3MXOA

Crystal structure oh human phosphoglycerate mutase family member 5 (pgam5)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
202
structure length
188
Chain Sequence
SMDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase PGAM5, mitochondrial
publication title Structures of PGAM5 Provide Insight into Active Site Plasticity and Multimeric Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 70
structure length 188
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3mxoA00
1E59A 1SK9A 1H2FA 4QIHA 1QFXA 3QPUA 1DKOA 4PZAA 1H2EA 4JODA 3MXOA 1UJCA 5CX4A 2DWPA 4ARUA 3OI7A 3KKKA 5AK0A 2P2ZA 2ENWA 2H4ZA 2P9FA 4MA4A 3F2IA 2P2YA 2H4XA 3K4PA 3QPVA 2P6OA 3HJGA 1K6MA 3GW8A 2WNIA 4ODIA 2ENUA 3BIFA 3LL4A 3IT0A 5AJVB 4D4MA 3QPWA 4D4LA 2WU0A 1CVIA 1RIIA 3NTLA 3DB1A 3EZNA 2HPAA 4ARSA 1C7ZA 1V7QA 3E9EA 4FDTA 4D4JA 4FDUA 3GP3A 3D6AA 5AJZA 1TIPA 2AXNA 1SKAA 1C81A 1SKBA 4PGMA 1V37A 2PA0A 5PGMA 2QNIA 2P78A 3ZHCA 3EOZA 3LNTA 2HHJA 2WNHA 4IJ6A 3K4QA 1NT4A 3IT2A 1QWOA 3IT1A 3O0TA 1RPAA 4TSRA 5AJWA 1DKPA 3C7TA 4HBZA 2F90A 2P30A 5AJYA 2H0QA 3D8HA 2H52A 1BQ4A 2EKBA 1ND5A 2P6MA 3D4IA 2GFIA 3FDZA 4E3WA 1XQ9A 2IKQA 1DKMA 5CDHA 1BQ3A 5HTKA 1FZTA 4EO9A 1C80A 1FBTA 2P9YA 4D4KA 3R7AA 1E58A 1ND6A 3PGMA 4AROA 2HIAA 1DKLA 1DKNA 3MBKA 1RPTA 2P79A 1UJBA 3DCYA 2I1VB 2YN0A 2P75A 2EOAA 5HR5A 3IT3A 1SK8A 4JOBA 1YFKA 2BIFA 2OWDA 4JOCA 1DKQA 2EKZA 4EMBA 2DWOA 2RFLA 5AJXA 4GPZA 4GPIB 2A9JA 2YN2A 3F3KA 3FJYA 4IJ5A 1T8PA 2A6PA 3GP5A 5CU7A 3FDZB 3E9CA 3LG2A 4ARVA 1QHFA 2P9ZA 1BIFA 4PZ9A 3NFYA 1EBBA 2P77A 1YJXA 2OWEA 3E9DA 1IHPA
chains in the Genus database with same CATH superfamily
3G5AA 1RNLA 4B8ZA 5BPFA 5M2QA 1P8JA 2HSEA 2BLNA 2E6UX 4E51A 5FNVF 3KSAC 2J48A 4HEA1 4ZYTA 3IILA 5EJ8A 2J31A 3DPSA 1PTJC 3BN3A 4PQYA 2QLNA 4GF5A 2ID4A 1W44A 3HWWA 3HU2A 4LVUA 1BD4A 2XQKA 1JZTA 3PQEA 1U1DA 3HA7A 2LE0A 3GT0A 3GDOA 2Y76A 3H3FA 2QYTA 4RV4A 3HXMA 2VF8A 3ACBA 3GWZA 1ZIPA 3KALA 4LMPA 3DT9A 1WKBA 2MYPA 1TJ4A 3BIFA 5DVZA 4C7MA 1DZ3A 1S8FA 5BXQC 1OYVA 3MS4A 4XYGA 1EPUA 2GB4A 2Z98A 3WG9A 1K6XA 1SUSA 4R5MA 5FDFA 3GIWA 2JAUA 2DBRA 3ANXA 3CISA 4Z9XA 1L5QA 5EPEA 3UQYS 4D02A 4CL0A 2HQOA 3JYOA 1BCSA 2C00A 1UIMA 4UEJA 4RULA 2VSNA 1ELOA 9ABPA 3AKDA 3ABRB 1M1UA 3D6AA 2BSXA 3HVUA 2FSVA 1PBTA 2AWOA 1T0PA 4BKOA 1SY7A 1KZ4A 2XYGA 4CZ2A 1ZCFA 1BNCA 3NOXA 3LUKA 2W0MA 4BVGA 4ER6A 3NEPX 2J4CA 5ALVA 2DPMA 2MMCA 5KOYA 1WXHA 3DYBA 1XNJA 3ZHCA 5I45A 5IMSA 3GVXA 3IAFA 3Q85A 1KA9H 1IXZA 5KAPA 4XVQA 1GAQA 5AVKA 3DFZA 3EZLA 3TJZA 2PGAA 2YV1A 3LD9A 2UUBB 3T9CA 4UOZA 1KI3A 2GD0A 3KP1A 5KNDA 1IEQA 1RXSA 4MQLA 3IHTA 5ER6A 3RTAA 1NI3A 3QFFA 2FLVA 4K6FA 2ATEA 4CV2A 2P3SA 2W6ID 2OBBA 2XBUA 3VX4A 2CD9A 2DWCA 4JC8A 3VPAA 2QVBA 1NUQA 4MJ7A 1JG2A 3ROPA 2G0AA 2IH2A 3UT5A 1C1DA 1PNOA 4DCCA 3D3WB 4WOJA 3JRNA 4CN8A 5JAIA 1OI3A 1T1IA 2XA1A 3AIOA 3NJ4A 1XCBA 3LX6A 3U7EB 3ZKWA 1RRCA 4ZGWA 3FTFA 4D80A 1WDTA 3B9QA 5E2IA 3MWDB 5J2TB 3NO4A 4MV9A 1XHLA 4BFCA 4JJ6A 1WU7A 2VXCA 5JXJA 2O3UA 1GA6A 1U3CA 1A9SA 1XP5A 2JI6A 3HGMA 3K0BA 5T41A 3RSCA 3SG0A 1E77A 4A2WA 3DCYA 4YHHB 1XDWA 1BOFA 3BE5A 2JANA 4IDFA 5IYZF 1W5TA 1H3EA 2VF5X 1BH6A 1GZ3A 4MUXA 3AKCA 1VJ0A 1TO1E 4EJFA 3FCXA 1NUAA 3EW9A 3Q0IA 4NU8X 1TPZA 2WIBA 4DMUB 1T5LA 2AC7A 5HNKA 2FW6A 2ODBA 1G55A 4FHGA 2HA5A 4L85A 4W9MC 1RWQA 4GPIB 3P52A 4WN3A 3GRKA 1C9MA 4DDTA 1YULA 3H13A 2JDIA 2K4MA 3FJYA 1E5XA 3WZMA 5K0SA 4ZZ1A 5I4CA 4R84A 3CONA 5TT1A 3GP5A 1FEZA 2BONA 4R4JA 1L4EA 2ZSFA 4DCGA 2K2WA 2E55A 2PPVA 3W8DA 3LBIA 5K6AA 3GK3A 3KTFA 3R7DA 2ZBDA 4RGYA 4IUCS 4P4UA 4F4HA 4ZOLB 3T5PA 2XE6A 4JI1B 4CF7A 1HR0B 3GG2A 4MVJP 2I91A 2AKEA 3CVXA 3UA3A 4TV9F 3INGA 1WUHS 1HC7A 3AEUB 1MN6A 1K7YA 2YJ3A 4PWYA 5A0TA 3K8QA 3KKQA 4RVGA 3VO2A 2FTKE 1Q1GA 3HP7A 1HLFA 5LZ9A 3C3WA 4G4JA 2MJLA 5EHXA 2AN9A 4WGFA 4KIUA 2FN4A 1EUCA 2GPYA 3WRYC 3SC4A 4CRWB 4EJ0A 4HVCA 2AVDA 5C8ZA 3L8FA 1T5DX 3L4BA 3QF7A 4OHBA 5JXGA 3W5AA 2WTAA 4G36A 1O7JA 1EXNA 5AESA 1EGVB 2QD2A 3NBFA 4PG6A 3TZHA 2O50A 4DY4A 1GZ4A 2X7JA 3GJZA 1GPMA 4BDTA 1E62A 2I3GA 4IQ0A 4NBKA 1AT1A 3KV1A 1H2BA 3G02A 3ZWMA 3AP2A 2FPPA 3V4ZA 5CB6A 3EBOA 5KTOA 3F5FA 3TIVA 4V2UA 1W25A 3N2ZB 2IXEA 3PE6A 3BQMB 4QJIA 1U0OC 4MVXA 4X20A 5CDUA 3LIPA 5FOUA 3FF4A 3RU7A 4CDNA 1ZHFA 4QYTA 1P7VA 4NCHA 3IAAA 5BV1A 1HYQA 4IEIA 2GZMA 4DMRA 1T0HB 2IY8A 5K3DA 2HUNA 2Y9MB 4KKXB 4MQUA 1EWRA 3QEKA 3ZY6A 1DBQA 3H2HA 5FLXA 3BERA 5K03A 2X42A 4Q4DA 3ICVA 3SYLA 3CF4G 1MGOA 3NHJA 3TLXA 1EXVA 4WUVA 1AGRA 2FX5A 4S0ZA 3EF3A 3V4OA 3WZLA 5L4LA 4WNAA 1K8QA 1DVRA 1RZ3A 4F71A 4CWAA 1XPOA 5B64A 1U4SA 3CRNA 3HZRA 2WM8A 4CQLA 3AF6A 1XDSA 1BXGA 4IDDA 4KW7A 1JG4A 3DPIA 4MTCA 4E7OA 1F2TB 3PIIA 4P36A 4ER3A 4NFLA 2RH8A 1LLDA 2EWMA 2VDMB 3W04A 2GLXA 1GZUA 1CRWG 4QDZA 5HZKA 2AYYA 2HMAA 3I92A 2ONZA 5CR9A 2NSLA 2PKEA 5CHEA 2I6UA 3V8EA 1AQLA 4HY3A 2VJAA 2AJ8A 2GDZA 4OBXA 3VSCA 3WLSA 1POWA 1E4OA 1HDOA 4BB5A 5FP0A 4LCBA 3UB3A 2DHEA 1L4LA 5GM1A 3ZHSA 1SO8A 3F3MA 4WZAA 1A9RA 1IOVA 2FQ1A 1MJHA 3WXMA 2XVMA 1TQ6A 4KB5A 1SWWA 4I9HA 2O3SA 4NBVA 3GUVA 1QYRA 2CVZA 4TV8F 3DUWA 5D6OA 1LKZA 4JKIA 2G40A 3RTEA 2XEXA 3IV7A 1L1EA 3UYKA 1E1QD 1LPBB 1DMRA 1W47A 3SFTA 4BLVA 5IHXA 5KIAA 1P3JA 4YJ3F 1ZGBA 5LKAA 1Y9AA 4CXMA 1T4CA 4RANA 2AD1A 2ZJ1A 1AN9A 1K3UB 4PYIA 3QX7A 1VHLA 1DAEA 3EZXA 2YIJA 5GONF 1W4RA 2F2TA 3LXXA 4J9UE 1XQVA 3GGGA 4KIWA 1CXZA 3E5MA 3QKWA 1KR5A 4E5MA 2NACA 3KOYA 4I66A 2HWUA 1NONA 1FXUA 1TMYA 1GTL1 1GQQA 3T6KA 1PG2A 1DJQA 2XUHA 4A8HA 1Z4IA 3K0EA 3PFIA 4FU0A 2RGAA 3IQIX 3KVOA 4P81A 2WWHA 4TVBA 4F4JA 1G41A 5M04A 2GRJA 4QIHA 5KSOA 2H3HA 2LR0A 2UZ1B 4RY8A 5J4LA 3KD3A 5MF6A 3FNQA 1P2VA 2J6CA 3GXBA 4MGHA 1G98A 3ST7A 2CEAA 4IQFA 5K99A 1BCRA 3DOJA 4KLRA 5FWYA 1G6KA 3MAAC 1N1DA 5JDIC 1GQFA 3EQ8A 5H80A 4KE8A 4X3CA 1GL9B 1DBWA 2JGFA 3KEOA 1NMXA 3MZ0A 3NWPA 4JT2A 4MGYR 4PZLA 2YWXA 4H35A 3VU8A 4MCIA 2CNWA 2P6OA 4HNAB 1H69A 3CKLA 2I8CA 1W75A 2AFIE 3I05A 2Z2YA 3FHLA 2XBMA 5L7WA 2XZTA 2XE4A 1FA9A 2YMQA 5HRUA 2GJ4A 3AR4A 3LA8A 1UC8A 2OCBA 2FUKA 2OKCA 2JIZD 3LHKA 2BN4A 4JQSA 3WMEA 4CDRA 1ACMA 2CNKA 2P9BA 4OFBA 5J47A 1ONPA 2PIDA 4BCBA 1MX3A 1H2AS 3FCOA 4TMTA 1VDMA 2H07A 2Q7DA 1PEDA 2YYZA 3SSMA 3VPDA 3KQWA 2H5EA 3I04A 5BP7A 5LD2B 4U3JB 1KTVA 3C3XA 2DGDA 1EFVB 2HT6A 2NV0A 4KLCA 4RXUA 5JNUA 2ZIXB 4HDKB 2OILA 4DVGA 6REQA 5EIXA 2Q5IA 3AUKA 3W90A 1NDUA 1PWYE 3O03A 4I4TF 3EG9A 3UGQA 4DR7B 1WMAA 1YKGA 3B12A 3D59A 4PQGA 1USUA 1QLJA 1VI6A 2QJRA 1YZGA 2HDHA 4YQYA 3UHFA 4LC0A 1P4RA 3KJNA 1T2EA 1I1NA 4KXXA 4YV2A 2CV2A 3MHPA 4EPVA 5AVVA 2YJNA 1HG1A 3LCRA 3LRXA 5ALGA 4S1NA 1Z33A 4UVIA 3BF7A 5A4DA 5JATA 3LO5A 5CFOA 1WKCA 3BGIA 3QX9A 4HH4A 1UKEA 2Q3DA 2IXBA 3SYTA 3V55A 3FR8A 1UEJA 2JZCA 2I7DA 5JQWA 2ZTUA 5LYJA 1M2EA 1P9WA 1MV8A 2X6QA 1OA1A 3B3FA 1NW7A 4JT8A 3DFUA 1O95D 3E8MA 3VC2A 4CMIA 2O7NA 2EKQA 3ETDA 3MWEB 3ONFA 4ABYA 1KZ9A 3PXBA 4ZAGA 3L01A 4WOCA 2DG2A 3OQPA 4KX3A 3EGVA 2C7BA 4QWWA 3ZQUA 4HGRA 1UDAA 4PPYA 4AXBA 2ZCUA 3QEBZ 2IBTA 1T26A 2GVNA 4E22A 2HEIA 3CN7A 3DTYA 4ZVUA 1UM9A 4IVNA 1DWQA 4GUDA 2ADMA 5CIYA 4OJYA 2RH5A 3C5EA 4UFNA 3HBJA 3EAFA 4BKUA 3LY7A 1KC3A 3E5NA 4DIKA 4ZHSA 3E23A 1XTQA 4CI9A 2C2GA 3LCUA 4B6OA 3OLZA 1Y5IA 2X5XA 3A2KA 2CZQA 5AXDA 4QBKA 1TD1A 2O59A 4LF6B 4QFMA 3DA8A 2REOA 3G5TA 3I3OA 4DW8A 1E6LA 1DCMA 1CS0A 2F8SA 3GZ4A 4HLCA 5LA6B 3CRMA 4RH0A 5ALNA 1OBVA 4KO8A 3AK4A 4KTTE 2WKPA 2WM2A 3A4TA 3MMXA 3PQ4A 3B6ZA 3X0DA 3EYAA 5EJEA 4S1OA 2ZK7A 2GPWA 3EW7A 1MXFA 1M5UA 3NS7A 3FX2A 3P8ZA 5EUQB 2YXEA 1CDOA 1R8XA 4B71A 4F3NA 4KE7A 2UYOA 1TJ5A 4FXPA 3ITEA 1VL6A 2CUZA 4V03A 3SOZA 2AE1A 3DTVD 3WLQA 4RTQA 4YRBA 4EKIA 3IERA 1SQ5A 1QTQA 5B7PA 3I73A 4UKDA 2XCQA 2FDRA 3W7BA 1DFIA 3LCJA 1A1SA 4QBTA 1UXJA 1O6GA 3A70A 3I2JA 4HAXA 1XT6A 1GP2A 2GEKA 2ZBQA 4ANFA 2PUVA 1AF4A 1TYCA 7ABPA 2C7PA 4UZSA 5JJBA 2NU6B 3A3YA 4FIDA 4FMDB 3WA7A 5IARA 1K6IA 4RE6A 4C7OA 5IK2A 4EKDA 1ZD4A 1ONOA 3KQYA 1QX4A 1EK6A 4PEVA 2C99A 1TYZA 2YOGA 3KSBC 1SEPA 1N2GA 2X0IA 3MMSA 4E5PA 4A5OA 3K0KA 5LKRA 3DBRA 4G8CA 3UCXA 4RA9A 5DW3A 2WZBA 1S02A 3B1KA 1Q0QA 2XT6A 1LQUA 1B00A 3DEYX 5BVHA 1XP8A 1EX9A 1URPA 3N8KA 3QGMA 1Y4ZA 2AEJA 3Q3GE 2C61A 4ZD6A 3NVAA 1J33A 1H05A 4R3UC 1B14A 5D00A 3WYBA 2CHFA 2QOEA 4XWAA 2HJRA 2D6FA 2B7CA 5C1IA 3DC2A 4S1PA 3S4YA 1YZQA 3N3AC 3HKEA 1IZ9A 4X95A 1Z2DA 2P2LA 5LLDA 3CVUA 1USKA 3MGGA 2OBLA 4MUMA 1MJNA 2PBZA 2J0UB 3WB1A 1TT5A 1KK0A 3PA6A 5HS4A 1D2HA 2O7VA 2JGMA 4OSEA 5IC4A 1MP0A 2JD2A 1KEKA 3GP8A 1G8PA 5DBGA 3MRVA 3QVXA 5CDFA 3P9ZA 3P4UA 3SHOA 2YWRA 1SJ9A 4TL8A 4MUHA 2R6AA 3MRTA 4ACAA 2PKQP 1SCJA 4M99A 2VAXA 4ZREA 2NP6A 4DZRA 3FWZA 3MOSA 1PP4A 3MMPA 4HB3A 4LF7B 1EBFA 4KIJA 4S1VA 2QYOA 3N2KA 5BN4A 1A27A 2HRCA 2IKQA 2QI9F 1LEHA 3SHFA 3ZW7A 3D8BA 1QHYA 2E85A 5F7XA 4N48A 1JG3A 2CHEA 1NBIA 3IQGX 5AKYA 3PHLA 1FBTA 3RVPA 1B6RA 2VWPA 4GOXA 2H06A 4J16C 3SLKA 4BNVA 5EQJB 4C4AA 4C0BA 3CW9A 3WHPA 2VLIA 3PQDA 2CNBA 2C8KA 4GP7A 3ZNOA 2NZUG 3OEHA 1HEUA 1G4HA 1X7DA 2NVBA 3UA4A 5TR9A 3DKPA 3T7SA 4MW9A 1E60A 1PEAA 1KEPA 3ONWA 2CC2A 2BH2A 2I1VB 3NTXA 4ZQFA 2F9MA 1U7PA 3NTUA 3OJWA 4TXJA 1ZCBA 2CJWB 1PZMA 5GP1A 3UMFA 3DFMA 1KH3A 2W2OA 2FCAA 3GJ8A 1SVLA 1UQUA 1XN4A 2EJUA 3GROA 1RYDA 3V4PB 1ZO8A 3W3AH 3MELA 4ZOCA 3MWJA 4JP1A 3JV7A 4LOKA 4B79A 4EY8A 2Q5FA 2X1VA 4BO2A 1H22A 3H6GA 3PJDA 3NWEA 3E7PA 4ZTUB 1A7KA 1UWKA 3GVIA 1LK7A 2A9KA 1HLDA 2O0HA 1ZAKA 1OZAA 1R6BX 3OG9A 1II8B 2DBYA 1ISPA 1S96A 2PGJA 1UMKA 1ZN9A 2MOKA 2V7UA 1DIGA 4QQNA 3ZCPA 5KYXA 2BTQA 3SM3A 2I3ZA 3BQ9A 4Q9NA 4QOGA 2AN5A 2OWEA 1JEQA 4D0RA 3NETA 4RIGA 1GSAA 3DNFA 1ETUA 3V7UA 4F1WA 3DZIA 2FAXA 3SBOA 1P2BA 1RAEA 5DT9A 1H4VB 2HBYA 3M6FA 4BFYA 4YRDA 3TOVA 4AZ3B 1JDBC 5K0NA 3VKHA 1AXEA 1ZUIA 5GJWC 2B4YA 1DAFA 4TOIA 2OM6A 5IEJA 3H75A 2I4TA 1CUFA 1DV2A 1A7AA 4W9RA 4EP1A 3NEJA 4LJSA 1CULC 1GUYA 3VISA 1O0CA 4MDFA 1E92A 3DO6A 4V0RA 1CRQA 2YXNA 1E7MA 1HRKA 1W4CA 1JR3E 2XNHA 3L93A 3D4NA 3PHCA 2A1TR 2XTJA 3N86A 3OTQA 4LYGA 2OXIA 4POAA 1SGWA 4DJEC 3SHQA 3SMVA 4XSGA 2CF5A 5C1DA 3SY8A 2OFPA 4LG1A 2QTNA 3K6SB 4NOMA 2VJOA 3GGJA 4CHTA 1ACLA 5IZ4A 1DSSG 3CF0A 1NVVR 4QUGA 3ER6A 2KJQA 3GAZA 3QF4B 1QIDA 4FBGA 2GK7A 2WTEA 4G0MA 2Y0CA 1X8LA 1YC5A 4PGHA 4S35A 2QG9A 3QKTA 1KOJA 4YMUA 5KYWA 2B4TO 4B3MB 3OU6A 1AB5A 4Y2GA 1INLA 1KJ8A 5C32A 2M6RA 4AWXA 3DL7A 1JUDA 5JV5A 1FMLA 2HFKA 3OUUA 4Q82A 1OC2A 3SYMA 5CRIA 3IQDB 4GRIA 4FWTA 3I1JA 3VQTA 4BAGA 2BEWB 5LZ2A 4JP8A 2BYTA 3TZKA 5F73A 1GU7A 3IL2A 2GXQA 1S7CA 4IDBA 4C30A 4B4VA 5K6TA 2XOEA 5BSWA 2PV7A 4C7JA 2AZTA 3WGUA 3SVTA 3VHXB 1JU4A 3OX1A 3ROFA 4CNQA 1BWRA 3IDOA 3IUYA 4RJJA 4AX8A 2FH5B 2BJHA 2NV2B 3CSSA 4HGNA 4M38A 4BUJA 4YCDA 3KQUA 2G5PA 4GKKB 3E0QA 1LV7A 4LGMA 5MN4A 3AJEA 3KR2A 4IP0A 4UUBA 4NMHA 1HYHA 3L8DA 1V39A 5T4BA 4QXPA 5BW6B 4NCJA 3JCZA 3FVWA 5BY2A 1SRQA 2I1WA 3NZEA 4Y18A 4FI3C 1T9KA 3BMXA 3HK2A 1YC2A 4PBSA 3LBHA 5B3AA 2V7QA 2HDWA 5G41A 2ECFA 1E5LA 3DDCA 3D3NA 4GBJA 3WGVA 3EQ6A 3VR2D 5C18A 2R8ZA 1TZMA 4RDHA 1LWNA 2Y27A 4TUYB 1QVZA 3BAFA 2WDPA 2ZOSA 3REQA 4Z4HA 1I4EB 1GGHA 2X1LA 4PYOA 5AVOA 4M4SA 5H3HA 2CL0X 4UUQA 4FM9A 3RUAA 5L6LB 4BS9A 1ZMXA 1DBRA 1VE3A 3M8KA 4RTJA 3FVVA 4YHBA 4GPZA 5IXJA 3DOFA 1FFAA 2WY2D 2FKNA 3MK31 3P0HA 2D3WA 3RS5A 4BMPB 3D31A 2IHYA 4JR2A 3WLHA 3THYA 5ALJA 5EQDA 1QHNA 4QUIA 4QRIA 1SB8A 1BS9A 2IHUA 3B2EA 5LZ4A 1Q84A 3DDWA 2ZI5A 3ZZNA 1GR1A 1VZ3A 2JFVA 3EXG2 3K0FB 2CK3A 4Q3BA 3PFKA 5G1NA 3DTTA 1J24A 1HX7A 1GPLA 1VGVA 1XZAA 2AMVA 3G8YA 1G3MA 4O4LB 1U8FO 3E81A 4F7WA 1BKYA 1FYXA 4II2A 4D97A 1NW6A 2PJUA 4JOSA 4K28A 4L15A 2E5FA 4CLHA 1BC5A 5EE9A 2EIXA 2AFIB 1DELA 4MULA 1BWQA 4AXXA 2C7QA 1NJGA 5SZIA 4ALNA 1SBIA 3UM9A 1CUEA 5ER9A 2YVLA 3OZEA 1C8KA 3PDJA 4QL3A 1BX0A 3O92A 2WZCA 3L6CA 4JUCA 4LTMA 3IOBA 1V8BA 4AUNA 4YPVA 4G0UA 2CXSA 4MWOA 1NBOA 4QOEA 1LX7A 2IZ0A 4JB0A 4L6AA 6NULA 3DZFA 3F98A 5CTAA 2YV3A 3H7AA 1RMQA 2H16A 1AUOA 1CZUA 4AIRA 3HXQA 4LJ7A 5AUOB 3UJ9A 2DQSA 3V4RA 1O57A 1YDWA 4EYGA 1ZOLA 4TKMA 1L8AA 1EGAA 5D3ZA 2Q5JA 2OEPA 4GIBA 5EYPB 4I0WB 5HF8A 4ZC8A 3V00A 3WS7A 3VZRA 3ZXSA 4RVSA 3IUMA 4JAVC 5FOVA 1JQLB 3N58A 4IDCA 4QDOA 2FHSA 2I03A 4RDXA 1JHRA 4KFUA 5DCYA 1MV5A 3TTSA 4CKEA 5LOVA 5D5PA 4EJSC 1ZD8A 3TAUA 5KQGA 2F62A 1IXYA 2PGNA 3PL5A 1R5BA 2A5YB 4FE7A 4LYFA 5JMPA 4OQFA 1EE2A 3MSCA 2FSFA 2O3RA 1IRIA 3BHMA 3LNTA 5I9SA 3BXGA 4FT4A 3BE8A 5ICMA 4IV8A 4GOND 1BXRA 1CK4A 2DERA 4CTNA 3LFTA 2BFFB 4Z9AA 1PJSA 4KRYA 2ZJAA 3DBIA 2C31A 1G20A 1JE0A 2NO7A 2FHPA 1DKPA 1WDWB 2OXTA 4JA0A 2DBQA 2C20A 1PGPA 2BI4A 1UADA 5E6SB 3LVRE 2WIAA 1JVNA 4RD6A 3OZ7A 2EFEB 3U7QA 2V1UA 4NPCA 4F11A 3VTFA 1R2QA 3BRWA 4Q4AB 2CXQA 4J43A 1J0DA 2X9VA 1JXAA 3VZDA 2PTGA 5I7OA 1JQBA 4HDAA 1WMDA 4KQ6A 4D4KA 3G1UA 3WAGA 1JI0A 2N3ZA 3HXPA 3KOZA 3A1SA 3BTVA 5K09A 5BSTA 5ICSA 5HF6A 2Q6VA 3GOHA 5EN4A 1F3LA 1B3BA 2EBFX 1BCRB 1I6KA 2VJMA 3DLTA 1Z73A 3R7WB 2IHKA 3IP3A 4G1UC 1P0PA 4KQJA 1DGQA 4O1MA 4BNNA 2WHYA 4EGJA 4J6FA 2VH5R 1DX9A 5E0OA 4F4UA 5K0BA 4IMRA 4KAAA 3CW8X 5D3QA 3WK9A 1NE2A 4R1NA 4WLEA 2O8DB 4B3JA 2DSNA 5JNTA 3DZBA 4P0TA 2IV3A 1R6TA 1D03A 4UHCA 3PX7A 3GJTA 3ONDA 4I50B 4JR1A 2A4KA 2LDBA 2Y8EA 1E3DA 3O95A 4M1OA 1C41A 2OHVA 4OXYA 5LC1A 1FPQA 1OQAA 3WLMA 3MCAA 3WAKA 3R7NA 3ADPA 4TYYA 2VT6A 3CG0A 4ER5A 2XTNA 3BB1A 3GGDA 1MOSA 1LSOA 1KH2A 2E18A 3BIXA 4IGIA 2E4XA 5I7AA 5TQ2B 1YJQA 3AR3A 3FIUA 3K9NA 3VR5H 3GJSA 5F1OA 4UUNA 1C0LA 3DE3X 3BD7A 3EXFA 2DE0X 4IXDA 4OREX 1PFGA 2XECA 3QNWA 2AR9A 4HEJA 2HA7A 4EUNA 3WJAA 4FQ7A 2OLJA 4MV4A 2XYRA 4LXXA 4O4JF 4B46A 4RTKA 1KYYA 2WFMA 3PNPA 3W1VA 2JIQA 3ZGLA 1KAGA 4M8IA 5CDTA 4L6IA 5G0VA 1UOQA 4HAWA 4WDQA 4REOA 5M3BA 3WYDA 5LJLA 2QPOA 2JLYA 3W79A 5HXAA 3T12A 4YCLA 4UD6A 1K8YB 2COEA 4D9GA 3PRKE 3CZ9A 3QUAA 1SUIA 4RSHA 3E61A 4LDAA 4WINA 4XQGA 3HKDA 3WLNA 1UP7A 1NNEA 3O8QA 2GTPA 1Q92A 4JROA 1WY7A 3CN9A 1P3Y1 1TIBA 3ASVA 4U2CA 2WJPA 2RG1A 4DLBA 1VJGA 2PSEA 3C3KA 5TT0A 4D2IA 3FE2A 2A30A 1VLVA 3T0FA 4F3RA 4UPEA 1YQXA 2DY0A 3B38A 3D5QA 3E22B 4W8GA 5AI6A 3VYWA 3FWYA 5FUYA 1CUAA 2BUBA 2O5RA 5JWOA 3NDBB 3Q3CA 4HAZA 4YMWA 5FL7A 5JZ9A 3TSZA 2QTBA 3VNUA 1F7UA 4AN1A 1OSNA 1H2YA 1C3JA 3RVKA 1PWEA 2FF7A 3KVNA 1ZIDA 3LUPA 3C24A 4QRDA 3AI3A 4NENB 2BFMA 1TUBA 3ZZMA 4CMAA 1YCHA 4U8HA 5CH5A 2RHGB 5EJIA 4DCVA 4E4RA 3R4VA 4QVKA 1G8GA 2BHRA 4OQNA 521PA 1Y81A 2CHQA 2LPMA 3OTOB 1L5OA 1BA2A 4DJ5X 3LZCA 2Z8YA 1Z0AA 5CHYA 1VKHA 2WWGA 5KVAA 2JAQA 4LY0A 2ILTA 5CA0B 1N9ZA 5F7ZA 1YZKA 1ZCZA 3DKRA 4M1EA 5I9NA 1P1JA 5IT9A 3RLFA 5HJ7A 3G17A 4XX0B 4IV5A 2P3QA 1UAYA 3V34A 4COOA 1SUEA 3DDUA 3GCXA 4YYEA 4WCFB 4Z54A 4DLWA 3L2OB 1OXXK 2HMTA 4CGYA 5EIEA 2X40A 2AN1A 3IKLA 4IHJB 1WBDA 2EEPA 5IM4F 2AF3C 2NZXA 3JD4A 1HMPA 4G09A 2H2AA 4KMOA 3ZXIA 1BWSA 3I8XA 1R9GA 1L4MA 3VPGA 5F51A 4YRIA 2B8NA 2GYUA 1M6EX 2V4ZA 1FQWA 1P1CA 1XTRA 3L7CA 4GRDA 3OZRA 1X15A 4O4IA 1UK8A 3LQYA 5J1TB 5CB4F 3RSZA 4KLAA 4EI9A 2JLVA 3WK5A 3EUEA 2YQ4A 2QU7A 3HBFA 5FPHA 1F2UA 5FEUA 2B7LA 4B7CA 2R8RA 3LECA 3SSAA 4AX4A 1NQUA 1M1NB 2D0PB 2NU7B 4BVHA 3IDFA 1CU1A 4UJ5A 1X7XA 4HNGA 1EEXB 3S68A 1L1FA 2G9NA 1OZ0A 2CMHA 1PL6A 3Q6IA 4HOYA 5M5BA 4IH1A 1YZFA 2HWYA 4I4CA 2E4VA 3UG6A 3ZJTA 4JVNA 4WOBA 5ICCA 3IRVA 3U4QA 1V1RB 2A6PA 4P93A 2V8OA 3ZHQA 3RU2A 1R0ZA 4CCAA 5HQJA 5F64A 2HCBA 1Z8FA 3TW8A 1Z88A 3KQHA 1PI3A 2D2VA 2FOLA 4K9QA 1UJ5A 4H1HA 2B98A 1QKJA 2M6KA 3WHIA 2EGHA 2W4MA 3NALA 1CCWA 4MIKA 5K4GA 3AH8A 1FJGB 4LZPA 3GGOA 4Z1MA 1QJ4A 4PAQA 4BZXA 1FNCA 3CR7A 1E2BA 3EOAI 3TMKA 4RDIA 2H18A 3DEIA 2ZYWX 3VKVA 3OF3A 1RWNA 3FMVA 4ARAA 2ZWIA 2QG6A 2QTCA 1FSFA 1NULA 3D2LA 3ZUGA 2FZGA 3NFRA 2Q21A 3ASYA 4ZCRA 4OHUA 3C4QA 5LL6P 4ZPJA 4PICA 4Q9HA 2QV0A 1RRVA 2C5LA 2HWXA 1IC6A 4TZTA 1HH4A 5JD3A 4O3FA 3N05A 1AA9A 4AU1A 2AC2A 1JR6A 1GTSA 1VYVA 5ESWA 2CW5A 3G85A 3TEMA 5C7IO 5BURA 1G16A 3OCUA 4N3CA 1TA9A 2ZRNA 3NEYA 5EE1A 5JG7A 1T5IA 2KWIA 4PF1A 2OFOA 3BGWA 1TK9A 1YKSA 5F5LA 5C35A 5KS2A 1QP0A 1SKYB 3BVPA 4NYMR 3VTAA 4QPCA 4IZ6A 5BYBA 1E2LA 3UPDA 4FEEA 4TMXA 4CEHB 4EK9A 4MGIR 4I2NA 1WULS 1YR8A 2PH1A 4BJ1A 3NDPA 3C3PA 4E7PA 1Z4QA 2I3BA 1RHRA 5C34B 2PZGA 3T5GA 1R0SA 3CEAA 1U4OA 2YWEA 4DXDA 2IWHA 1UMDB 1CQJA 4F60A 2JPDA 2ATIA 2VNSA 2JASA 4PHTA 1VJ5A 1KPGA 2P78A 3AR7A 4HUQB 1ULHA 3MGBA 1J4AA 4B33A 3B1JA 4KV9A 1KQ3A 5ENVA 3RK0A 3U3JA 1I9CA 4MRNA 5IBPA 4TYNA 4DDMA 4MLDA 1FLNA 3PLRA 3IQWA 3E3OA 4TN1A 4ZYVA 4HQOA 2A88A 2A94A 5C1BA 1NQXA 5JVDF 1JLHA 1EVIA 3AB8A 2PJDA 1OBCA 1E3QA 3PRJA 2WTXA 3EVDA 3SXUA 5EG5A 3PGLA 4ZI2A 2OO5A 4WD3A 3WFJA 4WK0B 4I9GA 4K87A 1YQWA 1Z35A 2R7LA 4HTAA 2IUUA 3DHNA 2C8VA 1P39A 2H17A 3CBQA 1H6AA 3GL9A 2YUTA 1GDHA 2ZBUA 4JMPA 3G9QA 2M1ZA 5A71A 4AN0A 2WFLB 3MN1A 4ABTA 2IUYA 2J3DA 2VH2A 3BE6A 3E1KA 3INNA 4ID3A 3NH9A 3WLKX 4OSOA 3MFYA 1F5NA 3GLFB 4QBGB 3PFNA 3UPTA 4R3WA 5IJ9B 5TVKA 3GFRA 1DC5A 2I6XA 2ZIEA 4BVBA 2AFVA 2LIPA 2P62A 2J07A 4DG8A 3MJCA 1VKZA 3ITNA 5E6UB 1G18A 2AG5A 3K05A 4RFSA 4M0CA 3LDHA 4BDSA 3RU3A 4BN5A 4IDOA 3CZRA 2K6GA 4M87A 5G4KA 1IBCA 1TM7E 5FBRB 4MJXA 1TK3A 2XSZA 1H1LA 2FRXA 1NP7A 5FA6A 1VCMA 4BFSA 1N77A 1P5RA 1Q5PA 1CUWA 1F4VA 3DAGA 3F8WA 3ZLUA 4Q9DA 4BNIA 2PZLA 2J9RA 3UWOA 1Q0UA 1G5HA 5AICA 2YVKA 5DNWA 5BRAA 3WYCA 1PSZA 1QE5A 4CIYA 2GASA 1VKRA 3DL2A 1Z45A 3VJRA 1ODLA 2FZ4A 3DE7X 5D51S 3U4MA 1Y8QB 4QG3A 2OAGA 1BHJA 3GMTA 4C07A 1U0RA 1B8VA 1A2OA 2OLKA 4OXKA 1G8JA 1H65A 1XI2A 1U2DA 2LD4A 2Y1GA 4GX2A 1TZJA 2GGSA 2V0CA 4DWVA 1COWA 4DUYB 2YASA 4HATA 1X1DA 2ZZKA 4XGQA 2F3RA 2QX7A 2RMKA 4XWYA 1BTOA 3HCWA 5HPYB 3PUZA 4A10A 2IY9A 1DTEA 2WSIA 3AERB 3FPGA 2PUAA 4FCCA 4H7DA 2XOKA 2ZB7A 4X64B 4RIHA 3U44B 3AC0A 4LQDA 2JG3A 3NVKI 2RHDA 3TVYA 2B1GA 4IVPA 4ZVVA 1AO0A 1W4AA 2RKWA 2WD7A 4WJZA 4I55B 1KEEA 4JX8A 1NVEA 3L05A 2VYQA 1OFIA 2NYUA 3IDAA 3IEIA 3NJRA 2YC4C 5K0TA 2QR5A 3GR6A 4DLUA 2HLHA 4N5LA 4Y2RA 4G1VA 1QV7A 3AR8A 3BSWA 3FW1A 2ANCA 4OGKA 5EZYF 2FSSA 4UFPA 3BZUA 4M2LA 4XYEA 5K3FB 5SZJA 4F4CA 2PUDA 2YZNA 4QUJA 1OTXA 2WIFA 1JWBB 3NVMB 2OO3A 1P2FA 5F1PA 3TI9A 3TINA 4ES6A 1NVWQ 2B4QA 3P9RA 2HHCA 4UBOA 5D3MA 3I8OA 3Q7IA 3P96A 3DVQX 4HZUA 4MO2A 4TSRA 2GF0A 4H60A 4YRLA 4ZI5A 1HG0A 1GV1A 1M74A 5JIBA 2P27A 4M88A 2W70A 2HU8A 3FNHA 2R97A 1MDBA 2ZUCA 1DC4A 1YZHA 2BKUA 4TTJA 4LXYA 1QPZA 4G0WA 2H57A 2H5IA 3ODGA 1IQ0A 2IPMA 1U2PA 4PX5A 4YUWA 3ZGZA 2MDTA 3KR0A 2WVJA 4L1KA 2XCRB 2JLBA 3HXLA 2H4WA 3S99A 1RLMA 5LYYA 4NFHA 2H4JA 1YJBA 2PTHA 4QE3A 3EEIA 3PHJA 1UKAA 3RTGA 1XX6A 1JLLA 1R64A 1EFAA 4D5EA 1IZZA 4JY7A 2LDXA 2VF2A 1UH5A 2G9ZA 2I2BA 1RQRA 3EXHA 3B6IA 2XF8A 3N5KA 3QYJA 3WLLA 2W2LA 5JFOA 2D0DA 1EFPB 2XV1A 3HM2A 2HYDA 2VDNB 1L2TA 2YXLA 3GMSA 3QW2A 3EWIA 7AT1A 5EJ6A 1CTQA 4NTZA 4RJLA 4V3BA 1QLHA 1UKCA 2C94A 3B3QA 4JBLA 5AMXA 3IIJA 1JXMA 2DPLA 5CAEB 1RI2A 3U4GA 2DEUA 3WGIA 2WD8A 4QM7A 1PKEA 4I3GA 4HF7A 1U81A 1PNTA 1O9GA 4AM8A 2XMBA 1RKUA 2VJPA 1NP3A 2Y99A 4BKMA 4WASA 1JWAB 4E1AA 2IKSA 4KO1S 3H1EA 2XLCA 1YZ3A 1SUAA 2WYIA 1TEHA 4I4LA 3UJPA 2X76A 4K9OA 5HP4A 1E4EB 1PNQA 2XUZA 4PM4A 2DR0A 2Q1XA 3AUUA 2C4TA 2YINC 3H5AA 5ALLA 4PZ9A 1WZCA 4ZI7F 2AMYA 1GZ5A 3U4DA 1O03A 3NIDB 3V6LA 4XKJA 3B7GA 3H1PA 3RGWS 1FU8A 4YASA 4ZYWA 1LU9A 4IH4A 2ST1A 4CM4B 4GSKA 5DTQA 1K98A 3BCRA 5CUQA 3Q7EA 5I5EA 1FW6A 4JI0B 2SICE 2NQ8A 3H9JA 1XMQB 1G5PA 1XRNA 3ME5A 4NMWA 1CZOA 3A1NA 3EFOB 2B0CA 5ERYA 2D7JA 4U2GA 2H1LA 3UK1A 2PV0A 5HDBB 3RSLA 2J3LA 4JKYA 1F0KA 3CPHA 1V71A 1BOOA 2VUIB 4JLWA 5AW1A 5BQ5A 1NTRA 2DVMA 3G2IA 4KSBA 5JFTA 2GEFA 4P7BA 2G5TA 3GW8A 4A8JB 5CA1F 3M4XA 4MCJA 4CM8A 2E4UA 1IXKA 1Z9BA 3WRXA 1Y3AA 5BN3B 4O2LA 1P44A 3ONNA 1WM1A 3IV9A 2SBTA 2QLLA 4YJHB 3BDVA 4HKTA 1V16A 4PNPA 3LM8A 4XZ3A 3VVLA 3TNYA 4D57A 2AMFA 4MVJD 2BRUC 3BL8A 2BD0A 4PCAA 2ZQ5A 4Q9KA 2JGDA 4KOAA 4KZPA 4N7JA 5AW7A 3R3UA 5J4HA 2XMGA 2IUFA 3DJYA 4LCEA 5IH7A 2AJDA 5BYJA 5IVDA 1EGMB 1H6CA 1TJPB 1XA3A 2QSZA 4EKEA 3ONVA 4AZVA 3T5AA 4AF7A 4BVJA 4INZA 4CT4B 1HE8B 5GMOA 5KU1A 4TL9A 5IAAA 4FCTA 3DYVA 3MJFA 3A7DA 4D8XA 2O5EA 2Y2UA 3DCIA 3QQPA 4P34A 1DTWA 4D9NA 4HPXB 1Y80A 4OYLA 2C3OA 1DKRA 1I5OA 3L4JA 3U56A 4JI5B 1E5QA 3QKSB 4AFNA 1N78A 8ADHA 2Q1SA 2X0JA 1FTGA 1QHXA 3QBTA 4U00A 1RQ7A 2PZKA 4UC0A 5INTA 2F90A 4K8OA 4TWIA 1ISIA 2RHTA 3K4HA 1M2GA 3VR6H 5CM8B 4KPFC 1KJYA 4MVYA 2FPLA 1ND5A 3I9JA 3JWIA 4AJHA 2ZRIA 3G7UA 1E5DA 5FORA 3UZUA 1KFKB 5JSZA 5H3CA 4L3VA 1NWCA 4C4TA 4YCMA 3FVRA 3TYXA 1FNMA 2QW0X 4Z51A 4LYAA 3MTEA 3D7LA 4QRHA 3PQFA 3UMBA 2OG2A 1PJRA 1U7OA 2D4HA 1ENOA 1PGQA 3B13B 4A0RA 4BMNA 4A92A 1DLIA 5J58A 2HK8A 3KYBA 2DR2A 4JV5B 3TK1A 3F4BA 5I9LA 1FNNA 4FYWA 5THKA 3PXGA 4IIBA 1JZSA 2Q41A 1SD5A 4OI4A 5ECGC 1JQKA 4DJJA 4W5RA 1SXPA 4KL8S 4TRJA 4ZZIA 2G80A 3MSXA 1N2CA 2PO5A 3DLCA 3EVEA 4UM7A 3L6UA 5H70A 1UL1X 4RTNA 1V4BA 1OFTA 3AYZB 1YR2A 3HYLA 2QIOA 4Q3LA 1PIWA 3LAWA 2OAQ1 3FLEA 5AI8A 3LBYA 4NAHA 4ED9A 4RK5A 1KDRA 4H3KB 3JR3A 2N9UA 2MR5A 4LDQA 1U2GC 2O19A 1BJTA 1N57A 3TLGB 4PQFA 2GR9A 2GVDC 1EXWA 2HIHA 2PS0A 3BRSA 3LMKA 4RKWA 4U7WA 4W1QA 4YY3B 3E53A 4GL2A 5JJIA 1Z6YA 5JD5A 3S70A 5JZMA 2IQIA 5IXSA 5AO9A 1OFVA 4B32A 3HBAA 3D7NA 3UV7A 5JT1A 2MMGA 5K3OA 4M89A 1OLOA 1IUNA 1TQ8A 4V24A 3PX3A 2HCRA 4XWWA 4CE6A 1XD2B 1VBMA 2X15A 4MKIA 1GA4A 3LW7A 2CNOA 3HA2A 4CIBA 3QI7A 4XM0A 5HK8A 1VBNA 1GCOA 4JUBA 2ENWA 3I4LA 3L7JA 3KQOA 1UC4B 1U1EA 4DIUA 4AS1A 1XTVA 1JBEA 1E9CA 3HV0A 4M60A 4Z0TA 2YHIA 1QRTA 5UKDA 5J59A 3B9RA 3VUEA 4ZV4A 1WHTA 1YB4A 1FMFA 4N0QA 2QRHA 5BSMA 4C4OA 4D4LA 1IVNA 1FYVA 4ZHQB 2CCJA 2IV7A 3C70A 3FYUA 2FU5C 3A6LA 3FF1A 2VDJA 3BMQB 3OIYA 4N0PA 4OI2A 4YNBA 5H59A 2EHDA 4EO4A 2HH9A 2IVZA 3DW3X 2QTWB 5CLHA 2GHRA 2ZPTX 4HNQA 1JR2A 1CHNA 1R27A 1J09A 3JD0A 3KPWA 3IIEA 3OIWA 1AUQA 3TDKA 4BFZA 1WX1A 3QSYA 1I2AA 3PNMA 1MIOA 1E94E 4BLRA 3AHGA 1YQEA 4QXRA 4RAOA 5LNK1 2PH7A 1QIGA 2AQHA 4C21A 5PGMA 4RKFA 2QE7D 3G49A 1Q14A 4EABA 4OP3A 2HQBA 3HU5A 3SX0A 2EP7A 2YZGA 2ZT8A 5JO0A 4BIIA 1N5MA 1FJ2A 5E6RB 4EG5A 3GH1A 3KFLA 1T35A 1XEAA 3REFA 1M1ZA 3UFXB 3MEQA 3BL5A 4EHIA 4AY6A 1KFEB 2ZCVA 4MKZA 4LRSB 3I01M 3THRA 4HGPA 4L0CA 3JQ8A 3NHAA 4UREA 4B2YA 2YBDA 4R31A 1JP7A 1CEYA 1FFYA 2J87A 3MCZA 3WI7A 2DR3A 5EP3A 4F6CA 4OHOA 3GZTB 3HJAA 2PN1A 1BA3A 1Z13A 3CXUA 2VL7A 3WK4A 1GQSA 2H7VA 4BNYA 2BGLA 2IYZA 3WKBA 3E2PA 2IOYA 4DQDA 1V6CA 2NXCA 4D8YA 4KXNA 4R6WA 2A5FA 4TTAA 1X2BA 4ZYZA 4W8HA 5DK6A 1VYTA 1V9CA 4PV7A 3PGA1 2C2OA 4G1FA 2P9JA 3E8SA 5FIUA 3HTXA 1DEXA 2FZVA 2Q9CA 2Z9CA 4LXTA 3PEYA 5EA2A 3O9VA 4KC0A 2W6MA 2E21A 2JHCA 3CUUA 3KBBA 5CDSA 4GGOA 3GLTA 3AESB 1U5BA 3KSZO 2FMTA 3JPWA 2QORA 2FN3A 3AU9A 4A8PA 2B8TA 5F2NA 3TECE 1YI1A 5ERGB 1W76A 4UUPA 1KMHA 5E9AA 2KM1A 3HB4X 3LUDA 1IUKA 3A9UA 1FP4B 3O84A 1K88A 2JATA 4GZ3A 4NMXB 1KVQA 4B17A 5E3IA 2AG8A 1O58A 2V7EA 4MHOA 1E9AA 2LXNA 4C5BA 1DQRA 3UC9A 3CC8A 4N8DA 1I32A 4MW4A 3L0BA 2Y68A 4D3XA 2IGTA 1Z34A 5JDCA 3FJ1A 1VHTA 3OEEA 5JECA 4MA0A 4RCVA 2JHGA 5AW2A 1K3TA 4FKBA 3E15A 2XPCA 4Y2PA 5E0KB 1L7XA 2J0EA 4KR7A 3VH1A 1ZUD1 1JZQA 1P0FA 3AJ8A 1P1HA 4RCZA 3S2YA 3W0LB 3QHQA 3DKKA 4P22A 3AUXA 1N5IA 4IKOA 2ECKA 2RK4A 1ZA1A 4ARUA 1U9ZA 4OQQA 1RT9A 1IY1A 4YXWA 3IOCA 3LNCA 4EF6A 2W2NA 1GN9A 3ZE7A 4AO7A 2YIDA 1L4YA 2DM6A 2Z5VA 3I5AA 5TF0A 1S8OA 5TX7A 3PHHA 4ZJYA 2H9YA 4ZJPA 3P45A 4CTOA 5AM0A 3GLGE 4FMCF 2ENUA 1JFRA 4H3VA 1KSFX 2JRLA 2FEAA 3DE4X 1G2IA 4H77A 1CVIA 4YDHB 1NA5A 2OOKA 4F46A 4V1CA 3TO5A 3ES9A 1T8TA 2BE7A 3PC2A 1KBQA 4TLDA 2IUTA 4RIIA 4HGYA 1UOEA 1DUSA 5L3SB 1BZYA 3M49A 5I9IA 1MQ8B 2Z2XA 3CA8A 2WU4A 3NYQA 1D1PA 3OKAA 1W5EA 2BKEA 3O8CA 1W4BA 2QZSA 1IDN1 2GN9A 1OKKA 3T7TA 4H9GA 4IQGA 1QDUA 1IN6A 2PMCA 3WO1A 4WWHA 5AK4A 3RSHA 4Z3OA 4PCVA 2HIMA 3BS4A 4C0AC 1U2EA 1LZLA 2VZLA 2Z5FA 5DNAA 3SYKA 4AMGA 3FB4A 2PD6A 1OZHA 1QU2A 4RK4A 3HXTA 4RX1A 3IBYA 4P35A 5IWAB 3WA6A 1NE7A 3UW1A 4ZGGA 2C0PA 4RKYA 3ORRA 2Z43A 1KC1A 1BS2A 4M0EA 4QZVA 4BP3A 2VA8A 2H1SA 2H31A 3MA0A 5I7EA 2FPGB 3M1AA 3R6TA 1RP1A 1G8SA 1R5JA 1NVAA 3T3MB 3PUHA 2JFQA 4KN9S 1ZRSA 1OAKA 3C3JA 3PNLA 5KTPA 3KFXA 3R74A 1V95A 4GGPA 4YAEA 3L8HA 4PCUA 5IC6A 4JBXA 3WGNA 1IUPA 4D6PA 5IX8A 3QPCA 4NBTA 2C4VA 3EK2A 4CL3A 2W9XA 3RSOA 3A9TA 3SF8B 1P72A 2C82A 2R751 2Q3LA 3FR7A 4TYMA 3A6DA 2Q1TA 1G8YA 1Z26A 4HFMA 2QRKA 2JBAA 5A06A 1JJBA 1NUHA 1CUXA 3LU1A 3RUDA 2NUTB 3FFAA 1HRDA 4MR9B 1NBMA 1XQYA 4LJLA 4C6TA 1GT6A 4X1IB 3AF5A 4Z53A 1ZU4A 4KTVE 4EI8A 3CNOA 4IHKA 2PMWB 1VCNA 3BGSA 4GMDA 4EJ6A 4MQEB 4F12A 5LLTA 3OZGA 1C1XB 2WA2A 2BFPA 1UOPA 3AEZA 1GGVA 2FJPA 4DJFC 5HF9A 1P5ZB 3SC2B 1HQKA 3O93A 2HDOA 4M7OA 3I9V6 4FS3A 1Z0KA 2NM0A 2OORC 4GRAA 4TT3A 1W5SA 3IP8A 2QMHA 3RVSA 3W3AD 4ARZA 3IC5A 3MMZA 3V1TC 4IJ5A 2OZEA 3B9BA 4I5FA 1JMKC 2ZJ5A 3TD9A 1C7EA 4GVPA 4BJ6A 2HBZA 1QFSA 4M8LA 1QRRA 1UP6A 1ZSVA 2IYYA 4XA8A 3QLVA 1THMA 1YRYE 2JIOA 4D45A 1ZEJA 3MUEA 2AZMA 2Q1UA 1W29A 5C7YA 4X97A 4Q1CA 1YJXA 2R9VA 4GOMD 4O1IA 1NYQA 1TCCA 3ZWVA 3M3DA 4R83A 1WCIB 3U49A 2H9AA 1NLMA 2V65A 3H8JA 4QC2A 4UULA 5EXXA 2RCNA 3OI7A 1E79D 2HJGA 4MO9A 4BZQA 1KAOA 2GCOB 3R0JA 3QMVA 2OHIA 1W36D 3W3ZB 3G9UA 4TV8B 2TS1A 5F7JA 4EZBA 1XMIA 2PRIA 3AUFA 4NATA 4MMXB 4ZJUA 4OIFA 5BO5A 1E64A 5IJ0A 4RF3A 4L51A 3VH2A 1I4TD 4KPYA 2FP4A 2ZDGA 1I51A 4ZVNA 3DVAA 4Q6WA 4BPBA 2EKPA 2K87A 3WOHA 4D3YA 4MPPA 5I47A 1U7HA 3HJRA 1YHZA 2G76A 3ZOKA 2WSBA 2WWXA 5FAKA 2XUJA 3IEPA 3UJCA 3BAZA 4XDHA 1RBQA 2RGGA 4M3NA 3F73A 4OKNA 5EINA 1EWYA 2HKIA 2QJTA 4Q18A 2A1UB 5CBPA 4BE4A 5K6RA 4O02B 3RK1A 1Y0BA 1P2DA 1RD4A 2F8TA 2ZITA 3H9GA 4EM6A 4OHVA 1JPJA 2MYUA 4G24A 3AR5A 4W5OA 3OFVA 4CVNA 1CUVA 3R0VA 3ADKA 4UFOA 1NBME 3RKRA 4LJRA 1Y1SA 1AQYA 3ZZ0A 1U1GA 4GPBA 1KSGA 1PQPA 3G0BA 1DJOA 3BIOA 1D0VA 3IUPA 4X3OA 1SU4A 1XCLA 2HF7A 4HTFA 1YUBA 2C96A 1J0AA 1DBSA 4NG5A 3MT9A 1M8JA 1YBMA 2WQZA 3HFJA 3N8IA 1QGOA 1DG3A 2C42A 2H0QA 3DHEA 1A69A 3HZHA 4L27A 4A2PA 2HBQA 1U9JA 3T4EA 4L6CA 1T8YA 2EZUA 4RHUA 1SHKA 3QJGA 1W85B 1P91A 2HXSA 2QRVB 3KJZA 1EH5A 5JWHA 5IKEA 1YR7A 1VPDA 1ADJA 2JGLA 4ZZ2A 2V1XA 1LBSA 1T5BA 1UBOS 2EFHB 2QG4A 1P0QA 2OQ2A 5GTDA 1R6UA 1PVDA 3JZDA 2CXOA 3L0OA 3PDIA 4BJ3A 4D7AA 4YMIA 4JXXA 2ZYTX 3D9QX 1FIUA 2GK4A 2O5CA 3TKLA 1L8LA 4EGSA 1TQ4A 1KSHA 1T6NA 2SHKA 4N8EA 3V8RA 3QE9Y 4YRTA 1W0JD 1XZMA 5LA6F 1YASA 4OHRA 3G2JA 1GTJ1 4D9BA 3I2YX 3TTWA 2E4ZA 5LP6F 1PR1A 4Q4JB 2I67A 2QMUA 1JHXA 4FMPA 5AVSA 1MUUA 4WVLA 1RSZA 4LPKA 3O3CA 4EG6A 3ILXA 3DNPA 2QRMA 2IEDA 1IZ7A 3OCVA 4LNUA 4IGKA 1CS4C 2F1KA 4I4TB 3TQTA 3AW9A 3VTKA 2BGMA 3GLIE 3OCJA 3NXSA 2HB6A 1OYYA 4EKGA 3G0HA 1U8ZA 5CU7A 4AS2A 2QMEA 3L7KA 2VFAA 1E2NA 2W71A 3BC1A 3GF4A 1M34A 2B83A 3IP9A 3VKWA 2WTNA 1BIFA 2AHRA 2DKFA 2NN3C 4XEHA 5J3JA 3NYWA 2GD2A 2NTYC 3TEFA 2AFHE 4M9UA 5EC8A 4IHAA 4YXFA 4G5HA 4Z4IA 1MA0A 2FWJA 2ZKIA 3QW4B 5F5XA 3SS7X 4NF2A 4BLUA 2XMCA 5CLQA 1K4YA 2Z6VA 5HS6A 1MTOA 4B6GA 5BYAA 1Y6FA 1REQA 1SC1A 1T1EA 3LGAA 3M1YA 3MXOA 3QEOA 3AKZA 1G8KA 5E9WA 4P8RA 2R2AA 3DOEA 4RU1A 3ZUPA 3ADDA 2OO5C 1U3DA 2D5LA 3AOGA 3CM0A 4ZP1A 4L2IB 3A04A 4ILKA 4JLPA 3GMIA 4KK4A 4C3OB 3IUEA 5J5VA 3LA6A 2NNLD 2FRVA 2XVXA 3IJRA 4CF6A 3KEGA 4LOHA 1SD1A 3H8WA 1B43A 1Q7GA 3NNNA 1QO7A 1X7GA 2Z8ZA 3N2EA 5CITA 5KNCA 2BBSA 5JBQA 1ZW6A 4M9CA 2WHPA 3L7BA 3CSUA 3E5HA 2W6JA 1V3UA 4LKOA 2XJ9A 2IIBA 5FI3A 3NIFB 3V1UA 2EJWA 5IFKA 2E5LB 4QM6A 5GJBA 3VR4A 3QLTA 4I3FA 2YX1A 1I33A 3B78A 5CXXA 3U7RA 2VBFA 1MLDA 4MYCA 3J80A 4C0XA 2H92A 1P6XA 4I4IA 4QFCA 1T34A 3EPPA 1TK2A 2RB5A 2PSSA 1BE0A 5E3JA 1N75A 3G7SA 3Q9NA 3EJ6A 4PC7A 5KBYA 3ZOZA 1JEDA 2CXXA 2F7SA 2WNSA 1QWSA 1H94A 3T95A 4URWR 2IPAB 1IZYA 3EOZA 4FJ1A 2QM7A 3BL6A 4LWPA 4QPPA 5KCMA 4JI3B 5KMGB 4UHEA 1EJ6A 4DLTA 3WDLA 4J1TC 2NZJA 2E48A 3R41A 1MOZA 4IOLA 4RWEA 3R7BA 5A6SB 4N76A 1EB8A 3M5WA 5BSFA 3O8RA 4KDCA 2FWBA 1QOZA 1CJVC 4OQXA 1Q1ZA 2VC2B 3FNGA 2Z57A 1AKQA 1QQ6A 3C41J 1GGJA 1DB3A 1MU0A 4E31A 3QKRB 5JNRA 3CX3A 1AK9A 1RAHA 5KQRA 1KAHA 3ROKA 1TUIA 4F9FA 2EAUA 2JK0A 4RA6B 1THGA 1W2HA 4EUHA 1U2DC 1DOHA 4QDTA 5DEOA 4FJ0A 3ZTWA 3COJA 2R5WA 1M34E 3D6NB 3L6EA 1XRRA 4BWFB 2B4RO 4NC9A 5K3EA 5KX5B 1Z6XA 1QYVA 3AR2A 3CEPB 3S2IA 2VTBB 3GCDA 2IW3A 3HNOA 2DKOA 1LW7A 3VJMA 1QVVA 6YASA 5HZGA 1X1CA 4CLEA 4XR4A 3HKBB 3NT4A 3ULKA 3IAHA 1OF1A 2O7QA 4MROA 4NCXA 1TM5E 1KY3A 1LDMA 3C6MA 4BNKA 5J4YA 1X87A 2A86A 4XYMA 4NNOA 4MPJA 1RP7A 3DTVB 4K9RA 4QTXA 1AMOA 3KYJB 4MHSA 3GHYA 3PXCX 4RHXA 3B5EA 2E82A 5EKXA 3LK7A 4JU8A 1O97C 5JEDA 2F4NA 1VG8A 4Q7JB 3OD1A 2GH1A 4UUAA 5TGDA 4ZVOA 3VV3A 1MPTA 2XA2A 5DV9A 1NNUA 1OMOA 2O6HA 3IR7A 1DXQA 4MMZB 3VNSA 4RELA 1UC5B 4DUGD 1K3FA 4TMYA 5TIIA 1GKIA 1EEHA 1Y42X 4R2LA 4Y6SA 4DREA 3X43A 3G2OA 2DT8A 5E4YA 4ZAWA 2XXAB 4O25A 3DAHA 4YO8A 1N34B 4IIJF 3CZ5A 1KDPA 4B82A 1N2HA 2Q07A 2H63A 3IAEA 1H2XA 4PBTA 4CG2A 4ZN6A 2Y1WA 3GLGB 1L5YA 1KAMA 2WLSA 3KWFA 3RRFA 1Q50A 2W8BB 4ZODA 5CYGA 2QM8A 5L3QB 2RKBA 4IGAA 2HT1A 5JHHB 4BBPA 1TZBA 4MPDA 3MWYW 2AJBA 4QHTA 2E1RA 2A58A 1CUJA 4GC9A 1GCGA 1LFDB 1QX3A 5TEVA 3UEOA 6ABPA 3UBMA 1SULA 3NRBA 4FK8A 5GOTA 4A1FA 1RBZA 3VNQA 1E3IA 1KQPA 3DXXA 3BBPA 4BO5A 3ILHA 4TMFA 2PR7A 4M55A 4CV0A 4WFIA 4D4MA 1KDZA 4EZEA 5B55A 4ZT5A 4YMSA 3QPAA 1JALA 2X3YA 4P3KA 5DT2A 4BQFA 4DNQA 1ZM7A 4XD7D 4H27A 2DH6A 2R6CA 1QIKA 1UINA 1A7UA 3PXXA 2FWPA 1EFKA 4I1VA 2WAXA 3DL4A 4FYXA 4QXMA 2Z5LA 1UKVY 5HIIA 4NHOA 2Z6QA 1W46A 1CJUC 5FPKA 1F6WA 1F3OA 3L46A 2R6HA 1A5ZA 2I1QA 2OAEA 1WKVA 1WHSA 4JLAA 3BILA 4MQ6A 1X80B 3RF6A 2NO0A 1DOZA 3K94A 2Z0MA 1CG6A 3PV0A 4FR5A 1NPYA 3M4JA 3W5BA 3FUVA 3RR2A 5JCZA 1WWKA 2HSDA 1B0AA 3B70A 5JXHA 4LQLA 4HXEB 4NH4A 1CUZA 4DLSA 5KEIA 3BCSA 4W1PA 4BGUA 3EVCA 2WB4A 3W2FA 5HE8A 1FCJA 5EIFA 1M2NA 1OXMA 3CY6A 3AUYA 3GD5A 2VPTA 4OXNA 5H4HA 2PBRA 4O5AA 3ED1A 3OLCX 2DHRA 2N1BA 4NYJR 3L0ZA 3ZWDA 1CUIA 1I9GA 2VYNA 1YQGA 2WE8A 4TPKA 3UC5A 1FDSA 2BP7B 1GZSA 4G5FA 1NVUQ 2I6GA 3TTTA 2OZKA 2N42A 1MFPA 4IVQA 2X0FA 3T35A 3FDZA 2M98A 3OAAD 3C6BA 3O9ZA 2PUGA 2YWFA 1T9HA 1M6YA 3Q5EA 4B3XA 5ARBA 3WV5A 3E1SA 4MV8A 4BEWA 5FR1A 1XAIA 4LY9A 3T0IA 2QD1A 4X6LA 4ETWA 2BFOA 3TQOA 4MINA 3EAQA 5ELMA 3S2FA 3KZXA 4MIEA 3WRWA 3KPVA 1OLSA 1B0UA 4YJKA 4HFRA 4MR7A 5K0LA 4CETA 3DOHA 3AFGA 3GNSA 2WFAA 1JH9A 5DP2A 1JDTA 2EYUA 5TPWB 3LF1A 5HFNA 1ZR2A 2ZANA 3SHTA 5LD2C 3FWKA 2OVBA 3OE5A 1AKTA 1KVUA 2IEGA 5CCEA 3RKUA 1Q0TA 1H4QA 3IKMB 5EWJA 4MHTA 1IN4A 2KB0A 2FFBA 2RBGA 4AMUA 4KITB 3H2GA 5A3VA 3FHJA 5H8WA 2JGRA 5JU6A 2V6IA 1HFKA 2CB0A 1A7JA 3FRIA 3HCOA 4ZQIA 3R7LA 3VA7A 3SQWA 3H7IA 3DM9B 4MR8B 4QA9A 1BVUA 1Y82A 3KXDA 3AL0C 2JJ1A 1P2GA 3KEFA 2C7OA 2O8CA 1DUIA 3PXDA 3AM3A 4CU5A 1AE1A 3M9XA 4LHWA 5FO0A 1DFHA 1MNAA 3DF9A 3G0DA 1Z6PA 4KPUA 4GYWA 2DUNA 2JVIA 3TKYA 5JRZA 5HG0A 1MAHA 1WXGA 3SDZA 4Z7QB 2Q0QA 3IB3A 5D8DA 3SJ7A 3ZVLA 3VU1A 2J6BA 1JXQA 2I3DA 3GAMA 4DLZA 2G63A 2W2PA 1ZX1A 4ZOAA 2O7RA 2P40A 2ZYGA 5AJUA 1Y4SA 3MGCA 4N3AA 4R8MA 2KS6A 5ALQA 2NVUB 2JVJA 1QZ3A 3DEJA 5EQTA 4ZCLA 1NBWB 2PRKA 1E3WA 3A1TA 3H5LA 4REQB 5LLSA 1LS1A 4A9AA 4XW2A 3NBYC 4Y9TA 2I4OA 1E1RA 3HFGA 2O2CA 4HK4A 2PR2A 1PJTA 2IXAA 4JMLA 4AUKA 4CTMA 3FHCB 3MQ2A 4KV7A 1OR8A 4UBNA 5LZ5A 2ZRQA 4IYRA 2J0VA 2JFOA 3CLUD 1RXIA 1M6HA 4OP1A 2P5YA 4BJHB 2QMYA 4ZK2A 1QKIA 4RACA 2FOIA 1N3YA 2IC5A 5CEEA 1C3LA 2ONJA 4GW3A 4FYIA 4F93B 5KQSA 2ZUSA 4AF6A 1Z7EA 2G8LA 3M6VA 4R9VA 5D87A 1XEXB 4H59A 1RHQA 1BROA 2G08A 4BBJA 3UH1A 1KZYC 4YRKA 1M9NA 3C98A 2YWBA 2WI8A 5BV2P 1EI9A 2GSDA 3GZNB 3QXGA 4WKNA 1M1XB 3ZWPA 3RAPR 3PI6A 1KAQA 2MSNA 1JLRA 3AHCA 1VMAA 2D8MA 4MQBA 1KI6A 3AF2A 1LBEA 4Q7KA 4RKQA 3G0CA 1XRSB 3INTA 3VGJA 1RPAA 4C3UA 3EA0A 5AW8A 1TRKA 2AMLA 1RKQA 4FHZA 2VEDA 4U63A 1N5RA 2J9ZB 1GSHA 1OZFA 3UMMA 1JHQA 2HMVA 3OJLA 4H1UA 3WIBA 3HH8A 3TFWA 3QYFA 4FT2A 1DIRA 3LQ2A 3E1GA 3ZBUA 2QRLA 1VIVA 3BPSA 2DTDA 1BKDR 3GRCA 1WLYA 5DTIA 1NPDA 3BT7A 3EPJA 3AJAA 5DYTA 2N75A 3A2LA 1HFJA 2IYOA 4S1TA 4YRGA 1Q7BA 3CO5A 1J25A 3UK2A 3RADC 3FVQA 2H4HA 4P86A 4L9AA 4J0IA 4PTZA 4J7CA 4Q01A 1OAAA 3CR8A 3GFQA 2QL5A 4PLHA 5KTMA 2V55B 2YYSA 2JEOA 1FQJA 4JL8A 4WKCA 2OECA 3W8NA 1G60A 1KI1A 2XGOA 3BK7A 4BFVA 3FYUC 2IQ5A 2OL4A 3GLIB 3IT3A 5FBZA 1NMZA 1XJ0A 5FTNA 2HSJA 2ZWVA 3EA5A 4NYIR 3X1KA 1U31A 5CGQB 1H2WA 4S04A 4JSTA 4MLCA 1YFZA 2AZ4A 3P9PA 3TPCA 5IN4A 2ZUEA 3F1KA 2OQVA 1PS0A 4GX0A 4WY5A 3FKSD 2R6R1 4RM2A 2AFHB 4XB2A 1E7SA 1UXHA 2FSPA 3OT4A 4JVMA 1EX6A 3AF1A 1U8CB 2C95A 2GZ3A 2OTCA 5EWMB 3RKSA 4G1BA 2WYVA 1A8PA 2X7HA 3IQXA 4HG2A 4MS4B 3T3EA 3IS3A 3DHWC 3SQNA 3CTMA 4CKCA 2YYYA 1SAYA 1XJWA 2ZUBA 5IANA 5JAQA 1FFEA 1ZD1A 2GM9A 4D25A 3RYCA 4XXHA 3EUAA 1FFWA 1QTIA 2FN7A 3IXLA 2KLBA 4Q48A 4QD3A 1F4LA 4MUKA 2XT0A 5DLYA 1T9ZA 4LSMA 3N8DA 3V48A 3QSGA 4QEZA 2FMXA 2DXIA 1V1MB 1RZUA 3KUUA 4EW2A 4WJKB 2WU1A 2X9QA 1F4PA 4KN8A 1B1CA 1UJCA 4KH0A 4AJPA 5C53B 1I94B 2X19A 2PH3A 4JLNA 4M8NE 2JJ2D 4HDQB 4RS3A 3DZHA 2X2PA 2BMWA 3C8MA 2Q4TA 1SFRA 3Q4GA 5AVXA 3L82B 1MT0A 2ZJZA 5BSHA 3LKVA 1BFDA 5JS2A 3C1AA 3LL7A 2X23A 1VLMA 2GPJA 1OVGA 1VA4A 3X1YA 3IP7A 2OP0A 2BCGY 3DQZA 4C89A 5AIBA 4ARBA 5BN5A 2A9QA 5I51A 2G7MC 1P73A 5HJ2A 2WAMA 3P97A 4OJKA 4Q4HB 3CZQA 4OL9A 4TWJA 1N6LA 1QFZA 3KZVA 3QPWA 4XLTA 5KOHA 3QI2A 1IM5A 1RIIA 3MJSA 3KAPA 2I7XA 2P2CA 2Z83A 1RC0A 2IPLA 3BXZA 5TPZA 2VUTA 5LQUA 2WMDA 3LW8A 1KKUA 4HQ0A 1O6CA 1AHIA 2OA0A 5J40A 2ZI3A 2QL6A 3H5NA 3D0KA 1YB6A 3E05A 2VDUE 2LCIA 3FRHA 4GI1A 1GQYA 4BNDA 4BMSA 2I6QA 1D1TA 3JARA 5FFFA 1SHZA 3O3NB 1H9CA 4MUJA 2ERXA 2CGEA 4BMOB 3L8MA 1AGNA 1XNHA 4LHZA 2WHXA 3BCHA 4LISA 1QDLB 1FFSA 4O4JB 4QJ4A 2QU8A 4DS3A 1MX1A 3ESCA 3FJOA 1U0TA 1MGPA 4RZ3A 1KYQA 2VOJA 1Q15A 3K4QA 2ONYA 3QOWA 4QSHA 3WMWA 1MENA 3QQ5A 3R8FA 3V2GA 2IS1A 2PLWA 3LYUA 4RMGA 4DWJA 221PA 1N2IA 5T8KA 3EVZA 4FDAA 5K1ZA 3E7WA 3UGTA 2AR0A 3SKXA 3O2QB 4U7DA 2A0UA 1HF3A 1A5BB 1F8UA 2G6TA 3JQAA 1OCEA 2PKXA 3JQ7B 2YWHA 2RHRA 5I9BA 5CBKA 3K5HA 1AQ6A 3OIUA 1RRKA 4OEHA 4RW0A 3LGSA 5HUJA 3AGPA 3JAKA 1RLIA 1T4MA 3TJMA 5FL3A 3LUGA 1XLWA 4RC9A 2FPMA 4PC6A 4CR6A 3IAS1 4OU5A 4ZAYA 3Q5DA 4JI6B 5JQGA 2ZTLA 4G65A 5IUKC 3LY8A 5FWAA 4PN3A 4ZZ3A 5BUZA 4YIHA 4K40A 4AULA 3WMXA 2TMGA 2PVCA 4AKTA 5IKOA 1YI0A 2A5GA 4YI5A 3U39A 4A36A 3C6ZA 2F1JA 2AK2A 2NPIA 2WUDA 4YP5A 5A7GA 2X0EA 3EE6A 3EOBI 4ZCTA 3UK6A 5JNVA 4JOQA 1L5NA 1RKVA 1IWBB 2R8PA 4D82A 1S2GA 3K53A 3GFFA 3PPIA 3O4RA 3OY2A 2F64A 5A4FS 1A8UA 2RB4A 2Q3BA 4C0LA 1M7BA 3I6MA 4NI5A 5DN9A 1PVOA 3QIVA 2P9GA 2EP5A 5D3KA 2HPVA 1LPOA 3Q87B 1YDFA 1FXWA 1C0EA 1P0MA 4I1YA 3JATA 1WMEA 2EKLA 4QPJC 2PRYA 4EPXA 1XG5A 2XHEA 1UDXA 1JLMA 1UT6A 2X77A 3LZDA 3T8YA 3DE1X 4WK2B 2V7VA 4A6DA 1PR9A 4B4UA 2WMYA 2GEBA 4JNCA 1W59A 5TGTA 3ZGVA 1X38A 3K1JA 3I53A 4UU7A 1RU3A 1D2GA 3EEQA 2V6FA 4BO1A 4M8KA 4QU9A 1G7TA 5BQOA 4MV3A 2Q3FA 3PS9A 2MSDB 1XRPA 3FOWA 1AUXA 5EXPA 1XKXA 1SVMA 3G8AA 1O94A 5CB4B 1ZVJA 4CCYA 3HCDA 1C1HA 5JH7F 1JDNA 1MEJA 1N3LA 4UAVA 4KHPB 4MA5A 2JCYA 1VMDA 3EGCA 1PWXA 3MAGA 3TLMA 1K27A 1ZLXA 3WGGA 5JCJD 1I0LA 1M2VA 3A32A 5KVVA 4RABA 2B61A 2FSHA 3IT0A 5J63A 1ECPA 1MF7A 4RSMA 1R0XA 2G1PA 1B8NA 1RYMA 4TZ0A 3EDYA 1VL2A 4MZXA 4KFSA 2HA0A 2XEDA 1JQ3A 4D43A 4KI0A 1OAOC 3G89A 2AFRA 2VYFA 4ND4A 1QLWA 1Y7LA 4TSFA 1AMUA 2HDNB 2AIRA 4Q24A 4AZTA 2VNHA 2FMUA 1WD5A 1QB7A 3SM9A 2HGSA 2FN9A 2V9PA 5EIHA 5H9WA 5LMNB 2J4FA 4K6MA 1A8IA 1O96B 1K06A 4MYUA 1GRQA 4CM3A 3P71T 3UJ8A 5FNVA 1EP2B 3GFVA 1E9EA 2ZIZA 3E6AA 3QLVC 1J22A 2HMUA 2R8BA 4TN5A 3M6UA 4G5GA 4UNPA 3ZV5A 4II3A 5ALHA 3UUWA 3AM1A 3CCCA 4WMLA 4A8TA 1YUNA 2B6NA 3BWYA 7REQB 1NRJB 5IT0A 2BFAA 1A2BA 1ZMOA 1MVLA 4MB0A 3U0VA 4E2XA 3ICEA 1XDDA 3PX2A 4ROTA 4V2IA 1R9MA 1JW9B 4O33A 4N49A 1NI4A 2YJ4A 4NP6A 1Y8RA 2QA5A 3U3RA 1V11B 1NR5A 1BQ3A 3EMKA 3KM0A 3C6KA 5DK4A 3PSHA 4A3SA 4F2PA 4WHMA 3LI2A 1CD5A 3KXLA 3KIPA 1Y8AA 3KQPA 3OURA 3ZV7A 3A26A 4DLKA 4V0NA 4AKHA 1X0XA 3KEQA 4IF6A 4NJMA 3F6PA 2HMWA 4H3SA 4ZT6A 2LCQA 1ZJZA 5KWVA 3OPYB 4QGSA 4LHYA 3L7YA 4BP1A 1R3UA 1IPHA 3P0EA 4IDPA 1SC3A 2ZKLA 1ODTC 4P31A 2IEZA 5GAJA 3TZLA 3PQCA 3ZZUA 1DPFA 2QN7A 4FFSA 3WY9A 4EAAA 3D0OA 3FA2A 4YQZA 5KVSA 1PWHA 4RIFA 3RFXA 3EXEA 2OYCA 1KEVA 1VSUA 4P3YA 1ZZEA 2Y77A 2P4SA 5B12A 2EKZA 1U02A 2UYHA 1J42A 3FPEA 1YU6A 4XTCS 3SJCA 4ASUD 3Q40A 2DQZA 4BP9A 5REQB 4XVUA 2FUCA 1OBFO 2AOWA 1ZI9A 1SBYA 3FYCA 4KIGA 4OMDA 5H9VA 5EP4A 1L5LA 1QH0A 4NU0A 2HWWA 5A2GA 3WYGA 5JAOA 2NTEA 4IIUA 4KVFA 2GO1A 3KPYA 4LHEA 1CFJA 2Y1OA 4HWKA 2BEUB 1QS0A 3H9UA 1ZNYA 3RLIA 1RC8A 1H4TA 1BU5A 1QP7A 1R1DA 4UE3S 5DO9A 4ENRA 4DCUA 5JPDA 2ZS7A 4Z49A 1U9CA 1G3QA 1NW8A 4C04A 1XL0A 4JB2A 3VNAA 2QTMA 1DWPA 5IC5A 1UEIA 1KKMA 1A5SB 2HZ7A 3AUTA 1EP9A 3THOA 4D3ZA 3PGKA 3MINA 2ZSIA 2QLBA 4EMUA 1DBPA 4WK4B 2G1JA 3OZIA 4DMFA 3FSGA 4P0PB 4YCBA 3L49A 1UIRA 2G8NA 3A6EA 3S2GA 4AQDA 4Z0HO 4BCCA 3FETA 2QE6A 3FYTA 4JGBA 5HRAA 3PWZA 5IYZA 1YZYA 1LTKA 5KX5A 1I6WA 3NASA 5ICEA 2X9GA 4NX2A 1L5HA 1QG6A 2ORYA 4E15A 5J5AA 2O8FA 4CF4A 3TH5A 1T5OA 4HLQB 2A9PA 4ISCA 2FWNA 1WXQA 1US8B 2W6IA 3ZIAD 3DBHB 1GPJA 4GQAA 1MRZA 5IAEA 1OJ7A 1B16A 3D3QA 2PLRA 5AP9A 4P4NA 2CUTA 4CMEC 5JYEA 4C22A 3OOEA 2O0JA 5J2UF 4C7BA 4NZMA 2IRWA 4OIMA 4Q02A 5B6PA 3TI7A 2QROA 3UBTA 1ARZA 3HUDA 4TV9A 4B87A 1RJ9A 1UP4A 1L9XA 2KSQA 2XUDA 4WPGA 1TCVA 5CK4A 3NUZA 4RESA 3IUJA 4FN5A 4QARA 3DMFA 5DP1A 3S2EA 3T4XA 2J7PD 1JDUA 5EFZA 1UJ2A 1NOKA 1TF7A 1GCIA 1WEHA 3KU1A 3JQBC 4FCWA 3I45A 4EHAA 1KPHA 3IT1A 3N6RA 4JWTA 2BZGA 4R01A 2O3TA 4FUTA 4DFDA 1OA0A 4EJ2A 1BO6A 1L5MA 4G8DA 4Q93A 3I32A 2A5DA 2X2FA 3KUDA 3Q8LA 3VU9B 1MW9X 5CW1A 5DRYA 5TJ9A 1G5IA 4ALLA 4EHDA 1E3JA 2NZ8A 3JASA 4LE2A 4K6KA 1FSZA 1O1YA 3O38A 1M6VA 3JWPA 3RGGA 4D8WA 1BJRE 2XD9A 2HN9A 5GGXA 4KQCA 4CMJA 4ILEA 3ZWAA 1UM8A 3U7GA 3RFUA 3LT1A 4CLRA 3BWEA 3K3PA 4PTLA 4C01A 5BOSA 1C7RA 4PLZA 1Y6GA 1XVLA 2DFLA 2FFHA 2XWBF 4Z4QA 4X66B 3R3SA 4GG1A 3ND8A 4QNNA 3SDBA 1DG1G 3KHSA 5AW6A 2ZZNA 1CDEA 1GIAA 1X7WA 2JVKA 2EFCB 5AM4A 3AFNA 4GM0A 4JJIA 2H4FA 5KYNA 3VKGA 5U9CA 2B6HA 1SXJE 2ZVQX 3GLKA 1IJEA 3H9BA 4AY4A 2P75A 1E3WB 2WF9A 3A4MA 3EGIA 3FPLA 1EFCA 4YQEA 4G1MB 1SA0A 1MVOA 3RC2A 1EAMA 3K70C 1ZK3A 2QSUA 3CS3A 4HQFA 2V7GA 1VKNA 2J41A 5DKFA 2JIPA 3TD6A 5MDHA 1N4AA 4Y1FA 1Z3IX 2HF9A 4ZWNA 3SZGA 2ZWAA 1TTTA 2NZVG 4OXQA 4ZO7A 1EUDB 2YN2A 3UOGA 1RLUA 1QM5A 1C4XA 2V7XA 2XZLA 4B8WA 2BBWA 3RYHB 1MC8A 2HGZA 4EMSA 4O2AA 1QSGA 1RWBA 4XVRA 4P4SB 3MYRA 4QFDA 2PKYX 1RBYA 3SQLA 1MEOA 3IEXA 1Z36A 4BVLA 1V5GA 2J6HA 3X3HA 1ZD9A 1EA7A 3WNVA 1P17A 1MA3A 3P7MA 1HFEL 3B3GA 3EEYA 1Z06A 2UUAB 2AS0A 2V45A 5BV8A 3THWA 2H1HA 3IQHX 3GLSA 2DRIA 3LS2A 3FBWA 4YDSA 2CJFA 2C29D 3AOEA 3GH3A 4C6RA 3P2MA 2OY0A 3HE3A 1QANA 1ORDA 3VOTA 5DE3A 2R65A 5C1OA 3OFJA 2QPAA 4BMDA 4C5AA 2QW1A 4C29A 1EUYA 4LZWA 2D7DA 1JPUA 2CDCA 3NANA 1JKJA 4YJ3A 4DKJA 2H4XA 2AOTA 3LCCA 4PXAA 3T9EA 2PZMA 3L1IA 1EM6A 2QNBA 4OM8A 1SBZA 2OP1A 3LH5A 3IURA 3R2JA 4F3TA 1TVKA 3NPMA 1N8TA 2IH4A 5GONA 2PZ8A 3CKYA 2WYWA 1Y6JA 3EG5A 4HX5A 5EPUA 1H1TA 1B2RA 1FOEB 1MAWA 2J9FA 4L57A 4LYYA 3U3MA 3SJBA 3HJHA 5DBIA 1SCIA 4EW3A 5EAIA 1N7HA 4NS4A 1YS1X 4Q4LA 3IGFA 2WAAA 4ZAZA 4AT1A 1X7ZA 2PMEA 4YRMA 3PD7A 1PNRA 3RYFA 4ZPXA 1SWVA 3CIOA 2CFOA 5HUHA 4ZI7B 4AWBA 1L5VA 2NAPA 4QU5A 1FUUA 5IAKA 4HP8A 4ALMA 5KU7A 3AUSA 1CUYA 4BO0A 1OPRA 1EFRD 4XJXA 5EIAA 3V7YA 3ZLTA 3WNDA 4Z4FA 1GQOA 4XRRA 3W9UA 1JJ7A 4BLTA 4PC1A 1AQNA 1TRHA 4FMDF 5KTSA 4CGZA 3TCKA 4CLOB 2R1VA 3EPRA 4TLCA 4UMVA 4F96A 2H5JA 2FY8A 1IATA 3ESXA 1KMNA 4G89A 2WJ4A 4JGGA 2W2KB 1U3WA 3IPAA 4UAJA 3AILA 3PNKA 3ZDFA 1KU0A 3NBXX 3BYZA 5ESXA 1IWPB 1G8HA 2CKMA 5ENZA 2CDBA 3PGVA 5F3WB 4PG7A 1RQPA 5EEGA 4CMGA 1DMSA 2XMRA 3M4NA 4S1WA 1QGAA 2WTUA 2WWVD 1LLCA 5EP1A 3WL6A 3E0XA 4MRRA 4R40A 3G0IA 4OGLA 5BWCA 4BEVA 1FTYA 2QLFA 1N9GA 1CUDA 2WILA 3JWGA 1S9DA 3QYAA 4MI9A 1NU8A 1PQ4A 2MINB 4NRDA 4E4YA 1NFRA 2AUMA 2JGAA 4FNAA 2ODQA 4HDMB 3KO8A 4H18A 3FYSA 4WLVA 4ZRNA 2EHJA 3ZY5A 3RIXA 4CF3A 3BB4A 1VLJA 4MW7A 2X86A 4LPSA 4MLPA 4IDAA 1R0LA 1GEGA 2C2YA 4CV3A 2IX3A 2OCPA 4DLYA 2VHUA 4KMRA 5FUVA 5K5EA 5EXEA 1Z38A 1R74A 2DFTA 2YWJA 4WY8A 3O3MB 4AYXA 1DAGA 3KLBA 4C4YA 3TQIA 4BO8A 3R9XB 3UTDA 4BUZA 2JAXA 3KYDA 1GFIA 4RVNA 3TOZA 5JRJA 1Q83A 4B2IA 2DULA 2XMSA 2XUPA 1ML4A 4OQMA 3VSAA 1UC9A 3GEIA 5DOZA 2WHEA 1Z0JA 4Y7CA 4A0SA 1JN0A 4D9JA 2LUOA 2QX9A 4B31A 4G1EB 4HUJA 2PSHA 2XZPA 4IG4A 1VCHA 3AFMA 3R40A 4RK1A 5FT9A 4IXWA 1MB2A 1TM2A 2CXUA 1DE0A 1YIDA 4X60A 4TKVA 4JDPA 3GPLA 3V7FA 1TO2E 3R3XA 4W1SA 2B4KA 2F59A 3L0CA 1CUGA 4HB4A 3RI3A 3WLOA 4B0PA 1TGYA 1KFCB 3U31A 3ZTYA 5JTUA 5CX4A 4WJLA 5FI5A 3TSWA 1XN1A 2JL1A 1P9LA 4EGCB 3DB2A 3U81A 4GEKA 1U65A 1GCUA 4CQMA 1BMFD 5K0JA 2P9FA 5LCXA 3PKZA 1TJ3A 4LFCB 3F2VA 3FCYA 4BL5A 2OFXA 3C3DA 4LS3A 3U48A 3ESBA 3HPRA 5JAMA 2B1JA 2LNDA 1YF3A 4AKIA 4IZHA 4L5YA 5C31A 4L08A 3WOVA 1GFSA 4D8VA 1CQIB 3T5DA 4WERA 3RIHA 1U2QA 1H42A 1QAQA 3ZD9A 3ZDZB 4EB8A 2NYAA 3P9CA 4JXZA 3QX8A 2WP0A 3V2UA 2ONCA 4XR9A 2WWWA 4LK2A 4OH1A 1ZITA 5CVCA 3ELDA 1J21A 4JXJA 4WXRA 3ZE6A 5HIKA 3DEFA 3SZUA 1HE2A 3DW1X 1LI5A 2EDCA 3WNZA 4D0NA 2ZP1A 3OKPA 2RHHA 3STTA 2I87A 3GP3A 4G41A 4RPGA 2BWJA 1ZNXA 3RSQA 2HFJA 4AUEA 1F7VA 5GIOE 1SG6A 1M0EA 3RUCA 3DTNA 4C14A 5KHOC 2YZ7A 4R0VA 1V6AA 2QS9A 1SCKA 3LPAA 4R0MA 4MSUA 5K8LA 5L4SA 1O95A 1ZM3A 1Z5UA 3F71A 3FTPA 2VDRB 4IF4A 1UBCA 1UQRA 5FA5A 4YP6A 2UXDB 2FJUA 2GJ8A 2JDID 1G4AE 1KYIA 2CHVA 1VHWA 4KR2A 3ANYB 1NLYA 3SIPA 4XIYA 2ZCJA 3AVXA 2BR5A 3FKJA 3E9YA 4NFYA 2QGFA 3FD8A 4MICA 5EUCA 2EBHX 2V5AA 5EMHA 1QORA 2HRDA 2B25A 1U7UA 1Z8NA 2JNWA 4U2KA 4ZO8A 5AK6A 2CEKA 3UJHA 5K0ZA 4YMLA 3VU0A 2NSYA 4B45A 3FOBA 1GLGA