCA 1KH3A 2WD7A 3H1FA 4NLLA 3TOSA 2X86A 4CDGA 1JEDA 2JI9A 1K6JA 3ICCA 2C4VA 2JAPA 2RBKA 2FEKA 1YD7A 3KT0A 3GGGA 1V9LA 1JB1A 2FHPA 3ISJA 1XNQB 2H8GA 3IR5A 2XVXA 4U9IS 3AF0A 1VKRA 3QVUA 4DSAA 4DB4A 1OI4A 3EF3A 5F9MA 3M33A 3G9UA 4HDCA 5K7SA 5LN1A 1UBHS 1J24A 3FH0A 3HYNA 2ZT6A 4XH9B 2HA4A 3B6ZA 1UODA 3C2QA 4UU0A 4NMWA 3GI1A 3O47A 5ALYA 4OAOA 1H2BA 1I10A 2D2EA 4PYJA 1KVUA 1OLUB 3PXEA 3EIQA 3ZW7A 2WG2A 3GH3A 3DQPA 4Q3BA 3TMAA 3KEMA 1DZIA 1LD3A 2YCBA 5KQLA 1IXSB 4DARA 1KIMA 1D2GA 2QGZA 1O87A 3W4KA 1TKBA 4MOWA 3KQQA 4OHFA 4HAYA 3ZU4A 1ULZA 1G64A 1VRVA 3TPZA 4BTLA 1I36A 1L7NA 1DS6A 2P6NA 2VSXA 3JAKB 1XZIA 3HJNA 4GOJA 5E3JA 2WT9A 1AOXA 4DC9A 2WMDA 2CJYA 4HHEA 3U6KA 4C88A 4DY6A 4KPGA 2OCYC 2JGAA 4GYKA 4ITUA 1C80A 5LQRA 2IBMA 1JDZA 1YCGA 3JWIA 4R1MA 4HDQB 5CPFA 5JARA 2A5LA 2F2TA 2G4LA 1C1YA 3JQPA 1QYWA 3N7UA 3OT4A 3TL6A 1GT91 4QREA 4ZDKA 1V5FA 5AVUA 2XKKA 4QQKA 2IZZA 3BH6A 3VVLA 5CRIA 4UDYX 4CM6A 4BS9A 4F4FA 3BZWA 3WLFA 4DIKA 2XTMA 2BRUC 4LXUA 5LLTA 3GP5A 1QDUA 3GLHB 2C95A 1Z16A 4FYKA 3BE8A 4HX2A 3W04A 4BNTA 3NI2A 1T0JB 2IH4A 2M32A 4LOKA 3WLKX 3QG5A 1PG2A 5BO5A 3NDPA 5C7OO 2VWHA 2X22A 3UGTA 4EA6A 2YJGA 5K6AC 4U6NA 5JBNA 4WWHA 2XCTB 4ZTUB 4M83A 2EV9A 2XA2A 3D4PA 2HRCA 3G49A 2DPHA 4N12A 1VIAA 4MYCA 1LRKA 3TZEA 4W8GA 2PZEA 5JR3A 1CW2B 3S8EA 1SC4A 5HMLA 1ZINA 2O9JA 1QXSA 4H7DA 2F9LA 4YRMA 1DC8A 2B8JA 4R7TA 1E7RA 4D3ZA 2JEOA 3FIJA 4PGMA 1EVKA 1FSSA 1ZPDA 5FV7A 3IUPA 2EZ8A 4V3CA 3V8QA 5KX5F 4G0ZA 1ONNA 4DR1B 3FNRA 4M1WA 2PYIA 2A4MA 1VI5A 1FRZA 1BU8A 2HT6A 3C16C 1HZZC 2HREA 5HFAA 4UE6A 4RSGA 4XM2A 1I33A 4NCBA 2OO7A 4HRXA 1Y8QA 2WWYA 3AFHA 3F1LA 1LJUA 1UPBA 1A2QA 4IIXA 2VS1A 3DHYA 3EDQA 5CW2A 2KHZA 3EWNA 1TZBA 3WWPA 2G76A 3UW1A 3Q41A 5F77A 4QGGA 1R4ZA 4CGZA 2V5VA 3FW1A 5DTJA 2ZIVB 4H60A 5F2EA 5CLQA 3E2IA 1T2DA 1U0HC 2HJ9A 4KQGA 1NQXA 1U2ZA 2HF7A 3HCRA 1T9DA 4HUQA 3LIPA 4JFRA 4CKCB 1RM3A 5HKKD 4B45A 2C58A 2XCSB 4NR0A 5C7IO 1XELA 4E14A 3TFOA 2WJGA 3AEYA 2V54A 3FRJA 4EG8A 2CE2X 1XTQA 4IGEA 2ID4A 3BB4A 4OLFA 4TSFA 1W96A 3EIEA 4KK3A 4EA8A 5BURA 3AF4A 5ENDA 4YUVA 4N03A 4OD0A 3PEYA 3WXMA 4FINA 4Q19A 5J40A 2C99A 2N47A 5F23A 1IG3A 2QNIA 1LLFA 2VJKA 2WJWA 3RS7A 1UF9A 1HPLA 5KCZA 3FDIA 2QMQA 2KBFA 3DV9A 4WXMA 4Z4HA 1SOVA 3Q1LA 3K8OE 1GA6A 3U4AA 1F7UA 4B0OA 4UQLA 3I9NA 2UZAA 1NPDA 2B4KA 5IUNC 5A1JA 1CJKC 2B5WA 4OLAA 2Y1EA 2I3GA 3HB4X 1P1HA 2ZWOA 2R65A 3GLHE 4MUAA 1DAOA 3PHCA 1OZAA 3ILVA 3H5NA 5LQKA 4GU5A 2QQ0A 3CF4G 4D96A 4ARUA 4B4VA 3FZQA 1G291 3PRJA 1P45A 3HV0A 4YX9A 4K8RB 2CVHA 3O31A 3IEIA 4W9RA 4C2BA 5J4HA 1VB3A 2FPSA 2OHFA 4MDHA 4W5RA 4D6XA 1H2AS 2O0LA 3DHWC 3P26A 3VMMA 3IJEB 4WCVA 3FYSA 3CUKA 4D26A 1JYFA 2GEBA 2W6ID 2YNMD 1UBGA 4NJEA 3KQKA 3HCBA 4B6SA 5ELXA 3H18A 3VH2A 4BPBA 3PLNA 1XR3A 2XQKA 5EE0A 1YDHA 3CG0A 3ZE8A 3R0ZA 2FAXA 5IKEA 5AKZA 1Y6ZA 1UDAA 2ZTVA 3SLRA 2WKRA 1Z2EA 3W1EA 1MLDA 2OQVA 3B1XA 3PFFA 4S1WA 3KO8A 2P90A 1NF9A 1WPXA 1QF9A 2C03A 3NOQA 4O1MA 3SQLA 3V46A 4A82A 5ADUS 1GY8A 4KLNA 4U00A 2O8NA 4MPDA 5DM4A 3ONWA 1YUNA 3PNKA 4J6FA 1B8NA 4LSWA 4MTLA 4XR9A 4E7PA 4IIUA 1YQUA 3L4SO 1UQRA 1GP2A 2IZ1A 1DX4A 5J43A 3T4EA 5SZKB 3L7LA 1E4EB 3I9V1 3FN4A 2GK3A 4LHVA 2C7QA 1GARA 3IVXA 4R31A 4BKUA 5AUPB 4TS3A 2JGFA 3QEJA 1OFTA 3NGLA 2FHSA 3EEFA 3ED5A 4TVKA 2B92A 2GK4A 3S68A 1WXIA 4LHXA 4KWTA 2C1XA 4C43A 5DTRA 4PPYA 2OBLA 3FPHA 3PXGA 1HKUA 2W0MA 2DKFA 3ZG6A 3M81A 4JEIA 1OXXK 1NFFA 1ZOOA 2QUIA 2HQ1A 4OQMA 4Z3KA 2EKPA 1ZVJA 4BFUA 4NS4A 5H70A 3HXTA 2P6MA 3OUTA 4DUYB 2VP0A 3IT0A 4V1CI 5AW6A 3UC5A 4C06A 3LC7O 4F6CA 4P80A 2AG5A 2Z8YM 5AHXA 1Z6GA 2P4UA 1RKXA 1RXWA 3FMPB 1ZJ6A 5E2AA 5JNVA 1G38A 3ZBPA 3L6BA 4PSDA 2I6GA 3G9ZA 3FYUB 4FQ8A 4O5OA 5K8VA 2BGJA 4PHGA 4CG1A 2EQAA 2ADFA 1T1IA 4OL0A 1R6DA 5TRTA 3SR0A 2W7TA 3OWOA 3IEXA 1KC1A 4H1HA 5H83A 2VPPA 4CM9A 2J0VA 5H3CA 1FOEB 2GH1A 1D5WA 2P3SA 3HG7A 3OZBA 5L3QB 1T0HB 4H6PA 4GR5A 5I4BA 3NTUA 3CF0A 3KUDA 5JQWA 2X42A 3UMYA 4BB5A 4IEIA 4WZAB 1TTHA 2OCGA 3F73A 4ISBA 3N07A 1SUCA 4A0SA 3NT5A 2XNDA 2O2YA 2ZE7A 1QUFA 3KQWA 4LYYA 1XT6A 2PN1A 4CLOB 5D5HA 2IOFA 4G97A 1XZKA 2R00C 4UUAA 4GI7A 1T8UA 1W48A 2XNSA 3CF2A 2YFYA 4Y6SA 4BX9A 2MU1A 2NTJA 4E09A 3Q5DA 3K0FA 4GWGA 4ND3A 1M2FA 3WGLA 3V2HA 4O2BA 3SX4A 4EI9A 4Q7MB 2C9BA 1N5OX 1WCIA 3QSYA 4QVIA 1IVYA 5C46F 5G4KA 2QGFA 2O2EA 2F90A 2NUTB 2XAAA 2ZITA 3T3GA 1CY6A 2SNIE 5BMOA 3ZQJA 5JFGA 4UNNA 4X84A 4AK9A 5LD2C 1XA0A 3DWGA 1VPLA 1JLKA 1XCLA 2QX7A 1ZDMA 3PJEA 2G1KA 2D06A 3DMRA 4JIGA 3ROXA 1G21A 2TYSB 1Z73A 1SZPA 3ZV6A 1VPEA 1Y81A 4FUQA 1WDLA 3GJ0A 4G24A 4HAZA 4ABYA 2P3OA 2GJKA 1IZZA 1NQUA 3DYVA 2ZDHA 1ADGA 2OO5A 4M8KA 2NSYA 2V65A 5JAPA 2YASA 2GAFA 2GK7A 2ZAYA 3O0DA 1EGAA 2OHIA 4BP3A 1HDXA 5DNUA 6YASA 5LDHA 2QN6A 3LZCA 2HHHB 3ML1A 4I99A 3VOSA 1U2TA 3BMXA 3DLTA 2H1HA 2BZ0A 3D6UA 3HY6A 2GAAA 2WU4A 1HK7A 1WCYA 1I2ZA 4W8HA 4YRQA 5F64A 3VR1A 4C2TA 1VHJA 3HA7A 4M1OA 4M0CA 3ONFA 4U7TB 5E8RA 3RUIA 1KXJA 3T61A 4K5QA 3C24A 3GR6A 1YC2A 1AMOA 1LQ2A 5BWOA 1R0WA 2LDXA 3WLJA 4R68A 4HPJB 4JODA 4BP9A 5EESA 2B37A 2YZGA 5EQTA 2HBQA 1MORA 2JJYA 2JRCA 2PLRA 3H2YA 3SKVA 3CINA 4ZCTA 3MGCA 1NGSA 2PLWA 4QUKA 1Z34A 2QN7A 3ASUA 3QQPA 3EGXA 5EWMB 1F4PA 1YR1A 4RZSA 3O38A 3PQ7A 1RYYA 2EAUA 1IZ8A 2WYHA 4J8PA 5IBCA 4RTQA 4FHCA 4NMHA 1K86A 1U3TA 2J09A 3OVMA 5ILQA 3IQDB 3QX7A 5AK0A 1GPLA 3U37A 4YCDA 1EXMA 4XIIA 4CM8B 5LDDC 2HZ7A 2WICA 4AKTA 2VUSA 2RAFA 5GMOA 4QLBA 1LBHA 3AI3A 4YAWA 4F2PA 2VDNB 1ZNWA 3C97A 1QP7A 2HJSA 1NUSA 4IV0A 2QYOA 3Q0EA 2XB6A 3LCCA 4LDNA 1EI9A 3EY9A 1JVNA 1M67A 4RMNA 2OBYA 1PJBA 16PKA 5BQ5A 3WK6A 2XRFA 4P4NA 3TJZA 5LKAA 1PLLA 1A77A 5K3FB 3ZI7A 5IASA 2YKGA 1OZGA 2WHRA 3ZCTA 3AFMA 1SO8A 3QPDA 2P67A 3H4MA 1TUIA 3LUCA 1J2YA 4L5IA 4NL4H 1EQAA 4RE6A 1JZQA 4GW3A 1Y9JA 3IHWA 1Y7PA 4RHCA 2ZB3A 1M8FA 3E5NA 1RM5A 2AS0A 2YWXA 3K4HA 2BSXA 4REMA 1E5LA 3I04M 3Q8LA 1JW9B 2JHGA 2IZ5A 1IIRA 2NO1A 4WLNA 4PPGA 4KKXB 3ZHXA 1IMOA 1PVDA 3E22B 1MOQA 1O57A 2DRIA 2IWRA 3V8NA 4E1AA 4ZYYA 4M88A 4K46A 3WYNA 2AFVA 4EGAA 3VKGA 1XF9A 3U44B 3EVEA 4DEVA 1PJ8A 4PFSA 3TN7A 5EZQA 1DEHA 4L3WA 2XI4A 3K0SA 2IH2A 4YY3B 3Q40A 1R6TA 1IMJA 3BXOA 3O4HA 3FX2A 4NDAA 1PT9A 3E3MA 4MQMA 3ZDFA 4QE3A 5JS2A 5C4IA 3IAM6 2FG6C 4O29A 1J9ZA 2QTTA 4B5LA 5KYWA 2G1UA 4Q3DA 4KYVA 4NS1A 3VYSB 1V11A 3LU1A 3MZ0A 1X8LA 3A0RB 4H31A 4EB6A 4LE1A 5U4QA 3MOIA 4ETIA 4MHTA 4ZYXA 4KLZA 2HC9A 4E51A 4XX0B 3RRNA 4HVAA 2YYYA 2JFGA 3GA0A 1QE5A 1TJYA 4OK6A 3PHGA 4KIJA 4MQEA 1JPJA 4CV0A 2B94A 4KFTA 1DT3A 3IURA 2V9ZA 3MSCA 4AZSA 4E94A 1B8UA 4G2TA 3SYMA 1J25A 3JATB 1XSEA 3H86A 1ZGAA 4YN3A 2JKZA 4D6PA 2ARKA 3R4VA 4E2FA 2E82A 2Q5JA 1E2HA 1BMDA 1KNQA 1N0UA 3QTBA 3UA3A 2W93A 4E70A 2XRMA 4OI1A 3SFTA 3KUKA 1GPH1 3NUQA 5FPKA 5KWJA 4J94A 1WVGA 3LQFA 3M6VA 3I2KA 4B9EA 1CZUA 3KXLA 2HU5A 3PKJA 3WWOA 3ZI0A 3CLRD 3HJFA 5FJJA 5CMLA 1O77A 2Z2JA 4CFSA 5M3BA 1S01A 4FC7A 2VT2A 4MVWA 1C7JA 2BHNA 2G04A 3FA2A 3MWGA 5CH3A 4YRCA 5EFZA 1GAEO 1ORHA 2IKQA 5KMGA 2ICAA 3O8DA 4MUXA 4UM8B 1E5XA 5CJPA 4LMBA 1EGMB 4JBIA 2R8YA 2QTVA 1W34A 4I4NA 3GOHA 5BQFA 4GX2A 4WCFB 1VSUA 2AOVA 4DZZA 2FEWB 1P81A 4ZZIA 3FLMA 2J0UA 3ZHZA 3G79A 3IXLA 4R0MA 4NCJA 1GU0A 5CNKA 1Y3IA 2WF8A 3VHXA 3OY2A 3ZDQA 2YL2A 5F3WB 1EFHA 3OX3A 1RPZA 2Q2OA 3WR5A 2DWUA 3S99A 4BXOB 5EE1A 3WL7A 4QBIA 3V33A 4E1BA 5MHTA 3B6JA 4KNVA 1O97C 5JBIA 2XUQA 3RAGA 1GTRA 4QIHA 4WASA 1WUYA 1W29A 2WU0A 3KZ1E 3H1TA 2P77A 4MUJA 1OASA 1TL7C 3A06A 1KY2A 2I80A 1ZH0A 2IOYA 4WDRA 1R3UA 4HX9A 2UXCB 2VTEA 1KYIA 1DOAA 1US8B 4AUKA 5KX5A 5LOVB 1SUAA 4MS4B 4E46A 3U13A 2OM6A 3EXFA 4TMYA 4LMPA 5IYZF 3SF8A 5IH7A 3M70A 3NJ8A 3OJ0A 1F8XA 1L5YA 1H65A 4O1HA 5LZ5A 2A5FA 5LVAA 4TYNA 4LJYA 1PDWA 4QGHA 1PT5A 3ILYA 3ZV3A 1O6BA 4K9OA 3TLJA 1ST3A 4AYTA 2VDLB 2XMBA 4IUDS 5DU2A 5ESRA 4COKA 1V0JA 3DLPX 5A04A 1O8BA 3HI6A 3QY9A 2NT3A 2EYUA 4RNCA 1W4ZA 5A7HA 2VK4A 3PJFA 3TEJA 4IUCS 4LXXA 5IVPA 4CKXA 4DMGA 3ZQUA 5H1YA 2WJ3A 3RSCA 1FXSA 3RODA 1CQJB 3BK7A 2YR0A 2HIAA 5JNSA 4IQFA 1ZM9A 5KYYA 3HP1A 5B5SA 2VRNA 2MR5A 3NHZA 1CRQA 4UASA 4Y2QA 4FFBB 5ALHA 5A5DA 1WU7A 1XDBA 1LLQA 4OX9B 1OUMA 3C4JA 2AI3A 2G06A 3FPEA 3RHZA 4LZZA 2FPRA 3AR8A 3BPSA 4INPA 3Q6MA 1DOHA 2A9JA 3NEPX 3KELA 3F7TA 3PE3A 3N2LA 2C97A 4F3KA 5HZMA 2CVOA 1G6HA 4MW7A 4QBKA 1VPVA 2W90A 3NHBA 1W0JD 5EIEA 3HSKA 3N8IA 1YL6A 4ZREA 4BNLA 4EJSB 4BFSA 1Y48E 1DC5A 4A7PA 3T9CA 1NVDA 5IBRA 4QGAA 1VG9B 1PWYE 1LNZA 2QE7A 3FHTA 1OZ0A 1OXSC 3GRYA 1YTLA 1SUIA 4GVXA 4OTZA 2YC2C 1A5TA 1L0BA 1HOTA 4MIEA 1PFKA 3JQ9C 4KFCA 4HQ6A 3EGDB 3NMUF 4HZUA 1UXGA 2VDVE 3PHBE 2FW6A 3R5FA 4F9FA 1GXSA 1L1EA 5ETJA 4LV5B 2XNJA 3WK8A 1TZMA 3UUFA 5TVGA 1YTUA 4A23A 3L05A 1NBAA 1QHIA 2HJGA 3ABSB 3ETGA 3L6EA 1MO4A 2IITA 3PTZA 4MIKA 1NBMA 3DTVA 4ND5A 3DNPA 4BAUA 5A3JA 4KPYA 4BMXA 1SBZA 3D4BA 1FSPA 3O1LA 3ZK9A 3LLMA 1U8AA 4PZEA 1O9HA 5JU6A 4FYJA 2IUTA 4DNXA 5A5VA 4OYLA 4RK0A 4FXOA 5FUMA 3AVUA 3CMCO 1M6EX 3H5AA 3A2NA 3VPCA 1HEUA 4RKFA 5FWXB 1I1OA 1MAVA 2PH3A 2YMMA 2VRWA 4ZRNA 4FE4A 3RT1A 3JD3A 1NVKA 2QPTA 2AFRA 1TU4A 3K53A 1U0JA 3VR3D 3ESDA 1L5LA 2GBGA 1D0SA 3S2GA 4URWR 4WE3A 3RREA 5JDCC 3S40A 4F4JA 1PL8A 2OAP1 2GEDA 2WA2A 3MB5A 3R40A 1UUFA 4L8VA 4D99A 5EMJA 4KLCA 3C3EA 2NVUB 1ZIDA 3W5JA 3QKTA 3AJAA 4A27A 1UAGA 3OTQA 1CR2A 3S3TA 2JI8A 3DZGA 1YMQA 2G70A 1UBSB 2HCFA 1Q1BA 2IK8A 2IYOA 2PUVA 3K1TA 1XPOA 4E03A 2XBLA 1ODFA 4NJEB 1Z7WA 1KDZA 1JTVA 3U26A 3UV3A 1TYEB 5DEIA 1R4NA 4OL9A 4ZJZA 1EBBA 2VDWA 3W8FA 1N2EA 3V7YA 2R7AA 5DTQA 1CY0A 4K6OA 4JB0A 2FP4A 2AHOA 2ZKLA 4NVRA 2A9PA 4IJWA 2IEZA 2PHZA 3SBEA 1ZIYA 1IWBB 1QQ5A 1BFKA 3LT1A 3VXKA 1Z35A 2IEYA 3Q88A 1W6RA 4EKYA 4U7DA 3BE6A 3NWEA 4I6JA 1JBQA 1QAOA 2W00A 3UM9A 4KBGA 3PYMA 2D5AA 4JAVC 4WNAB 1JIVA 1J42A 2ZJ7A 2ZWVA 3A25A 2X5KO 1ZGCA 2OZLB 1D6MA 1P1CA 4J16A 2ZRIA 3BWBA 1MENA 1LFDB 4JL5A 1KR5A 1J06A 1FA9A 2Z5LA 3RV4A 4X54A 4EUSA 4DA4A 5FOTA 5JOQA 2PUDA 5HIMA 4LJ5A 2M6KA 2HN9A 4KVAA 2RH8A 4DLXA 621PA 4ZOLB 1EVIA 4EW6A 5LR6A 2JHPA 4DYHA 1GR1A 2LBPA 2D0DA 2HLHA 4OHVA 3WLQA 2FWPA 4XIGS 3RBAA 1J21A 1WSWA 3WHKA 1SU4A 4BAZA 4ER7A 1Z5UA 2FE1A 2YN4A 3I6QA 4BB0A 3ZUPA 3CC8A 1YZNA 3QUAA 4KK4A 4KVGA 4F97A 1CP2A 1J97A 4XA8A 1ZRNA 4AJLA 1W4AA 2J3MA 1UK8A 2IE8A 2IYNA 3MAGA 4TM7A 1IU9A 4WCFC 1L4KA 2WKPA 3QU7A 2AK2A 1IQPA 2Q7XA 3GFRA 3VR2A 1FFYA 1JA1A 3WIVA 5CG1A 4NXMB 4Q03A 2FN8A 2BCJQ 1QS0B 3PB3A 1UPCA 1RXUA 2I33A 3VRHA 2AUTA 4CIXA 1BWSA 3T41A 1IEQA 4ENVA 1U1FA 2IUSA 2OCXA 2GOYA 2KMLA 3HJAA 3SM9A 1ZI8A 5JTTA 1O5OA 1XJCA 4EBBA 3VOBA 4F91B 2IV3A 3WYCA 4EUEA 1Q17A 2EP7A 1RHJA 5HBRA 1C9JA 3STXA 9GPBA 5F12A 2X5NA 4MB0A 3JQGA 2C0CA 3VR3A 1JXAA 2MSKA 1T1JA 4ZHSA 5JUWA 1JKJA 3DBVO 3I45A 1CDEA 3U3ZA 1PL6A 3NIFB 4KN8A 4X1YB 5ALXA 3WKDA 2W6NA 2Q6VA 2ZBDA 2WM8A 1UKCA 3E5RA 1TVMA 4LUCA 5T4HA 2BGTA 5JLAA 1UMBA 2AN3A 5CFNA 6LDHA 4ZV4A 5B6JA 4DUPA 4RWZA 3EZYA 1Z7EA 3AMVA 3GDOA 2EXXA 4HEA1 4JLDA 4D0LB 4FB5A 1K7SN 3MJFA 4N82A 3MJTA 2CXTA 1GQOA 2FFHA 1ZM3A 1J0DA 2GASA 2GYUA 3DDWA 1AKEA 1R4MA 3HO6A 1QFYA 1EDOA 3L6RA 4J0EA 4JFAA 4JQYA 4LSZA 9ABPA 1YVPA 2C9YA 1XWWA 1ZW6A 3M1IA 1EE1A 3U7EB 3ZCXA 2RB5A 3E23A 2GR9A 2PXCA 3VU1A 3N8KA 4GBED 1LSOA 5EP4A 2AI1A 4PQYA 1Z36A 2P5SA 3H11A 5BRAA 2ZSDA 3OFND 2CV1A 1BMFD 4BZPA 2R5WA 4F1KA 1YA6A 3K31A 4KXYA 3EMVA 4CIWA 3M4NA 4H3SA 2VF2A 2YUIA 3HSSA 1WDWB 4QU5A 4ZVQA 1XOIA 3A1WA 3A9RA 1NVMB 4I9NA 5A5EA 2EJWA 1N3IA 3MTIA 4HY3A 5KTRA 3HZZA 4TT3D 2X9QA 3K3PA 1QJ4A 1IEWA 1GKIA 2GEKA 3TNJA 1QTQA 3HK2A 2YN2A 3RSGA 4W5WA 5BN4A 3WGUA 2QMHA 4F38A 3W6PA 4GD3Q 4JT9A 1G4AE 3LPNA 4F2DA 5BV2P 4WHMA 4DR5B 3LF1A 1J2JA 1OZHA 2ZR8A 3O8QB 4CCYA 4W5NA 1PZMA 3FXAA 3D59A 3OQVA 4A8JA 5BSVA 4CETA 4O4JA 2VQ6A 4RVNA 2FA9A 4GE3A 4YRSA 3WWYA 5A0FA 3OIGA 1J0XO 4ZT5A 4EM6A 1ISIA 1N8SA 4R8RA 2E3JA 3OE7A 1J2TA 4XWWA 1E63A 2O1WA 1Z4KA 5BMVB 1T2NA 5KPJA 1QHYA 3DT8A 1B8PA 1VECA 1ZMBA 2C5BA 2GZHA 3DFFA 3DQQA 1S1CA 1V25A 1J0BA 2XA1A 4QPJC 1C0KA 5A4IS 1SXHA 1QQ7A 5ITSA 1KEZA 3GBPA 3ZR4B 2VYCA 2ZPUA 2ZJ8A 1PUIA 4Q7KA 4RETA 4O4LF 3WQSB 1CUJA 4ZKDA 4L3VA 4QGFA 3AZOA 3I04A 1NMYA 1SKQA 4EFLA 2LCQA 2PRJA 3RIGA 4BX3A 5KVQA 3W06A 3ROGA 1HYHA 1E2QA 1MV5A 2OR3A 3W4JA 3EA5A 2RD2A 1ZK2A 4JLVA 3W4IA 2AUMA 4XB2A 5FTLA 4W5QA 2EEZA 2UYOA 4Y67A 3AESA 1D4ZA 3PENA 1T3TA 4RKWA 3LUDA 4CG2A 3OEYA 5I3CA 1M6NA 3AI2A 4F8YA 1RCFA 2I6UA 4JCOA 4PRYA 5EGSA 4U9HS 1WUJS 5LOVF 3JW8A 1ADCA 4DIDA 2EG9A 4Q02A 1Z17A 1U65A 2C3YA 10MHA 1YO6A 1N5DA 1MC8A 1Y1LA 4V38A 4DG9A 3R7LA 1SC3A 4MMZB 1YI8A 3GHYA 4ZVLA 4HUTA 1H5QA 2BMWA 2ZJ1A 4JVLA 4W1RA 3V32A 5DNAA 2EJUA 3VZCA 4B8YA 4H3KB 1MABB 3A9VA 3WIBA 2UYHA 3HPRA 4MA0A 3S1LA 5KYKA 1NW3A 3ZV4A 1Q0PA 4FFLA 1ECBA 1WL8A 4P3KA 3FG9A 1I7PA 2V1UA 3OPQA 5BUCA 3WBKA 4C89A 3QVGA 3D0KA 1JWBB 4E08A 4M8SA 1E6UA 3WDMA 2BBTA 3GPLA 2ISQA 2FN7A 1UFKA 2GPNA 1B6GA 2F8LA 4XEHA 3HDQA 3RYHB 3DT9A 3WFIA 1OBCA 2LKCA 3X43A 3VMFA 2PWPA 2CNWA 1ODJA 1SVIA 1AGPA 2ZU0C 4BMZA 4E2ZA 6GPBA 2D1QA 3BXXA 3NR2A 1IY0A 1CULC 1WSDA 3MGGA 1SHKA 1QB7A 3IQGX 4LJ8A 4DWOA 2UZ4A 3OQOA 1E1QA 4NFSA 2G5GX 2V98A 1VCMA 3HPQA 3MCUA 1B00A 6NULA 2H2DA 2O4CA 4ML3A 3SI7A 4EEZA 2KWIA 3RHSA 1S2IA 2EBUA 4N1AA 4DJFC 2ZOSA 1P3Y1 3D6HA 5TDHA 1R50A 1XHFA 1OU0A 3SX2A 3ZWAA 4I9FA 4LTMA 2P9ZA 3FLEA 3EPRA 4XAQA 2ES4A 4BGVA 3VSBA 2P9CA 5E1OA 2AC7A 3EQ6A 5IHXA 3OLCX 3P52A 1F17A 3D8BA 2AWOA 4DV4B 3HU2A 5KVCA 2QI9C 4AYXA 1XMXA 5DF1A 2VFAA 2C2HA 4CEIB 1LX6A 5AJZA 3C3KA 4AZVA 5JPCA 3TLZA 3ROEA 5LB4A 2UUBB 5DLPA 3TAHA 2RGDA 4OB8A 4DSZA 4YDSA 4E5KA 4FYYA 2Y1XA 2WF5A 4HYYA 1QMGA 3WQQA 1FL9A 2C9CA 1Z0JA 5AP9A 1SHLA 5I9IA 3IR6A 3G8YA 2FR8C 1YB7A 1PZFA 2ECOA 1V7ZA 2BTQA 4AY2A 4NDZA 4DYDA 3HYCA 3ZWMA 4WLEA 4HN9A 1NBMD 4Q48A 1MVNA 2DTDA 2XMRA 3IA7A 3LPDA 3VAYA 3NOVA 1PJTA 1SC6A 2DQYA 2Q6OA 1E7MA 4NZNA 1ANKA 3FTNA 2ZULA 4QRIA 4RENA 5FT9A 3U19A 5CT5A 2CEKA 1OXVA 4N6GA 4P84A 3HCFA 5ALLA 2B4YA 3IRUA 4Q4HA 3JQFA 2QRGA 1PDVA 2OQIA 1VKJA 3H4TA 4UHFA 3M6UA 3J81A 1GNSA 2V3WA 4GR4A 1DJLA 5A2GA 1KO8A 1VLQA 2O8FA 3GA5A 1W6UA 1TTTA 2BFFA 2OBXA 2OORC 4JC0A 4KAXA 2PQ2A 4M60A 5HWSA 3FHLA 1ZD2P 3B89A 4EPXA 2Y66A 4RA6B 4ZEOA 5E9WA 5FBVB 2XRYA 4H0FA 1FYEA 2D8AA 4PC2A 4F0JA 4UXIA 5NLLA 2LUOA 3C6XA 2DT8A 4RIEA 3NKVA 4CKEB 4UFOA 3FLBA 2VHUA 3OA0A 1A3CA 1SG9A 2B21A 2QG6A 2HBRA 1AK1A 3ZOKA 1NL3A 4NZMA 2P68A 1FNDA 1O7JA 1MEEA 4BQQA 3TI9A 1VCNA 1KSFX 1BQ3A 1G2QA 1TIKA 2FPLA 2IODA 3HKEB 1CJBA 1U7PA 1Q2UA 1XTZA 2XD9A 3AM4A 2OGWA 3L1UA 5D8DA 5KOJB 3CFYA 2NSJA 3CS3A 4IG4A 4RVSA 5HBGA 2XB9A 1P7VA 2W2LD 3V8MA 1EVYA 1R6UA 3HI4A 1ZA2A 2HX1A 4K9NA 3ST7A 1GL3A 2BKUA 1Q20A 2O7NA 3AUYA 1R4AA 2IYPA 1SCUA 5AW2A 1VRWA 3D8RA 2LD4A 3B7PA 3W5IA 1E1KA 1Z25A 4EG6A 5KNBD 2GBLA 4EABA 4IIHA 4BVJA 3QWBA 4MWSA 2HV8A 2JK0A 1PIWA 1NJ2A 3PYXA 3RS2A 3DDUA 4OUKX 5K4AA 2JEZA 1KVQA 4AZ0A 1CE8A 3FWZA 4X60A 3L7CA 1CRPA 3U1BA 2K2QB 5FUQA 1R6VA 1M2NA 2O2DA 3BHNA 1FLNA 3VAZA 4R54A 3TX2A 4R8KA 5KNCA 1ADFA 3CUVA 1VBNA 1E1NA 4JJ6A 1MD9A 1OIWA 2A14A 4REQB 5JSYA 4X1KB 5C9ZA 5EZ5A 2AT1A 2VAPA 1SKYB 4U5QA 1FSFA 3H17A 4ALLA 4C5CA 3FUWA 1P1JA 2ZIAA 5HIIA 3GUYA 4HGRA 3GAMA 4IS3A 4MICA 2XUJA 1U7OA 1QHGA 2GHRA 2WMNB 4FNOA 1S9DA 4ZK2A 2F67A 1PGPA 3AIKA 5UKDA 2IXEA 2JLYA 2JLWA 2H08A 3R23A 1VCOA 1VBMA 5CBPB 2HO5A 5G4KB 5GJCA 1XTJA 3BL6A 3BSYA 4AN1A 4BBPA 5AW4A 1ND5A 3VZBA 1FMFA 1E9EA 4FMCB 4G07A 1CZNA 4GLBA 1R88A 1IUPA 1TU3A 1G7TA 4ZAWA 1EWYA 3B9PA 3CX8A 1E96A 3WJ7A 4HGYA 3ZJYA 1TB4A 3U6BA 2BFCA 1LVGA 1II9A 3GCXA 3P0JA 4Y0VA 1M8PA 3CZCA 5HQJA 4C2UA 2I91A 2AEJA 3BILA 4YJGA 3AEXA 3OQPA 3NU1A 1E9RA 5HKKA 3U4MA 4H7JA 3L01A 2H5LA 4HBGA 4UHJA 1FQJA 1PX2A 3DR3A 4KWCA 1I3MA 4K03A 3RS8A 1CQJA 1EVEA 2JLRA 3UK0A 2H29A 2Y93A 2XVMA 1Q0RA 4G4JA 3FF1A 5AXBA 5BRNA 2CMFA 4J1TC 4BTEA 3F1KA 1R2QA 5EZ6B 4AVYA 3B3QA 3C15C 1FJXA 4X3CA 3PUYA 4G65A 2PXXA 1OILA 1YH3A 3KTOA 2Q9BA 3HDJA 1E0KA 1HXHA 3I9V6 1XQVA 1GUDA 5L53A 3SQMA 2GAIA 4FI3F 1X1BA 2DLDA 2QYTA 1VE6A 1CKEA 4G5HA 3I9JA 4KACA 1IIBA 2O1XA 4I46A 4RJJA 4AIRA 1PJQA 3CZQA 4D92A 5KNLA 4RW0A 5I7OA 4GL4A 4RA6A 2MSCB 1U63A 1QU3A 3LHDA 5YASA 1JHOA 1FLVA 1VIVA 2XVYA 5BOSA 5B7NA 1SCNE 2C7OA 2JLAA 2FUG1 3KEGA 4FFOA 5FA5A 1NFQA 3IE0A 3W5UA 8GPBA 3IKTA 3RG8A 5F3RA 3TTWA 1UC4B 2VHQA 4XQCA 1DC4A 2DQZA 4H1TA 4UCWA 3GRAA 2JBWA 1T13A 4HZUB 4ACBA 1X8JA 4MYRA 3EDRA 1GZ7A 1I4DD 2O14A 3DUFB 4QUHA 4RVHA 2X5JO 4XE5A 1CYEA 4CL3A 1F2DA 4HWGA 3WB9A 2C88A 3T7EA 3CKYA 4LYJA 1HUQA 2ZWIA 1CIJA 2CBXA 1NLUA 1TT7A 2ISCA 5E6SB 5GONA 1AUOA 3RUEA 1SHUX 4LXIA 1EFTA 3W1VA 3EQ9A 2FYTA 4LRYA 1QHSA 4NATA 1EFKA 3KTAB 3K2IA 3ZWOA 1YGYA 1DE0A 3AYXB 3FJOA 2XNCA 4Y6OA 4XJXA 3SXUB 1H0KA 4LHYA 1G5QA 4RK1A 4XWTA 1LWOA 2OXCA 1JA0A 2CXHA 2WJPA 4LRWA 4M9ZA 4WGFA 4UFPA 5GZ1A 4XGQA 1YBVA 5J2UB 1DDOA 5FBZA 1AKNA 4R98A 2ZUWA 2ZXFA 2P6UA 3UMMA 2WWXA 1WABA 4HWPA 1Y1RA 1G16A 3IMKA 5AJUA 5E9QA 3VR5H 2OXEA 3JYLA 5CB4A 5CCXA 1JJIA 4M1TA 3A4VA 1XDDA 1BXGB 4UOEA 1JU9A 5JYDA 1NXPA 1SGWA 1XA4A 4LYAA 1RAGA 3MTQA 1MRSA 5G40A 1N5JA 5KDLA 3HXMA 2X2FA 13PKA 1H1LA 2QLNA 3BRWA 2C3PA 1YRHA 3F2VA 3LO5A 2PSJA 3F6SA 4R1OA 4NU0A 3AHGA 5TS3A 1KWGA 3IEMA 1ARZA 2P5UA 1WDTA 2WINI 5MN6A 4AJKA 4OHPA 3WK5A 2ATEA 3WBBA 1DKLA 4BUJA 2YWGA 2I2BA 2ONJA 3WGGA 3ZXSA 5AM0A 4RORA 2O0MA 2XDAA 5KTOA 1I2CA 3ITDA 1LK7A 3KQMA 3TXXA 4W1PA 5HKLA 1CLUA 1C81A 1RJEA 1YZFA 3BGSA 2VYND 4IGIA 4QUIA 3WNCA 4F3CA 3FFTA 1JBKA 2O50A 2M1XA 4AJ2A 3ZVNA 1T6BY 4XFJA 2H85A 2WOJA 4DXDA 2AOWA 1ZVVA 5JD6A 2JBAA 4A4DA 3KKNA 3UMGA 4LW8A 3WYBA 4W7IA 2ZBVA 4JBYA 1E3DA 3MK31 4HYEA 5B1YA 1MH1A 5FHRA 1F60A 3TSOA 1D04A 2YBDA 3CLRC 1W5EA 3K4QA 3Q7PA 1MB0A 3UK6A 3VNQA 5KNDH 1IE3A 1FFXB 1ENYA 1PEAA 3DFMA 4WOPA 3IOBA 1KI8A 1SC9A 1CY4A 4WKOA 1BQ4A 2R751 2ZE8A 2I67A 2Y0EA 4I1SA 3P9YA 4YCSA 3LYUA 4CL0A 2WD7B 4D5GA 5J23A 1FPMA 4QEZA 2ZRAA 4Q1DA 4G0MA 1I2AA 3LBIA 3R7DA 2YJ3A 4Q9NA 3A1TA 3G6KA 3PSAA 4KO2S 4OYHA 1LY1A 2YV1A 3PPYA 2P9FA 3I58A 4II7A 5DLEA 1E9BA 1R0ZA 4XJSA 1ZAKA 3A1CA 3ZIUA 2ANCA 1BKDR 3GRRA 4KKVA 2GBPA 4MS3B 1N0WA 3KVRA 2FX5A 5AHOA 4QDJA 1W5TA 2QTVB 2HY7A 2MSEB 3L6CA 3USCS 4EFMA 1OA0A 2XZLA 4F85A 1QV6A 3VNUA 1NBHA 4RDIA 5GONF 4JI5B 1F14A 3AVWA 3MWEA 3NWJA 3VR4A 4EFKA 1JLSA 1RC1A 4TTTS 2POQX 3AKEA 2PUHA 2QD2A 2ONZA 3N2GA 2AOTA 1YACA 2FMFA 2HK9A 1TCUA 1ZYUA 4GOOD 4EA7A 1NUTA 1E2UA 4OOEA 3RU3A 3HKBB 1WPQA 3RQSA 4EO7A 6REQB 2OLEA 3PDUA 3QE3A 4YACA 5K2OA 3OZTA 1CUYA 1SZCA 3D31A 2JGKA 5ARCA 2ZCJA 4GF5A 3SHOA 1ESDA 2IQ5A 5EOVA 3CUWA 1SQSA 3V2IA 4B6FA 3T1NA 1HLGA 4B7CA 5CXQA 2R2GA 1H1DA 5LC1A 2OCKA 4II3A 4BKRA 4DIOA 3OM1A 1FDSA 1T5IA 1NC1A 1P0CA 1QK3A 1QGDA 2PUTA 2YZ7A 2ZZMA 4V2UA 3EXG1 3HWSA 3LKZA 2X4DA 4DV2B 4ZOQI 1CEEA 4OMUA 3BX1A 5ALDA 3EA4A 4C03A 3CRRA 4ND8A 4U7WA 3ENKA 3NW9A 4MQFB 1RPNA 3G1WA 3ZWVA 4UAUA 3E2MA 4PLFA 5ALNA 3QKRA 1F3OA 2XSZD 2Y05A 5JAZA 4UBLA 1HDZA 4YJ2A 4RC9A 4QOJA 3RTEA 1BIFA 1WV1A 2RAUA 3SLGA 2RHJA 5ALEA 3HDGA 3BXEA 3HBAA 2VUIB 3TIFA 4IPTA 3NIWA 1JDNA 2BGUA 1Z39A 3KZCA 3CJRA 1UDCA 4J0GA 2NWQA 1NAHA 2Z5FA 3O03A 1U8UA 4C01A 3IA2A 5CDSA 2JL1A 4Z3OA 2UZ1A 1JDSA 1VXRA 4FHZA 4BP1A 1UJ5A 2H92A 2QV7A 4ZTBA 1FVHA 5E7QA 4A0GA 1HL3A 1WP4A 2XNDD 2ZT8A 1L7PA 3C3MA 4INAA 1EP1B 4GOKA 3HA3A 5AWFC 4LOHA 3TSWA 2NZUG 3R9WA 4UD6A 3WI7A 4MR8B 3SFVA 1YCHA 2FWNA 2PX3A 1OTXA 4H27A 1L2TA 5HK9A 5JEEA 1K6IA 3IAHA 2JFYA 3M6AA 3OOEA 1M66A 3L18A 3OZCA 3QBDA 2XCQA 1RQ7A 2H0QA 2VDOB 2R97A 3KALA 5CX1B 3VYTB 3DZBA 3IERA 5I3ZA 4L5JA 3S2UA 1J8VA 2BEVB 4NKRA 1QH8B 3QFHA 2O1EA 3C4VA 1RP7A 5DN6A 1RTKA 3W6OA 4P08A 4CM4B 2HQBA 1Z7BA 1S1MA 2YJ5A 1MA3A 1A88A 1MEOA 4OHOA 1JR6A 2OBMA 3NTXA 3KPWA 3FZNA 1D4AA 1E9CA 2H7CA 1XQXA 3PC2A 1GSOA 3LFUA 4YLGA 1RWXA 5T6BA 1M2HA 4CF5A 5IKXA 4FDMA 3MJHA 2CDCA 2PPLA 1MFZA 2EFGA 4OF4A 1ST2A 3IDSA 2GN6A 3NHPA 1KPHA 3JQBC 2BV3A 3TDMA 5D3MA 3M1LA 4E4TA 3UT0A 1CWUA 1CZLA 5I47A 4RVGA 2R4TA 4L8GA 4OQFA 1G7CA 1V1MB 2R1UA 4GI3A 1MIOA 5DIZA 4I3FA 3ZE0B 4HVCA 5CA0F 4US2R 3OWXA 1SM4A 4MQBA 1EP9A 3V00A 4C0XA 3LBFA 1JHRA 4I5IA 1RMTA 4DV1B 1WMDA 3BHIA 2AKYA 3VNAA 4DRYA 1BTOA 3PPWA 5EKSA 3UN1A 4FNAA 4IGKA 3OQMA 3BWMA 3VISA 3EVGA 2JZCA 3AEUA 1SQ6A 2QT9A 3WNDA 3NC1C 1XKQA 3H2IA 4OB7A 4BFVA 3T38A 1VFPA 4EDHA 1Q0SA 3BMNB 3CPEA 3K5WA 3UJNA 1UQUA 3EA0A 3PNVA 2PRSA 3D8NA 4KDFA 2CJFA 1FZQA 2C7GA 2QN3A 2CLOB 3C6ZA 3ENNA 4KJZA 3WSTA 3TD6A 3CVJA 1QH0A 1DKMA 1RKQA 3OJLA 5F5LA 1YQGA 2BF4A 2Q5CA 1YFZA 3B8EA 4H1VA 5IDWA 4RD4A 4PTYA 4EY3A 1YDGA 4MI9A 4PY2A 2AJTA 4EEKA 4P53A 1MQ8B 5KVSA 1Z47A 1S6YA 4LCBA 2YHUA 1E5QA 3LGAA 1UBUS 1V45E 3AFOA 1S3GA 3L7JA 2FFRA 2R00A 3GVCA 3I9KA 4YDRA 1Z4IA 3N0TA 4Z4GA 1MG5A 1SFRA 2O8EB 1I01A 4OGKA 3IVGA 4QAQA 2JFUA 4F04A 4FZRA 2P9GA 4BO2A 1RLTA 1EUYA 1QG6A 3LVQE 3AL0C 2ERXA 3OUZA 4OJQA 4MH0R 1SEVA 5HNKA 3CH7A 2OV1A 5CM9C 4WNAA 3TOCA 4MSUA 1MNAA 3X1WA 4JL8A 3UAXA 3AEZA 5T8KC 3RWOA 1HC7A 1QJCA 3M6IA 3EQZA 1MPTA 4KMRA 3RRJA 1Y5NA 2AOUA 3VGJA 3BJZA 2AI2A 2X23A 5BUZA 1MHTA 2XTJA 2UYYA 1VI2A 3R4CA 1E4EA 1AURA 2E0IA 3I1FA 5ECGC 1KR2A 2JS7A 3MCVA 5B1IA 3YASA 3U60B 1MKYA 1K9SA 2Q3HA 3K92A 4FNGA 1JFFB 1XVVA 4ZO9A 1WMSA 2X2EA 5JJ5A 5TQ0B 1DRUA 4K9DA 5IJAA 3MC1A 3SU8A 1VE9A 4I1VA 5CLGA 3OJEA 1OYOA 2PUJA 3ANMA 4JASB 2WK1A 4PC7A 1R00A 1IL0A 3PQ3A 1Z12A 4N5NA 2YHBA 4JLNA 3R24A 3EG9A 4DMLA 2PIAA 4FIZA 3ZU6A 2R6ZA 5DNVA 1GPUA 1RRKA 1XK7A 2TRSB 4R9SA 3WMRA 2WYVA 3DMNA 1E79D 2NVUA 4D3DA 1M3SA 3WLHA 5CDHA 1KIFA 2GKGA 3M83A 1ZIPA 2ZR7A 5AKYA 2CNKA 5I7HA 2VEDA 1UDWA 4Q16A 4R2MA 3PNMA 4G0YA 4B35A 5CFQA 3JSXA 3OX2A 5JHHB 1N9GB 1WF3A 2Q3DA 1I94B 3EVDA 1UZLA 2EDCA 1YAHA 3W5HA 2VQEB 4P3XA 2ZUBA 3QYPA 2Q46A 1M7GA 2GDJA 1YS6A 3ZHQA 3MOGA 1YJ8A 4CTKA 3DMFA 4RV5A 2PX0A 4YCLA 5CD1A 4Q15A 2UXBB 5DYNA 3N58A 4Q4HB 4LF6B 1WUIS 2XB2A 1U7WA 4MAAA 1QHXA 4PLYA 4ZO7A 3SZOA 4HGNA 2DSNA 3EHDA 1JFTA 4TKMA 2C2KA 2XZPA 4GM0A 2CLEB 4QTTB 2DFLA 4DABA 1EBUA 4MYUA 2I2DA 5KJEA 5KNCD 2HAEA 1T3SA 3AJDA 3D8SA 5GV8A 1KQNA 3VR4D 4MGYR 3W2FA 2DQ4A 3MRXA 1Z5VA 2QVXX 3K96A 1YHYA 3Q6NA 2HUNA 4Q4AA 3BDIA 2ZI6A 4DHEA 2ZTMA 1O2DA 2OXFA 1FP2A 3O4IA 4Y2RA 3TVTA 3MELA 1OLOA 3G1TA 2HADA 2V6FA 4U7FA 1NA5A 3P2OA 5CXSA 5GM1A 3N86A 3ZV5A 2AR7A 4AO6A 3AXTA 3SQDA 2EKLA 1C3LA 4ERXA 1XALA 1LKZA 1YMUA 2VBFA 4PR0A 4ZI7F 3PGA1 4QG7A 1UWCA 1WG8A 1B0ZA 2WJIA 2Z2IA 3Q7TA 4N39A 4QU8A 2XUDA 3D4OA 1ZMRA 3H3JA 4M7WA 3BRQA 4MKGA 3QW4B 5E6UB 1KDYA 2NPFA 1XRQA 4IQ8A 3CNOA 1V43A 4TN5A 4S04A 4N5IX 3PUKA 2W5UA 1SMKA 2CHGA 3O83A 5JPIA 3HS3A 4BRUA 2JH9A 4HFJA 5BSMA 1T1EA 3I8XA 4I08A 4ZDWA 5HTOA 2D59A 5J9FA 2W2LA 2ZLBA 3TNDA 3HFRA 3ZEAA 3F3SA 1GOTA 2I2FA 4BE9A 2PZFA 4A8JB 4X20B 5FBKA 2JIMA 2V6GA 4IILA 3LW8A 3SICE 2PGOA 1ZI9A 3TZLA 3WWEA 1EVQA 2BY4A 2R4QA 2Q49A 3QEOA 1CJTC 4KX3A 4QHYA 3VU9A 1DBSA 5KJFA 4LF5B 3TW4A 1EFUA 4I1UA 3QOXA 4KFSA 2ECFA 3CW2A 3JR3A 3INGA 4ZOEA 3RYFA 1LLCA 1OFUX 3TIVA 5CB8A 1NZDA 2RH5A 1HLDA 3QI2A 1DRKA 4HH0A 2O3SA 1YKSA 1BSVA 3TAXA 1MVLA 4RIHA 4ESHA 4BB6A 1SCIA 2VJQA 1TA9A 2AB0A 2P9TA 1UAAA 1OXKB 1EWRA 2IIBA 1NLZA 1T5SA 2VATA 1UBKS 3GEGA 3L9WA 2VHEA 3LUKA 4YAUA 4ZANA 1KFEB 3D2LA 2GZ2A 4OGGA 3PX3A 1LNSA 3IOMA 3MGAA 4URUR 3EUEA 4AZWA 2D6FA 1EWTA 5TVKA 5JMTA 1P9RA 3NM6B 4DVJA 4FT4A 3CVVA 3DBOB 2OECA 2WPDA 4ZP1A 4H4DA 3H9EO 1YASA 1AA6A 2IWHA 3VV3A 1CFZA 4P4LA 1K7FB 3CF6R 1CV2A 3SZMA 3DVAA 4A2CA 2A35A 3PI7A 3NPMA 3R5XA 1RVDA 5K0ZA 3CRNA 5IWAB 3O26A 1H0RA 1ZO8A 4S1OA 1LSSA 4G5YA 4EF6A 4LV6A 4AURA 2DETA 4AMVA 4DLZA 1AIPA 4DMMA 2CEAA 5BUSA 2RAPA 3RNLA 1LLUA 1BE8A 1X70A 4MI6A 3OM9A 2BI8A 3V7NA 1T2FA 1YS2X 2ID7A 2QVZX 4YI3A 4C0QC 5L7TA 2QRKA 3DR5A 3IB3A 4HK4A 3U49A 3ZHOA 1KEEA 3IVAA 1VMKA 3KD2A 3GRFA 5DGDA 1P2UA 3V8BA 1Y1TA 2VJLA 4K9MA 2FUEA 3A6ZA 5A4KA 1SVMA 1BVRA 5D86A 4RAQA