3MXTA

Crystal structure of pantoate-beta-alanine ligase from campylobacter jejuni
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
283
structure length
283
Chain Sequence
AMQVITSVKEAKQIVKDWKSHQLSIGYVPTMGFLHDGHLSLVKHAKTQDKVIVSIFVNPMQFGPNEDFSSYPRDLERDIKMCQDNGVDMVFIPDATQMYLKNFSTYVDMNTITDKLCGAKRPGHFRGVCTVLTKFFNILNPDIVYMGQKDAQQCVVVRHMVDDLNFDLKIQICPIIREEDGLAKSSRNVYLSKEERKASLAISQSIFLAEKLVREGEKNTSKIIQAMKDILEKEKLIKIDYIELVDFNTMENIENITDNVLGAVAAFVGKTRLIDNFLVQGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Pantoate-Beta-alanine Ligase from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Ligase
molecule keywords Pantothenate synthetase
total genus 91
structure length 283
sequence length 283
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3mxtA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3mxtA01
3SP1A 1EFPB 3MMXA 4ND7A 1EXDA 1XNGA 1NSYA 3IMGA 2A86A 1Q11A 2DUMA 3QTBA 1OWOA 1K4KA 1K97A 4DNXA 1FFYA 3AG6A 4MW5A 1WY5A 4ZCQA 3GMIA 5LFAA 1F9AA 5H7XA 1EUQA 2CT8A 3KT6A 3ZIUA 3CLUD 4GRIA 1J21A 4MUEA 4Q16A 1CT9A 4YBRA 1NYLA 2ZUEA 1UFVA 4ZT6A 3N05A 1I6KA 1Q19A 2QJFA 3P52A 3CLTC 5DB4A 3N8HA 3HZRA 4MWDA 5K0SA 4MWEA 3IH5A 4U63A 3K32A 3MXTA 2J07A 4NAHA 2A1TS 4MUJA 2B7LA 1COZA 4HK4A 1WOYA 2GKSA 3QE4A 4F4HA 1K92A 4ARIA 2CV2A 1NUQA 4NZPA 1MOPA 2X0KA 1KKUA 1LI5A 4YP7A 2RE8A 1R6UA 1RQGA 1IHOA 1N2IA 1T6YA 3RFFA 3INNA 1PFUA 4AS1A 3ZXIA 2DR2A 3IVCA 4DJAA 4NX2A 5LLTA 1QU3A 3X1MA 2X1MA 4E1AA 3IOCA 2ZP1A 1WZ2A 5FO0A 4MW2A 3IMCA 1PFVA 4PBRA 2X3FA 2DERA 2YWCA 4QBTA 4H3SA 4BWVA 1JMVA 1O97C 2E0IA 2IELA 1R6TA 3L93A 2QUHA 4EGAA 1U7XA 4HJRA 3QTTA 2DXIA 3G6KA 4JXXA 1NUPA 1KQPA 4YP6A 1IRXA 3FETA 1XNJA 2GM3A 2A4MA 3FY4A 1R6XA 1O6BA 1QRTA 1VBNA 4WNYA 3A4IA 1I6MA 5DEOA 2CYAA 3P0JA 2QTRA 2D5BA 3Q10A 1NZJA 2YWBA 3N2YA 4OUDA 1GTSA 2WSIA 2JANA 2PXHA 4QRDA 1K4MA 1F7UA 2DLCX 3HL4A 2IP1A 5FO1A 3UK2A 1IFXA 2J08A 1ILEA 3SEQA 2BYTA 4DE5A 1PG2A 2A1UA 2E89A 3CLSD 1TEZA 1NI5A 1WQ4A 1BS2A 4NAUA 3IODA 3IVXA 4FZJA 3UMVA 1O95D 4RUKA 4MLPA 1QQTA 1T9GS 1EUYA 3D6UA 3NBKA 3CA8A 1OWNA 3AG5A 3P0HA 4NDAA 2AZXA 1KAMA 4L2IB 2X1LA 4ARCA 1H3NA 1JIKA 3PNYA 5EKDA 1OD6A 3KFLA 2QTMA 4KR9A 2ZUFA 4KPUA 4NATA 3ND7A 3G59A 1VLHA 2AG6A 3A2KA 3RHSA 3CLRC 4R2LA 2QJTA 1X6VA 4ZT7A 5HUJA 1PFWA 3HGMA 1G8HA 3L92A 5J58A 4KR6A 4MUFA 1T9GR 3MUEA 4TS1A 2YY5A 3CLTD 2Z09A 1HYBA 1KH2A 1N77A 1WXFA 3GUZA 4EG3A 1G59A 1O95C 4MVWA 4I6GA 3LE8A 4JZYA 1ZUNA 1QTQA 1G8GA 1M83A 3ZJTA 3NV7A 5LM3A 2CFOA 3ZGZA 4OUDB 3ZJUA 4G5YA 3ND6A 4UZFA 1OWPA 1J1UA 2V0GA 1I6LA 1A8HA 4R0NA 2J09A 3PXUA 5KCMA 1QU2A 3RK0A 1OBHA 4DDHA 3M5WA 1MAUA 2TS1A 4MW7A 4WSOA 1O0CA 1N3LA 4J76A 3JXEA 2O8VA 5KWVA 4XSVA 3DPIA 2RD2A 3NBAA 1M8PA 3AIIA 2NZ2A 3TZEA 3H9BA 3CVXA 1JEDA 1WQ3A 1B6TA 1MC1A 1ULHA 5J5AA 2XRZA 1J20A 2Z3VA 1H3FA 2HMAA 1JGTA 3H99A 3MLAA 4ZCSA 3UC5A 1LW7A 4XFJA 4R2MA 3VGJA 5H16A 4CDMA 4EG1A 1YUMA 5F23A 1KH3A 1O5TA 4MW4A 1M8FA 3X1JA 3IVGA 1FYDA 3LOQA 4F3RA 2DPLA 3A05A 1SURA 1U7DA 4JYZA 2DEUA 4ZCPA 5AHWA 3COYA 4PBSA 1JIJA 3AFHA 1VBKA 1TQ8A 4MVXA 1YIAA 3RK1A 1N1DA 1IQUA 1KH1A 3CLUC 1GLNA 1U0BB 4K03A 2CV0A 1Q77A 1XJQA 3OP1A 1KP3A 2D54A 1TYCA 3FH0A 2VTBA 4XFDA 1KORA 2E18A 2CUZA 5TS2A 1N2JA 4CQNA 3COWA 1T6ZA 4EG6A 2CYBA 4U8HA 5KHAA 3UY4A 3IDFA 2QUJA 1EJ2A 1S4MA 1O94C 3IUEA 2C5SA 4KR7A 3TNJA 4MUHA 1N75A 1QNFA 2PZ8A 1KR2A 1OBCA 4MVCA 5TEVA 1EE1A 3TZLA 2WQ7A 4UZEA 5IJXA 1GAXA 1P7PA 4DLPA 1GN8A 3ILVA 4X0EA 1IQRA 3FI0A 3P0IA 2A7XA 1D2RA 3H05A 2CSXA 1J09A 3CLRD 3DO8A 4EFKA 4MQ6A 3FWKA 1TFUA 1GZUA 1O0BA 1U3CA 1TYAE 1JZSA 2WB2A 4P2BA 2VXOA 3SZGA 1G8FA 5HG0A 1T6XA 2A1TR 1N2HA 1YIDA 3FOCA 1OWMA 1MB9A 1EFPA 3GLVA 4MW0A 4G6ZA 3ZJVA 4ZT3A 1H3EA 4EF6A 3BL5A 1YI8A 3TS1A 4QREA 3FNRA 5TGTA 1NUSA 3SDBA 2XRYA 1U3DA 3FIUA 4G5FA 2OQ2A 3HV0A 3F3MA 3TQIA 3COZA 3RBAA 5HUHA 5JBNA 3IUBA 2VTBB 4HPWA 2EJCA 4EG4A 1QRUA 1PFYA 5K0TA 3H9CA 3E27A 4J75A 2NSYA 4MUGA 4MAFA 3ZUGA 2D13A 4EG5A 5BNZA 1JHDA 2PZBA 4CT0A 4AQ7A 1JEEA 1NUTA 2QUIA 4PY2A 4RPIA 5J59A 1NP7A 3SYTA 4U7JA 3AKZA 1JIIA 4MUIA 1J70A 4DDKA 1N2BA 1MAWA 1I2DA 1TYDE 3UOWA 3SZ3A 1N2OA 2J5BA 1X8XA 1QRSA 3K9WA 1O97D 1M8JA 1F7VA 2HGZA 4EG8A 2QUKA 1N2EA 1WXIA 4MW1A 1GTRA 2JA2A 3AL0C 4S1OA 2YXNA 4ZCRA 4MUKA 2IJGX 3N9IA 1ZJWA 2QTNA 2I1LA 2V0CA 3OTWA 4ZT5A 4MULA 3TQOA 1MB2A 2GOYA 3PRHA 3A04A 1ZH0A 4MUNA 2A1UB 3COVA 2Z08A 1PG0A 4EG7A 4JXZA 3ZXSA 4KKVA 3IOBA 4HJXA 2PIDA 1Y42X 3I05A 5DK4A 1JILA 4OJMX 1VBMA 4ZT4A 1WXHA 3ISJA 1MBZA 3C8ZA 1O96A 1O96B 1XNHA 2A88A 1YULA 3D6VA 1IQ0A 5DASA 3KT8A 1MRZA 4L2IA 4A91A 1KQOA 4K0RA 2J4DA 1KQNA 3CVUA 1N2GA 5TEWA 1IVSA 1VL2A 2EL7A 5IHXA 3CVYA 3KT3A 2BTEA 4MWBA 1MJHA 1EFVA 3HMQA 2H29A 1J1ZA 1M8GA 3Q12A 1JZQA 3U1VA 1N78A 2PG3A 4I6JA 4MVYA 3RJZA 3X1KA 3HFJA 4PBTA 2CYCA 4ZCTA 1JECA 1KAQA 4MW6A 3S3TA 2A84A 2DETA 4MW9A 4YP5A 4ZT2A 3LCJA 4Q93A 1TYBE 1YUNA 2E21A 2O5RA 1V8FA 3MLBA 1V47A 1LI7A 4KPUB 4GU5A 2PFSA 4DDMA 3SEZA 2H2AA 1M1ZA 1KP2A 3PNBA 1EFVB 1H1TA 4YMIA 1DNPA 3DLAA 4MWCA 3VRHA 3FHJA 1GPMA 3CVWA 1F4LA 2CV1A 3ND5A 2QJOA 1IH8A 1Q15A 1WKBA 1NURA 2R5WA 1QJCA 3PNVA 2OV4A 3Q4GA 4I6EA 1M8KA 3CVVA 3FG9A 2JAXA 3IOEA 3H97A 4JFAA 3VU8A 1WXGA 5FNZA 2HZ7A 3DV2A 4CDNA 3FDXA 3KT0A 1OWLA 1WJGA 1WXEA 1O94D 2PZAA 3CR8A 2WQ6A 4ND6A 1NUUA 3CLSC 3ELBA 2G36A 3G5AA 3IMEA 1ZH6A 2AKEA
chains in the Genus database with same CATH superfamily
1QIDA 4LK3A 3Q87B 4YRQA 5FBZA 3SFZA 2HT1A 4TL6A 1EK6A 5I01A 1XTKA 3KELA 4J0JA 2XMBA 3ENNA 3O5AA 4FEGA 5KOJA 4YAOA 3DO6A 4I50F 1IL0A 2AJBA 4JC8A 4NCKA 2AYXA 2YYAA 1JDTA 2F1IA 4H35A 3HV2A 4OYRA 1FFYA 1BHSA 3EFHA 5KU7A 1P4RA 2ZAOA 2ARKA 2PD4A 3CRW1 4C06A 2R3SA 3V1KA 1STOA 4YJGA 2C00A 2G04A 4DM3A 5KYWA 5FNVA 1F9AA 2NO0A 1KMCA 3RU7A 3QUTA 4OU5A 2YMQA 1AS3A 4WASA 1VPTA 5B7GA 3PNSA 3ITEA 1U5BA 3EAGA 4CR7A 4V1CB 1VI6A 3WL8A 5ICSA 2OSBA 4KAFA 3T7TA 1CUXA 2XYQA 4ZT6A 4C14A 3IL2A 1MORA 4MV8A 4U7HA 4E5DA 2A9RA 3CR7A 1D0VA 2IXGA 3W8EA 5KS2A 3VSBA 1FUUA 4KC0A 2FLKA 4RACA 3RWBA 1WB9A 1J39A 4INJA 3EIOA 1IOWA 1MP0A 1XI2A 3WL5A 3ZE6A 3BUSA 3KVRA 2ZI5A 3LX6A 3EVCA 1VJDA 4BIMA 4A03A 4BAZA 5FYDA 4RM3A 2G9NA 5FX2A 2WKPA 3GP3A 3IJPA 4QVGA 2XWPA 4LE1A 5FWYB 1KE2A 4DIMA 2UXBB 4AMGA 1YC5A 3I30X 3AUTA 3MINA 1CQIB 3QQPA 4YP7A 1Q6ZA 3OWOA 1ZC3A 2JATA 2HWKA 4Q9DA 3KDSE 1NDHA 2F3QA 2GHRA 4EHHA 1ESZA 1N2IA 2IUFA 3F47A 2CHFA 5KC8A 4KRGA 3IYLW 4CL2A 3K6KA 1XZIA 4B9EA 1PF7E 4W4TA 5JYCA 3ZXIA 1GP2A 1NV8A 5IUKC 2C9CA 4B48A 3X2FA 1RAIA 1B6SA 2VOEA 4GOXA 4FI3F 4EJSC 2WIGA 1U7OA 4RMHA 2AZDA 3RAFC 2W5UA 4EQ6B 5CLFA 5CFOA 2H9IA 4RA9A 1JW9B 4D8WA 3IOCA 2W2LA 5BNFA 4PYRA 4F2GA 2H0RA 3WDMA 3PXGA 4KIUA 4TXJA 3RVOA 1NE2A 4MW2A 1JE0A 1FTSA 1R0BA 2Q62A 4PBRA 2QM8A 3FJ1A 1CDDA 1X2EA 2GRAA 2Q3LA 4ESVA 4ZMBA 4G0YA 1SRRA 1UK9A 1OXTA 2O50A 3IA7A 3KQKA 1ADJA 1Y80A 3ZW9A 2FQQA 4DIUA 1CF2O 2REQA 4KQGA 3EBLA 1KQPA 1ONSA 2IU4A 1ZN8A 4HSGA 3P9SA 1MJ5A 2UVPB 1DKQA 1EIZA 3ASYA 2XMGA 1P2SA 1FY2A 3KWJA 4P80A 2IZ7A 2XEXA 5G3YA 5D5PA 5DOVA 3V4SA 4MZDA 2PGLA 4ZTZB 1M7GA 2IW3A 4YRSA 2XVXA 3U7GA 1IEWA 1E2JA 1NW3A 1IUPA 2IKSA 3LY9A 5LC1A 4C0JA 3RNLA 2KX7A 4WGFA 2B3TA 4TTPA 4ARZB 1LVUA 4O5OA 1C7QA 1E6EA 1E7YA 4UHEA 1LC3A 2YV3A 1VKNA 2EHDA 1EG7A 3PDCA 4LSWA 2PXHA 4U00A 2IUUA 2PGAA 3FVWA 4OBEA 4B3RB 1NBME 3KEOA 5KQLA 3X1XA 1A9XA 3DJFA 1PJ3A 3OM8A 3ZJ4A 3CFAL 2Y05A 3D0OA 1NLMA 1A77A 2CMHA 3EB9A 1IFXA 3GAAA 1ADYA 4I08A 1W35A 2B99A 3QWIA 1G2IA 3CN7A 4LSZA 1UPUA 1H9CA 3M81A 4LJRA 3WX0A 3CNEA 3NWEA 1QHFA 4PTZA 3EFOA 3C1AA 3PHLA 1CUAA 1QFZA 4ABYA 4UQLA 2IEZA 3NB0A 4HCJA 5CYOA 1CEEA 2WPDD 3EZLA 3O4RA 5JAHA 1I7PA 3EJ6A 3CI0I 3PFFA 2CNBA 3KIPA 5KSOA 2YWJA 2VI5A 2VP6A 3K0BA 2H16A 4JBYA 4Z7JA 5KYYA 2NPOA 1BE8A 2IGBA 821PA 3WAGA 4OIMA 4H7FA 2A0UA 4CM4B 1MH1A 4PPNA 4ZIRA 3ESZA 2IS1A 2IXDA 5IW8A 3TNYA 2H5LA 3EGWA 5JZSA 2GT1A 2F55A 1TMYA 3OOSA 3N7TA 4FQ7A 2R4TA 1Q16A 5G4KB 1EWVA 1FTWA 4NATA 1JDBC 1PV1A 4S0XA 4Z0TA 3B82A 5T67A 4K9PA 3LH5A 4YCSA 2CLKB 1X6VA 2CVPA 1NBAA 2C4TA 2Z56A 2IIQA 3H2ZA 1JIQA 2AFHA 3IULA 3MMPA 1ULTA 3SJ7A 1W36D 1QQ7A 4MUFA 1F8XA 1EM6A 1NJSA 2ODBA 5EHIA 4R1SA 1E3EA 5LQCA 3J7TA 5MN6A 2FFHA 2RETA 3FCSB 4ZHQA 4CQNA 5LOVA 3G88A 3I09A 4YJGB 4CQMB 2D62A 1LV8A 5K8UA 3FPJA 1D9XA 1T9KA 4CWAA 4QQNA 1WSWA 2QRVA 5EXSA 5DN6A 2G0AA 4BJ5A 1DC5A 1LFDB 4JJGA 4YCNA 5L3QA 2UU9B 3OZAA 3ST7A 3AVOA 1XTUA 2P11A 4B8YA 2IU6A 4DCSA 2GTHA 1V1MB 2HF7A 4TLBA 5BVGA 2VYVA 2Y68A 3BRCA 2ISCA 2C7VA 2P40A 3GA5A 3R20A 4N01A 3UHJA 4DC0A 5FUVA 1A2BA 3ZIDA 5KOJB 3RYCA 2QM0A 4PC6A 4YUXA 4MR8B 4P83A 4U6NA 1Z6PA 1S2LA 5C4GB 3PL5A 4J2TA 5ICGA 2OQRA 3RFVA 4CKWB 3ZBTA 3E58A 3QFTA 1U1EA 3TOSA 2WHRA 4A6DA 1DCKA 3HYNA 2TS1A 1K6IA 3SIPA 1K06A 2VWHA 1NMEA 1AX9A 1ICEA 4J7UA 4OQYA 3VNSA 3MHTA 3H2YA 5LKAA 2F1JA 4N5MA 4WZAB 3G85A 3NBAA 3OMWA 1T8SA 3GJ5A 1X74A 2BGWA 3E7XA 2H8KA 4RLQA 4HLDA 3H9BA 5A6SB 2PWAA 3VOTA 1VRWA 2X8AA 3DOJA 3E2PA 3EGIA 3L6UA 2ZTSA 3E3NA 4HFJA 1ZCFA 1Y8AA 4G56A 5LIRA 4Z4QA 3K4HA 1VLJA 1HDOA 4QDKA 5DNUA 2I22A 1JGTA 2VP2A 1PS9A 2GVNA 2HCJB 4EKEA 5KYTA 1GQOA 4L7VA 2PZGA 1FJ2A 5FPSA 2O57A 2HQSA 1MFZA 1MJNA 4PX5A 3T9DA 3HKBB 5JSYA 1XG5A 3A4NA 3FR8A 2JBWA 4PX2A 1JIXA 2WU8A 1XVIA 3E9CA 1GPLA 1M8FA 3MGCA 4O59O 5T64A 3FMGA 3M82A 4BNYA 1TEXA 1W0CA 1Q57A 3NBFA 4MWZA 2YJ4A 1AD2A 3RS0A 1B0UA 1IULA 4BVFA 2V58A 4XD2A 3P9RA 3K4PA 3EZGA 2O52A 2C7GA 4KQJA 4HZUB 4PZ0A 4D9NA 4OLAA 1DT5A 2ZYAA 3A11A 1XTVA 3W6NA 2Q1UA 3MUNA 1BVUA 3JQGB 4LJ7A 4MVXA 4FPXA 4XUGB 4XYBA 2W8BB 4D8YA 1T2DA 2CUKA 3AJ9A 3N39C 3ORRA 5I45A 3GZNA 5FBWB 3WGTA 1OQAA 3ICWA 1NG1A 1VKRA 4CCWA 1ZBQA 1MTOA 3B3GA 2ZJFA 4UCQA 1NSFA 3BS4A 4MI6A 3K1AA 1NNEA 1DMRA 3W5BA 2QU8A 1PLKA 1ZUNB 3FFAA 4GHWA 1TECE 1E4EB 2XKBA 3IDQA 5KKAA 2CNLA 2PEYA 1W36B 3MTBA 3BSFA 5HYVA 4UJ3A 3ER9A 3SQWA 5JS1A 2QK4A 1FVXA 4Q01A 1VDZA 3RWMB 3IDFA 4JC4A 3BB3A 5DSXA 1DU4A 2PXCA 2O1WA 4DCVA 4D9KA 3ML1A 1T15A 2C03A 2BAGA 4BBJA 1G7TA 1NBIA 1FS4A 2DHDA 1W5EA 4RFSA 4TVSA 5BV1A 4EFNA 4KQ1A 5KTRA 1SC9A 5CPFA 2XB2A 1OBCA 1U8TA 4L78A 5TEVA 1U5BB 3ZU6A 4GOMD 4BZPA 2G82A 1B73A 2LCFA 4WXMA 2AEJA 1R0RE 2EDAA 1WZEA 2TMGA 5EHGA 1PT7A 2QTHA 3EVNA 2GBPA 2X4DA 4FMDB 3M9XA 1IQRA 1DOAA 3FI0A 5COQA 4AZTA 2RBEA 3M3HA 4DQXA 1ATZA 5F64A 1IZ0A 3WOHA 1TE2A 1YACA 1F2TA 1TFUA 2GK3A 3FROA 4EPYA 3H5LA 4XLTA 3ZNOA 3AESA 3DVSX 4II3A 4MMZB 1PYOA 2IDKA 3MELA 4P0TA 3THRA 4F6CA 1KYZA 1FQJA 3IUSA 3D81A 3RC7A 2Z4RA 3DOHA 1BGXT 4QC2A 1P3Y1 2FDXA 1QS0A 1ACLA 3TLCA 2R62A 3TD2A 3D7RA 1FX0A 1A88A 3DZBA 1DX4A 3IQZA 4B31A 1M6EX 3L7DA 5CBKA 4MKFA 1C3OA 2F00A 4G37A 5FBRB 1VE3A 3OCUA 5EXTA 1GV1A 1PEKE 2F3SA 2P0YA 2XNHA 1M1XB 3KEMA 1IOZA 3OE1A 3EW9A 4E1BA 3WKBA 4L6CA 1BWPA 4NJMB 1U1IA 4BV2A 1K66A 2QJRA 1Z13A 2CLMB 2DBQA 3C6XA 2NU9B 3LW7A 2DPYA 5JT1A 3COZA 1AG9A 3IRUA 2FAXA 2GILA 4LECA 4CU2A 5HUHA 2QHXA 2XLBA 4YCDA 3W6PA 2D5CA 2G06A 1GUAA 3TYXA 5K5EA 3EZNA 4R1PA 2GJ9A 3VH1A 5B5SA 1EINA 3DWFA 4YRZA 4QXMA 3GRKA 4RTRA 3L0SA 1G21A 1V16A 2PUDA 1G9XA 2G4CA 4EATA 3NDBB 4IXMA 3LMKA 1X3LA 4HWPA 1GZ3A 1ETUA 2DKNA 4RPIA 3GLHB 4XQ0A 1KJZA 4KFSA 2ETXA 2HJ9A 5THQA 2NQ8A 1J49A 2DU8A 4N7MA 2G25A 1IJFA 1OAOA 2GPNA 3RD5A 4JI6B 4QXRA 5C4IA 1JG7A 2AN9A 3QI2A 2E4ZA 3UOWA 5I9IA 3SZ3A 3K71B 4XEHA 2FN4A 5IM5A 4PZCA 2PLWA 4O5AA 3OOEA 2JFUA 1H8ED 5IABA 2QZPA 2WPNA 4ZWNA 1O97D 4PSVA 4UTOA 1LUAA 2BKUA 1W30A 3BFPA 4R9SA 2P91A 4U7DA 2XY4A 1PHPA 3G8CA 2LNDA 1CY4A 1LQTA 4ZOAA 5LXTF 3SPXA 2GJSA 2B37A 1NASA 3EVDA 4MWGA 4UHDA 4DA6A 4WBNF 4B75A 4CLHA 2HPHA 2XA1A 4WNIA 2H2IA 3QBEA 1BCSA 4UDYX 4IHJA 3B20A 5A4FS 1ZH0A 5DV9A 3RB8A 4WLFA 1M6VA 4NYIQ 1DS6A 2YYSA 1K98A 1OH6A 3W8NA 1AK9A 4BLTA 2YN4A 3W4JA 4HJXA 1D4OA 3GUHA 1ZD4A 1KFKB 2FSVA 4FDAA 1AO3A 3D5TA 5EP1A 3TVTA 3IT2A 3I39X 4TKZA 4H6PA 3OOYA 5G0UA 4YRKA 1MBZA 1CQXA 2O4CA 2VSFA 3WHIA 1CEXA 2F90A 1R8QA 3R40A 2B20A 3LIIA 1SOMA 5K3FB 1A96A 5DASA 2INGX 3OO1A 1G18A 5C8XA 1J0DA 3PQ6A 2JS7A 2FETA 2MSKA 3E82A 3VYSB 5JCOC 1XZMA 1KQNA 2J85A 5BNTA 2WDZA 4PZ9A 4E11A 4GGOA 3VU1A 3UB3A 3NV9A 2QTVB 4UMVA 3QX3A 2G67A 4LHVA 5BV7A 5DNWA 5H9VA 4FYKA 5JCOA 4BUJA 3DVAB 2NO1A 3KJQA 3IHKA 3REGA 4N39A 1X80A 3U44B 2BLNA 3JATA 3BWVA 3SJCA 3H4MA 2XUAA 2ZI4A 3SX0A 1PBTA 3WTBA 3ENQA 1MQ9A 4D3SA 3AKDA 4OP2A 1WUYA 1E1YA 2CKMA 1RXCA 4KB5A 4M22A 2WHQA 3V8EA 4DIEA 3G2JA 3EIXA 1K8RA 3SZUA 2VHQA 2P6OA 1MAVA 5JS2A 4D4LA 3IAS1 2B94A 5G02A 3HL0A 1KAQA 3GIDA 4N3CA 2R1TA 1CJSA 5CK4A 5E7IA 1FYXA 3CG4A 1PWYE 3BORA 4UTZA 3WYGA 1D2HA 3A27A 3HVIA 2ILVA 4U9UA 4DUGD 1FJXA 2XOKA 2WUWE 1N3YA 4DG8A 3AUSA 2WT9A 3EWNA 1ATIA 2GA9A 1DEOA 4PR3A 4YASA 2YJNA 4ALNA 1E3QA 2HF8A 1T2NA 2FWJA 3I2FA 2GLUA 2ZYSA 2HBRA 3U4MA 3AYXB 4XLZA 2YL2A 2Z4TA 2VP3A 4GYWA 5DI3A 1HFWA 4R8LA 2D1QA 3UH0A 1QRDA 3EPJA 3OQIB 1W2GA 1B2LA 3MJHA 4F8JA 2EZ9A 2OILA 5KKCA 5AVWA 1CP2A 3SVTA 3G8BA 4O1MA 1DKOA 1JH8A 1ODFA 2C3PA 3MTQA 2CL6X 4FHFA 3SR4A 1SXHA 4ARUA 4WCFA 3KJNA 5H9WA 4OSOA 1J6UA 4D8UA 4A23A 1TC1A 2I7VA 3FG9A 2YHIB 4WZBA 1KRXA 3ZVLA 1LF5A 3C16C 4IV5A 4PYNA 1YBMA 5B30A 4HHEA 3V9AA 3W78A 4ZCMA 1VB5A 2REXB 3FOAA 3DMHA 1G5PA 3GFRA 4EB6B 2QD5A 1M76A 4K8OA 4Y2RA 3BBLA 1SKYB 1T8WA 1GRCA 1UK8A 2BKXA 5HK8A 4XWWA 1XC7A 2AGVA 4AYWA 1YJAA 4BQQA 2RHTA 2GKOA 5I7UA 3D6FA 1L4UA 5DXAA 1VOTA 1YA8A 2FZ4A 2LBPA 2H1VA 5MDHA 3TUIC 1XNGA 2RGXA 1SVLA 2POCA 3GJTA 4KLNA 5EJ6A 2EX1A 3U5ZB 3D0QA 3O92A 2A33A 1KAEA 2F43B 1JKXA 3MEQA 1WBJB 1S8FA 2NZJA 3BXGA 3D3JA 3H17A 3UWOA 1WO8A 4E4TA 1RKUA 1S96A 1Z35A 2OHJA 3DTTA 3LGXA 1SKAA 3PLRA 3R5SA 4H31A 1ZNZA 3PJGA 4K9QA 2ZBFA 2HLDD 4BN4A 4DQKA 1G20E 1T9CA 4LTMA 4O2LA 4OHMA 4ZHQF 1KZYC 3KKEA 3PGKA 3B8HA 1W2WB 4B79A 1IN7A 1SHZA 4NH0A 3ZIUA 1K63A 2IEGA 3KQQA 4QBIA 3KSUA 5D2CA 3AOGA 5DMHA 4NENB 3EH2A 3FFXA 1EDOA 4CKEA 3U49A 3WRXC 5EIAA 2YBEA 1NHGA 2YWDA 3H9JA 3L8DA 3RU2A 2FYTA 3C8DA 3PP8A 4YAKA 5KSZA 3OLCX 1YBVA 2H65A 4RKWA 4KZKA 3HJUA 4ZDWA 1EQUA 1NF2A 3EOBI 3QWHA 5KX5F 1X0XA 3BSYA 2ID8A 1SGWA 1NN3A 2Y1KA 4KVGA 4WVFA 4OH7A 2A78A 2C3UA 2Y3IA 3OESA 2ZUVA 2O2ZA 1M34A 2DH5A 3CNBA 3AHCA 3KX2A 1LPPA 3M5DA 4TTAA 5AKEA 4ARIA 3GUUA 1KJJA 1NUQA 4O1IA 5CVDA 5A1TA 2MYNA 4TXLA 1TLTA 4TKUA 1KKUA 3FIJA 3REOA 1XDBA 4DA8A 4IFTA 3RSZA 4U2GA 1RJFA 4QDOA 2EL9A 3OZVA 4ITVA 1Z7BA 4LHSA 1RWVA 2ZTMA 2W8ZA 3EA0A 4NYJR 4U6QA 1SQ0A 4OAPA 1DWQA 2OMKA 4M4SA 4X97A 5C0OE 4TS4A 3RFFA 5I8PA 1YA6A 4AS1A 2XE8A 4FFNA 4QJIA 2R68A 3TH5A 1YQTA 2PUCA 1EFAA 3NI2A 2D1SA 2KWIA 4QDUA 3DZIA 2AR0A 3VTAA 1MA3A 4XUDA 4F8EA 2GA8A 2NO4A 1R5OA 4DSOA 3JRXA 2PZJA 3DFIA 3QMWA 1RLTA 2VSXA 2DERA 2FQYA 4AU1A 3QKSB 3FZEA 1EFDN 2KSQA 3K4QA 4BPRA 1KL7A 5EGNA 4WZ6A 3VR1A 2HF2A 3ADOA 3ZCQA 4ZI7B 2VQEB 3ZD7A 1C3XA 4CN8A 1CF9A 2K87A 3VYRB 3JVVA 2QU7A 3E9DA 1GXSA 2WUEA 1NZFA 1QH9A 4OHFA 3QTTA 1I30A 5TQ0B 1EA7A 2H5JA 2IFTA 4HAYA 5ALIA 1P9RA 2P3LA 4UU7A 2QR2A 2VP9A 4IIBA 2FZVA 4BU1A 4CQLA 5HM8A 4JB2A 3OFNA 2EKPA 2R7LA 4HXFB 1NFFA 2PV0A 3GU3A 2F3TA 3RKRA 3WNCA 2DUWA 4KZPA 3QELB 1EKXA 4KFUA 4ZC8A 4BDTA 3Q3HA 3PEFA 1D8TA 1HE3A 4G0PA 1I2MA 4MS4A 4RNCA 3FTFA 3LDUA 1GQFA 2OGZA 4GEKA 5DM60 1BCRA 3KYDB 4LTNA 5FUWA 1UBEA 2X9NA 3WGHA 1F0KA 1B4DA 4ZZIA 1GZHB 1PSZA 1XK6A 3QLVC 3KJIA 3U7HB 1GTSA 3KKQA 1P75A 5JI2E 4AZSA 4WK6A 5LP6B 1Q3HA 2C99A 2GPBA 3D7MA 4IDPA 1QAQA 2HSDA 2EP8A 3PKJA 4J2HA 4WKOA 2G80A 4H1WA 1O4VA 2X42A 3PQ5A 3BRQA 3UO8B 2IP1A 4YCJA 1FVOA 4ZI2A 3CH4B 4LYFA 2J08A 3LC2O 3HNPA 2PZEA 2DBVO 3DEYX 3H87A 3D3NA 4RY2A 1DC6A 1V7CA 3FTCA 3KYIB 5JRZA 3GZNB 1GV0A 4BBPA 1ONBA 2O3TA 2ZXUA 3OLWA 4RUKA 3S27A 5HKBA 2P90A 2H17A 4B3IA 1N5KA 4W1PA 1RPNA 1QQTA 3BHIA 1UODA 1ZRMA 1JDVA 4YAGA 1TCCA 3JWHA 5I4BA 1EUYA 4Q0MA 3CA8A 3WB1A 3S1LA 4QG3A 1MC4A 1DELA 1O2DA 1MIHA 2X1LA 3EOZA 3IBGA 2QRLA 2XADA 3H8WA 3D2LA 5F21A 2GXUA 5EKDA 4BO5A 4DGSA 4BV3A 3EMVA 4P7BA 5A3QA 4YO7A 2J0VA 5A05A 4L08A 2IPXA 4TYNA 5HEKA 1B42A 1JLLB 3DMGA 1PK9A 4C6TB 2JC3A 1PZNA 4EF5A 2XTNA 4GOLD 4UHKA 4LQDA 4RMIA 3PFNA 2B2NA 4ZD6A 1ZCBA 3K9BA 3WYFA 4R40A 1KNXA 1OW3B 1TX4B 1D2CA 1GLGA 2E85A 1EAYA 1TIPA 2GUWA 3AUKA 1AUPA 4FYJA 3I12A 4KIFA 4D57A 5JSQA 5K0BA 2GD6A 4B3TB 1G8HA 4UQOA 3D4NA 2I6UA 1T9GR 4CKWA 4YRNA 2Q45A 5JMTA 3KR9A 3X0DA 1QF9A 1QHSA 1JU4A 4FGUA 2AIRA 3TAXA 1JG4A 1G66A 3R8XA 1O95C 1RSZA 1P0IA 3KOUA 4GI3A 4HUQB 2FW6A 3ZQUA 3CWCA 2PZKA 3DNMA 3V6MA 3EGDA 3WYBA 4R1TA 1SUDA 4BKMA 1ZMOA 2PK3A 4LDNA 5HSGA 1AQNA 3LHSA 1T2VA 3WMEA 4F4DA 2OWDA 3L1KA 4TRJA 2QE7A 3QOWA 3RVMA 2DG2A 1GU7A 1OHHA 3WZMA 1BXRA 3GRPA 5EP2A 3KVNA 1UM9B 2BGIA 3TX2A 4QE3A 4BO7A 3IUNA 4MR8A 4D2IA 4D0NA 5CBPA 5I4KA 3PD0A 4AJ9A 1OB2A 2DQZA 3I3SR 3P2KA 3N2EA 1OBHA 3VAAA 3W6OA 2HQ1A 3QVUA 2ACWA 3JXEA 1W25A 2O8VA 3NU1A 2CMKA 3QE0A 1Z17A 1PVOA 4JROA 4CQMA 2FK8A 2JLCA 5GM1A 2G0TA 3QFCA 1CZLA 5BWCA 2UZ3A 3JWJA 3Q15C 1KJIA 1EWYA 1ULZA 5AJZA 4QIHA 4ZO4A 1IEVA 3O2QB 1WXWA 3H99A 3EZ7A 3TVDA 3MWDB 4R2WA 1NW4A 3BICA 1JJ7A 3AQIA 3ZDQA 2B3DA 3GY0A 2QLTA 3LLCA 5JEDA 3EG5A 5JH7F 3JQAB 3NHZA 2ZRCA 1SUBA 5TC4A 2OK8A 4IJWA 3S5UA 3QJ5A 2EP5A 3O1IC 2NNLD 4Z2AA 4GSYA 2G83A 3WVNA 5BSVA 3OMXA 4U1RA 5GY7A 2P78A 3FI9A 4LRQA 1KAHA 1FYDA 1YASA 2R8PA 4NESA 1I4EB 5TPZD 3JVIA 3VTZA 3A05A 5MGNA 2R8RA 2G16A 4R5HA 1NVMB 3MWLA 3PI6A 4L5CA 4JA2A 3MIZA 4PSKA 5AJTA 3OQ1A 1RZUA 1NXVA 1AKQA 1GPAA 1MTZA 3WKEA 3I4FA 5EMHA 2ZIVB 1GNLA 1GZSA 1CUJA 3ZNQA 3PU6A 2C4HA 2R6CA 3HKCA 4NCIA 3ZQJA 3H5VA 3UKJA 4K03A 1ZS9A 4ESEA 2Z2ZA 2CV0A 1Q77A 2G9QA 1KP3A 2DE0X 2PT5A 3WK5A 4DUZB 1Y8RB 4QFMA 1JAYA 1I2CA 2PDAA 3G0OA 4X20A 3C14C 5EPUA 1NP3A 3T3DA 5YASA 1FVHA 1DKNA 3MCTA 1B3BA 2VWPA 4FEYA 1IN8A 4C3VA 1H4QA 3WRXA 1XFDA 1BDIA 5REQB 4EG6A 1BQ3A 5FWNA 1DIRA 1FBTA 3TI7A 1NBEA 1PR4A 2GSWA 3G9TA 3AVTA 4TMVA 5K8IA 3AXSA 2BE9A 1U0FA 1FRVA 4LVNA 3JQ8A 4F38A 2REQB 5KQGA 2NP6A 2RHJA 1HOXA 1T5LA 2W2KA 1F6BA 3WGOA 3GFQA 2X5XA 4X92A 1EDBA 1QGYA 2GLXA 2JIOA 3QKIA 4OV6B 3A4LA 2P4SA 4R2XA 5FWXA 4E13A 4TKVB 3FHTA 4MUBA 4EUHA 3IEIA 2X8BA 3E70C 5DGCA 2LMEA 4JJKA 1JSXA 1XMJA 3DE7X 3DE0X 4B71A 2OZVA 3FKQA 3NGLA 2QROA 1XTQA 5F2NA 2QMHA 1QZTA 1Z4QA 4GW3A 4EQ6A 4ZVVA 2Q41A 4WJLA 4JD5A 3UPDA 3OTHA 1F06A 1PJRA 2W2XA 3B3QA 3QPAA 3GDFA 2QVZX 3ZY6A 1QK3A 1X7XA 2VDVE 5JYDA 2J41A 1F20A 1ZCZA 2ZRQA 4ZXFA 4P2BA 1KNQA 1NWHA 5IAKA 2VRCA 3VPSA 3Q8MA 4AX8A 1CUGA 2FUCA 2OL4A 1E2UA 1WDMA 3MYRA 2OM6A 2Z57A 1BA2A 4MR9B 4W8HA 5DXJA 3ZHSA 3BA1A 3Q41A 1GGNA 2C2HA 3UW3A 4UUPA 4HRYA 4MPJA 5HUQA 3DNPA 1H5UA 2AK2A 4RA9B 1NNSA 3GUYA 5IWAB 1TA9A 3CX4A 1LLCA 1QE3A 1PJ8A 1W0JA 4DPMA 1MX3A 2EKZA 3D8NA 4PZPA 5TMBA 4Q3DA 2QXTA 2P3OA 4GD3Q 3S2SA 2G08A 3G2QA 3OU2A 4M89A 2AC4A 1N6HA 2QVXX 3NC4A 2V8OA 1BXRB 1TJ5A 1P1FA 3HDYA 3F3MA 4ZKEA 2AV6A 1ZESA 2EKLA 4IOJA 3AEUA 1XRRA 1UCFA 3FRJA 4GSLA 4Q7EA 4V3CA 3C6KA 1PNOA 3AOEA 4LMAA 3VMMA 4EBBA 5K0FA 2XHEA 3N53A 3H5RA 1E1KA 4RK7A 2QX6A 4F56A 4EY8A 4TWJA 2X5OA 3FTEA 4BUCA 2YOHA 1Y6ZA 1XRNA 3DEAA 3FFTA 1W88B 4OEHA 1P19A 4AKEA 4EG5A 4C2UA 2E87A 3EXHB 4HAVA 4ZYLA 1JS1X 4PY2A 2NPFA 4JBNA 4JGIA 4TLEA 3A1SA 4ZRNA 1PS8A 1BVHA 4QEKA 4XVQA 3PGA1 5ILGA 2CXRA 2X2EA 2JIQA 3DCJA 4HUJA 3VPCA 4BLQA 1I2DA 4J9UE 4GPBA 4KYTA 4QLOA 2XYPA 2P1RA 3OSUA 4CIWA 1D6SA 2QD3A 1RLMA 2H2HA 1IZZA 2HK7A 4PFQA 3UAZA 1HZZC 3VR5D 4V0MA 3GLFE 1C0PA 2ZVPX 4RF3A 1P74A 1PGNA 3EDQA 1CC1S 5EUBA 1EXWA 4EX6A 5KMGA 2XTAA 3EWSA 3HZHA 4D6PA 4PG8A 1JPNA 4MV9A 4DHEA 4XYGA 3UJDA 5DTMA 4L8YA 3E5HA 3LPNA 3MCUA 3G9XA 3IDZA 3ZWQA 4EGSA 2JKVA 3WFZA 1H0SA 1G64A 2JI8A 1HZZA 4N03A 4W6QA 4INPA 5GJVC 1XMOB 2VP4A 1CR1A 3T7KA 3IUJA 3HXTA 4LWQA 4QEDA 2QTNA 3WZ2A 5CVTA 1MN6A 3ZYCA 4MULA 3VDNB 5DE3A 5ALUA 1ZAKA 2FJPA 3UGTA 2FP4B 1E58A 4XB1A 2ZCJA 2Z08A 3ECSA 5DGDA 1RDFA 4Q9AA 1RU3A 3QLJA 1AZWA 2O5VA 2QL7A 3UV7A 3AU9A 3FCYA 2CCJA 1PO7A 2NZXA 2YIJA 4GICA 1NXQA 4RL4A 1G0NA 3EZXA 3DZ8A 2LIPA 3O9MA 5CM2Z 3ILYA 4Q02A 4F84A 4CMGA 3TIXB 1JYSA 4BVLA 5DNDA 1IAVA 1VL0A 1C9YA 5JWHA 1SVMA 1ZJJA 1JEYB 1XVUA 2Y4OA 5EERA 1BHJA 3JWEA 4YMUA 5CLLA 3HY4A 1VL2A 5E6UA 2Q2QA 3VDMA 4P9NA 1KXJA 3QVJA 2J87A 1XHEA 1CXZA 1OHHD 3PFWO 4G89A 1RT9A 2D1RA 1CIPA 5KQRA 4H77A 1GGFA 1JYEA 1BS1A 4QYXA 3UFXB 3TJMA 4N76A 2E5LB 1KU0A 1REQB 4GKVA 3O3OB 3KAPA 3TOZA 4B2IA 1K5GA 1J0XO 3KXIA 4ZQHA 4BY9E 2BBWA 1N78A 4L3VA 1MH9A 1FNSA 5A7FA 1SOUA 2EFEB 2HJVA 1BOFA 1YT5A 2PUJA 4EJMA 2XRFA 1NJ8A 4CQJA 4JQOA 4ZCTA 3U19A 1FRQA 1NLFA 1K68A 3T3NA 3EEOA 4FQ8A 3S3TA 1KJ9A 1ZHFA 2JLQA 3P96A 1KSGA 2V4ZA 1PL7A 1ZCAA 3SY8A 5JAZA 3WQSB 1Z28A 4OBWA 1QYDA 3MOIA 5EEHA 2YXDA 4LZAA 3PDHA 4EK9A 2XBUA 1F8GA 3SQOA 5BYJA 1ESNA 3U3JA 3ZHBA 5J1SB 4CXMA 1Y4UA 3K9CA 2K7FA 4E1VA 3PHBE 1Q1BA 5AI4A 3RQIA 4LOKA 4TZ6A 3LPDA 3CVWA 1YB4A 3A0UA 3H11B 1HDCA 4JJEA 1U7ZA 2XECA 1THMA 1WKBA 3DC7A 4PAWA 1EGMB 1NURA 2ZXFA 3LQ1A 5L9AA 2XVAA 2OV4A 2EVWX 2J9ZB 1C9KA 4NECA 1WDLA 4EY3A 5EMMA 2AOTA 2XEDA 1FP1D 1WHTA 3AI2A 3AF3A 1T5SA 5L7YA 2WYWA 4H27A 1ODSA 2CXXA 2PXXA 1JR3E 3FDXA 3OFSA 3RVRA 3V4ZA 4NCBA 4D8TA 2I1QA 4PGGA 4KRYA 3LT4A 4G5RA 3QVXA 1C29B 1NOJA 1Q0PA 4GLJA 1KETA 5TQVA 3TDNA 1UC9A 3O8QB 4FYHA 4DZZA 1A69A 1GPKA 1DO2A 3PVSA 4H3KB 4XVHA 4DILA 1Z2CA 13PKA 3JQPA 1N6LA 1SAYA 4MPTA 1I0IA 4TV9F 1WPXA 2HO4A 1H0KA 1Z6AA 1CTQA 1WU7A 2IHZA 1NKVA 3LF4A 4L1KA 1D5WA 3GT0A 1QH1B 2NNWB 1N8TA 2XV1A 4Y9DA 2E1PA 1RQ2A 3A6HA 4OYHA 4RPKA 1R3DA 4TMTA 5DYTA 4F85A 3NWBA 3NT2A 1KYYA 2EQ5A 4NCJA 1KBOA 1ETHA 3W9BA 5FADA 4DNXA 4QDZA 5JCJD 3OQMA 2ZSHA 4MEJA 2I0FA 2NX2A 1RC1A 3T99A 2C4NA 2BGGA 3LDAA 4Y6SA 3GMIA 3DTVB 5FV4A 1J2RA 3KPVA 2OCIA 4DLNA 4IJUA 3EMDA 5D5HA 1KJ8A 3KJGA 3MGBA 2ZB8A 4WEQA 5ALMA 1J21A 3SXUB 1U0NA 4N1AA 4QUAA 1Z5VA 1ZGAA 3AKEA 3DEFA 3HU5A 3IVAA 3PPXA 5AH0A 3HBLA 3K6JA 3N8IA 5FB3A 2XT9A 3S8MA 2P6MA 1NRWA 2ZAYA 3G79A 4ATNA 2ZKIA 4IDFA 3RUCA 1F2UA 2QD1A 3AV0B 2OFXA 4Q3CA 5JJCA 1ZQ1A 2AQIA 4YPFA 4ER6A 2VRCD 2ZYVX 4A0RA 5L7WA 4YUWA 1KDTA 3D3EA 2VUTA 2VF5X 1QB7A 3CZQA 1K0FA 3ZGOA 5IASA 3QX7A 4YCBA 4BXOA 2WMOB 3Q7PA 2XVYA 2X0FA 1WOYA 2EZ8A 3DDCA 3KWFA 4G5XA 5JANA 2IE0A 1M5TA 3BMCA 3FNGA 1JBKA 2DFNA 4B7CA 2GYUA 4Z4GA 2WU0A 3O21A 2VAMA 4CKBB 2C5HA 3W90A 1RQGA 4OQDA 3F6RA 4QD3A 1CQPA 2R60A 5FI5A 3TBHA 3TIVA 3MSCA 2B4RO 3OCXA 1TZKA 3UV3A 2X23A 3KOWA 3I4LA 5HF8A 3E53A 1Z36A 5KSYA 3KZCA 3OCZA 2A53A 3GJ0A 1IHYA 1YKGA 1T8UA 4G1UC 2AQHA 3LGAA 4H7EA 3HZOA 3IVCA 4YRDA 3VI3B 1F12A 1KKLA 2ZWVA 1U2SA 2IEAA 3EZ9A 3PFHA 5GTDA 5K99A 4AMZA 3UAWA 1ZKMA 5LOVF 3MMNA 1USVA 5DNAA 4H17A 3ZOKA 2AZTA 2C77A 2GBIA 3BQMB 1QJ4A 1TU4A 2BFWA 1M1YA 2ZB7A 3HB7A 4XQEA 1R5NA 4RDIA 3IMCA 4M60A 1UOQA 4IMRA 2XZLA 2X3FA 1CVIA 1VG1A 2VPXA 2YWCA 4IIJA 5GJWC 3UUFA 4YUZA 1JA9A 4C7OB 4JL6A 1GNRA 1PNQA 5JWRA 4EGAA 1R6TA 4D9GA 2QUHA 4XB6B 2V03A 4HDCA 3VSDA 1T4CA 2BEWA 1ELOA 3ZDBA 3DP9A 2AFIB 3W0LB 4DIKA 1IATA 4ZOLB 3QFHA 4ECAA 1A9SA 1QIGA 2CUTA 3W8FA 1DAEA 1SKYE 5AW8A 4D4HA 4IZOA 1AMOA 2J3HA 3ZWMA 1LS1A 4E08A 1GARA 2G4LA 5ESDA 6PFKA 4QQ8A 4U2BA 1I6MA 1TMKA 2HY7A 4PLCA 1Y3HA 4WESB 4INAA 4CEHB 2P5TB 1GYPA 4INOA 2IUTA 2X8JA 5D3MB 2PUEA 1GRRA 3JAWB 3PNLA 5FEUA 2C4WA 2VDJA 3N2YA 3UQYS 4P1ZA 4EPXA 2ZATA 1XTJA 4ED9A 4UJ5A 2H54A 3E6AA 4RZSA 1YRBA 1A8SA 3M1YA 3T15A 1HM5A 2XLCA 2XODA 3AM3A 3FPAA 1FMTA 1G7SA 1DP4A 3E23A 3NOOA 4I5IA 2JD2A 3T0IA 4BP8A 2DQ4A 2GPAA 1REQA 2OAGA 3BGWA 4NLLA 4DAEA 4JI7B 2AB0A 1H4VB 1E1CA 3GLFA 4RV5A 3A1UA 4NVRA 5ENZA 3RS3A 3NEPX 2CXOA 1TB4A 4PVCA 5AD1A 4GO1A 5FO1A 5KNCH 4DQUA 2P9HA 3U4QB 5AUOB 3GPDG 2BGTA 2QLJA 3U31A 1XJ0A 1UAGA 2V1UA 2WE8A 1YVUA 4U7TB 2FRDA 4DBVO 2MSCB 4N5IX 2QF7A 5ED0A 2XUIA 2Q5QA 3A7EA 4FKZA 3UMVA 3EIUA 4ZYVA 2RHRA 2WINI 1C4KA 1DARA 3B6EA 1N92A 2PTHA 1Y4SA 2BFAA 3FM9A 1YC2A 3I72A 5CDSA 3RVJA 3H1TA 3QNUA 1LQ2A 4G0MA 3RSQA 1DRWA 4MH0R 1XQYA 3JRWA 4Q21A 3AILA 4AD8A 4CEIB 1DQYA 2CWDA 4WACA 4GX0A 4E22A 3DJYA 3DD1A 1VG8A 2GWHA 3B7GA 3GAZA 2FFAA 2QVGA 1KO1A 3AONB 1XU9A 4IEIA 4PANA 1AHPA 4PYQA 1GR1A 1CBUA 2QSZA 2R5FA 3DFFA 4MP8A 4GH5A 3ZHOA 1HNNA 4OBBA 5LQMA 3GPLA 3G59A 4DMFA 4NFHA 3QE3A 2QTBA 4BFYA 1EFRA 3AF6A 5LB2A 4BCCA 1TM5E 2AN1A 2XZPA 5I6DA 4EO7A 4ZT7A 5FAXA 1PYDA 3LLSA 1K3UB 2NV0A 4IDAA 4KRFA 3WDSA 3L92A 3OAAA 1NLYA 1QWOA 4GMDA 3KVOA 2J45A 3Q85A 4RV4A 4CW7A 1VHJA 4NEHB 2Z09A 1OT3A 5DM0A 3EXFB 3R7WB 4OQNA 3RW9A 3WFJA 3PHHA 2JEZA 1XPOA 2RI0A 5KTPA 3FBWA 4YNBA 1IWOA 3O2JA 2FWNA 2E6UX 1GITA 4CM6A 1PJ2A 4HDMA 4QL3A 4W1QA 3PSAA 1NJ2A 3ED1A 5LA6B 1FDIA 1OJLA 2VUSA 3JQ7A 1B74A 1QHNA 3OEHA 3FOZA 1EE9A 1PGOA 3DBIA 3CZAA 2VIIA 4B4KA 3MAAC 2Z43A 3KHKA 3PXUA 2AKAB 4ZARA 4HQNA 1PR3A 4TMZA 4N9WA 4ROSA 1OAKA 1DIOB 1KGDA 1MAUA 4Q1AA 2ATIA 2Z5LA 5ALEA 1UJ6A 4D42A 3FZYA 2C8VA 1QTRA 1ZGGA 2ZI9A 1LGYA 2Y1LA 3HLKA 2XMPA 4GPEA 4R9RA 1QIIA 1W6UA 5GQSA 1QZZA 1T0IA 2EZTA 3WYCA 1RXUA 4FJ1A 2IDZA 3DWEX 1A0OA 3RTBA 2A9OA 2P67A 1WZCA 3ROXA 1SKMA 3L1JA 4NWIA 4P4TA 1Z8DA 2IC5A 2ODAA 3ZWDA 4OGLA 4G9GA 1H3FA 1ISRA 1EBFA 1W581 3A6EA 1H2EA 3OQBA 4M37A 5DMXA 1SIUA 2LGJA 3DVLA 4BVHA 3AJDA 1T4CB 4JVNA 5EE0A 4UE2A 2VO1A 5DGIA 4DG9A 1XLVA 4MIYA 1VJ5A 5UKDA 3R3XA 2GAIA 5IT4A 3AGPA 1Y1KE 5E9AA 5GV8A 4DKJA 3SS9X 3X1JA 3FE2A 3QQ5A 4K3UA 3R7LA 1Y4AE 3FVTA 3IVGA 1FDOA 5ELMA 4WINA 3T1OA 5JZBA 1SUSA 3NYQA 3CBGA 5FT9A 3RTDA 4YB8A 1WWKA 4DT1A 1K7XB 3D31A 4DFDA 1Y1LA 1ZEJA 4LBWA 2JGNA 1SD1A 3AFHA 1A3CA 4PM4A 4AC9A 2FR1A 4AQYB 3ZOZA 4BIIA 2NUTA 2NXWA 4DLUA 3SD7A 2NUBA 1GLNA 3VKFA 1CLUA 4IO1A 4V0ME 3W79A 5IFKA 2GPWA 2O8NA 1TYZA 4FCCA 1VYTA 5JPCA 4IKOA 3IALA 3RUHA 5FR2A 4HDMB 4DA7A 2C78A 2GERA 4QBGB 3WV4A 5KO2A 4LZLA 4E3WA 3OIFA 3OG9A 2WYOA 4NQZA 3FOBA 3CJTA 5L4LA 2WIBA 4D0RA 2Q5HA 4IQGA 2I87A 2C61A 5KNLA 3M4JA 3FNBA 3ZBPA 5KDOA 5I9LA 1YZKA 4OP3A 2ZWAA 3UY4A 5EIHA 1VPEA 4YQYA 1UBKS 1Z0ZA 3PR3A 4REOA 3QENA 5AHXA 3LRXA 3GDWA 4B85A 1MEEA 4LMRA 4Y2HA 2KQUA 4H1TA 1V5FA 2E5FA 4K6OA 2PZ8A 2CKDA 1KR2A 4P38A 5BRAA 4JLDA 5HCUA 1HT0A 5K9ZA 5GINE 1ZVMA 5IC6A 5SYNA 5K0EA 3GJRA 1QP4A 4RY8A 5CT4A 4UHCA 2DRIA 2J0EA 4G01B 4R2IA 4JT9A 4YRTA 2EBUA 1A9QA 5JQGA 1LSJA 1KOJA 1A8UA 4X24A 2RJ3A 1IY2A 4GXQA 1YU9A 1VFPA 2M32A 2G5TA 3AH8A 3B85A 3QYPA 4OJQA 1ZL0A 5DLEA 5ETJA 2YJGA 3C5VA 3KQYA 4XRRA 4HBZA 3MWEA 5LDHA 3MWGA 5DTJA 2C9BA 3H4VA 4RD0A 4BVBA 1AGXA 5JXIA 2A1TR 1G8FA 1E9RA 3SC6A 3EXIB 1A1VA 4TZTA 5KNDD 1N5JA 1HG1A 4D6YA 2V6FA 1U8EA 1W4RA 2C58A 1RXWA 1XKQA 2QYHA 1RRFA 2R8BA 3N1UA 4UVEA 3VA7A 4ZOEA 1VIDA 4CV1A 2V3WA 5CX1B 4RABA 5EUCA 2OYRA 3P97A 1OCEA 3O8LA 3IOMA 3KHSA 1Z37A 2W4MA 3ORSA 2R25B 1HA3A 3T3MB 1FLAA 1CYEA 1DIGA 1VPVA 5MGBA 3FNRA 2COUA 2V74B 2LD4A 3D6HA 2GYYA 4MGZR 5IF3A 5AMXA 3WKAA 3JZIA 1XV5A 3TO5A 4LUCA 5AW4A 2YCLA 4G5FA 2AOTB 5FNVB 3UJBA 9LDBA 3KSBC 1FSZA 3WWPA 3OT5A 3NTRA 4RXMA 5FPQA 5LZ8A 5IXJA 1HZJA 1V1MA 4CPDA 1TVEA 2UKDA 5BOSA 1ZJ4A 2QI9C 4RD6A 1SKQA 1KK1A 2AR7A 3JAWA 3KYCA 1V6AA 3CTPA 2GCEA 2PQ0A 4L6AA 1RZ3A 3U60B 5KAMA 2NU8A 5A9SA 2NSYA 2PA3A 1BDBA 1QGZA 2SNIE 3BCHA 1W88A 3LZDA 3UG7A 1Y8CA 4FW9A 4JFRA 3LQFA 4IHJF 1II8B 3TW8B 4CT0A 5A1JA 4AQ7A 2OPHA 1CVLA 1E4EA 1KZ4A 5CDUA 3ZN2A 3L7KA 4CLXA 1RM4A 2ZE6A 1KK3A 1J70A 4Q3OA 4AVYA 1YAHA 4G25A 2CJYA 4N8SA 1P3JA 2X0IA 2VCYA 3AQ4A 4LDQA 5EAIA 3ZTYA 2X15A 1D6MA 1TYDE 4P31A 4N4AA 3QFRA 1YDWA 2UV8A 2ZBPA 4KWIA 1PKXA 3DO5A 1CE8A 2WHEA 2MCFA 4A26A 1J9ZA 1M9NA 2FPMA 3K0KA 1TUBB 2GXAA 4H6WA 4OM7A 1LDBA 3K0SA 1IY9A 1ZMTA 1W85B 2HGZA 1GNPA 4A73A 3CUYA 2R4QA 2PL1A 3G2KA 3GRCA 3OETA 4IXWA 3WTCA 2IECA 1JYFA 2ZJYA 2ATCA 4YJFA 2R6HA 4LZWA 4RF2A 2Q1WA 2VTVA 3ZI7A 5A06A 4LKRA 1M2GA 3H75A 2HNBA 5FPTA 3EF0A 1M2WA 3PZBA 2FKAA 4L51A 3U4IA 5D8DA 5B6JA 1Y8ZA 2ZG6A 3N9IA 4RDCA 1FYFA 1MB2A 2IHUA 1NTRA 5CR9A 4L4UA 4BO6A 2JLRA 1H23A 4PTYA 4QU8A 3V46A 4ESHA 1XZJA 3Q8WA 4L22A 2IE8A 4DUGA 2Q4BA 4JXZA 3VJMA 1X8JA 4UNIA 2R7AA 5L8VA 1PG5A 4RIGA 2I4IA 1JILA 3G2PA 3VR2D 2A6PA 1CU1A 3U4HA 4GBED 2F4NA 1GCGA 3NR2A 4DCPA 2D3WA 4BNWA 1MVNA 2H4WA 1G2PA 1W34A 1PSDA 3LK6A 5CT8A 2HA6A 2MSWA 2ZRAA 4L2IA 4QT4A 4DR2B 5K6RA 2M6KA 3LY5A 1T8TA 1ZMRA 3RM3A 5DLDA 5A62A 1G9SA 2GWRA 3KU4A 5AW6A 3ZX5A 4DQDA 1Y7HA 3CVYA 2GAFA 2GN6A 1R6VA 2P2YA 3ECCA 1V3UA 1ZIPA 1ZM7A 2HLHA 1DV2A 4H0NA 2HBYA 4M36A 2AC7A 2H29A 1PJCA 5CDFA 3HJRA 3ISVA 3SJAA 3G9QA 2DF8A 2V6JA 2VXYA 1QHGA 3OE7A 2FPIB 5DN6D 1A82A 3NXKA 1I5EA 2Q3JA 2PJZA 2HFJA 3KV3O 1U2GA 2QENA 4A0HA 4EARA 2GJKA 2H07A 2A3NA 2VF7A 4J4HA 3Q7EA 4LRTB 4QHTA 4M0KA 4V0LA 4PNEA 4MUXA 2NQ2C 1XD8A 2D5IA 2HKIA 5EL0A 1DTEA 1AA9A 2LE0A 3MGKA 1VFNA 1E0AA 1JMYA 1Z4PX 2QIOA 3UGQA 1E9DA 2VJCA 3TTXA 4MSUA 4Q4JB 1RKQA 4MW9A 4YP5A 1S1CA 2V54A 4LC9A 2BF4A 2HNAA 2OE2A 4HZGA 2VUHB 1CRWG 4K6KA 1V8FA 1IHXA 2NSHA 4GU5A 4UFNA 1Y6JA 2OK7A 5FULA 2GCGA 4JLOA 4TLCA 3HUTA 1KP2A 3PNBA 4YRMA 1LY1A 2J0QA 1RADA 2Q9AA 1CJKC 1V11B 4DF3A 2WWRA 1F4LA 3NETA 5KZMB 4DA4A 2Q6TA 4Q3AA 3MJ4A 2SECE 4BCDA 4PEVA 4PINA 3GELA 3DCIA 1VKJA 2VKQA 4X8MA 2D8MA 1ZA2A 1DZIA 4BOYA 4AJEA 5B7QA 3R3UA 2ZULA 3LTNC 3VO9A 1YWGO 2WFAA 1VM6A 2GZSA 2MSLA 3WGKA 1OYWA 2AF4C 3EMKA 4HP8A 4M0EA 4X5OA 2I5PO 1L4GA 1WXEA 2RKOA 3P2YA 2VG8A 5F2KA 3WLFA 2OVBA 4DCJA 1L5NA 2CXSA 5KHLB 2O2CA 1AUXA 5AVVA 1SHTX 3GZ4A 3MWEB 5SY9A 1GCAA 5DTQA 4OQEA 2VNAA 4GZLA 2E55A 3VDRA 3GGJA 3MWDA 3EG9A 5IKMA 4H15A 4NJEA 3ZKWA 4GI1A 2OM2A 4XCQA 2AD1A 4MKIA 4B5LA 1JHAA 1QQ6A 4G24A 2I78A 2PH3A 4F3YA 2G1KA 1CUUA 3BG5A 2P2SA 3QTBA 4FDVA 4JLWA 3DFKA 3LUKA 4KQKA 2FVXA 1F38A 2VDOB 1Z2OX 1DCMA 3EWAA 2GBFA 3ISTA 1GDTA 2HLPA 2X0JA 3L46A 1U31A 3GN1A 5KYKA 4Z0NA 4D9BA 3I23A 4WKBA 1W73A 1X1DA 4X1IB 1L5LA 3U0BA 1QKJA 4ANFA 3KPYA 5FP0A 1JPUA 4YJ3B 3FRIA 3O3NB 4IKEA 5H82A 2PSHA 5CG1A 1XEWY 3AB8A 3B12A 2L17A 1IY0A 2AZ4A 1B8PA 2BTOA 2P9ZA 1NPDA 1HDRA 4MUAA 4WY8A 3IPRA 4PQGA 4OMDA 121PA 3CIOA 1FTGA 4JLUA 2J6CA 4HBGA 3ELDA 4AMYA 4FSDA 3ER6A 5FKJA 3OQ6A 5GM2A 5BRNA 4EW1A 4N6NA 2J59A 3FDIA 1QP8A 4TV8A 5TGDA 3UN1A 3ZDEA 3ZHRA 3KAQA 2A5JA 2W2LD 1L9XA 2QLLA 3VPGA 3CJRA 2YWRA 4L74A 2OCAA 3AEQB 4ZU6X 2VZ0A 2GKSA 4QSMA 4Z99A 1FMJA 3QXHA 5HIJA 3TMAA 3I2GA 3ZY4A 5JSZB 1YONA 5U1PA 4RXUA 2PKQP 5EXEA 1Z4KA 5JALA 2XUGA 3RLFA 3H9UA 3ELUA 2G5PA 3RUFA 3UBMA 3SHOA 2PUTA 5GOTA 1E7MA 3U1BA 2G1UA 3LKBA 4Y2UA 1G6OA 2R11A 1BJRE 1QH8A 1V41E 1SD5A 1XHLA 3ABIA 3Q3IA 1XTRA 2NZ8A 5LLTA 2QMZA 4II2A 1QGUB 1YAJA 2ZGVA 1VJ0A 3ZWPA 2AXPA 2YX1A 2ZQYA 4C7VA 2IYPA 4PFKA 3W9YA 3JQDA 3UMRA 3PYMA 3GBSA 1TQHA 1YJXA 3E48A 4FI3C 2GDJA 4R84A 5AI0A 5LYJB 1HSZA 3MLEA 3KOOA 4WXYB 3L6OO 3PX3A 2ZRPA 4IMPA 3RS7A 3R0IA 4FCWA 2CL5A 1PFQA 3A3KA 4C0HA 4N8DA 4PR0A 3X1ZA 1S2DA 2JK1A 3V8PA 4YGYA 4TYMA 3UAGA 2ABWA 1DO0A 1VL1A 3AJRA 3G2MA 1OX4B 1W9HA 2YC4C 3KWLA 1BQ4A 3EXHA 3NWOA 2EBFX 4KQFA 1PIWA 1SIBE 1VBNA 1A97A 1UAYA 1Z6XA 5IBPA 5KNBA 3A4IA 3CEHA 4H08A 2XUKA 4L4ZA 3SLRA 1C30B 3GFFA 2OD9A 1TGVA 4CMHA 2FLVA 2OPBA 3JR7A 4Y2SA 4ZEVA 1SZJG 5L3RA 3UAVA 1YA4A 1TCVA 2R4UA 4MI1A 4BQFA 2QMEA 3OPYB 3AEUB 4TVOA 4ER0A 3KKPA 2VJMB 3ZR4B 1C41A 4KI7A 4P92A 5FOQA 4Q7KA 3HC7A 3AETB 3T34A 1Y3AA 3N7AA 1IMOA 1XZLA 4G2TA 2HMTA 1GL6A 1UKYA 3QKSA 4JJZA 1AH2A 4XH9B 2H8GA 1ZM3A 4M1SA 3X1WA 3TFOA 1C1HA 1EBBA 4XW2A 5IU6A 4LRUA 1V4BA 3MS7A 4POAA 3I5XA 4F60A 1YE8A 1NOIA 2DUUA 3IILA 2I2CA 2JHAA 1G5TA 2MOKA 2REBA 3H5NA 3UJ6A 2BMVA 3BMOA 4RA6A 4UTPA 3BL6A 1Q7GA 3B38A 3VZPA 4YDSA 4YFVA 4C4TA 4KX5A 3STTA 1IXZA 2AT1A 5ECWA 3ODPA 4CIBA 3A9WA 2LCIA 2QA5A 3U2QA 5L95A 2Z8ZA 4A2CA 1O0SA 3OURA 3H04A 1TA0A 6CHYA 3RUEA 2VHUA 3J81A 4U7PB 2R87A 3PC7A 4H2DA 3HU2A 3FPCA 3SSMA 1W7AA 4N18A 1GQSA 4G0XA 4N41A 3G1WA 4XYLA 1I80A 4DWVA 1OFTA 1UBUS 2GHTA 2GN1A 3PC6A 4L75A 5AKZA 3P9KA 3FB4A 5BR1A 4C4ZA 2HYDA 2N0SA 3V6LA 1E3WA 1SUIA 1VJ1A 2O3RA 2V4MA 3B6JA 3KCQA 3PNQA 2VK8A 3U4DA 2RHDA 3VAZA 2ZUUA 4PO1A 2UZ1A 4I19A 2X0RA 1ZRNA 2IIBA 2O07A 1V2HE 2YMLA 3L9XA 3AW9A 4R2LA 3SZLA 2YICA 3R2JA 4TLMB 4EOGA 5KJCA 4U9IS 4UDOA 3MZ0A 4X60A 3LBAA 3AFGA 4DV5B 1IBKB 1AB5A 3BMXA 4I4TB 4RVGA 4BO8A 5C51B 3QG1A 4V0OA 5D7NA 2RHOA 1J06A 3M2TA 3O1HB 4MWTA 3EQZA 4A36A 3F3YA 1KH2A 4I46A 1FNMA 2N46A 1SK9A 2YS7A 3NBMA 5CGQB 4CG0A 4EW3A 4ESOA 1GRNA 4LXHA 1Z82A 3PD1A 1RYMA 2A0WA 3GLSA 1M83A 1NMXA 3O47A 3SHTA 2R6ZA 3TPFA 5C5CA 2CFOA 1E5VA 2GX6A 4MRPA 1NY5A 1XO1A 3C74A 3HA2A 5HCIA 2HCBA 2W43A 4J0FA 2FHPA 1G17A 1Q95A 1SVWA 2VHEA 4G1CA 1APBA 2NM0A 3OZIA 1J1UA 3AIMA 3L8YA 4PC2A 4WI1A 4CM1A 2CVQA 1X7WA 3LY8A 1PX0A 3R5JA 1G1AA 1QX3A 4F4JA 3O8NA 3IGFA 3RHZA 3WB9A 4IVNA 2B8EA 4UTVA 5DGHA 3OUUA 5ESXA 3U62A 1N3LA 2AUMA 3I5UA 4MR7A 4DV7B 2D1FA 2PNFA 5KWVA 1SU7A 3GLHE 5KDLA 3INYA 4AKTA 3F5DA 4N48A 1VI5A 3VNQA 2ZWOA 3WWYA 2XGSA 1M54A 2WK1A 5AWFC 3WAKA 4D5GA 4N0MA 2QZ4A 4B3GA 2CXQA 1RHKA 1U0GA 2J5RA 4HVCA 3M7IA 3KXPA 5F9MA 1UFRA 3CX7A 1WQ3A 5DNVA 3NUZA 4H1HA 4Q4CA 3UTCA 1AC5A 3VYVA 1TIBA 3O4HA 2XRZA 4M0DA 1ZPDA 2OUIA 3PPWA 3OZXA 5BOVA 1DEAA 1M1YE 3QVGB 4CFYA 3KJZA 4JN6B 2XXAB 3I37X 1BE1A 3EZ6A 2CXUA 3H4TA 4F11A 5AR1A 3VR5A 4ZVTA 2WJ3A 2G6BA 5FQNA 2WM2A 5CLHA 2WI8A 1N6KA 3DT8A 1BJKA 3ROQA 1UFKA 2RK4A 5EIEA 3D2AA 5D7BA 4QPJC 4YP0A 1I9GA 4DCCA 3ESAA 2ZUTA 2O8EA 4UHHA 1R3UA 1L1RA 1RYHA 1Y37A 1YCGA 4GIBA 3L6EA 3JSXA 4JYZA 3HXKA 2C0CA 4EAAA 1XLWA 2FU5C 3G2OA 5JBIA 5DCWA 1C1XA 3KCNA 4HDQB 4D41A 1EDDA 2P5YA 1U2ZA 2HK9A 2JD1A 5JNUA 3A31A 4WFJA 3SXPA 1U0BB 2XA9A 1W76A 1TVKA 4FLFA 1MPTA 4II7A 4XWYA 1FDTA 4YDHB 3T1QA 1WUKS 4B09A 2XCIA 1FMLA 5HHTA 1WMSA 2I4LA 1BQEA 2HJRA 4UD2A 3F78A 4Z0PA 5EHXA 2A7QA 4TUYA 5BURA 4NYMR 1YHNA 2F1HA 4LF9B 721PA 4WXEA 3TLGB 4WNCA 4J43A 4KFCA 1X7WB 4U8HA 4WNAB 1ZD8A 2Q50A 2GM4A 5FWDA 5EA2A 2FSIA 4KWCA 2MYPA 3UXYA 3AR3A 3KKNA 4AMBA 5AQ1A 3DAGA 3CX6A 5K3OA 3L77A 3EUFA 3B7PA 3EEYA 4WUVA 1QOZA 4E5UA 4HPXB 5JZOA 2PS9A 1E0JA 4RD4A 1HNXB 2J6HA 3G5MA 1B00A 1D03A 1N5IA 3HFSA 3M89A 1VMKA 4IUDS 3EVBA 4BFLA 2WKQA 1X86B 1JXQA 2JEYA 4AYTA 4XJVA 1GPH1 3G6WA 4Q3KA 3UFBA 2V7BA 4D74A 3D4IA 1EXMA 4Y2TA 4YMTA 5ARBA 2NXNA 2WIKA 3JV7A 4F6LA 3P0IA 4G8DA 5NULA 5DX1A 4BECA 4QTYA 1T4GA 5DW3A 3HB5X 3H6HA 4Y9TA 1XD9A 5L51A 3LBFA 1U3CA 3FAZA 4IHJB 1BCSB 1DKPA 3KG2A 4CG1A 4F9EA 3ZD6A 3R9WA 1JWLA 3U3XA 1V25A 3A9TA 4BV9A 2FSPA 5H3HA 3E5RA 2C2BA 5CXSA 2I8CA 2KLBA 1Z4IA 4MW0A 3KEGA 3L79A 3ETCA 2X4IA 4XE5A 4JI0B 3GLKA 4GYKA 4BEJA 1H2XA 5FBHA 4HNVA 1U8AA 1RYZA 1I13A 2CDBA 2JIPA 3EC1A 3HP1A 2PU5A 3CKMA 4GVPA 5G53C 3Q7RA 1TUBA 1BRMA 2I66A 3PLNA 4JQSA 4P33A 4QGHA 4AG5A 1UBNA 3NM5A 1V96A 3C5CA 1JSCA 5J2TB 1L4HA 4O63O 2C5FA 4J3JA 2A5YB 3CZ5A 4WCFB 5E4YA 3GJ7A 4WVLA 3EH1A 4N7RA 3DR3A 2ZIWB 2VPWA 2AWOA 4I55F 1QR2A 3KPUA 5I7AA 1VE5A 2NWQA 4C21A 2OCKA 4X41A 4NG4A 1V1JA 3MTAA 3RAJA 2ZVQX 1E62A 6NULA 1P73A 1JHDA 2MT9A 5FJJA 4MHTA 3NKFA 4YXWA 5BPFA 2QUIA 2LIVA 1VGRA 4E5SA 2QNRA 5H4HA 3ZTWA 1S2MA 2GZHA 4BEBA 4NBVA 5DM2A 5PGMA 5GP1A 5TIIA 4PSCA 2H1OA 2Y1WA 2II6A 1P2FA 2BFFB 5IVPA 2QD2A 2A0YA 3IAS6 3PQCA 4JGBA 3OX2A 5F5LA 4ZJZA 5K7SA 2XNDD 2FZKA 2EGHA 4G85A 3SDSA 1K4YA 1Y81A 2B6HA 2BKAA 5DM70 2PGDA 3OPXA 1HL7A 1TJ4A 2C1XA 1V2GA 2Q5OA 4M8SA 1CNFA 1DT3A 3ZTTA 5CIYA 4YACA 1L5MA 3DZHA 1XZGA 1VZ2A 1KPHA 5FUBA 1U9ZA 3PPYA 2R2AA 4FGWA 4JIMA 1T1JA 1EHIA 2BFDA 1ZSNA 1U8YA 2C57A 3JQQA 2XVMA 3D0KA 2G9ZA 2AFVA 2QL6A 1H2ZA 2CLHB 1JEYA 1HGXA 2OCLA 3H86A 3LK7A 3BFKA 3P27A 4WLNA 4LGVA 1RLOA 2XE6A 1FXSA 3NHUA 1KYXA 5G4KA 1NI4B 2XNDA 1GLVA 2A9QA 5AVOA 3D0RA 3OTWA 3VR6D 3WGGA 2GXSA 3EN0A 1A9RA 2GOYA 2NIPA 3E61A 3F6YA 4ILKA 1BAPA 3HCDA 3SOZA 3ITKA 3HKEA 3KQMA 4QSHA 4IINA 2C8KA 4HNHA 3CCBA 1GDHA 1KVSA 5D51S 5DGXA 4AN1A 5LQRA 2PIDA 3DMDA 5K51A 1V4NA 3RVQA 4D6XA 2FI1A 5EJ5A 3DDWA 1F3LA 4GEGA 1SKBA 4IV0A 3ABQB 4Q15A 4LRWA 4URXR 3QKRB 4BHRA 3L40A 5JPIA 3L06A 3D6VA 3NW9A 3QPWA 5HF6A 1L7BA 5IP5A 3II6X 2AJTA 5BVGB 1QIMA 1KVQA 3T7RA 5A5EA 8MHTA 4JA0A 3FMFA 2ZJ8A 4LIPD 2G5CA 5CJPA 3U4AA 1FJGB 4GQIA 3TL6A 4TXHA 1DI0A 3TAUA 4F21A 1ZITA 1VHLA 1A5AB 1CZKA 1WDKA 3Q6IA 3CPSA 3ED5A 4KYIB 1TNDA 4OK3A 3KSMA 1X77A 2BJWA 3GJSA 4IQ0A 3U17A 5AUQA 3C3EA 3ELWA 3L6BA 3VSAA 4EG0A 4GQBA 3O1JC 2BMJA 1NVBA 3ND8A 2FFBA 2RIPA 3I1IA 2WTAA 4LE2A 1EFCA 4L95C 1RYEA 2G17A 3STUA 3SJUA 3QKWA 4ZVRA 1BA3A 5BSHA 1Y98A 3K0HA 2PYIA 2W42A 3W1EA 1OC2A 4CGYA 5BWMA 1T5TA 4R8SA 3JTEA 3ZX4A 2BCJQ 2WDPA 3L01A 2UYGA 1SELA 4GQAA 4X1IA 3BZWA 4CUKA 3ZJYA 3OSZA 3AHEA 3I6BA 1U2TA 4NSNA 3I5MA 3LCJA 5KTOA 3O84A 5TSDA 4BVEA 4RZ3A 3DM9B 4JAVC 1JR3A 1E61A 3X1DA 1XXHA 3GZTB 3K9LA 4EY4A 5LMUB 2RCYA 4HB0A 2O7RA 3HSKA 1CUIA 2E9SA 2H2AA 3W2TA 4BQRA 1Z88A 4DV1B 3OIUA 3NM4A 4XWKA 4NNOA 1ZD5A 1TUGA 1KDPA 4XX0B 3TZ6A 1U5AA 4YJ2B 4JYBA 1HYHA 1H22A 3KUKA 5FTKA 4FOTA 4PZYA 1M7HA 1RRMA 1TYEB 2R5WA 4G1EB 3S7ZA 3NTQA 3SZOA 3UCEA 5CCEA 5EHNA 3WQQA 1U6KA 1PEDA 3CH6A 4ACBA 4RKRA 3VU8A 3I42A 3FMOB 1L2TA 3AF4A 1CNEA 1PEAA 4IFEA 4NYMQ 2IEYA 1O94D 3C3BA 1RHMA 1VJCA 3AFNA 3E4DA 3GEEA 3KUDA 4M8LA 4UVIA 4YAJA 4K0KB 1KOFA 1NW6A 3PJDA 1ODKA 2CDCA 3TQSA 5KWSA 1PYGA 2YVUA 4D82A 1TL7C 4NL4H 2BZSA 4ZOQI 2YNMD 2AX4A 1A9PA 2G28A 4GSKA 4N3AA 2QSJA 4ZJUA 2P62A 3A28A 2EBHX 4L07A 3MTJA 5A2GA 1VMDA 1J8YF 1S8NA 3AOEC 3OIVA 1D3AA 1XELA 4BB5A 1ARZA 1LVGA 1CY2A 2EJVA 3KS9A 3OC0A 4MWSA 2WLTA 3JATB 3ONNA 3RUAA 4MW5A 5DJ5A 3VPXA 4IIXA 4PN7A 2NVUA 4MS4B 3EIWA 5CNIA 1TLLA 4LXIA 4IYRA 3I0NA 1LXCA 2QTGA 1HO3A 3OEHD 1NJGA 2WOJA 1SZDA 4QOJA 2QRQA 3TNFA 1Y5RA 1AN9A 5AVJA 2HAEA 4GRIA 5FTJA 3PNPA 4X45A 4MKRA 1CT9A 3SF8B 1C7RA 1ULAA 1S2OA 2O0LA 1CY1A 1RBMA 1TXGA 3GGGA 2VNSA 4IMIB 4YBRA 1J5XA 2ZUEA 6LDHA 1AZLA 1XQ6A 4FFMA 2E4XA 3QE9Y 1O7JA 2XUQA 4QGGA 3BF7A 1WD7A 2I65A 3CLTC 1ACJA 1XIVA 3A4VA 4NBNA 4NICA 4EZEA 4MWDA 5I7VA 4Y2GA 3WQHA 4LJ9A 4ZYYA 1N0VC 3UV6A 1WAMA 3FWHA 3CO5A 2VDWA 1GSHA 1CR6A 1E2HA 4J29A 4BDSA 4EJSB 4DLXA 4Q4LA 2VPYA 2G8LA 2NYAA 3F7MA 3QE4A 4QAJA 3F6EX 4MV1A 2BMDA 1QVRA 1BN6A 1W49A 5HM6A 1N7HA 3GMDA 5JFGA 3UCXA 3N8KA 3LUPA 3TNDA 3KXLA 2JGDB 1D09A 1M2HA 5JAUA 4KHPB 2DBYA 2QRKA 4UEQA 1HTTA 1YCFA 3HDVA 5DK6A 1YBFA 1VHTA 5A4JA 1KO7A 4WZAE 2WWYA 4GF5A 1OFVA 2A5LA 4ZFNA 2ZITA 3EJWA 3HJTA 1TKBA 2BM0A 4EECA 4P7FA 5EKXA 3LOPA 5C34B 1P17A 1D07A 4JLJA 5KWIA 3FTDA 2FG7C 3TQTA 3PHCA 1QPBA 2GN2A 2ZP1A 1TT5A 3BJMA 1O95A 4V1CA 5FO0A 3NAQA 3L0CA 3D1LA 3TIIA 4OTZA 3EUEA 3ZK9A 2G3DA 1U6IA 1GIAA 1M0SA 1X7YB 1XCLA 4G4GA 1PFKA 1K6JA 3ELYA 3O4FA 4YECA 5FFFA 5EHQA 1AV6A 2OHIA 4IP0A 1A7AA 3N76A 3D6AA 4FDUA 4MCJA 4D9IA 2W98A 5IULC 2C96A 2RDMA 4J2OA 1R12A 2BKLA 2ZCVA 1G8YA 3DOCA 4MINA 3GLGE 1QIHA 3QWAA 4FWTA 5IAOA 2AMFA 4IJKA 3W6ZA 5KVVA 4PZAA 3LYHA 4X6YA 2PEZA 5IT0A 1NJ6A 3VNVA 4R51A 1RABA 1VKZA 3UENA 2V7WA 5AW9A 4R0VA 1TC2A 3GWZA 1SEVA 1WS6A 1ZH8A 3O8BA 2JLYA 1B7GO 4O2BA 5AM3A 3RHFA 4HH4A 5CUQA 1FMCA 3EUWA 4L7QA 4BKQA 3ZWVA 3VBCA 3ZLVA 4KE7A 3KQHA 2XOEA 5KOYA 4B46A 1XKTA 4PZEA 1AGRA 2H00A 4B40A 1UQTA 4LI0A 3NHMA 5LZ5A 2W6JD 3FOEC 3GT7A 1UBRS 4JR1A 1VP9A 2PBZA 3O4IA 1FZQA 2GBCA 3AWIA 4BB0A 4FGSA 4C5CA 4LYYA 3UK2A 1RFGE 3G7UA 1H85A 4HNRA 3UT5A 4QRHA 4ADSG 1V7QA 4AI6A 1US8B 4O3FA 3AEZA 4J03A 3AP3A 2PKXA 3OD5A 1VIVA 4B3SB 1QLJA 2VR1A 2BGKA 4FKMA 1G7CA 2XYHA 2ZBGA 3TAHA 1SCIA 4BNJA 2CLOB 2Q0XA 3R6DA 4UEJA 3D4BA 4UEOA 1VSQA 2BC9A 2NU7A 1WMEA 2UZIR 2QD4A 2Z8YA 3WYEA 4DJEC 1NRXA 4EB3A 5JH7A 2Z98A 4KXLA 5DPMA 2ZBQA 3RIMA 1OJ7A 4KDCA 3SLKA 4XWOA 1YMUA 4FDLA 4NZZA 3IAM6 2VPIA 4C43A 3IAAA 5KWEA 1BN7A 5DI3B 3NUQA 1VSUA 1Z2EA 3OO0A 1DIAA 2FW8A 4HY3A 2IYXA 3GUVA 4O4IF 4RCVA 4ZRMA 5F52A 2IHNA 2ESRA 2VNJA 3LYLA 4KUGA 5GAJA 2FWAA 2FPKA 1E9AA 2AG6A 3R3JA 4GYYA 1ZIOA 2WHYA 3BCRA 4UU0A 5JTTA 3RHSA 1XCMA 2QJTA 2VSYA 1NC3A 2NXEA 3ZDFA 1OKKA 2ZUCA 3I04A 3HDTA 5D86A 4BQPA 4RJTA 5KYYB 5EN4A 1YRYE 3KJFA 1I9CA 1K3TA 3PPIA 2VF2A 2E4UA 3I64A 4TS1A 3CLTD 1OY1A 3QHQA 2C8JA 4KQ2A 2Z6QA 4QYWA 4EG3A 3BF8A 5FNVF 2ZROA 3A1NA 3VHXA 3VZSA 4HFNA 3FR7A 2DWQA 3AC0A 1W0KA 2Z9BA 2DPMA 4RJ2A 5E3IA 3VI4B 1E20A 4R01A 5EIBC 3V5NA 4BNIA 1T8RA 1HT1E 3GHYA 1ITZA 5KOHB 5A3JA 4J3FA 4F72A 3NIDB 3G5LA 4UZFA 4RFLA 2ZYWX 3B70A 1NKTA 1UKAA 1AU9A 3C6BA 4G41A 1A9XB 3AZPA 3FGNA 3WMFA 2J09A 4XD7D 1BE6A 1R6AA 4TT3D 2FPWA 4TZKA 5C3MA 2EFGA 3LQRA 3TCXB 1XCBA 1RC8A 1CS0A 4HDNB 5CFRA 4IIUA 4J1TA 1IIBA 2IYRA 4ZZ0A 4N6OA 4YJKA 3TQFA 3CISA 4Z7QB 2TSYB 2WZBA 2YVKA 4Y2PA 2B98A 2OO7A 4DPLA 3MGAA 2VDUE 1NJ5A 3KJXA 4H9GA 1M67A 2BEUA 4IR7A 3I9OA 3NRJA 4Y1GA 2OENG 4CM9D 3LM8A 1RFLA 1IM2A 1V8OA 2ZETA 3NHAA 2EJTA 4ZDIA 3ZWAA 3JARA 4BMOB 2Z3VA 4Z4EA 1IXYA 4FR0A 4FTWA 2FKNA 4R8KA 2JCVA 1HKUA 1YK1A 1TD9A 5LWHA 5GJCA 1C9DB 1JKJB 4PE5B 4FGKA 1Z5OA 2A5DA 2F17A 2QP9X 1W0JD 2SHKA 5J23A 4B4WA 2QM7A 4OSEA 3OF3A 2Y0CA 1KS2A 1QRRA 4GWKA 2QN2A 1UQRA 1VQ1A 1Z0SA 2P65A 3D4LA 3WS7A 4CCSA 4CTNA 4WZAA 4OMCA 5BW4A 1F51E 1FYVA 1DG1G 4MYCA 4P93A 5G1NA 5HOEA 1NVGA 1NU8A 1M5UA 3FZQA 3I8XA 4AJLA 4C78A 4MJXA 4F06A 1AKYA 4C6RA 3U09A 2ADOA 4PHGA 4YCMA 1G7RA 3OF2A 3OZUA 1AF4A 1JQ3A 2VYND 5BV2P 3KKMA 1F6WA 5BSFA 4PLVA 1ZVVA 4OLHA 3BC1A 5AOBA 3OE4A 1K08A 3OZSA 4NBWA 2FRXA 4GM1A 1HYQA 1IQUA 4EBFA 1D2MA 3QUCA 2C1EA 1RWNA 2GUGA 4A0SA 3Q3VA 1E1QA 3M1LA 4I4LA 2C9MA 1L7OA 4FHDA 3O9ZA 4J07A 3PJFA 2NT3A 2WSYB 4Z5XA 4C07A 2D54A 2VHVA 1JNYA 2POQX 4BFCA 2HCTA 3B89A 1BZYA 3W7VA 3AR7A 1DX6A 2OLEA 2I33A 3VHXB 3H7IA 1KS9A 4Y2JA 2CUZA 5DYNA 5TS2A 3EF3A 3UFXA 4QQFA 1UT8A 2ZRIA 5IDVA 4B4UA 1F4PA 1P5JA 1T6ZA 2JAOA 3DEIA 4KE6A 5EJGA 3VZBA 3EPLA 2PSSA 1FK8A 4O2AB 5F1OA 2IHJA 5H80A 3UMMA 3AR6A 1RJ9B 4IGAA 4QFDA 1X1TA 3RU9A 3RF7A 5DBGA 1C7EA 3ICQB 2ECQA 2FSVC 1MABA 2RI6A 3I5AA 1V48A 1Q91A 4U0KA 1XVLA 1TQ4A 4F8YA 1IWBB 4M0CA 2BJVA 3PICA 1CZUA 4AL4A 2H4YA 4J1SA 2HREA 4QBHA 1P7PA 4DLPA 2WMNB 3M5PA 3NOQA 2PAFA 4DN6A 4FILA 2F8TA 2RHCA 5FLYA 1CPYA 3AV3A 3EDRA 4JNCA 1EGAA 4RLFA 1SCAA 4LQLA 4UAVA 2FPLA 4LYGA 5AVSA 3ICEA 2PWBA 2WWWA 4GUDA 1RLIA 4MQ6A 2C5BA 1LCIA 3DLTA 2GBLC 3RBZA 4OX9B 1D1TA 1RVDA 1L9KA 1Z0AA 3ZD8A 1I3NA 4K9MA 1RR6A 4NCHA 5H83A 2DB3A 4EL5A 1KK0A 2P9BA 2ECPA 5IG2A 3CC8A 1MB9A 2XCLA 1EFPA 3UEOA 1J8MF