3MXOA

Crystal structure oh human phosphoglycerate mutase family member 5 (pgam5)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
202
structure length
188
Chain Sequence
b'SMDHYKAKATRHIFLIRHSQYHVDGSLEKDRTLTPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAPVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCRALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein phosphatase PGAM5, mitochondrial
publication title Structures of PGAM5 Provide Insight into Active Site Plasticity and Multimeric Assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 70
structure length 188
sequence length 202
chains with identical sequence B
ec nomenclature ec 3.1.3.16: Protein-serine/threonine phosphatase.
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1240 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphoglycerate mutase-like 3mxoA00
1IHPA 2P2ZA 2EKBA 1DKPA 2IKQA 2RFLA 3LNTA 2EOAA 2HHJA 3D4IA 2A9JA 3C7TA 3FDZA 3NFYA 1YFKA 1NT4A 3K4PA 4HBZA 3O0TA 3DCYA 3IT3A 1CVIA 2BIFA 3E9DA 2P9ZA 1E58A 1SKBA 1C81A 2HPAA 3LL4A 4PZAA 2OWDA 3IT2A 1E59A 2H0QA 4GPZA 1DKMA 3D6AA 2P6OA 2AXNA 4JOBA 1RPAA 5AJWA 2I1VB 4PGMA 4TSRA 1QWOA 5HTKA 4IJ6A 1SK8A 5AJXA 4E3WA 5PGMA 1BIFA 1TIPA 1QHFA 5CX4A 3DB1A 1C7ZA 1T8PA 3LG2A 5CDHA 2P79A 2YN0A 2GFIA 5AK0A 1BQ4A 2EKZA 3PGMA 1XQ9A 3BIFA 4ARVA 3K4QA 4PZ9A 2P9YA 3NTLA 3F3KA 1DKLA 4JOCA 4D4JA 4D4MA 1H2EA 2P78A 4EMBA 3GP5A 3E9EA 1RPTA 1V7QA 2H4ZA 3EZNA 5AJZA 3E9CA 2DWPA 4ARSA 4IJ5A 1YJXA 3FJYA 2HIAA 2PA0A 3MXOA 1H2FA 3GP3A 4EO9A 1UJCA 1ND6A 2P77A 4ARUA 4ODIA 1BQ3A 1K6MA 4D4KA 3QPWA 2YN2A 2H4XA 2P30A 5CU7A 3QPUA 4QIHA 3F2IA 2QNIA 3IT0A 2P9FA 4AROA 3QPVA 1C80A 2WNIA 3GW8A 3EOZA 2P6MA 2DWOA 3FDZB 1SK9A 1DKOA 4FDUA 4FDTA 1UJBA 5HR5A 1RIIA 5AJVB 1DKQA 3D8HA 4MA4A 1FBTA 4GPIB 3IT1A 3R7AA 2H52A 1FZTA 2F90A 5AJYA 1SKAA 3KKKA 1ND5A 2WU0A 4JODA 3MBKA 1DKNA 3HJGA 2ENWA 1QFXA 2OWEA 2A6PA 1EBBA 1V37A 4D4LA 2ENUA 2P2YA 2P75A 3OI7A 2WNHA 3ZHCA
chains in the Genus database with same CATH superfamily
4ZT2A 1YB5A 5FOXA 3O31A 4C2UA 1W25A 4RWEA 4YMWA 3GRCA 5CBKA 4QTXA 4EHLA 4AUEA 2G70A 3NC4A 1RNLA 4LDNA 1QLHA 1XTIA 1TIKA 3QU2A 4CL0A 4R2KA 3HPRA 3O9VA 3Q2KA 3F73A 1OUMA 1OVMA 4GZ5A 3HNOA 4G0XA 5AVSA 1GUFA 4JXKA 4XW2A 3IKLA 2GEJA 4WLFA 1GRCA 2X40A 2ZWOA 3M8KA 4XUEA 3WBKA 1A2KC 3TLBA 1A7UA 2YV2A 3PB3A 2Z6QA 3WRWA 2YYZA 3FF4A 3MJHA 3BMCA 1N0WA 1PLJA 1XZPA 5LSAA 2CT8A 5AKZA 1CYDA 3DZ8A 4JLBA 4G1BA 4OXNA 2JA1A 5B37A 4X71A 4B4VA 1L5OA 2A7QA 4NPCA 3NHZA 4G0OA 3PC6A 2CL0X 3KIPA 4MKZA 1QQ7A 4K40A 3STWA 2W8BB 4EKNB 4P7BA 4YAEA 3A70A 4BFZA 1POWA 1PK9A 5B1HA 3SLGA 3KQVA 4HPWA 4LTDA 3RS2A 5EIBD 1JUDA 3ZJ4A 5LKRA 4KQJA 1LTHR 2C0PA 3HMKA 4MP8A 4MS4B 2GJAA 4KLRA 4YBRA 2XGOA 3WDLA 3A31A 3QBTA 2C77A 4C4SA 5H8WA 1XDWA 4A5OA 1G8KA 3OC6A 4EIWA 1L4EA 1PEYA 2X6TA 1W5AA 2VUHB 2AG5A 1X7GA 2FLKA 3VKGA 1E18A 4G5OA 1NBIA 2QEQA 1I3OA 4CU2A 2X9LA 5KPJA 1DX6A 1DEHA 3R0JA 4F60A 3MCTA 3AEQA 5IXSA 1CQXA 1TM5E 2PA0A 2ACWA 3I2KA 4Q66C 4BFTA 2HDHA 4BP8A 5A9SB 1JEYA 3BJRA 2HFJA 1VMDA 2P2LA 1U7PA 5DM70 4XVRA 5K0JA 3HA3A 4KO2S 5ALLA 3LWBA 4DGQA 3CU5A 2V4ZA 1R4NB 1XRNA 2OGUA 4FX5A 3LC2O 3V6LA 1YS6A 5EFZA 5DGHA 1ULSA 2H63A 2PX5A 4ALIA 1T4BA 2ASEA 2V9ZA 3F2IA 3HRHA 4KAJA 4M46A 1E3JA 4WJLA 3BXEA 3IEVA 4FNMA 1VJGA 3KXLA 1L5QA 3MRXA 2A9KA 1DT5A 2Q3EA 1H85A 4NU6A 1LZKA 4OI2A 2ALJA 3PQ8A 4D0SA 1Y8AA 5P21A 3OQHA 3BIOA 5B55A 3ZK7A 2ZULA 1JALA 1WKVA 1YR8A 3F5DA 2CDNA 1HSOA 4D9KA 2XQIA 3EGDB 3NHKA 2DR2A 3CF4G 3M4XA 3L9XA 1NQWA 2BDEA 1NW8A 3E3NA 3HU5A 3LC0A 1NYQA 1JHUA 1WHSA 2V7BA 2WYOA 3DJFA 3JASB 3QSGA 3OT4A 1ETHA 1O95D 1ZI9A 2G3YA 1VLLA 1VSUA 2PZAA 5F5NA 4ALKA 5M29A 4GKAA 1I2DA 3QUBA 4DCTA 3T9FA 1Z4LA 5EZ5A 5AKYA 4CKBB 4QYSA 1CF9A 2AT1A 3BS4A 2GETA 4TXMA 4DLPA 1AO0A 3BXFA 1QIFA 3NV7A 4CM1A 2J07A 5FI5A 1EM6A 2HWKA 1EFPB 2IDJA 1CZHA 2A3RA 4RPJA 5DI9A 2BR4A 2PKWA 3AG6A 5I9MA 3KAKA 2WIJA 5K0ZA 1P1RA 5ETJA 1NW7A 5AHRA 2FSFA 2NVUA 2WHYA 4AO6A 1H8HD 4DANA 5KNCA 1W0JA 5BXYA 1CRLA 1Z5GA 3X2SA 4B85A 1G19A 1YL7A 4S2EA 2PO7A 3A27A 3DWGA 5F2NA 1P9NA 3A9CA 1JSZA 1VBFA 2I4OA 3CH6A 3O6VA 4JJ4A 4D8YA 1P81A 4NJMA 4UBIA 3JAWA 1Q15A 1SOVA 2UYQA 3NPAA 3R3ZA 4M36A 4M1KA 4OLFA 3UAWA 3VR2D 3WL4A 3ZK8A 1QS0B 3O0DA 2D1QA 1OY1A 2HU2A 1FDOA 4HQOA 5HS4A 1DIRA 3DUFB 3JZFA 3THYA 4BNYA 3EZLA 4FYVA 5CAEB 1DTSA 2ZTMA 3NC0C 3BB4A 3K9BA 2HCRA 4UM7A 3KTOA 4CGYA 2V7TA 4PCLA 3RB8A 3MCVA 2XB4A 4IQGA 1E7SA 1CY8A 1R0KA 4QWWA 6AT1A 2XMBA 5JS1A 4I14A 1E1QD 1N25A 4E11A 3DGFC 4ND5A 5FOSA 4H4EA 2HXGA 2PCLA 3ENVA 4FW9A 4GLJA 1HFKA 1Z07A 2CF6A 2QIOA 2YNMC 4FS8A 5LZ8A 5IBCA 2B35A 3O7WA 4PHTA 4M9QA 1XZBA 1SQSA 3U3JA 1D3AA 1AXRA 2Q3BA 1M33A 5DOZA 3BMNA 4YAOA 4XVUA 3PGXA 2ZDQA 2XWBF 5HJ7A 1GLNA 5ICGA 4QYTA 1AHIA 2A86A 3PTZA 4MRPA 3R7FA 1QYCA 4QPNA 1R9NA 2EZTA 5EP3A 4V0ME 4A10A 1V2HE 2B99A 3LLSA 2D1SA 5FPSA 2WYUA 3KYCA 2HU5A 4OXXA 2X7JA 4AZ0A 1QYIA 3K0FA 2BYTA 1W1UA 2R79A 2C4WA 2VPQA 3RKSA 1TCCA 3BULA 4A0RA 4F9TA 4FR2A 3Q3HA 2Y71A 3PGVA 2D8AA 2DFKB 1Y5IA 1KXJA 2PXXA 3GVPA 4D3FA 1VIDA 2A0WA 3IEIA 4F91B 2WSMA 3OEYA 2RIPA 4IHJB 6ABPA 3DZBA 1W88B 2J30A 1TQ4A 1H6AA 2PGAA 5A02A 3ACBA 3TBHA 5CCXA 4GKJB 2WFZA 1YSCA 3N28A 3OFSA 3RJMA 1A1VA 3QPUA 4QIHA 3BF8A 1X2EA 2F67A 2P9EA 4IRXA 4DQDA 5J47A 1K6JA 3GW8A 4B5KA 1ORHA 2YDYA 5FAKA 2K7FA 1P61B 2E85A 3AILA 1FQKA 3KQOA 4TL8A 4LJ6A 3Q3GE 2FW6A 1G18A 2OD7A 3ODGA 2NU6B 5JNSA 1WB6A 3D2CA 2IELA 5JYEA 1CRPA 1CV2A 1VPDA 4PS0A 5JSKA 1B4DA 4H3HB 3DL0A 1TUBA 1M2KA 3MXTA 3FKSA 2AX4A 4L7QA 2AZTA 2CL6X 1X1AA 1NOKA 2GLXA 2YYSA 2ZBQA 3PJDA 5DYYA 1QNLA 4G65A 3TJMA 1I5RA 1E6EA 2V7WA 2B34A 1GFZA 1OXBB 1PJCA 1Q11A 1SD1A 3BCHA 3OCYA 4JDUA 4RMGA 4WBSA 1XEAA 4PE5B 1J8DA 3UT0A 5I7AA 4Z6KA 2I6TA 1I4DD 3H99A 4HAYA 4R4JA 2NZJA 5BPFA 1TAQA 3PHIA 1UWVA 1ZMOA 2AN4A 4MLCA 3QU5A 1V3QE 4H27A 2R4UA 3O5AA 4AS1A 4ER5A 3DHVA 3FZQA 4GBJA 1WR8A 2KM1A 2BIFA 1YRYE 2H7CA 5L3RA 4IR7A 1ZJ5A 4BUJA 4XWOA 2WWVD 4KR7A 2RGUA 4Q6BA 4TKMA 4YHBA 4MDEA 4W1QA 3ANTA 4DTCA 2E4UA 3WHKA 2J9GA 4MA5A 1Q6YA 2UZAA 4BFYA 2OC4A 1TK2A 4ZT4A 3R3UA 4WN9B 3OIDA 2C59A 1YHNA 2FEAA 2BE7A 2YIMA 3AR8A 1NLYA 2Q27A 5EYPB 3ZXSA 4WDRA 2FUKA 3Q9UA 4A0SA 4EFKA 3HKBB 4DXHA 1CNMA 3FE2A 3LH5A 2Z2IA 1XELA 5AM5A 1ILEA 1WABA 4MW0A 1SIOA 3W6PA 4GXRA 3P45A 1L5ZA 5E6SB 4AUNA 4F38A 1SUAA 1A76A 4RTOA 2V9PA 2R84A 1XJ0A 4R84A 4ENRA 5KWJA 5DSZA 2XEDA 3HCAA 5L4NA 3FH0A 1KOLA 1U2DC 1U1IA 1Z8DA 5FLEX 4YK7A 2ZQYA 1HG1A 3MLAA 4B45A 5EGNA 3KUCA 5HNKA 2J0QA 2X0RA 3V4VB 3MA0A 5AKGA 4BV8A 5C7YA 4UXJA 2FZWA 4M55A 2FMIA 4YONB 4IV0A 4IJMA 1DP4A 3HADA 4HDKB 4RK4A 3TZEA 4TM7A 4YLGA 4P92A 4EPRA 3FHTA 5FPKA 4OP1A 3R8FA 4WTOA 3UMSA 3HBJA 3IQDB 4XDHA 1VDMA 3ZQKA 2R86A 2C8KA 5F35A 1WPXA 2GF0A 2XD4A 4PVCA 3RLIA 3SJCA 4BVFA 2V65A 3VV2A 1YJXA 3ED1A 3KSZO 5CA1F 3JZIA 3Q8XB 4BATA 4EP1A 4OYLA 1U04A 3GH3A 5KYUB 5TIIA 1M0EA 1HZZC 3LK6A 1I2ZA 1MV8A 1BQ3A 1WSDA 2IIVA 1XDDA 3AEKB 3AINA 5A5DA 2I33A 2V9CA 3T3HA 4BX3A 1UM9B 4BAGA 2PEZA 3DLTA 2WTMA 4R2WA 2O4UX 1Z12A 2QJOA 2OCIA 3L43A 4ZREA 5KHAA 3QF7A 3SAJA 3ANSA 5AK3A 5FQOA 4C76A 2JGJA 1KK3A 1Y3IA 5I5EA 4MKFA 2DETA 4TWJA 2D1RA 4UHBA 2O59A 2TS1A 3HCCA 4O63O 4H6XA 3PFWO 1N4DA 2C7VA 5LZ2A 2J5KA 3ROPA 4QPJC 1TKCA 1E3QA 3EVBA 2KPOA 2O2DA 2GF9A 4DTIA 5JJLA 1CUGA 1EB8A 2OXIA 2E4WA 4HXFB 4MQFB 4G09A 4KIWA 1OX4B 1JH9A 3BTVA 1CR1A 1H1TA 3DFUA 4DC1A 4PLFA 3SQNA 2GH1A 4CLDA 2JJ2D 3HABA 1PNQA 5FTKA 4DLRA 3HXTA 2PZLA 2XMDA 3FVTA 3DDHA 1UFRA 3ORSA 3Q4GA 4U2FA 4KH0A 4N5NA 5D3MB 1FDTA 1NN5A 4MRRA 4UUNA 4BQEA 3OLWA 4KK4A 1I9GA 1TFUA 2X0NA 3HUTA 4N3NA 3NUZA 3ZJVA 1VRWA 3OCJA 1T0IA 3A6DA 1GKYA 4N5LA 2GERA 2XLBA 4BJ3A 3KKEA 4X90A 4A0FA 4BO6A 3R7SA 3HEMA 1SXHA 1Y8RB 2XT0A 1KYQA 1YFKA 4OREX 5C34B 4W99A 4G36A 2O23A 1Q1EA 2AEEA 3ETJA 5ELLA 4QJBA 5A7FA 2PZBA 4UVGA 1X74A 1AZLA 3BMXA 2HF9A 4EGFA 4BMPB 2XMQA 3OQ6A 2BUAA 3EVDA 4PU0A 4NS1A 2C95A 4M98A 2AR9A 4XFDA 4CR8A 4LK2A 2DQYA 1L7EA 2X4DA 3K1JA 2E4ZA 3ZYCA 2ZTLA 3D8TA 1JIVA 4ACAA 4AJIA 1FQOA 1EFRD 3UVEA 3OMLA 5BVHA 3FW1A 2ODBA 5BR1A 1RJWA 1C3VA 5A62A 3RUFA 3T3GA 4NESA 1MOQA 1WZEA 4BNDB 1T5IA 3PT9A 3QG1A 1EKXA 2VSQA 4IO0A 1T8PA 1HV8A 4LAFA 1BW9B 2J9XB 3NHUA 4UPVA 3CLSC 3RYHB 3IS3A 2GZ2A 3ORQA 4PO9A 2X9QA 4OOEA 1VSBA 2IFTA 2JBAB 3IUJA 4NENB 1G5QA 1C2TA 2X1VA 4QSHA 4XDZA 4YI3A 4M60A 1IY2A 1AT1A 1TKBA 2YVUA 2ZJ1A 3NAMA 4EX6A 2X7HA 4D4JA 2FWNA 4NU5A 5BVGA 1L5MA 5LBTA 4DSNA 2LCIA 1EZZA 2ZVJA 2OBBA 1Z6AA 2VKTA 4DHEA 2AJLI 3R3XA 2D62A 3PT5A 2F4VB 1FUKA 4US1R 3L1JA 4RDHA 1F60A 3O2SB 4D8UA 3SBEA 3U4QA 4HWKA 2X5KO 1C0KA 2ZVDA 2WC1A 3LUBA 1UBOS 3DDUA 2OHHA 5JISA 4ONEA 3WWEA 5JCJD 3MOSA 1VLZA 3CPHA 4FJ1A 5EP1A 3R7BA 4IHQA 4IVRA 1JQDA 2OILA 3BXOA 1YDGA 4RTQA 1ENZA 3R5XA 2ZYRA 1CFJA 1ZHHA 1OC2A 3FNQA 3QVGB 4AP5A 3PJRA 1B43A 4Q19A 4QFDA 3TG2A 1BU5A 1WXXA 4R2LA 3B1KA 2BGTA 1XBTA 3IP7A 3LMKA 2JAWA 3N2ZB 4CMBA 5IT4A 3VKHA 2CVPA 4DQ0A 3NUQA 3RS4A 4FFBB 5LCXA 3ORRA 4NYJQ 5JASA 4ZC8A 3HO1A 2FV8A 2G5TA 1YCFA 1IZ0A 2V0CA 5LPNA 1DKOA 1PWHA 2ZUDA 3BT7A 2UXCB 3G9XA 3BMOB 3KAJA 3WTBA 1BCRA 3PNLA 1XL1A 5TEWA 3ZGLA 4ARZA 1PR0A 2B4RO 2ZXFA 2Q9CA 4UBLA 2BJWA 3NEAA 1DXQA 4JI2B 4OHRA 2DLCX 5KQGA 4G97A 3Q7SA 1DBQA 4CI0B 2IS4A 4KYIB 4M0CA 3H0CA 3KJQA 4XGIA 3HEAA 2E49A 2HPHA 5BSRA 1OYOA 4D3ZA 4DWJA 5A7HA 4EW1A 1PW5A 5LXTF 1FYXA 5FQNA 3GK3A 4BQFA 2NT3A 2ZUEA 1QVVA 3NASA 4HNAA 1NUTA 4MUJA 2QU7A 2W6QA 3VR4D 4LV8B 4MKIA 3N58A 3LFHA 1E9DA 1A5SB 1EFCA 1IN5A 2UZ3A 2XUGA 3H2JA 3LPAA 3GJTA 3NR2A 4HLUC 3A4MA 4UBOA 5JHHB 1ZK0A 2R8OA 1D0VA 3IAM1 3PVZA 5DV9A 1QRDA 1DFGA 2XNDA 2WM8A 2XKAA 3I4CA 4IDFA 4LQ4A 5EQTA 1CY7A 4YP0A 4DPKA 3NBUA 1A9YA 1FVFA 3VVMA 4PYMA 4CQMD 3B52X 3GEGA 3HBFA 1JLLA 1OR8A 2HXYA 2VHEA 3IJRA 1WG8A 1ZXBA 3BWCA 1FP4B 3O3OB 4JJ8A 2AV6A 5D6NA 3UGQA 3OUTA 1TQDA 3VSBA 1VYTA 2MSWA 3AZOA 1A8QA 3DE0X 3TL3A 4IW3B 2Y66A 4IM7A 1XCLA 4PPGA 1K3TA 2AXQA 3AEYA 1E6WA 1BGWA 2CXNA 4GXQA 1C9NA 2FMTA 4Z7OB 4GBGA 5K6RA 5EIAA 3ZLBA 4L4YA 3R23A 2FUNB 4LQLA 4QICA 5HF5A 1G66A 5T7BA 5E9QA 2X15A 2ZU0C 1EAMA 1QC5B 4HMQA 4NYIQ 3GJ8A 3QLJA 4PG7A 5FB3A 4OJKA 3RNLA 4U02A 1KK0A 4CCYA 1AXGA 1BDMA 3I9KA 3IV9A 2R2GA 5ERYA 3UGJA 2B78A 3MMPA 4RZHA 1ZC3A 1VLMA 4Y30A 3WKAA 1CUZA 1T4CA 2JI6A 2QTVA 3EXFB 4FT2A 5GJVC 4D92A 5K8VA 2BKXA 1LD3A 1Z2PX 3FOBA 2Q9BA 1JAHA 3IAFA 4HZUA 5FEMA 3RO7A 3V4LA 1ZGAA 4JOCA 4LVNA 5IJ0A 5JFGA 2C4NA 1J42A 2B1JA 1R18A 4POOA 3GY0A 4BO3A 3RIGA 2FE4A 2PJDA 3MS7A 4KQEA 2M6KA 3P9RA 5K3DA 3TZ6A 1YBHA 2WR8A 4GT1A 2JEYA 2D5BA 2QAIA 2ZSFA 1IONA 2KB0A 1J2EA 4PG8A 4KV9A 1EDBA 5AI4A 2FQQA 2QVXX 3C5EA 3JQ8A 2A92A 5DX0A 3T0GA 3T54A 5JAPA 1WNTA 4XWAA 2ZKIA 4IJVA 2HIAA 5FUMA 1YAHA 3GJRA 4G8JA 4PYNA 3KQYA 1RAEA 3DKPA 3ONEA 5AT1A 1SXJA 3QKRA 5IULC 2RGAA 1FJXA 1CS4C 1BAPA 2JIZD 3Q7IA 5L4SA 3TTSA 3NGLA 2YY6A 3R4VA 2O2JA 3FZGA 2R6CA 4ZVNA 1YQQA 3LT1A 2A8YA 3QBDA 2DY1A 3ITEA 5CNMA 4OHYA 2FXIA 1A5ZA 5B3JC 1GL7A 1QHGA 2BGWA 1ZX1A 2FEPA 4KSYA 4QBKA 1T8WA 2QRGA 2H2FA 2P5SA 4J16C 3V7WA 1XCJA 3YASA 5FBZA 3VPHA 1SQGA 2EF1A 4XDYA 1Q84A 2IHBA 1XJ5A 3NHSA 1P2GA 1JSRA 1PR4A 1TA9A 1KQPA 2VPYA 2ZUVA 3FSGD 3WL3A 1U9JA 5DN6A 5A6SA 1USWA 4K26A 2GFHA 4X6LA 1USIA 1UPTA 2IYUA 3NFRA 3B5JA 2XCUA 4EK9A 1U65A 2FE1A 4U3JA 1KQOA 4OFBA 1CR6A 2X0EA 1EVQA 3AEUB 3PJEA 1EWRA 1HI9A 3HFSA 3GFBA 4AJOA 4BMDA 1GL3A 2MINB 3Q7QA 3E5HA 3OT1A 4QBTA 5LA6F 3ZY3A 4D74A 4YECA 3UJHA 1DOAA 3KHUA 1O6FA 5CVTA 1TM1E 4BZZA 4YJKA 1D03A 3GQBB 2HLHA 3OE5A 2JF0A 1G60A 1JLKA 1ZU4A 1TM7E 3SZMA 1V1MB 1CDEA 3LUPA 5TF0A 4RACA 3HCDA 3CUVA 1P6UA 2YRWA 1RBYA 1GVNB 1EEHA 2IUSA 5DW0A 2DBVO 4E7OA 2VA8A 2FR8A 3CNLA 2J85A 3P2IA 1ZH6A 4R3WA 2P0AA 5B1EA 2Z8YM 1GZ5A 1TM3E 5KO2A 3QEOA 2WYWA 2B9VA 1E69A 3BBPA 4PPQA 1BD3A 1Z82A 1JE1A 1JQBA 1N9GA 1W87A 2Q1XA 5B2ZA 1KIMA 3WLRA 4F3KA 1T2DA 4D42A 4O2AF 1XHLA 3DW1X 4J3NA 3VPFA 2UVPA 1IWBB 1OIVA 2V0NA 1KVRA 1COWD 2WTUA 3PFCA 3T95A 2GBPA 4HGQA 2ODTX 4MZDA 1JAIA 4TPKA 1HDYA 2E89A 5BMVB 1Q57A 3DE4X 1XQYA 1PJSA 1PNTA 1I10A 1O87A 2WJJA 2XUPA 1IBRA 1QHFA 4R2HA 3KG2A 1WW8A 3S2UA 1H4TA 2EL7A 1ZP6A 1FFBA 2FFAA 4P84A 4DRXA 4PQEA 4B3DA 3QVWA 1MZPA 3LQYA 1TW2A 3RRBA 4AJEA 4MIOA 4Y9DA 3AHJA 3GLHA 6GPBA 5K6AA 1F1JA 2VDQB 2Z4RA 3EGEA 4LJ4A 5HRAA 2H11A 4H3KB 5I7SA 1B23P 2BZSA 2FRDA 4BX0A 3KEFA 2ASVA 4DIOA 3BB3A 2CZQA 2VEOA 2FZ5A 1JMKC 4HYYA 5CH8A 4ZRDA 3IO3A 4Z9FA 1WXGA 2PH3A 1SRRA 3HXPA 2ZRBA 4DNOA 4E6PA 4I4LA 4CIAA 1G7RA 4BN5A 3QEAZ 3KR1A 1QIJA 2B8TA 4XJSA 4ZQFA 5AM1A 3USES 4G0VA 1KY4A 1TADA 4JKOA 1B00A 2CKDA 4OK3A 3HJRA 3TGLA 1M8FA 2R4QA 2JKZA 4RVCA 1E20A 3FPSA 5DM1A 1L5SA 1QYDA 4EKEA 4IICA 3EBPA 1JTEA 2W2OA 3DDCA 4Z0PA 4UTNA 3A4VA 4ZVSA 4NYMQ 4FD3A 2EHDA 1W4ZA 4I9NA 3RSCA 3U3MA 4N8DA 4LKOA 1QHHA 2EBUA 5EERA 1K6MA 2I3DA 3QPWA 2W22A 4YJFA 4WCFA 3CUKA 2GASA 2YX1A 3INGA 1FSZA 4LRYA 3NOXA 2ZTHA 2DPMA 4CIBA 2Y1GA 1MEOA 1P7VA 1QGED 3AUFA 4QFMA 3WGVA 2ZIEA 2FSHA 3G2LA 1NMZA 2IPLA 1TMYA 4GX1A 1CDZA 5CHYA 2C1EA 3QYAA 3STUA 3G2PA 2MIIA 4HNUA 4XCVA 2V5UA 3HA5A 3C6MA 2IBMA 3HCNA 3OPYI 1BE0A 2NW6A 1EFUA 1N5OX 3DDWA 3N0TA 4K9RA 1SVWA 1PKEA 2C54A 4D2IA 1A7KA 4LX0A 4N3BA 1V8ZA 3KB6A 3DTYA 4R69A 3CVUA 1OKKA 1BJRE 1PZGA 2NG1A 3RVKA 1AGYA 1KF0A 3LGXA 3R6WA 4RFLA 4GI1A 4MWDA 3WIUA 2XQFA 3UYLA 2O05A 5CT4A 3NIGB 3ONDA 4CMHA 1OXTA 4NARA 3N3AC 4P0QB 2HLDA 2WD7A 4G81A 5HUJA 4JLNA 5D7NA 3W2TA 2GPSA 3LE8A 1LDNA 4N7BA 3VDRA 4EZEA 4YXWD 1DKNA 1UC5B 3D2AA 1XRPA 2OFPA 1NIPA 1JA9A 1E2GA 1DWUA 1DAPA 1NXVA 1T1SA 1X3SA 2C7GA 2XGGA 4OU4A 5GONB 5E3IA 3N70A 1KRWA 3HXLA 2FSPA 4H1TA 3SYKA 1P9LA 2X58A 2D1YA 5ECDA 1ZIOA 1T29A 3NNDA 5CXQA 5C7LO 2CHGA 3KQTA 4ZVTA 1NXQA 4IXDA 1K4KA 3THOA 2XB6A 3VYRB 4DCMA 1TE2A 3CG0A 2W2LD 4CN8A 1N5KA 3C24A 1QNFA 3B78A 3E53A 3ONFA 5G1NA 3D0RA 5JRZA 1B8UA 4MDFA 1MGOA 4D98A 3OE4A 1ZGCA 3B5EA 2EKLA 2XDQA 3FWKA 4RKQA 1Y1KE 3FYSA 4KZPA 4G86A 4IX1A 2AMLA 2QTCA 3ZHZA 1M5RA 1LBEA 5DI3B 3I04A 1U28A 3AXTA 3BOSA 5ALMA 2FPPA 3DFZA 1ID1A 4JSTA 2HBRA 2BR3A 1JHZA 4PWZA 2GJ4A 3D1LA 2X8WA 1F2TA 4IMRA 4P3OA 4PVDA 5IP5A 1PV2A 1R37A 4JXZA 3T5DA 4IJ6A 4ZQCB 5EMMA 3HO8A 3TD9A 3UMFA 4E3WA 2ONJA 3TBKA 3THXB 2R87A 3I34X 3QKSA 4MLZA 2XBLA 4LISA 1YB7A 1X2BA 1RAFA 4V24A 5EJAA 1IVNA 1I30A 4PZPA 2GEDA 3TPCA 4BV2A 3GCDA 2YBEA 4D99A 4BP1A 4F1JA 1IUNA 1JNYA 2OG1A 2PY6A 2WQZA 5B6PA 1QGOA 1FLAA 3HL0A 5BW6B 2YXBA 1GSHA 4JUIA 4MV8A 1JIQA 2HU7A 5JXWA 1H4VB 3D3QA 3EQ6A 3WVNA 2WU1A 4PNPA 4QHTA 3LY8A 4D4MA 1JYSA 2LTAA 3GJ5A 4JJIA 4CG3A 3EB9A 3ZS9A 5I7UA 3I01A 2DR3A 3PYMA 4PRYA 2UVQA 2V7UA 4LXYA 4QPZA 2ZWVA 1VHTA 3WRYC 3L46A 4ARAA 4EG1A 2VYVD 3DFIA 4IIFA 1HDEA 1VJCA 1RLMA 1OFUX 3JCZA 2MOKA 3W79A 4P5PA 2P3SA 2CHEA 2R1TA 1BE1A 4RV9A 4RAOA 3WLTA 2CFTA 2C96A 5HZGA 1PP4A 4RD6A 2WKRA 2QMQA 3V3KA 3JQEA 3ZDZB 4V1CA 2WB2A 1ZU5A 1G41A 1Z25A 2AR7A 3TKAA 2VP6A 2YFQA 3AF1A 3BEOA 3IE0A 4Y9UA 3PQ4A 3EMBA 4BZWA 8GPBA 4R8KA 5JECA 1N7GA 1VHQA 3TH5A 4Q9HA 2C5GA 2XMZA 1V96A 1ZOOA 4QQNA 4HYEA 5BSTA 1KBQA 2CYAA 2COUA 1GG5A 1WBJB 4HFNA 4G5GA 4OHFA 2PSHA 3PDWA 1TQHA 2I7CA 3UXMA 3OIWA 4KRXA 4A03A 2OZEA 1WD5A 1F12A 1UOPA 4Z0HO 1PGNA 5HUHA 4GF5A 1NF8A 1Z2CA 2ODAA 5HR5A 2O7RA 4B3SB 1C3LA 2Y6UA 1I6MA 4OFZA 5CM8B 1FBTA 1MN6A 2ZIFA 3L1UA 2HF8A 2Z5VA 4H77A 4UEKA 4ZCPA 5DT2A 1SCBA 2G7MC 2D54A 2X2PA 2CNNA 4IXNA 4MROA 3W6NA 2B36A 1RJFA 4B3TB 4CEIA 5KAPA 4PQRA 4AJ2A 2V7QA 5BYKA 4IO1A 1NMSA 3BMCB 4JP3A 1T24A 3ZS8A 5HTOA 3QV1A 1N6KA 5FHRA 5F3DA 1HE2A 3WP1B 4EHAA 4JKYA 1U6IA 1PFYA 3DM5A 3U4AA 2ORVA 3WBFA 3KSMA 1AK2A 4V0SA 1EP3B 2JVIA 3R75A 3RF6A 2WG0A 4FBLA 1FLDA 5EZQA 1JTFA 2YFHA 3UK2A 4LRTB 4YIHA 5KVAA 4IEFB 1JDBB 2DHDA 4E5SA 4MNTA 2CNWD 2OE2A 3C70A 3P0FA 4R54A 1ZPDA 4PAQA 1E2LA 1X9IA 2Q3FA 4BV3A 1C8BA 2OXRA 2G9RA 5KYYA 1VSQA 2JH3A 2OFWA 3WY9A 4AQ7A 1LGYA 5JAUA 2FQXA 5EEGA 4RIIA 3IEXA 4X97A 4BL5A 4OQNA 3GMTA 1RWNA 1UMDA 1A9ZA 1YRQA 2LZ0A 3ILVA 2BKUA 4C7KA 2Q9AA 3WHPA 1QCCA 5JJIA 3RU9A 2C2OA 4B3JA 3L41A 4FZ5A 2VPTA 1Y6FA 4BDTA 4OKSA 3S5UA 4LF8B 1OJLA 4CTJA 3D8UA 1N9ZA 4YMLA 3PZRA 3GJ0A 3AKZA 3LY7A 1OTXA 1SK8A 5FPPA 3VH4A 4F6RA 1UBMS 3AEQB 4LGCA 2NADA 3HJHA 4RM3A 5EQJB 4ZJPA 1E0KA 4Z0NA 1JEYB 1NBME 4K9LA 2PIAA 1SCUA 4YMVA 1YDMA 5CPFA 1XVIA 2YFYA 4JCCA 3KUDA 4YRIA 4Z2AA 4G0YA 4M22A 3DH0A 3B7PA 3IB3A 2VK1A 3ZWBA 5KSPA 2XUDA 4TYQA 2XAAA 1CCWA 4I3HA 4DN6A 1AJEA 3QLTA 5LUAA 3DLAA 4PFQA 2HL6A 4US2R 1BNCA 1P73A 1KDRA 2EKDA 2EJVA 4WFIA 3UMJA 4WOKA 6YASA 4JAVC 2F1OA 1PQPA 3GRZA 2RBEA 1BMFA 2WEKA 4E5MA 3TPFA 4MKGA 1ADGA 3ETGA 1YKSA 3CF2A 3Q5GA 1EB9A 3G7SA 4WXRA 2PZMA 3O82A 1NVDA 3WNVA 1ZHOA 4TL7A 2I6QA 4RTRA 1P74A 3EMDA 1PQ4A 3BF7A 2YJ5A 1WCXA 4JEMA 1E79D 1WHSB 3NYWA 3GPBA 4TMFA 5D3ZA 3VAYA 3MJEA 3OURA 2I2XB 3B2NA 4GM4A 1DINA 3VPDA 1WCIB 2ABWA 4N3GA 2DF8A 4FHZA 3AL0C 3C48A 4B6GA 4N41A 2GWRA 4RV4A 3EA0A 5ALZA 5K45A 4PRLA 1JBQA 2Q0SA 5CEEA 1GL6A 3IOYA 4WE3A 3PKIA 4NJEA 3NW9A 3PCXA 1YNSA 3N59A 2QTLA 2H92A 2HJVA 3AM4A 2ORYA 5H7XA 1SOUA 4YT5A 4COKA 2OHOA 2W6PA 5KCZA 5CIQA 2NVUB 1WRBA 3DG9A 1BHSA 1N8NA 1ZRSA 2QORA 3C14C 5B1IA 4DILA 1BXRA 2CXQA 3GDHA 4MJXA 4EABA 1Q3HA 4J07A 3DXXA 5CXXA 4KQFA 3QX9A 3ELDA 1SB8A 2IS6A 4KX3A 5F3WB 1YONA 5DHPA 4NJMB 1IHUA 3H8SA 3JAWB 3VBEA 2HIMA 3TQTA 3THWA 5KKCA 1VIVA 1K68A 4N8EA 3LF2A 5DOVA 1BH6A 4L6IA 4MRVA 2R62A 3T41A 4BJ6A 4D02A 3AUSA 2PXCA 3P20A 4EFDA 4B9EA 4R0MA 3THYB 2C2ZA 3QEJA 1USVA 1LWOA 3SICE 3QNUA 1MF7A 1M8GA 2FW7A 5AHKA 5HIIA 4KGDA 2BEVB 3L0SA 5C5CA 1CIJA 3OQ1A 4M38A 4N82A 3UJCA 3ZWDA 1UIRA 2BISA 5JATA 2OHXA 2ZYTX 3V4SA 3DULA 2G6BA 3A06A 4MRAA 1KQFA 2XQVA 2IDMA 1F8UA 2P11A 3CT4A 4ITVA 5BSFA 5JARA 1ZWLA 2CJWB 2H65A 3C3KA 1JSXA 3KPJA 1V6AA 3NFYA 3N6RA 4X63A 1CP3A 2V97A 5JCZA 3ASYA 3PHLA 2ZRGA 1VHLA 4XCQA 5FNVA 3BMNB 3JYHA 2AOUB 2GNOA 4EPXA 3FUVA 3OESA 5C1PA 2JG3A 1LDMA 5F21A 1ZCFA 3WYAA 5I4KA 2G76A 1YO6A 2H2GA 4ZQGA 1WY5A 3T0IA 3NALA 3GP8A 2QWXA 1X86B 4G8BA 3KYCB 5AJWA 4RMNA 3FOAA 4AZ0B 4Q7MB 3K0FB 2YJGA 3KSDO 4LFBB 2MYPA 3RUDA 3A2KA 4F92B 3CINA 3E18A 3EUFA 3IVAA 4HZGA 4TS4A 3KTAA 2LKCA 2HBQA 3TDKA 3QK7A 5M2QA 1UEIA 4JBIA 3W1EA 3JYPA 1N9KA 3WNCA 5CB0A 5DM4A 1DCMA 5C35A 4NFHA 1OWPA 4WXPA 1BQ4A 2FSUA 4LIPD 1RQXA 4FT4A 1YGPA 4DLKA 3SU8A 1E0AA 2XUJA 5ER9A 5T41A 1ZNZA 3NBAA 4OM8A 5AOBA 5CW2A 3HVUA 3JD1A 3M2TA 5E1BA 2P69A 3L4EA 4D4HA 2PS3A 4HDNA 4EI7A 2IOFK 4TQUS 4NYMR 5I3CA 1O95A 2AMYA 1Y7IA 1UF9A 3GHYA 4IIUA 4Y6RA 3UMRA 3RS3A 1XF1A 4XQ9A 4MWCA 2CK3D 4WJKB 1I33A 4XXHA 5KX5F 3W78A 4WLUA 3PE3A 5A3QA 1O8BA 2QSZA 1KYVA 1TUBB 2GRAA 3MFYA 2JFQA 1DE0A 4Q3AA 2F8LA 3LCRA 1DQNA 3IMGA 5FBQB 3LECA 2IA5A 3O21A 3O4FA 4RD0A 1D09A 1H8HA 3L6BA 1II9A 3PU6A 2EJUA 5JXIA 4QE3A 2D3TA 3ZX4A 3OP4A 1E5DA 2SKDA 2R66A 3EA4A 3LXUX 4NLLA 5JZSA 1EXDA 3MGBA 1KRXA 3NATA 4MVJG 4OMUA 4DQKA 1RQLA 2XSZD 4FFVA 5CITA 1YB2A 2DFTA 2PKCA 3WL7A 3LDFA 1O1YA 1JX6A 1EDZA 1N92A 3BTSA 4RHEA 1FFSA 5K3CA 3VR2A 3MLEA 1WB9A 3A6PC 3OKPA 2Q5FA 4JUFA 2QN3A 4GU5A 4AY6A 2FETA 3EXIA 1Z5OA 1GD1O 3EJ6A 4CIYA 5ED4A 1LBTA 3M49A 4UUQA 1WVIA 5E7MA 4YYZA 4B71A 1KMNA 4JITA 4U7TB 3H1TA 3ZD7A 4I9GA 1QE0A 1ZD9A 3ET5A 3VR6H 3OLYA 1M2EA 5AVJA 1VP3A 2B4KA 2OBFA 1QO0D 1OOEA 2A1UA 2O2CA 1E1QA 3L7YA 4RZXA 1C4KA 5G53C 3IJ5A 2ZWAA 2W6CX 4AWXA 3DV0A 4Q6WA 2OGSA 4NK5A 3E5RA 2GCOA 1OWMA 3ZHOA 4A8PA 2NV6A 4EDFA 4EYKA 1BMQA 4NCKA 4FLFA 4JD5A 5GOTA 4YDSA 3AVYA 1C0PA 1Z2AA 1WEHA 2ZAOA 1CUSA 1ULUA 3L9WA 3U37A 1ZG3A 1Q5PA 1P0MA 3KKNA 4CFZA 4JUCA 4XGKA 4ZYXA 4OHMA 4IUDS 4K2AA 2IH4A 2AZDA 5BWCA 2GAJA 2WDPA 3FSJX 3WJAA 4AYXA 6NULA 1ORIA 1PZMA 3L1HA 3E22A 3TVDA 1JXAA 5EFOA 4QUDA 1J20A 4Z0TA 3SDZA 1JLSA 4WCDA 5TQ0B 2HC9A 4OQZA 1U6KA 3LRPA 3IQXA 2YY5A 2H54A 4ZMRA 1VOTA 3VRHA 2OWDA 1XMOB 3ABIA 2BZ0A 1H2YA 2QAJA 4JUDX 3RYCA 1KQGA 1FVHA 4JBGA 4O4IA 2IV3A 3U7FB 1J00A 3VU9A 3W8FA 5CDSA 3ND5A 1ADCA 2YZNA 5JY6A 3PXXA 1V16B 5EQDA 2XIQA 5BR7A 3DEFA 4Y6OA 4UEWA 3WRXA 2A0UA 2XUAA 4DCJA 3AR2A 3LKVA 1CY0A 4FCCA 3FOWA 1EFLA 4O08A 1W2WB 1OW3B 5ALDA 7MHTA 1GQFA 1V9LA 1TAHA 4LMPA 4S3MA 4Z4FA 5AI0A 1ZIDA 4ZPJA 2YTZA 2R00C 4TXNA 2PCJA 2H6EA 3SSMA 4C29A 4BN4A 2I8AA 4KWIA 1D1SA 5DNEA 4ZCQA 2FAXA 3P9YA 2BAGA 2P4SA 1DBRA 2DU8A 4QDKA 2FWAA 4PSAA 2YFKA 1YMQA 4UULA 1EVLA 1ZUNA 5CPBA 4DV0B 2EW8A 1EA5A 2B21A 4GMDA 5DHTA 1T2UA 4DRZA 5MGNA 1SVUA 3KRTA 1IH8A 4DKXA 1ZOLA 4MRNA 2B5OA 1HE4A 2YWCA 3KKQA 4W6ZA 1TZBA 1ZH2A 1OBVA 1ZK2A 3U5TA 4FKBA 1Y6GA 3RBAA 1ZINA 1B6GA 2XE7A 4YUWA 1OI7A 2HQ1A 1U7HA 2FH5B 2GK4A 3IX7A 3M1YA 3PC8C 1XXLA 4YGXB 3TCKA 5AW4A 4MMYB 3K9QO 4U5XA 2O8EA 3FF1A 4PN7A 2I4TA 4RKWA 2FPRA 2P4EA 4XM0A 5DGDA 3A10A 4Y8VA 5KNDD 4G41A 3W5IA 1UJ2A 4IPTA 3TNYA 1L7OA 3MWDA 1NONA 3W1WA 2I3ZA 3HWRA 3ZHTA 1MB3A 2JBHA 2FKNA 4S1VA 5JPDA 5C51B 2G77B 4ZO9A 4JGIA 4FGKA 4K9NA 421PA 3ZIAD 5BQ3A 1WBBA 2Y2UA 2CHQA 3QVUA 1M2VA 1Z5PA 1HNNA 4KFTA 3V3TA 3B82A 3Q7RA 2WZBA 4UNRA 3OTWA 1ZK3A 3FMGA 1QH9A 1XI2A 3DQZA 3RS0A 5DP2A 1QGYA 4ZC1A 5KJ1A 4OQMA 1K6XA 3IP8A 1EGHA 3W5CA 1HWYA 2WJYA 4ZYWA 3EVNA 2HN9A 4UU1A 1QRSA 4D45A 2XB2A 1VL2A 5LFAA 4FHGA 3C3XA 5DXAA 1GILA 1NJGA 3DKVA 3HM2A 3IESA 3KBBA 4BAUA 3C5HA 1MO5A 5KNCH 1CRZA 3PGKA 3TRKA 5IH3A 4FGUA 2VDVE 2AG0A 2BD0A 3PP8A 2G82A 3RFFA 1SIBE 2C04A 4DC0A 3IAEA 4AJ4A 1KJZA 5E6RA 3NGXA 3F4KA 3GF4A 4BP3A 2ENWA 3KCNA 5FFMA 5IUKC 4E51A 5KTSA 4IIJF 3CONA 2V6IA 4QJ5A 3AY6A 1F4PA 1U7XA 3R0XA 2GAAA 4CN9A 5EIXA 3H2BA 5FPQA 3AUTA 2JC3A 3PUYA 5KB3A 5LDHA 5KSYA 1L3CA 3L6RA 4MUAA 3UC9A 4YAGA 4G5HA 3D54D 1VLVA 1WF6A 2N46A 3T4XA 4JEIA 3S40A 2AUNA 1YQTA 821PA 3NEJA 4XARA 5JC8A 1H5QA 2XCLA 2LWIA 3UMBA 1KYWA 3AW9A 1OZHA 3L1IA 1J1IA 1J5XA 4P3YA 4PXAA 5BVGB 5HZHA 1QQAA 1H1LA 5KQMA 4NPAA 4C0HA 5JNTA 3MGGA 3EN0A 3P94A 3FPJA 4GRDA 3TLKA 1J0EA 2HA0A 3GIDA 2QUIA 2AE2A 4BYMA 4GPZA 1B8OA 2Y4NA 3ROTA 3RU7A 3W06A 4PRKA 1AMUA 1W4LA 3U4QB 3A3YA 5GVRA 1EGMB 1X87A 4UHDA 1MB4A 3U3RA 3IFSA 4LRWA 3HV0A 3C8UA 3D3WA 3LD9A 3MWJA 4OQPA 4Q3LA 2HF7A 4AZWA 3AVUA 1E2BA 4TLEA 1ZBDA 3BTUA 3BCSA 1JHAA 5D3KA 4PX2A 2WLSA 1ZZGA 3SJUA 4AJ9A 3QU9A 4RCZA 3LJKA 1U0RA 5F2OA 2IDKA 1NNEA 1GHTA 4CTOA 3OVMA 1XZNA 4ZOLA 1S3IA 4A3SA 2J5BA 4R98A 4Y9SA 3ROGA 5GY7A 4H17A 1T35A 3UAYA 3A32A 1AKVA 1L7VC 4K1XA 4MUGA 5A9TA 2VLBA 1AF4A 1XZQA 2CSUA 4OM7A 1Z4KA 3L7IA 3TD2A 4KKXB 1AS3A 3TIVA 2IOHA 2NSYA 1FFCA 4L6CA 5DK4A 5C4MA 3WNQA 3GUUA 4RWZA 4D41A 1BCRB 2G17A 4ARZB 3GRYA 4CKZA 2QW0X 3F6RA 1WXEA 1XTUA 1IXSB 2JJ2A 3EY4A 1CP2A 1JG4A 1Z15A 1R6AA 5HPYB 3BH6A 4HSGA 3U2QA 1E3DA 1LVUA 1X0VA 3H5RA 1G8AA 1PGQA 1RCTE 2G9VA 3WP0A 1TEHA 2PLFA 3K92A 1U8UA 1AUXA 1BZYA 1NG1A 4HNAB 5BSVA 5G3YA 1XZIA 5IEJA 3O74A 4Q39A 5SY4A 1E62A 1TU3A 4I9UA 2FPXA 3SZRA 5IHXA 1URPA 4N5MA 4LJYA 2V54A 4PXYA 1TJYA 4POAA 5M5BA 1M1YA 3PQFA 4E3ZA 2ANCA 1WMAA 4LMBA 3I9LA 4Q9DA 1GTL1 4RY2A 4EF5A 2PGOA 3AJAA 4F1KA 5LP6F 1OWNA 3QNMA 4YTEA 4BQQA 4F5DA 2WFLA 2EJWA 1ESMA 1JDVA 2CN1A 4YCDA 1P5RA 3LHIA 1XWWA 4HYQA 1EFRA 4R81A 4X66B 1JLLB 3KU4A 1P1FA 1EHCA 2CNOA 3VR5H 621PA 1TRKA 2WSBA 4ZT7A 2W90A 2F3QA 3A28A 3KE9A 5CYGA 3OFKA 4GPIB 1GZSA 3IXMA 2EEPA 4Q47A 3RSHA 1FS5A 4Z86A 2L42A 2G08A 1BG6A 3VNAA 3H84A 1NUUA 5JSHA 1EDDA 3E5MA 4KLAA 5K7SA 1XF9A 5JBIA 5AVZA 1A2BA 1ZKMA 2PZGA 1E5LA 2VXOA 3AUUA 5H82A 3RUIA 2I4NA 3VGPA 5F1PA 1Z47A 5AW7A 3VJRA 3N3BC 1QDEA 3NCTA 4GQAA 3VJLA 1ZEJA 2H7XA 3B1ZA 5BYJA 1EXMA 1EBBA 3ENQA 3LXXA 3IR7A 1WDKA 2YV1A 1UINA 2BGNA 4MWTA 2CDAA 3SIRA 1NQAO 5INTA 4CCYB 4M89A 5FOVA 2ZK7A 1W4AA 5EJEA 3GRKA 4BLPA 4HT3B 1KAMA 4NBVA 3SBXA 3WYDA 1MO3A 5K3EA 2QTVB 1T4CB 2XE4A 2ECPA 5J63A 2FDXA 5LU8A 4BVJA 3VVCA 4ZVOA 3O7MA 5IAJA 3R0VA 4HZUB 1P9WA 2BBSA 3IERA 1GYQA 2R1UA 3DCYA 4KMRA 3VSDA 5JCJA 1L7XA 5DWDA 1PL6A 2OYRA 4CGZA 4GSLA 3IAHA 1KP9A 2D2FA 2ZBGA 3PEUA 5I9NA 3FAZA 1RAHA 2WSIA 2OCKA 1TUIA 1YD7A 4JN6B 3T6KA 3NEYA 1H6BA 2DB3A 1RMYA 1MUUA 1FMJA 2PFSA 1FW8A 2PKYX 3JQ8B 2IYNA 3HR4A 2GDZA 2A9OA 1NFQA 2QR5A 2C2WA 5JDIA 1BDJA 4HXEB 4BEWA 5EC8A 3NWEA 5A0FA 3RS5A 2QUZA 1SXJB 3QKRB 1CJTC 4UBKA 3WKEA 3ZPXA 4ZJZA 3T7JA 5KTYA 1RC1A 2PRZA 5ADUS 3IUNA 1LTKA 1S2IA 2OV1A 3PX3A 3B38A 3ICWA 4CKXA 1Y7HA 1V7ZA 2VQFB 3KDAA 5JNUA 1EFVA 4RULA 2D5IA 1BSVA 1RKBA 1W1IA 2W0MA 4OU5A 3MTAA 1Q50A 3G3EA 2VRNA 3VNRA 4ID3A 1L6RA 2WSSD 4P32A 3RT1A 3H5VA 4AZTA 3DEIA 3BK2A 4KR6A 3HN7A 3GJXC 4BLRA 3ULKA 1VTKA 1T1EA 5A6SB 4ZZ1A 1G6HA 2QUAA 2UYOA 4AULA 3I8SA 2Y0BA 4Q4DA 1ZCBA 2YXPX 1RWQA 3DWIA 3FY4A 2CEAA 2B3TA 2GGSA 1C14A 3OJ0A 1AIPA 4U3JB 2DPYA 2Z8YA 4DR4B 3IO5A 3EGIA 1XAHA 3BGWA 4Y1EA 4CQMA 3K6SA 1Z7EA 1XZFA 3OT1B 4L08A 4KQIA 5AHXA 4ZJUA 1QTNA 2V55B 1KIAA 3NG1A 3T7TA 3MF4A 2DT8A 1IVYA 4GI2A 4QU0A 1N2JA 4R1TA 3W77A 1NVXQ 4HS9A 1P6QA 1VECA 3MMSA 3ZGYA 5I7VA 1QFMA 3UUWA 2QPTA 4MVJF 3MTDA 1XB2A 2IW3A 5TF4A 1QIMA 4YY3B 2AWNA 2JI4A 1V1RA 1NVMB 4PHCA 3K1AB 1IOLA 4E14A 5A6VA 1SBTA 4B4DA 2R48A 4M7WA 3KJXA 5ALHA 2F1RA 2RG7A 3HJBA 4RSMA 3L84A 4LJSA 2UVPB 1SKMA 2FMUA 2VDOB 3B3QA 1NR5A 3HV2A 1MXFA 2BCEA 4YAIA 3PPYA 2H4JA 1E6LA 2QYHA 1Z88A 1MXHA 4P4LA 2VYQA 1D04A 4QARA 4FWIB 5FL7D 4JKIA 1QVZA 3KD3A 2G0TA 4WVFA 1Q74A 2JAUA 3PUVA 1U3FA 3AETB 1M2JA 1SBCA 3TRFA 3UKDA 2ZRFA 4B82A 4ZVVA 4XD2A 4J91A 3ZCPA 1WZCA 1AQUA 2Q0QA 2ENUA 1G0NA 2GUGA 2R3SA 2IHZA 1NJ8A 1CQZA 1NLMA 2I6FA 1NF2A 1XOIA 1T6BY 4FHFA 4YDHB 1OXXK 1KZ1A 2X76A 4BNXA 3H1PA 3PFBA 3QE2A 2P9CA 4HATA 1TD1A 4R41A 3W0LB 3GFTA 3O0TA 2RGCA 1H2ZA 2A84A 2QMHA 2GRJA 2KJQA 2PUHA 2GCIA 3S8MA 3RIHA 2I71A 3NIWA 3CKLA 4L15A 3SIPA 1LF5A 3GFRA 5FWXA 3SEQA 4L3VA 1AQIA 5FTWA 1J8MF 4UOQA 1Z2NX 4HNRA 2IU0A 5KOIA 2C3UA 2JIZA 3IDZA 1P77A 4Z4HA 3T3OA 1YT5A 2WF9A 3BXZA 3JWJA 3PGJA 1ZD1A 3L4JA 1I94B 1E2DA 5BYAA 4YRQA 1R27A 1RTTA 3REGA 1XP5A 2OV3A 5ED0A 3A36A 2QL9A 3L7CA 5KWVA 3BH7A 1QHHB 4JMPA 4S1WA 4P5DA 1JFTA 1X8LA 4J0HA 2Z83A 4Q1VA 3AP3A 4YJFB 3PEWA 3TVYA 3KXDA 5ALVA 4N0QA 5BW4A 1O8CA 3PPIA 1QRAA 4HB0A 3FUXA 4KQ2A 3ZHXA 4BLUA 4GOXA 4UQLA 4AO7A 4X65B 3FSGA 5FLXA 2AW3A 1GYPA 5FO0A 3SLRA 4YAKA 5CA0B 1IN7A 1PFQA 2GJSA 2ZRNA 4IXMA 2XUQA 2YZKA 3L8ZA 3R74A 3TLJA 4DHWA 1E1NA 4R9SA 4NMHA 3OCUA 2VAVA 2UU9B 4YT2A 2YNMA 3EH2A 5JCXA 1JFLA 5BR4A 1F2DA 4H7EA 5KJFA 4RHUA 4HADA 4Q4LA 1NXSA 5FULA 3G8CA 4ZAFA 4CQJA 2C7BA 1YDEA 4B40A 5D86A 2XA1A 3CQ9A 4X1OA 5EJ2A 3I61A 3PXBA 3BB1A 1GPAA 1PSZA 2QM3A 3EHDA 3W7BA 4DDVA 3C3PA 3O2NA 3E9RA 2P6UA 1EEXB 2B4YA 3IAUA 4GX5A 3E82A 1NNLA 2WD7B 2WA1A 1YV9A 4HTAA 3WE7A 1B74A 3B89A 9LDBA 4GBMA 4CTKA 3JD2A 1I3NA 4ID9A 4IS2A 2VR1A 4N7RA 2PRJA 1BYUA 2FR1A 3WAJA 5ELMA 1KEPA 2BGMA 1KH3A 1W5EA 1YI1A 2G0NA 2P0EA 3FCOA 4KUGA 4NMMA 3S70A 3NX4A 4HYTA 8ABPA 2ZITA 4EG5A 2PX4A 2QNIA 4PLPA 4XJTA 1USGA 4RIGA 1TPYA 4ISCA 3KJGA 3FCUB 5FI0B 4CBVA 1COWA 1V9CA 4DFDA 1BE6A 2RI6A 4OQ4A 5FO1A 1L2TA 1ISSA 1HOXA 1BJKA 2GJ9A 3JQGB 3JD4A 1DKQA 3PNSA 4Y67A 3ZVMA 3V9AA 2XDQB 4UVIA 3T7AA 1YS7A 1M6EX 2I80A 3RNOA 4EG6A 5AKEA 4OO3A 1DZ3A 4YGYA 4KNYA 4RPKA 3LWZA 3F5SA 3GWGA 4Q9JA 3NQ41 2VPPA 1RPNA 4RPLA 1WXDA 4JR0A 2EGUA 3P2MA 4HAOA 1N5RA 4XFJA 3ZU4A 3QKSB 3LCVB 1XAGA 1QYWA 1NUHA 1AMOA 1Z0SA 3JWEA 2FP4B 1SC1A 3RFUA 4IILA 3O4VA 4O4HB 3PA6A 3TDNA 3V4PB 3UJBA 1L4MA 3C39A 1Z0IA 5JLAA 5AUOB 3W5DA 1NT2A 2J48A 3K05A 3RU2A 1OH7A 4E5KA 1IY0A 2Z2JA 1FDRA 1G8YA 3AO0B 3HP7A 4I1VA 4HEA1 1YOVB 5CEJA 4GGMX 1YIOA 1OIXA 2FEKA 2VUSA 3EXG2 1WEKA 2WPNA 4IOLA 4UZFA 1XTQA 3TZHA 3UXHA 1J7JA 2WYVA 2P9ZA 4JI0B 1LV7A 4PSDA 4PR3A 4KU4A 2VZ8A 3U1BA 3MRVA 4YP9A 1I3MA 4NZPA 3SOZA 1X8XA 1ZGHA 1FP1D 4WCVA 4CF5A 3OZAA 4Z4CA 2GSDA 2NLOA 1FTYA 1RRGA 2ZB7A 4XEHA 4Z3KA 1UT6A 3A37A 5B1YA 2R1TB 3ADCA 4DLYA 1EUQA 2FG7C 3C98A 2LDBA 1A7JA 5KNBD 3MAGA 2PTHA 4ZFNA 1NVWQ 3DE1X 3OMWA 3CW8X 4YH1A 4ZTBA 3U9SA 4TZ0A 2IYXA 2I54A 4UTOA 1OB5A 4KMOA 4DZZA 1WMFA 2FA9A 2GJKA 1MQSA 1JB9A 1ZM2A 4CMCA 4F4JA 2VJYA 1THMA 3GWZA 3AL3A 3BIFA 2F1JA 3LBFA 2C9CA 4OAOA 4QAQA 3WWZA 4BKUA 2X8BA 1MJNA 3GD5A 4EBBA 5JE8A 1QE3A 4Y18A 3G7NA 3E1GA 4BE7B 5K8TA 3HFRA 4IP0A 5IAEA 5AOCA 2GWHA 4J7UA 1YVRA 1BCSA 3FPGA 1KFKB 4YXWA 3JXEA 2E6UX 2ZIAA 5GM1A 5LOVA 3CX4A 4FYKA 3PFHA 4Y2XA 1BKYA 2WU4A 4H6VA 2YWRA 4CEIB 1U7TA 1TAUA 1TD9A 2FOXA 1NBHA 3C45A 3CNEA 1AM4D 3IUQA 4O1HA 1CS0A 2EIXA 3ZUPA 3B9QA 4YJDA 4LCJA 4LXTA 1W0KD 2JGMA 2ZSDA 3M6MD 1Q16A 4Q05A 1KGDA 4UJ3A 1EWQA 2HA5A 1JKIA 2W2LA 3IQWA 1BVHA 2HQRA 5BRJA 2BTOA 2ZWMA 3TW8A 5LP1A 5LQMA 2MMGA 1MTOA 3HBAA 4K9KA 1HZZA 3COVA 5IN4A 1JPUA 3RRMA 2ZOSA 3DOEA 1Q7CA 1PF7E 2OBYA 2Q5JA 1YZYA 3MMXA 1X1QA 1E2KA 5ERXA 1VMAA 2H1WA 2DWQA 2WIDA 4YQZA 2H2AA 1ZVVA 4DPLA 4CVNA 3TZBA 2MR6A 1RZUA 5DTRA 1WPGA 4E1VA 5KYYB 3Q40A 3LKDA 5H0IA 1JJFA 2P2DA 2Q4DA 1JHYA 1PR9A 3HN6A 4D43A 1Y1SA 5LLDA 4RTLA 1UMDB 1M72A 5TX7A 2C61A 4HVTA 2ATIA 3GGPA 4Y2VA 4HS4A 3VPAA 4NZOA 2EG9A 1MVLA 3TMAA 4RPIA 4HJRA 1SZPA 1ZN2A 3QXGA 5EPEA 2VKQA 4PQFA 4XA8A 3CBQA 5HUQA 4BGUA 4RTSA 5SZIA 4YUVA 4F6RB 3R9IA 1M75A 4YT8A 3RC9A 1H65A 4X60A 2PAFA 2OZPA 4H16A 3OUZA 4OJQA 1SCUB 5A0VA 5JBQA 3VO9A 4LOKA 4U2KA 1FYWA 4B48A 3LI2A 2MR5A 4RU1A 3HDVA 1Z36A 2QVZX 1OX6A 5H81A 1C1YA 2ZT7A 2M2IA 4L16A 2VYVA 1EE9A 1ZCZA 2OKCA 1FS6A 4E5UA 2L18A 3QBJA 4N9WA 4NEQA 3CEPB 4KXXA 3N8GA 4Z54A 5CFLA 3MD9A 2R7KA 3DTNA 4U4AA 3OD1A 5CYOA 1P8JA 1KARA 1SHUX 4KDCA 3I8OA 2IP2A 4OHVA 3FPLA 1A4RA 4NVRA 3CSSA 1EBUA 2WKWA 4PQGA 4XTRA 1IIRA 4XQ0A 5EL0A 3KZCA 4YJGA 3IVGA 4IDHA 2VNJA 4TSRA 3EDQA 3JVIA 1IXRC 2W71A 4FQ8A 4DLNA 4PYOA 4DADA 5FI1B 3RRNA 4YHHB 1P9OA 4K28A 4TLMB 5EAIA 4YCBA 5B30A 1Q1BA 2H57A 1X8JA 2XB8A 3X1WA 2XA2A 1JQKA 7REQB 5L95A 5AI5A 3I53A 4JLSA 1PEDA 5L3SB 1SD5A 3PI7A 1Y7TA 3DO8A 3IEKA 4DIMA 2P2NA 3AGPA 4NJEB 5D85A 4R8RA 3WLKX 3DLBA 2AHRA 5FL3A 2XTMA 3CZ4A 4IGIA 4RZ3A 4EVQA 2WT4A 4KN9S 4MVJM 4PIVA 3ZOKA 4BFXA 3K6KA 1BXRB 4HH3C 1K5DA 2NV2B 3D0QA 3F90A 3PKJA 1U81A 3WGKA 5BP7A 1Z8HA 3ROZA 4IZ6A 5LBIA 5JXJA 5CFOA 3R9XA 2HMWA 3E3AA 3FCAA 3TBFA 1IATA 5HM8A 1KYYA 4MICA 3THWB 5ICSA 3H3XA 3UG7A 1SUBA 2HEGA 3OEHD 3RDPA 2NZXA 2EBWA 1DWQA 1KL7A 2PV7A 3RVOA 5JAHA 1NZDA 3KOMA 2CNWA 2EKQA 4LDQA 4E2XA 1LXCA 1JB1A 2CLOB 2DY0A 4H60A 3WMGA 2IH2A 3TNFA 2WIAA 3AYZB 3K5IA 1K75A 4XYBA 5FWDA 3BQ9A 3R44A 3D7SA 4J0FA 1E2IA 1IEVA 3LUGA 5E4FA 2ZUCA 4R7ZA 3KQHA 5HE8A 5LLSA 2IY8A 4BZPA 1YULA 1A5TA 2RSLA 2NTNA 1S9DA 2DUMA 2RAUA 1VL0A 2OXCA 2PWAA 3KPVA 3N2LA 4NE7A 4KXUA 4PHGA 3L77A 3ST7A 4CR7A 3Q15C 1XKTA 2Z2KA 4L8LA 1VLHA 5FNVB 2KLBA 1DIOB 4TUYA 1IPEA 2IYVA 1X7XB 3SY8A 5JH7A 5K01A 5KYNA 4A8TA 5DHFA 3CNNA 4DLUA 1ZGBA 1ST2A 4DV1B 2XQKA 5HS6A 3ES9A 3ZVKA 3EA5A 3HU2A 5K09A 4JQOA 1UKZA 3P26A 1SELA 4MV0A 5FKJA 5ECGC 3JQAD 1XLTA 1E89A 3UOGA 4QG7A 2ZSIA 1JKMA 2ZRHA 1WD7A 3OZSA 1YRWA 4ENPA 2JW5A 3QXCA 2WLTA 3CIFA 4JHLA 4PGHA 4F72A 3IUPA 3KJHA 3PWKA 3KTAB 1C3XA 3UHPA 2JFWA 4C3OB 4JFRA 1TC2A 2GZRA 4V0OA 1XQVA 3L7JA 2O7SA 4JGBA 4M8NE 4BQIA 5JMWA 3VO8A 1C4OA 3GUVA 1UZNA 4R7GA 1PZXA 5K3BA 3K3PA 3ZY4A 1TVEA 4CUZA 2I6GA 3VZPA 3ZE1B 4MGEA 4II7A 1J8VA 2QG9A 5JO9A 2W98A 3ZDYB 4PNEA 2FPUA 1CY6A 1MA0A 1M6VA 2FU5C 5AQ1A 3GYGA 2C5EA 3QY9A 3K4PA 5J2UF 1YE8A 4EHFA 1NWHA 4BTVA 4D25A 2JGFA 1ZXLA 1VSVA 2ZGVA 3L6UA 3T9EA 2ZETA 2B37A 4G85A 3L7AA 4QDUA 1E79A 2VAMA 2A1IA 3KR0A 4NQRA 4QBFA 3VR4A 4CETA 1LY1A 5K1ZA 1SKQA 1KH2A 1WV0A 3SQLA 4S1OA 1CUJA 2IIQA 1Q12A 4Z8XA 2C2HA 5C4IA 3R7NA 3OTGA 1OILA 1Z5ZA 3VR3D 3HACA 3IQFA 1I1QB 2I4IA 2C4MA 2HO4A 4ATNA 2RGEA 4RETA 1BN7A 2QXTA 3LL7A 1DAIA 4QT4A 2V7VA 3HUFA 1B16A 1D0SA 2VNKA 4WV3A 4MUFA 4MVXA 2H3HA 3NCHA 1ULZA 3OZ7A 2CJXA 3PEFA 4YI5A 1L8XA 1T3SA 3Q3EA 5LNK6 4GUDA 4LMRA 5D1NA 5LDDC 4XYEA 4YMTA 2JATA 4H7IA 1EWVA 2ZJ4A 4UM9B 1ZZEA 3OZDA 1XE3A 2EZ9A 2J09A 4QQRA 1W8IA 3VNSA 3R5FA 1OU0A 3EW7A 5FTNA 2FWRA 1UZUA 2OHVA 1Z13A 3KQPA 4IGAA 1NVKA 3PL5A 1XP8A 2IYSA 1TJ5A 1QX3A 3EXIB 3TDMA 4CLRA 1BN6A 3ECAA 3GAFA 5F77A 5G0TA 2X4IA 1O57A 1TJ3A 1EVIA 2IITA 2HBYA 3ZIDA 4D8VA 5KQLA 1J06A 2BSXA 4Q9LA 3P9IA 3SHTA 3FR7A 2FN4A 3ER9A 2PLWA 3V8EA 4BCBA 3Q0IA 3PQ5A 2A1UB 4RK5A 4URVR 5KREA 4WWHA 1XNJA 1PBNA 2EIHA 4FDMA 2QT1A 4IF6A 1E1MA 2REXB 4JHXA 3DV0B 3NDRA 4KG7A 5DIFA 5G4KA 2AYXA 2NAPA 2VJKA 2BW0A 4AMYA 2GCOB 1NXWA 1TK3A 1Y0BA 1YRHA 3OIUA 3LCJA 5EIOA 5JWOA 2QOEA 3C7CB 1ODCA 2J0SA 1BMDA 1B73A 2IUTA 1SXJE 3SXUA 1YQWA 2FEMA 4RD2A 4OQEA 2XAUA 4XSVA 4LBZA 1NVVQ 1SU6A 4UUMA 4BLOA 3Q88A 1ZGGA 4UBJA 1VHJA 3CZQA 4LV6A 5T4FA 4J1TA 1WE2A 2CEKA 4PAWA 1Z0DA 5DNUA 3WLOA 4L22A 4DUZB 3DC7A 1VG8A 5CNJA 4QU8A 1I5OA 2DSTA 1L7MA 3E22B 4FNGA 4UMVA 1Y37A 2XYRA 2COKA 4UREA 3KUXA 2JZCA 5JSYA 1PVDA 1RJDA 1ADFA 1KJWA 2XQGA 5IU6A 2EBFX 2QL7A 3ZCXA 4JI8B 2IVFA 4O2BF 4J16A 4KACA 3H18A 4MULA 2I2CA 3ENZA 4JYMA 5HZMA 3RYCB 4O4IB 3GB9A 1U9ZA 4KXFB 1Q3TA 4X95A 4NZYA 3VU9B 4OHCA 4QDJA 1BDHA 3K71B 3JAMA 1Z0UA 4N5DA 2XMRA 2ZFUA 3Q6IA 4PNHA 4WH0A 5B64A 1UXGA 4KI7A 1M34E 1ZK1A 4PW0A 3EMKA 3S1AA 3K5WA 5I3ZA 1E9EA 1GUZA 2WABA 3NI2A 4JP2A 3HB1A 2DFVA 3QHPA 1ZMRA 3K0CA 4OIMA 4WFJA 4MUMA 3CURA 1JDBC 3SXPA 3CUTA 4AP6A 1VPLA 4P35A 4A2WA 1U3CA 3B1VA 3GLTA 2VJCA 3GMDA 3X3HA 1EYZA 3KV1A 4A0GA 4UCQA 2Z2ZA 4J90A 5A4AA 4R8LA 5DWVA 4IIDA 2G1KA 1U0LA 1GNPA 1P44A 2A1TR 2CK3A 2J87A 2NGRA 2PQMA 3LT4A 4UEOA 4LGMA 2FPLA 1N32B 3SE0A 1LRKA 1ZUNB 3A1CA 3F74A 1MT0A 4MDHA 2JRLA 4DE5A 4YRBA 4HN2A 5C2JB 2WUWE 3SEZA 1SKBA 2Z9DA 4PPYA 1H4QA 2IXGA 4JUAA 1E2JA 1K8RA 2PKRA 3D4BA 3I58A 5TV2A 5IT5A 5ARBA 4N5IX 2B98A 4JOBA 1SN7A 1D07A 1XMXA 3HXQA 3L40A 1F2UA 3OPYA 1VCOA 5IWAB 1L7DA 1TUEA 1PGOA 1AC5A 2DMRA 2X5XA 4D79A 1OFGA 2XSZA 3O03A 2WKQA 3TSWA 2O8EB 1OPXA 1WW3A 4LSWA 4RLQA 1XMVA 3SZUA 1MU0A 4J4TA 3KELA 3GVXA 1A0OA 3CFYA 4Y0VA 1T5TA 4LSZA 4PLGA 1U3WA 3TIXB 1N2GA 2Y3IA 3KXIA 1A71A 2YVQA 3L4BA 3MWDB 3IAAA 3OU7A 5GZ1A 1GVHA 5EHQA 1US8B 3FVVA 2KWIA 2ZBVA 3EXAA 3U4CA 1RBZA 4JBWA 4ZCLA 3EZGA 1O96A 1ZUWA 3CJTA 3HI6A 1O03A 1MVNA 2G07A 1V25A 1XNGA 1CW2B 1XLVA 1OBHA 2GLUA 2J45A 2JKVA 3GLHE 4NAUA 1U3UA 3PIRA 1D6SA 3WL6A 4YRAA 1V5FA 3ZEIA 1HLFA 3BCUA 1HFWA 1NFRA 2ZJ0A 3UYKA 4E4YA 2BEUA 3H3JA 3EVFA 3X44A 4F71A 2P6PA 1GGKA 3BWXA 3I6QA 1Q0HA 3EZNA 4FOOA 1IHYA 1OLOA 3O9ZA 4MAMA 4AJHA 2WHXA 4I2NA 2K5UA 1B41A 2H8KA 2VH5R 3EYWA 2ZB4A 5HFAA 1XPUA 5HYVA 1VA4A 5E6RB 3DW3X 1UBKS 1XDUA 3N7UA 4QDXA 1Y8ZA 3CJRA 1IXYA 4P33A 2AZXA 2HSEA 5DSTA 2OXTA 3PX2A 1KERA 2E4XA 1UEJA 4HAIA 4XWYA 5IVKA 3JZAA 1T1RA 5CBPB 3QPVA 5LYYA 4YMIA 3QFRA 2C2XA 1WKCA 2VAWA 1SPXA 5K8LA 5JLJA 1SZDA 3Q41A 1KVUA 4NS4A 4D46A 3ZQUA 4FGSA 3QVLA 3L8MA 5C52B 1XA3A 3HU1A 2F43A 2KBEA 4IDNA 2EWMA 3DE6X 2ES4A 4DR1B 2W2QA 5G0VA 3ZXIA 4QBIA 1TZJA 2HJHA 1ODKA 2RHTA 1NTRA 2QGZA 3AONB 2OBNA 3ZI0A 1EQAA 3IHKA 1D8AA 3COWA 4LFAB 3DVAA 4ADSG 2R68A 4DC9A 2ONZA 1H0SA 3ZWQA 1D7AA 3FTFA 2RBKA 2YV4A 5E3HA 4NBRA 3EDYA 2YWEA 5D00A 3TL6A 1LBSA 2B7LA 4MV1A 2WMYA 4WZBA 4AG3A 3NRJA 2FSGA 3DD1A 3HCPA 2PBZA 3PR1A 1TYBE 1FVOA 3IAS1 4MYDA 4ZOLB 2HRDA 4KHZA 5EGSA 3KETA 4B3GA 4TMZA 1D6JA 3CHYA 5FA8A 1ZBQA 2AIRA 3Q11A 1EE2A 1FNNA 3DONA 1NHWA 2YIJA 4LHSA 4BQSA 1VMIA 4ZOBA 5CLQA 4JVLA 1OH8A 1B6SA 1E1LA 2JHCA 4OXQA 3ZBPA 1KWGA 1JR2A 4U7PB 5KEIA 5M04A 4MTCA 2BMWA 4PZAA 3RHSA 2D74A 3UATA 4ND6A 4BLTA 2YWJA 3DBVO 4Q37A 4Q4CA 1UT8A 2XVMA 2J33A 5KNDA 4YLEA 3LRTA 3T5MA 4BQOA 1X13A 1U90A 3PVCA 3RREA 4ZO6A 1ISPA 1FSFA 5P8WA 3UN1A 3SS7X 2CXOA 4EYQA 3MYRA 1JDUA 1PNVA 1W4BA 1JVSA 1KAOA 1DKUA 3CLVA 1UR5A 3KPYA 5C8YA 3C7DB 2V8OA 4C7MA 3GDFA 2GHQA 3QFTA 5FWAA 3ZH2A 1IN8A 1QZXA 1XO1A 2TMDA 1PDWA 3DMDA 2ZZNA 2FMHA 3OOJA 1KRHA 1Z0KA 1M9NA 1JIXA 1IIBA 3FMFA 3PGMA 4GYYA 2Z04A 1ZC4A 1RI4A 2WDZA 3H4TA 2W5UA 3IUMA 4IG9A 4EG8A 1LSSA 1SIWA 5AVUA 5BO5A 3LFUA 4GNRA 3VDXA 3AESA 4QVGA 3JQFA 3NTLA 4N4AA 2BUCA 2WFLB 4NH4A 4DYVA 4K6GA 2WTXA 3FCCA 4LG1A 3IBTA 4OBBA 1E9SA 4I6GA 3O4JA 1Z73A 4WNCA 1CIVA 1H3NA 1IWPB 4XB6B 5G02A 3KYBA 1W35A 4OTZA 2D2IA 1Y3FE 2QZ4A 5LQJA 1K08A 5CB4A 1D6MA 2PL5A 4NL4H 5KOJB 3SEFA 5GIPE 4YAWA 1NJ1A 4B2YA 2RJOA 5E95A 2JJQA 2XYPA 3D8NA 2YXEA 3OQVA 3WWCA 5SZHB 4BE9A 4ARCA 3E9ZA 2XVYA 1T4MA 4UTVA 3JX9A 4R3UC 3U09A 4GYJA 1GZHB 1H2BA 1DO0A 4J7CA 3CRQA 5D3QA 4RS4A 3IVRA 2G5GX 3TUIC 4M1TA 1XVVA 1NL3A 1B3BA 3K9GA 1KDZA 1RWWA 2ERYA 3UJ8A 4D5GA 1N8SA 4ZCSA 3A6LA 1KI9A 3HO6A 4KOEC 1U9IC 1YS2X 2CB0A 3UUFA 4C7JA 4AG6A 1GPDG 3GZNB 3CNBA 2ECFA 4JP5A 2JCBA 4W5WA 2ZI7A 4JH0A 1XPRA 1QF6A 5DRYA 1JAZA 1HT3A 1U8FO 3PRHA 4CL2A 3NANA 4OFWA 2VQSA 1YACA 3GUCA 4CQNA 4LF7B 2E37A 2B82A 1B6TA 2IKSA 2IU4A 3HXOA 1A9XA 4ZODA 3UPDA 1ODJA 4B9AA 4N3AA 5DB4A 3SZLA 1ZS9A 1DUIA 3MOGA 4BRSA 4RNCA 2YWBA 4DQLA 4QXMA 3FGZA 3IE2A 3II6X 3TEFA 2M9MA 2C82A 4Y0NA 1PT7A 4JYBA 1BHJA 3WRVA 2J3DA 4CM3A 4DJJA 4YUXA 5B36A 1O6CA 3BWEA 4LZWA 4P82A 4H2DA 1ORDA 1NV8A 2KSQA 1JIIA 3DBIA 3FCXA 3GG2A 4H35A 3B20A 2KBFA 3CZMA 1UC8A 5AXAA 2X2OA 4CLOA 3N74A 4DLWA 4G26A 1XWFA 5KHOC 4IVNA 1IQPA 3O26A 1HLPA 1SNYA 2ZREA 4KJZA 4Q4JA 1XVUA 2HAEA 2HEIA 4PX9A 3SKVA 3C4JA 1C3OA 3LM8A 1HKUA 3GD7A 2FWBA 1H8EA 3JS5A 4GEGA 1JDNA 1NWCA 1NY6A 4L0QA 4U9UA 3ZNOA 3D6MA 1V45E 1EFVB 2AQHA 3ZLUA 1R8SA 4JOSA 2P1DA 2WJVA 1T6XA 4HBGA 3UBMA 2YWFA 2Y05A 5DEIA 3P8ZA 1LS1A 4AS2A 4ZO8A 2AEMA 5ITWA 1XD2B 3OZVA 1DI0A 5ITZA 2PL1A 3KT3A 2R1ZA 3DZFA 3ESBA 4BGIA 3CV3A 3ROXA 4DSZA 2H5LA 2HPAA 1G9SA 1YH3A 1RBQA 2Y2VA 5IASA 3AVXA 5IANA 1YDWA 3ONNA 3PEEA 5ELXA 4IQ8A 4TWBA 1YZ3A 2GTIA 1EGVB 5TS2A 1TGYA 1FDUA 4BPBA 1IVSA 3NM4A 1L3BA 1QM5A 2ORIA 4XOUA 3LW7A 1JA0A 3RRJA 1M1ZA 5ALWA 3CLRC 5J40A 1S2GA 2V96A 4DV6B 1GGVA 3HB7A 1UBNA 3L8YA 5CX4A 5D5QA 1U0NA 4HTFB 1ILWA 1PN3A 1G2OA 4G56A 1O97C 5C8VA 5IFKA 3GXOA 3ND7A 4MWEA 1RQGA 3CBGA 4CQMB 5ARDA 1TVCA 4RGYA 2Z98A 3TK1A 1ZEMA 4JB0A 2ZUTA 3V4ZA 1C30A 3IDSA 3ITKA 3DAGA 4LYJA 1R5OA 2WU8A 3FGNA 4HH1A 3IJPA 1KZHA 1S2DA 3TLZA 2P67A 4YUYA 5CA1B 4D96A 1XG5A 4M9RA 1YB1A 2PWZA 5ALUA 3F2VA 5CDFA 4Y9TA 3OECA 5JAZA 5TLSA 4I46A 3M3DA 3OBBA 5L51A 1DG1G 2AFIE 1NVEA 3T1OA 2OXEA 1TO6A 2Q5EA 3T34A 8MHTA 1V1RB 5K6TA 3U0VA 4TZTA 4KFUA 1I1NA 3E5NA 2SNIE 4KNVA 2G5PA 3C3JA 4N0DA 4JLDA 4X54A 3JV7A 1JDZA 1CUCA 2NQ2C 4XTCS 3Q3VA 1U8TA 4OLAA 4WGFA 3PCRB 3KFVA 3ZX5A 3B6MA 3G9ZA 1R4AA 3FMOB 3F6CA 3PJGA 4QUKA 5COBA 5FUBA 1TYEB 4CV0A 3HY6A 5A71A 4DJTA 3BKXA 4ZICA 1UBGA 1NVVR 2O5VA 3V1YA 2O7QA 1U3TA 2IXTA 1RYMA 2JGKA 1N2SA 3BKWA 3OE7D 3V80A 4WDQA 1DL5A 1R66A 2QP9X 1YZQA 2XMCA 4R2XA 4XH9B 3RRYA 3I73A 2XZOA 5EOVA 2WV9A 4BP9A 2XB9A 1LJUA 3AI3A 4F7DA 2AL7A 3MEQA 2BMDA 4HEHA 3F49S 2IXAA 1IOWA 1QH8A 1WZNA 2C3OA 3G2NA 3CVVA 1Q6ZA 2ACKA 4P4NA 5HFNA 2QVLA 1EBFA 5I7RA 2G80A 1A2QA 4PC1A 3RGGA 4ED9A 2J6CA 1RXEA 1V6SA 5ALOA 3N8NA 4IFBA 5H70A 1HO3A 2FX5A 1JRLA 2IYQA 4PC3A 3WV5A 4B2PA 4CDGA 2QRLA 3IT1A 3HXKA 5FWXB 2WUGA 2Y6VA 2FEWB 3A4TA 3OPMA 3P9QA 5DBGA 3MLBA 1NJ5A 3P1JA 3HN2A 2PSFA 5AJYA 1RYHA 3RARA 4NI5A 3E4CA 4YQYA 1B2RA 1LNQA 4BFLA 3DL2A 4WUTA 4XE5A 4ZXPA 1UZLA 3VPGA 1JR3A 1KP2A 1V11A 1XTRA 3K70C 1Z74A 3NT4A 2EDCA 2YZMA 1IRXA 4DG9A 2XUOA 2RI1A 3UUGA 3PHHA 1F06A 1JBEA 4P83A 4W5NA 2XIJA 2W2TA 4L2IA 3BXXA 3Q87B 3UH1A 1G17A 2WSSA 3MXOA 4S35A 3G88A 3DC2A 4AU1A 4EO9A 2PUDA 4FMDB 3QV2A 2FB9A 5ILQA 3FA2A 4LBWA 5ILOA 2NSHA 1IN1A 1LUAA 2AOVA 3V7UA 4LF4B 2AX3A 2JARA 3VGJA 1CU1A 4Y7CA 5TMBA 4JC0A 1KORA 3UJ9A 2BFBA 4Q34A 4W7SA 5A0TA 1N0VC 2D00A 2EWWA 1OH6A 2V7GA 1QR6A 5AQEA 1CG6A 5AW2A 4KXQA 4MI1A 2QSJA 4MVJH 5CXSA 5HA5A 4DMRA 4XVCA 2QL5A 2AXNA 1CRQA 4U9IS 3IR5A 4IH1A 4UUOA 4NQZA 1SWVA 2MSEB 1U7WA 3AHCA 1XCOA 2IXBA 4MQ4A 4Z9YA 4W1SA 5IC4A 3GFPA 1KO5A 5LUBA 1RI3A 1VGVA 2DX7A 1TQ8A 2R8PA 3ENKA 1FFHA 1GV0A 1HDZA 1NUAA 1PYGA 2OZVA 5HOEA 1LSUA 3STXA 3FPHA 4ETWA 4IYJA 5EJ9A 2VRWA 1G0OA 1ZNQO 3NS7A 4DQXA 4RSHA 4E0BA 3FYCA 2JGEA 2X1LA 1XD9A 4XB2A 5LQUA 1PG2A 4V2IA 1QJCA 2G36A 2R44A 1SBYA 1PEAA 1UAYA 3KWFA 5BRAA 2YN4A 3I4FA 3STTA 3FDXA 4ALMA 2OVBA 2CVOA 1WCYA 1ZN8A 1G5PA 1E61A 2CB9A 3P5SA 1NKSA 3PNPA 3PLNA 3Q3CA 4GD3Q 1SVNA 5CFRA 3S2ZA 2HHAA 1VL6A 1N5JA 2MYNA 2XVAA 3E8XA 4OAQA 1K7CA 4G25A 5FL7A 5BN3A 3C97A 3BFPA 4AZ3B 3W05A 4GDFA 2VZ9A 2AMFA 1S02A 2JI7A 1W46A 3HZHA 4Q03A 4AT1A 1N33B 2PWYA 2VSXA 1JEEA 2H1LA 3GLFE 2VG8A 3RFVA 5HCUA 1X8KA 4IWXA 3W2EA 1KPHA 4O4LA 1SEVA 4E7PA 2UKDA 4LUCA 1A8PA 1WMEA 3QJGA 4RJTA 1A8UA 2ZSJA 3O1JC 4MQ6A 1ZITA 4Z3DA 4BNGA 4L27A 1KH1A 2I7XA 4JENA 1A8HA 4X93A 2XGSA 4AKHA 4HB4A 3ZCRA 3TLCA 1WO8A 1QG0A 4TKUA 5JMPA 3D0KA 4MI3A 3SHQA 5A2QA 3V8PA 2YASA 4B1FA 4BMCA 1V5GA 3GRAA 1SKYB 4YJ2A 1NLUA 2JLWA 4DMUB 3F6PA 2P6MA 3AYXB 3QX8A 4ASUD 4XVQA 2A59A 4JBHA 4Q0MA 4WKBA 4BVBA 1N36B 3L7NA 4AKTA 3FCSB 4S1PA 3OOYA 4CM9D 5HWSA 5CCBA 1UWKA 3DMHA 3WV4A 4WT7A 2ZAGA 4RXTA 5I47A 1KU0A 3JYNA 4L7VA 3H7IA 4PNZA 1QXSA 2X5NA 4UMEA 4P3NA 2A0XA 3UT5A 5HZKA 1VE6A 2J0UA 1YHZA 1W5BA 5SY9A 5KCMA 2YJ3A 3PQDA 2CNBA 2DCMA 2Z5GA 3L8FA 3LBAA 3HB4X 4JT4A 1UOEA 1GPKA 1REQA 2ZRJA 3PA8A 5ALTA 2Q6IA 2OCXA 3KX2A 1G6Q1 1HF3A 2UVDA 3Q1LA 1D9XA 3H1GA 4ZZ2A 3VSCA 1NYRA 3PUXA 4TOIA 2A7XA 4DA0A 1YZKA 2WJ4A 4KGVA 4QYXA 1J9GA 3I6ZA 3Q5EA 3B9RA 3FOCA 4PLWA 2O2XA 4QPDA 4WECA 1NNSA 2VCHA 4XIYA 4L4RA 4EEZA 4NFLA 1I7PA 1ZSNA 3AB3A 5LQKA 3G0DA 1HYEA 4WLOA 3MCAA 3A14A 1Y4SA 3NKLA 3EE6A 1TO2E 4PONA 4B31A 1IM2A 3QWBA 4XDGA 4DUPA 2YIVX 4R1SA 5KC8A 2OXFA 3MB5A 2OQ2A 1BCSB 1QCDA 2W11A 3V1LA 1LC3A 1S3FA 1QONA 5J4YA 5LOVB 2FMKA 5ALJA 10MHA 4TMYA 3FYUA 4K03A 3A04A 3SYNA 2JIRA 3HR7A 4ANFA 3WOVA 4DBZA 3HJTA 4E21A 2QLMA 4O4JF 3DB1A 5EG5A 1D1PA 4COOA 1GKLA 3KDSE 3DYIA 4KIGA 1HBJA 4KO3S 3RYTC 1NRIA 2G04A 1FVXA 3IIJA 4IEIA 4FSXA 1A98A 1V26A 1IK4A 4RTNA 3JY6A 5HK9A 3JPYA 3AVTA 4E2ZA 2K2WA 1NVAA 4YFYA 3ZDEA 2FDCA 2F48A 3O4GA 1U2TA 3BXGA 4X5OA 2NXNA 3GLGB 4DJFC 3SFTA 4IXTA 4I66A 1IE3A 4BNHA 3ZN2A 3H6KA 1KZ7B 4ZKDA 3U7HB 1DRJA 3F8WA 2WM3A 1I6LA 1GCAA 3MTBA 4PZZA 4O3MA 2R5NA 2HJWA 3EIXA 5AJHA 3G2HA 2X0KA 1YJCA 1BS1A 3P5BA 4LHXA 4LRSB 4LHVA 4NOLA 1F8YA 1UK6A 4CIDA 4DA8A 4JYAB 2QJFA 4HAVA 2AK3A 2D2EA 3U9LA 4KB5A 3O8RA