3MXTA

Crystal structure of pantoate-beta-alanine ligase from campylobacter jejuni
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
283
structure length
283
Chain Sequence
AMQVITSVKEAKQIVKDWKSHQLSIGYVPTMGFLHDGHLSLVKHAKTQDKVIVSIFVNPMQFGPNEDFSSYPRDLERDIKMCQDNGVDMVFIPDATQMYLKNFSTYVDMNTITDKLCGAKRPGHFRGVCTVLTKFFNILNPDIVYMGQKDAQQCVVVRHMVDDLNFDLKIQICPIIREEDGLAKSSRNVYLSKEERKASLAISQSIFLAEKLVREGEKNTSKIIQAMKDILEKEKLIKIDYIELVDFNTMENIENITDNVLGAVAAFVGKTRLIDNFLVQGLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Pantoate-Beta-alanine Ligase from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni subsp. jejuni
molecule tags Ligase
molecule keywords Pantothenate synthetase
total genus 91
structure length 283
sequence length 283
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2010-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3mxtA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3mxtA01
4UZFA 1TEZA 2RE8A 3AL0C 1O6BA 3QE4A 4ARIA 1F4LA 1QU3A 3PXUA 1WQ3A 2QJTA 1Q15A 4K03A 4ND6A 2ZP1A 4U8HA 2VTBA 2IP1A 3ZUGA 5JBNA 1XNGA 3HMQA 3CLUC 4EG8A 4ZCSA 3SZ3A 1P7PA 2HGZA 1OBHA 5TEVA 2CSXA 3RJZA 1MRZA 1KQPA 1TYBE 3FNRA 4ZCRA 2YXNA 1NYLA 4MUKA 4YBRA 4XFDA 4MQ6A 1TYCA 4XSVA 1YULA 1QU2A 1WKBA 2RD2A 1N75A 1GTSA 1EUQA 2A7XA 1A8HA 4JFAA 3IDFA 1ZJWA 3RHSA 1RQGA 4MWBA 4AS1A 3JXEA 3ZJTA 1JIIA 1YIAA 4XFJA 2DR2A 1VBKA 3SYTA 4EG6A 1NZJA 2H29A 3C8ZA 2A4MA 4PBTA 4MVXA 1QTQA 4NAUA 2QUKA 1KP3A 4MUFA 1JIJA 3H9CA 2X3FA 1GAXA 3COYA 5H16A 2YWCA 3IMCA 2Z3VA 1IHOA 1KH3A 2GM3A 3RK0A 1QJCA 3SZGA 1JEDA 4KR7A 3P0JA 1U0BB 1MAWA 1T6YA 4S1OA 4MVCA 3N05A 4J75A 5FO1A 1YUNA 2GKSA 3GUZA 1V47A 1EXDA 3SDBA 1VBNA 1JMVA 4MW5A 4ZCPA 3AG5A 1KAQA 2QJFA 1EFPA 1KH1A 1V8FA 2G36A 2X1MA 1OWLA 2A84A 2A88A 1MBZA 4I6JA 4F3RA 4JZYA 1O95C 3CLTC 1PFWA 1GN8A 3ZXSA 3Q4GA 1MAUA 1H3FA 2J09A 2CT8A 2E18A 5IJXA 3TZLA 1MOPA 3IODA 1K4MA 4DDKA 1LI7A 5LM3A 4U7JA 3S3TA 1IQ0A 4KPUB 3MMXA 1K4KA 1ILEA 2X1LA 3H05A 4MVWA 3TQIA 1O0CA 2BYTA 3ZJUA 4YP5A 2PZBA 2J08A 1PG2A 3AFHA 3FHJA 1XNJA 3KT8A 1CT9A 3LE8A 4TS1A 1M8PA 4BWVA 2BTEA 1PFVA 4AQ7A 3FWKA 1WJGA 5F23A 3SP1A 4F4HA 1Y42X 4L2IB 3E27A 3COVA 1QRSA 3H99A 3X1MA 1JIKA 1J70A 4WNYA 3FH0A 2ZUFA 1GZUA 3FI0A 1JZSA 2DEUA 1NURA 3G5AA 3TQOA 3FIUA 2JAXA 3X1JA 2A1TS 1NUSA 3OTWA 4MVYA 1I6MA 5J59A 1ULHA 1WXGA 1ZH6A 1NI5A 1WY5A 3ND5A 1N2EA 3IH5A 1U7DA 3ZJVA 4HJRA 4R2LA 1IH8A 1YI8A 1VLHA 2WQ7A 1YUMA 4NZPA 2CYAA 1QRTA 3K32A 5HUHA 1KORA 4MWEA 4EGAA 3G59A 4ZT5A 1T9GR 4MULA 1MJHA 3IUBA 3ZIUA 3ZXIA 5KWVA 1O96A 4WSOA 4MWCA 3ND7A 4QREA 5KHAA 3Q12A 3SEZA 4MW6A 1R6TA 3U1VA 1U7XA 1I2DA 3NBKA 4FZJA 4MUNA 1EJ2A 4YMIA 1EUYA 4KKVA 2CV2A 4DDHA 3VRHA 2JA2A 3FG9A 1F7UA 1Q19A 2PIDA 1M1ZA 4MW2A 4JXZA 5AHWA 4MW4A 1O96B 4MUEA 1KP2A 4NX2A 3HV0A 2E21A 4JYZA 5EKDA 1NUTA 2I1LA 4L2IA 1FFYA 5HG0A 1M8FA 4MW0A 3CVWA 4ZT3A 3K9WA 2CUZA 3CLSD 3QTTA 1N2GA 2PZ8A 2J4DA 1F7VA 1HYBA 3F3MA 2QTNA 1IQRA 1OWMA 1T6XA 2DLCX 1XJQA 1D2RA 2CV0A 4DLPA 3D6UA 4G5FA 3HZRA 3LCJA 2DERA 1EFVB 4OUDA 1TYDE 4G6ZA 4CDMA 5TGTA 1G8GA 1O5TA 4GU5A 1O97D 4MW1A 2CYCA 3NV7A 3P52A 1QQTA 4EG3A 3CLRD 5KCMA 2GOYA 3A4IA 1GLNA 3QTBA 3UK2A 3FY4A 5IHXA 4OJMX 2V0GA 2D5BA 3AG6A 2DPLA 3KFLA 5HUJA 3TNJA 5FO0A 4ZCQA 2NSYA 3I05A 4MW9A 3CVYA 2OQ2A 4DDMA 4MUHA 1O0BA 2WSIA 2AG6A 1OWOA 3CLRC 1KAMA 1ZH0A 2CYBA 4HK4A 1WXFA 3X1KA 3TS1A 2AKEA 3CVVA 5LLTA 4KR6A 2B7LA 1N78A 3KT6A 1K97A 3IMEA 3GMIA 2PFSA 4R2MA 3KT3A 1KQNA 4A91A 3MLBA 1Q77A 2O5RA 4MLPA 3P0IA 1R6XA 3AIIA 1NUQA 2QUHA 1M8JA 4Q16A 1NUPA 1WQ4A 1Q11A 1YIDA 4PBRA 1KH2A 4ND7A 3UOWA 4CQNA 4JXXA 1DNPA 1UFVA 5DK4A 4G5YA 1M83A 1XNHA 2Z08A 5DASA 3DO8A 4K0RA 4RUKA 1K92A 3IOCA 2EL7A 4KPUA 4ZT2A 5K0TA 3CVUA 5BNZA 2EJCA 3CA8A 3IVCA 1I6KA 4ARCA 4MAFA 1I6LA 3IOEA 1EFVA 1NUUA 1M8GA 3N9IA 4MW7A 5K0SA 1GPMA 3OP1A 2JANA 4EG7A 5LFAA 2VTBB 3TZEA 3IMGA 3CLTD 3CVXA 2OV4A 2J07A 1U3DA 1PG0A 3KT0A 1H3NA 2XRZA 2Z09A 1G8FA 4EG1A 4HPWA 4KR9A 2QUIA 4DE5A 3UMVA 1T6ZA 4OUDB 3G6KA 2ZUEA 1ZUNA 1O94C 4MUGA 2VXOA 3FOCA 1N2HA 2C5SA 5DEOA 4PBSA 4U63A 5FNZA 2DXIA 1EFPB 1WXEA 1J20A 5TS2A 4QRDA 1FYDA 1TFUA 2O8VA 4ZT4A 1N1DA 1LI5A 1IRXA 1WZ2A 1TQ8A 2PG3A 1WOYA 2CFOA 1H3EA 3A04A 4DJAA 1VL2A 1T9GS 3RFFA 1WXHA 1G8HA 2A1UA 2PZAA 2IJGX 1OBCA 1U3CA 2A1TR 2XRYA 1OWNA 3IVXA 2E89A 3L92A 4MWDA 3VGJA 4QBTA 3MLAA 2D54A 4I6GA 4DNXA 4CDNA 4GRIA 3RBAA 3CR8A 2H2AA 3CLUD 3Q10A 3DPIA 1R6UA 4HJXA 2YY5A 3AKZA 2V0CA 3DLAA 4YP7A 1COZA 3ELBA 3IVGA 1X6VA 2E0IA 1MB2A 1N2OA 1MC1A 3HFJA 1O97C 3FETA 1OWPA 2J5BA 3BL5A 3HL4A 2A86A 3L93A 1O95D 4E1AA 1JGTA 3D6VA 3RK1A 4P2BA 1KQOA 1JECA 1J1ZA 1VBMA 3FDXA 1H1TA 4NAHA 4YP6A 5TEWA 1X8XA 1N2IA 3UC5A 1J09A 1JILA 1J1UA 1QNFA 3COWA 2HZ7A 3ISJA 3PNBA 3PNYA 4J76A 4UZEA 1M8KA 2A1UB 3IUEA 1NSYA 5DB4A 4X0EA 1N2BA 3ZGZA 1IQUA 3GLVA 3PNVA 4EF6A 2WQ6A 5J5AA 4CT0A 1PFYA 2QJOA 5J58A 3COZA 1LW7A 1O94D 3P0HA 1B6TA 4NDAA 4PY2A 5H7XA 1N2JA 1MB9A 3ILVA 4R0NA 1OD6A 1F9AA 4I6EA 3INNA 2IELA 3MXTA 3UY4A 2WB2A 2X0KA 2YWBA 2AZXA 1S4MA 1G59A 2DETA 1JEEA 1JHDA 4MUIA 4H3SA 1GTRA 3CLSC 3N2YA 4MUJA 1BS2A 4EG5A 4ZT7A 3NBAA 3H9BA 1EE1A 1QRUA 1TYAE 1N77A 4RPIA 1KR2A 3VU8A 1J21A 2DUMA 4ZCTA 1WXIA 3SEQA 2QTRA 2NZ2A 3N8HA 4NATA 4Q93A 3DV2A 2D13A 3A2KA 3A05A 3IOBA 1N3LA 2PXHA 1KKUA 1IVSA 1JZQA 2HMAA 3PRHA 4ZT6A 2R5WA 1PFUA 3LOQA 2CV1A 1IFXA 1NP7A 3HGMA 4EG4A 2QUJA 3MUEA 3M5WA 3H97A 3ND6A 4EFKA 1SURA 2QTMA 2TS1A
chains in the Genus database with same CATH superfamily
3PWSA 4YRLA 3A4VA 4P7JA 3JQ8A 3WK8A 4C7MA 5G4KA 3ZKWB 3VPGA 3ZU4A 2RDMA 3BGIA 2FZCA 3QBVA 5GIOE 2R7MA 2OXTA 3VR4D 5IYZA 4OQLA 1AGRA 4OP3A 4QBHA 2DFKB 1WZUA 2ZLBA 3S2UA 1RXVA 6CHYA 2Q4EA 1V3UA 3FGOA 1NTOA 3L4SO 4Y1EA 1OT3A 2VTBA 3ZUGA 2DFDA 1KDTA 1GZ6A 2R8BA 4A6DA 4UTVA 1ECBA 2XUDA 3GEMA 4QZVA 1NONA 1YHNA 2BKEA 3TVDA 3WMRA 3CFHL 1AX9A 1BGXT 1CY4A 1ZOPA 4YPVA 4FCWA 3NHZA 3QVOA 3IYLW 4GMFA 4GOMD 3REGA 4ZCRA 4E4TA 3NIWA 1XVIA 3LF2A 5JJIA 2BI4A 4N18A 3N8NA 4JOBA 1TMOA 1CY8A 1GL3A 1T29A 4E7OA 1C29B 5D5HA 1CW2B 1W9MA 4HWPA 3WWOA 4AZ3A 5CIYA 4DLVA 1EYZA 1IATA 1ZOOA 3EDCA 2KW5A 3CNNA 2EG9A 5TNXA 1G1AA 5AR1A 3V8PA 2RHTA 3O3OB 2BUAA 4J0FA 5TGZA 3O8OA 5THKA 3ZH2A 4C2BA 3KJXA 5JPDA 8OHMA 3HFGA 4I3GA 4K8OA 4D3FA 1DAGA 4HRYA 3GLIA 4RS4A 5IDQA 3HB5X 2AJBA 3RREA 4MGZR 3NVMB 4P36A 5LZ7A 1W0KA 1YA8A 2CJYA 2WICA 4I14A 3UEOA 4CCYA 4A0HA 3TW0A 1QFZA 5L45A 1SVKA 2LCFA 3BF8A 2E1RA 5I9TA 2JLWA 3COYA 3DAYA 2LTAA 2ZYVX 4FE7A 2QN3A 1JBKA 4INPA 4YJGA 3D81A 3IMCA 3K9NA 2VTKA 4J94A 1U65A 4LV8B 4N7MA 4RVFA 4YRZA 1SQFA 3Q1LA 2LMEA 1E3SA 4M0LA 3UJHA 2V1UA 5HK9A 3EZ6A 1RHKA 1U28C 1JFSA 1TVKA 2I2BA 1I5RA 2YVQA 3GPCA 4WE3A 1B3BA 3U7QB 4ZXPA 4XYGA 3P0JA 3V8MA 5IPFA 4LE2A 4C5CA 4FBMA 1YZLA 2YV4A 1A1VA 3N05A 4AJ9A 2GRJA 2KBFA 3U60B 4TWBA 4HG2A 3Q85A 5FA5A 1PDWA 2HL6A 5IULC 5LUAA 4KXQA 3RSOA 4D9NA 4IIGA 4L27A 5ALQA 2K2QB 3ZE0B 1D4FA 2YZMA 3O38A 2CW5A 1Z63A 2XYGA 1V8FA 2K6GA 4KG7A 5A7GA 5B7NA 5BV8A 1PS0A 4BE7B 1KK0A 1QLHA 3GRUA 1BWPA 2QT9A 3WSTA 1G21A 1T3TA 4PFKA 4D9JA 2GLTA 1WBDA 4M9XA 1H3FA 1GJRA 5EFOA 1POXA 4ZAVA 4B09A 3NWJA 4DY6A 2WNHA 3K09A 3O3NB 3UBMA 3MMXA 4TTSA 1HYEA 1PNQA 4HR7A 3RF7A 3HA5A 3H5OA 3HSYA 3PXAA 2ZSJA 1XN4A 1X7GA 3EVDA 1PR4A 3LA8A 2GHTA 5BSMA 2JIZA 2DFTA 4HDQB 2WAXA 2VQ3A 1EIWA 4LSZA 1FRQA 1WJGA 1WV1A 2PMWB 3QKWA 4Q7MB 4QTZA 1Q0LA 2A3NA 1IK6A 4BQRA 5LL6P 1C0LA 2QU7A 4HAWA 2QZJA 1N5MA 1BE6A 4HQOA 3GLGA 3PBKA 3MD0A 3P4XA 2DE0X 1IZ9A 3DBVO 2WT9A 2JLVA 1ODFA 4GW3A 3TQQA 3LFHA 1IEQA 4EYQA 4QHTA 2ZB2A 5H1YA 2Q0SA 2O7QA 3AB7A 2WJVA 3TWOA 1OH6A 4URYR 4ZK6A 3FD8A 1V0JA 2NZYA 3DFUA 5E0KB 3C3BA 3QOYA 2OZLB 1WBJB 1YR2A 1WXDA 3N6XA 2GARA 3X1JA 2YS6A 1W48A 5JR3A 2DPMA 1DTEA 1TJYA 4BEWA 1DDGA 3JD2A 4ZZ0A 3NVDA 5G0UA 4M1OA 4FEAA 3ZNQA 1CR4A 5JNUA 3ZHSA 4MDYA 2WSSD 3IBGA 4Z3KA 4F3YA 3SKVA 3KLPX 1U9ZA 2BI8A 2CLOB 8ABPA 3N7TA 1NVVR 2ZJ0A 5B1HA 1NLZA 1GSOA 1PWYE 1T1RA 3TS1A 4AWXA 4YMTA 2WQ7A 1NY5A 3KEGA 3SX0A 1J2JA 1KORA 2Q4TA 3K72B 4O02B 3TCKA 2R3SA 1KO8A 4X1KA 4Q4LA 2HGSA 1SCUB 1T9GR 3U2QA 4A2WA 2PXCA 4L5BA 1B2RA 4EITA 4M1WA 5IWCA 4MWCA 2FZGA 1QWSA 5KHAA 1PN3A 1QYCA 3VU9A 2HKIA 3F1LA 2TSYB 3L02A 1NIJA 3MJDA 3QFCA 1XEWX 2Y1OA 3SR4A 4MYUA 4U5XA 2HRBA 2DT8A 3QEMB 3FG9A 5K4GA 5LNK1 4QOJA 4FJ1A 4EFLA 1DRUA 2EHJA 1M1ZA 1AD2A 2EYUA 5J5VA 2P9HA 1BRMA 2F7SA 2R62A 4JJAA 2AA3A 4KJXA 4MW4A 4PZ0A 3ZWAA 5CA1F 3HV0A 4BX9A 3HCCA 5E8RA 5EKDA 4ZKDA 1EX7A 2FPIB 2WV7A 1NHGA 2K87A 3U16A 3EH2A 1YSCA 4LAFA 3QYFA 2FK8A 1GCOA 4BO7A 1SB8A 3ISTA 4R7GA 1X1SA 1SO8A 1XRRA 2Q5FA 2K5UA 3IXLA 3KYDB 5JI3E 5MDHA 1NJFA 3BCRA 2JJ8A 4YJ3F 5F5XA 1NQAO 3ETDA 4NHOA 4XUGB 1EVYA 3SIPA 2QQ0A 1JBEA 5ABPA 1QC5A 3OJCA 1O9GA 4IQ0A 1YL6A 4MO2A 4B3CA 1LSOA 4G26A 1L4HA 2J3QA 4IXMA 4NIMA 4K87A 3V1TC 2HT1A 2ZUCA 3PNOA 4LWQA 5K51A 1E8MA 3KUCA 2YN0A 3SS9X 3D0KA 1BFDA 3WGJA 1KWKA 1Z2AA 2FDXA 4W9NA 1X7HA 3ROPA 4O0LA 1Q6ZA 1G9XA 2Q5IA 3P52A 4Q7LA 3QENA 1PCXA 1SUIA 3TX6A 5L4LA 4Q4AB 1VGVA 3FA2A 4O2AA 2NU9B 1GG8A 4Y6RA 1IHPA 2X5OA 3VV2A 4O5OA 3WYNA 1UBRS 5JAIA 1ESEA 4QEDA 3HU3A 4KPGA 5JYBA 3NTLA 5C7IO 2WMDA 2AK3A 1WDLA 3BD6A 5D6OA 1GADO 4E5MA 3DZFA 2VT2A 3VJKA 1B1CA 3EEBA 2YUIA 2OQ2A 2WLTA 1ORIA 1GA4A 1QHEA 2D1SA 3IQGX 5FWDA 5L3SA 1L5KA 2ISSD 4K9KA 4DSUA 1E59A 1NN5A 4LISA 2AKEA 4S2EA 2EFYA 2GFIA 4YRPA 4BLWA 1GLVA 3RYCB 3D2CA 4Q1VA 1V39A 1W1WA 4OQNA 2FX2A 2PMCA 3AV0B 3L3BA 4LXXA 3MPUA 4YV1A 4FI3C 3H16A 3ZWBA 3JPWA 5A5FA 3MLBA 1NDQA 2H4XA 4LMRA 4NYMQ 3GCXA 2EIXA 4CM4A 3QE2A 4MLPA 3V97A 4DRZA 4EHLA 1QO0D 3JS5A 4S0ZA 1QRDA 2AJCA 3PV0A 1ZXXA 3AIIA 3KOOA 4Y98A 2WWXA 4PV7A 3GLHB 4W5NA 2W6QA 2QUHA 1YDEA 4D9KA 2FRXA 5I8WA 1HDZA 1U8ZA 4QELA 2CWWA 4DLNA 4QUJA 2OYCA 1QH9A 3TRDA 3R8FA 5F4BA 3FMOB 1CUSA 1CCWA 1W0JD 1X14A 2Z08A 2FY8A 3OE7D 4HGQA 4LCJA 1OI4A 3AETA 3KM0A 4J03A 2AJDA 4K9QA 4BVKA 2HK7A 3K6SB 1UBOS 4DF3A 2I91A 3OKCA 2X0RA 2CJWB 4TKMA 1G8JA 4G65A 3QWFA 4PTYA 1JSXA 3KXKA 1WUJS 5AQEA 4TTIA 2DU8A 2XTAA 1Z0UA 3FPCA 3WL8A 1UZNA 1DBPA 1KYZA 3O2QB 2ET6A 5HGXA 1UMCB 3GGGA 3N2LA 2NSDA 3NDIA 3ZBQA 4DT1B 3NHPA 1DGQA 4J0QA 1AKWA 3FFXA 2HHAA 5DDIP 4CUJA 1YJAA 1VXOA 5FP0A 5JSQA 3OPYI 3CVXA 1Y63A 3W5IA 4R7ZA 2YYAA 1UJCA 1W36B 1JEYA 3PVSA 1EUZA 3IDOA 3TUJC 3KT0A 4CPDA 1ESMA 3CZRA 3ZGOA 1WP9A 1XE3A 4R1LA 2BDEA 1KO5A 4X95A 3G0BA 4YJDA 3C5EA 3VHXA 4XI9A 5G0WA 3LPLA 5AYVA 1DRVA 3PE4A 1E3QA 5DGDA 1RYZA 3NPAA 4PBSA 4UOEA 1ELOA 1MHPA 2R4QA 3HCWA 1XTKA 1MZVA 3PJEA 4XR4A 2RGBA 5P21A 1JIVA 1RNLA 4YRQA 5LB2A 2PZGA 3IX7A 4ARVA 5GIPE 1G6KA 3D8BA 3QQPA 3P71T 3PLNA 3KLOA 4WDQA 3ZLBA 4QBFA 1OW3B 3VZQA 2F1HA 1X8JA 2R7LA 4DV1B 3B38A 4I3FA 1I30A 3SBDA 3SS8A 1VECA 3R5TA 4NNJA 2QNIA 4IMPA 3LP6A 5CD1A 1LH0A 2FE1A 3HLTA 2C2OA 2PTHA 4B87A 4XWOA 1FTWA 4WECA 3VSCA 2O9JA 4R6WA 5ALFA 2FPIA 1SNYA 3H9JA 4IUBS 4XQEA 3TL2A 1L7EA 2PWYA 3I4LA 3LX6A 3WGUA 2QXTA 2RJOA 5HS6A 5CFMA 3L7NA 4OKSA 2PJRA 2AG1A 2HM7A 2SKCA 3FYUB 3I9LA 3VH2A 1DO8A 1AVTA 3EEOA 1GNTA 1V5EA 5CB6A 2O8BA 3O8LA 3VZDA 1PIWA 4WNIA 2PD4A 2X22A 4FWIB 3RRXA 2OXRA 3QTLA 1H65A 1UR5A 1PV2A 3DFMA 5I4BA 4QX6A 3SQWA 3HN2A 4BLPA 3CFYA 2YUTA 1XAHA 4KGVA 1N9GB 3A1SA 3SHTA 1D2AA 2GNPA 1NXSA 1Z82A 2VP0A 2K7ZA 3OI7A 1V96A 4RBNA 4DQKA 4MUXA 2PS3A 4FLFA 3D3EA 2FQQA 2AT1A 3I62A 3V3TA 2I5PO 2WUFA 1OWPA 3TNFA 4MKRA 1CQZA 3BMOA 2QR5A 4QC2A 5IMSA 3ER9A 4FOPA 2PGDA 2P3OA 1QE5A 3QYPA 3C0KA 3RVKA 1PSWA 3H6KA 3OLQA 3TIIA 4A6XA 4NYJR 1VBMA 3IEMA 2R1VA 3H9EO 3FDXA 4MYRA 1S8NA 1PZNA 2PYIA 4L95C 3BKXA 1DBQA 4BUZA 2OB1A 4QXMA 2H18A 3THXA 3A1DA 4LYYA 5CA0B 3PENA 1CB7A 1V3QE 2GPYA 5IJ0B 1QGED 3KZCA 2RGDA 5EKUA 3F7TA 3ER6A 3I42A 1E5VA 2PO7A 4AXBA 4HTFB 1VIVA 1X1TA 4YJHB 1NSYA 1Z8HA 4E12A 3GWGA 4F5DA 1EEHA 1JQBA 4J2OA 8ADHA 3EUEA 5AKHA 4M1ZA 5D84A 5BN3A 1L5NA 1CEXA 2JRCA 1OAAA 2ZRJA 2BM0A 3DW1X 5HWSA 4L4UA 2BR4A 3IVMA 4FWBA 2PUGA 2IBSA 1O94D 4NE7A 2F00A 2Z1NA 4ZJUA 2HBQA 2HHHB 1GGMA 2B69A 1E61A 3IMKA 3B6JA 2NM0A 3TTVA 1MFPA 4TMVA 2VVTA 3NTOA 3SVZA 4WL0A 2A54A 3AEXA 2HF7A 4OOFA 3ILVA 5FBVB 3Q41A 1F9AA 4HAVA 4F8EA 3A9VA 3TLGA 4FMBB 1LPOA 4O2AB 1NYTA 1W4RA 4PO9A 2CLDX 2H48A 2IELA 3A14A 3G89A 5FJIA 2IV2X 4F11A 2DHRA 5NULA 3K6KA 5E3IA 5ELLA 2X0KA 4MV9A 4CXMA 4QVIA 1NVTA 4EYGA 1HLGA 3EEIA 3UXMA 5DMXA 3K9QO 2P67A 2H92A 3PHJA 4YCDA 3V1UA 1ZM7A 4H4DA 4N0DA 3GJSA 1PWHA 4UARA 4WT7A 4QHSA 5DGIA 4HNUA 4JI2B 2OC9A 2WV9A 4OJKA 3G1TA 2H08A 3A2LA 3OJ0A 4WXYB 4EA7A 5HZMA 1TZ2A 3U7QA 4BNYA 1GZ7A 5CFOA 2W2KA 2VYND 3OU6A 5C81A 4UHDA 2PLAA 2I2AA 2PUHA 4IKEA 3PHBE 3ECSA 2H0AA 3LSYA 2BC9A 3I0ZA 2DUMA 2CDAA 1KO7A 1FX0A 1ZWKA 5JYEA 3UAGA 3OLXA 3REQA 1UP7A 3OIWA 3SLGA 2FDCA 1SVIA 1JVSA 1H6DA 2ZB8A 3B1FA 5AKGA 2EBHX 1H2YA 4DIEA 3BS4A 1LK0A 2WJZB 4PG6A 1TVKB 4TN1A 5J4LA 4AKHA 4DQ0A 5L3SB 1OMOA 2BRUA 3GLIB 3LFTA 4FEEA 5F1PA 3IEKA 4RW0A 4X8OA 3SIRA 6AT1A 4LXUA 4DMKA 2G7MC 2O8CB 3LT0A 4UEWA 3SXJA 2MCFA 1J0EA 1EM8A 2XCRB 4HDKA 2J5RA 1T36B 1GU1A 1A7KA 3VZSA 4M53A 5TV2A 3GEPA 4QPCA 5EHGA 4LJ5A 3QX3A 4AF7A 4B31A 3RRNA 4ZI2A 3UFXB 3FTNA 4F91B 5FUWA 1SCUA 3H9UA 4ZU6X 4KQKA 4IDNA 1ZI6A 1F38A 2QBYA 4DR2B 2B35A 3QNWA 3E7WA 2XYPA 4RPHA 1RBQA 2H5JA 2P75A 2BTOA 2FQWA 2EKDA 3B6KA 4EHHA 3ADCA 5F2KA 2VP4A 3O95A 3U3RA 4LK2A 2QZZA 3LP8A 2BMDA 1C4XA 1DAHA 3KSMA 2HF8A 3H8VA 2SECE 3VVMA 4B73A 2CSXA 3RJZA 3BJZA 3DOCA 3EZ9A 4JASB 1TYBE 1KQPA 3UW3A 3O84A 4U7TB 1RYHA 3P45A 4GNRA 4DCPA 5FBZA 2HHCA 1P3DA 3C8MA 1CUDA 2FQXA 4JH0A 1WW2A 4IVRA 1RYEA 1WDTA 4QEZA 3P2EA 2XR1A 1K86A 1TIBA 2WFMA 5CW1A 4YVFA 1FUEA 2QD4A 5CR9A 1HEUA 4JR1A 1QMGA 4M8IA 3N6RA 1CFZA 1EVZA 3L7BA 2COUA 4IGFA 2OFWA 1QH0A 4TWIA 3REOA 3KL2A 2O2JA 2RGEA 1D1SA 3G2OA 5DYNA 3TDKA 3ULKA 2NQ2C 8GPBA 1JDUA 2NLOA 1KP3A 3A9CA 3HVUA 4GMKA 1SOWA 2VS1A 1Z62A 4GNKA 5E7QA 3AWIA 2JFVA 2GDZA 2AR0A 4HGNA 2BKLA 2CN1A 2XJ4A 5TDHA 4B40A 4RETA 4EPRA 3HBJA 2JJQA 3F5MA 2Y1FA 1H8EA 2GJ9A 4FHEA 4HLQB 5CDGA 4H77A 1FYXA 1VE3A 4TVOA 2BJWA 4U7DA 2GSDA 1K1EA 3LWZA 6REQA 4EY7A 3HADA 4JBGA 1DQPA 3H0EA 2PYZA 3W4JA 4DWVA 5KNCD 1UEIA 2QJWA 1M67A 1F2DA 1X7ZB 2GKSA 1HWYA 2QLLA 3GUZA 3KTDA 4UMFA 5FO1A 2NAPA 1WRBA 2XAAA 3K09C 3LNTA 4AMYA 4EJ0A 2V6BA 4C7OB 3QFSA 2MINB 5FJJA 4EO7A 3C6KA 1ANKA 1G19A 3CZMA 3F6SA 3JZFA 5ARDA 3FUTA 1EQUA 1UKAA 5CT9A 1ADJA 4IDAA 3AVYA 3IAM1 5B4TA 3OC6A 5AK6A 5IT5A 1MOSA 1DV2A 2EJWA 2H16A 1JDZA 3OQHA 4AMUA 1QIIA 5CTAA 1DMRA 1XRMA 4YRGA 1IIRA 3D54D 3FN4A 3HXLA 1N6PA 2PV0A 1MVOA 3CGWA 2G9ZA 3LQ2A 3U3JA 3EXHB 4G56A 4NG4A 3EPJA 2GZAA 4RD6A 3U81A 4ZO6A 3IULA 3F5FA 3JD1A 4IHKA 4M9RA 3S3TA 3LZ6A 1WSAA 2G5GX 1JB9A 2HFKA 3ZZ1A 3Q0IA 2CHUA 4I1RA 4WH0A 4C22A 5KYYA 3BCUA 3OESA 2PS0A 1OIWA 1LV7A 2CK3A 2VWQA 1YS1X 4WLOA 1FTSA 3GARA 4UCXA 4BLQA 4F4UA 3TBHA 1FNSA 4PCVA 3U4AA 5AW8A 2IP4A 4RORA 1L7MA 2J67A 4PQRA 2SKEA 4TTJA 3V8EA 2ZVPX 1RJEA 3TLGB 1ZVMA 4ZEMA 121PA 2GETA 4MVJM 3CUTA 2YV1A 3AFOA 4QDOA 3CX7A 3RTGA 3T1NA 2G2SA 3GA0A 1BXGA 2BH9A 3H99A 5DCWA 4P7GA 2ZZMA 3ER8A 5C8ZA 4V0KA 4G25A 2YHIA 1E5TA 1RJ9B 4P54A 1F0KA 3SVTA 3QF4B 1NA5A 1KEEA 2HREA 3FI0A 3SIXA 3AERA 3NKFA 1U0SY 4N0PA 1II0A 4D0LB 4BNMA 1RI2A 4JQSA 2AYZA 4YDQA 4RZUA 5LD2C 1G63A 1ULHA 4KBGA 2R8RA 3L7AA 3SC2B 1EBBA 3AF4A 3LTEA 1U7PA 4C20A 1HNZB 4TM8A 1UWVA 3UAWA 2V55B 1HDOA 8LDHA 1G42A 4B0PA 1E2NA 3N8IA 3ETLA 2ZULA 1P0IA 1K5HA 4M9SA 3ZHRA 2V5VA 1URPA 5TSDA 3KE8A 2MU1A 4RHXA 2HWKA 2Q0HA 4PLPA 4REMA 4PCAA 2JAWA 2VBFA 4N8SA 4QQFA 2BEWB 2FMXA 3EGDB 5E1MA 1LBEA 3BFKA 3SYRA 1G2IA 3TEFA 4L0MA 4GPIB 3Q12A 3EIWA 4GYKA 3U1VA 1MW8X 5LMNB 1JKXA 3PDUA 1KMQA 5FLEX 1VSBA 2OKGA 2FHSA 2YOFA 3WLIA 3M33A 5I8PA 1MQ9A 2EG5A 3ISVA 4MVJI 2C5GA 4RFSB 3RS2A 5A3RA 2OVBA 2PX6A 1DKUA 1F7UA 3AY0A 4JBHA 2RIRA 5M34A 1E69A 1CLUA 3R8XA 3LGXA 2IZ7A 3U7GA 3F9CA 3NYQA 2PWPA 4RZSA 2I71A 4LXIA 5FTMA 1YU9A 1BX0A 2Q3DA 4PYQA 3UHAA 1ADBA 3EZGA 4OXNA 1XVAA 2XQIA 4DUGD 5KYNA 1FDTA 2I3AA 4EPXA 4ZYYA 1X15A 5JJKA 2A30A 2WVHA 1P1CA 3HUDA 1VPLA 3IVRA 4HVCA 1KHHA 4CFSA 4N3NA 3SR0A 3R5XA 4MDFA 3TBFA 3TPCA 1ST3A 1EM8B 2PUFA 2I80A 2QVXX 2FUCA 5L9AA 3DEZA 1RLTA 2BAGA 1T2FA 3T4PA 4B6SA 3CH5A 2A2ZA 2P2CA 4MPRA 4BLRA 2DERA 2FPKA 1ULSA 1ZY2A 2QW8A 2ZROA 1OH7A 3QEAZ 2GEKA 1AB5A 1JUDA 4N6GA 4TXMA 2W70A 1ZOIA 3OWHA 4YQYA 1L1QA 1O5TA 1TK9A 3PA6A 3B1VA 3RVPA 1QQTA 4DLKA 2IEYA 3EC7A 3CU5A 3L0OA 3N2GA 4NFYA 5EZYB 4WBNB 1E3LA 2V6MA 3FGNA 1HETA 1YBMA 2XWPA 2GOYA 1D03A 5HJ5A 1BDIA 4BB0A 3UK2A 4JQCA 4PWYA 4BFZA 3EZ7A 3QG5A 3INGA 4TT3A 2WD7A 2IHUA 1M1NA 4P83A 2BISA 3S27A 2WF7A 2V45A 3A58B 4B43A 5FWYA 1EDZA 3ZS9A 4XCVA 4HFNA 3A70A 5EHIA 2PKCA 1FNBA 2A9RA 4GC5A 3GT7A 1LJLA 1HFWA 3TSWA 1ZM4A 1WZCA 1E6WA 4AO8A 1I6WA 3BK1A 4BNIA 4DV4B 4DDMA 3DB1A 3DT8A 3LGSA 4EI2A 1B00A 2C7GA 3LF1A 2O1SA 1QVVA 3FM9A 2AZTA 3FPKA 4Q9NA 4UUOA 2OD7A 4L8FA 5LZ9A 1A69A 2O20A 5EJ5A 1B26A 2L18A 3HR4A 1TUIA 4WW0A 2XQJA 5CK5A 1XCJA 2M1XA 2W2VA 2WNIA 1HOTA 3N53A 2AYXA 5HFJA 3RSHA 4JIMA 4MV6A 1Q20A 3KT3A 1KQNA 2AW3A 3KZMA 1RHMA 2NMVA 1QGAA 2NYVA 5FPTA 3U7EB 4AWBA 1Q17A 1P73A 1R6XA 4OXQA 3HEMA 1B0UA 3AINA 3I9FA 1TLLA 1AK9A 1O9BA 3T3IA 4A36A 3FKSD 3ORFA 4DSOA 5JSHA 1NLUA 3C3WA 2PNJA 1YIDA 3CX3A 4QTTB 4D98A 1QORA 1K7YA 4JKOA 1J8DA 3UOWA 4CQNA 4PCUA 3HNPA 1KVQA 4AECA 1OXXK 5C5EA 4UBLA 1M83A 3GDHA 3MIIA 4K0RA 5DNWA 4B4WA 4NYIQ 5KVSA 2P6PA 2P30A 4WAUA 2Y93A 3BE6A 3TB6A 4M9ZA 1UKEA 4IRXA 4ZGGA 2JCVA 4U2DA 2R4TA 2ZJ5A 3KXLA 4L4RA 5AM0A 1BXRB 2G28A 2RGWA 2ZZKA 3DZCA 5EJ4A 5BR8B 1ICEA 3DCJA 4ZVTA 5LMCA 1J0BA 1RZVA 3ZVKA 4DBZA 1EFCA 1ZJ6A 2WTBA 3C41J 4P4UA 1D6SA 2PJUA 4AYTA 2QENA 5JYDA 5LOVB 1PYOA 3EODA 3OA2A 3WJ2A 3WLPA 3PFWO 1XWIA 5AK0A 2D3WA 4MTCA 4NMXB 2K2WA 2UXDB 2HMYB 1FX0B 4AB1A 4YQEA 3KD2A 4XD7A 2XUZA 3GCGA 5LP6B 3ZGNA 1KRHA 1G8FA 2O2DA 2YRFA 2FXIA 3AF2A 2EX0A 2Q3FA 3H2SA 5AXDA 4JVNA 3SJUA 5JRJA 1G2PA 3LP5A 5J4KA 3HVRA 4E32A 1EGHA 2WYUA 3K9LA 2RGXA 4FYWA 1MF7A 1BCRB 1S4QA 1QONA 3M5CA 3MOIA 3L01A 4LKOA 3EPRA 4N8EA 5EMJA 5JPIA 3T7TA 3UJ3X 2XY4A 1T2EA 3WG9A 4CG2A 4D3DA 5K6AC 5KUTA 3PJFA 3WGIA 2HYDA 4YAWA 3LW7A 5K8LA 4NS1A 2GERA 1AUOA 1R8QA 5B1IA 1XYVA 3PWZA 3BZWA 1PJ8A 3IJEB 1KI1A 4XSHA 4IDHA 2UVPA 4QJ3A 3ZVNA 1YVEI 2V9PA 5FV7A 3T41A 3PYLA 4QGFA 4ZOAA 4E09A 1Y9AA 1PYGA 3JAKA 5AVSA 1RT9A 2YXEA 1XZPA 5CH3A 2H52A 3IQEA 4BAGA 3V8BA 5K0NA 4RELA 5F7JA 1K6MA 1II9A 2VUHB 4MRMB 2WJAA 4FN5A 1Z0FA 4H59A 5FUMA 5KNDD 3GLGE 2VTVA 1OREA 5C1PA 3OZIA 2NU6A 1KMHB 3LT2A 3KP1A 5F1YA 1WSWA 1Y6GA 2DAPA 2ROQA 3HCEA 3PC8A 4Y2XA 2E5LB 4IIJF 2ZE5A 1EGVB 3P26A 4MWDA 5ALIA 3NBFA 3DMPA 3HKBA 1Z5OA 5BW4A 4DLZA 4H18A 3I8OA 1LCIA 1KJQA 1ZCJA 2IUSA 3PSAA 3SSMA 1B93A 4GAEA 3RASA 3CR8A 1ZK4A 2ZJ7A 5KOHB 4F12A 3KYCB 1YCDA 1JEQB 4J07A 3E1KA 1EBUA 3BIXA 4Q6WA 4CIBA 3T1YB 3C4QA 2NYAA 3L4KA 4N1AA 3L5OA 4G4SO 4MJLA 3AYXB 3IV7A 2YCLA 4PLZA 1XZDA 1ZSNA 5B3KA 2XKKA 1UCFA 2HSGA 2NVOA 1OROA 2VYQA 3ELWA 5F64A 4NU0A 4B8YA 3NBQA 3IRVA 1A8SA 4LEIA 4KQ1A 1BJKA 4M7WA 1GRQA 1NTRA 2RGAA 1YMVA 4IGIA 2PR7A 4A82A 4CLEA 1BGWA 1ZUIA 4EWLA 3NDBB 3RS4A 2O5EA 4ZAZA 2W11A 2D2FA 1GA1A 2PH7A 1I7DA 3WIEA 4PZLA 5JQGF 1RBYA 4HMOA 3WO1A 2I6XA 4BHTA 4C08A 1OGJA 3P94A 4BQSA 5D1NA 1NMEA 2WM8A 1SKYE 2P3QA 4HADA 3ZLVA 3TTTA 3VO1A 2AN9A 3C6QA 2RGCA 3ROQA 4XD7D 3OQ6A 1AQYA 1JAHA 3WGHA 1NXPA 3JWHA 3PTLA 2JAHA 1WEHA 2NTVA 2Q7XA 4P6VF 4J76A 1KERA 4JT9A 4LE1A 1ECJA 4OJQA 3V5NA 1SD5A 3MS7A 3E9ZA 4FGWA 2Y68A 4IDCA 1ZEMA 4RAOA 5T41A 3PXGA 3UVEA 3A9UA 3EXHC 4C2TA 4HYEA 1Z28A 3PITA 4Y2TA 2GF9A 4A73A 4C3OB 1ZD2P 4XE5A 4IFIA 1IU9A 5TB5A 3KPUA 1OB5A 1ABBA 5IAAA 1C7EA 3WXBA 4BNVA 4DLLA 3KETA 3Q8LA 4L74A 2HA2A 5BSFA 3N07A 4S2UA 4E1BA 1N32B 1GCGA 1WE2A 5K8CA 2OCBA 3M6FA 1L4YA 2IW1A 3WLLA 5C34B 1MB4A 1JFRA 4C4OA 3C15C 2DPXA 2HK6A 1N0UA 2VSQA 1FTQA 4QQRA 3CPHA 4Y7CA 3CNEA 1N4DA 3FF4A 2KX7A 4YACA 1EXMA 5ICFA 3HDJA 1TCCA 1WZNA 1PWZA 2CFSA 4ZTBA 4C3UA 1A98A 3OA0A 1B74A 1CWUA 3L46A 3QQ5A 2OQRA 3TNYA 4BNWA 4JOCA 5JVDF 3NHSA 4PPGA 3BX1A 1CUAA 3GF4A 4P22A 1ZM9A 2YICA 4HSEA 3RIYA 4AWAA 2VP2A 4NCHA 5IFLA 2O06A 1QHIA 1WB9A 4OEHA 4BZZA 4AJOA 3W3AA 3SE7A 3VFDA 3R6TA 3CLSC 3GNSA 4NJMB 4MUJA 3C3AA 3RFUA 2X23A 2R00C 2FQ1A 3PNQA 3MT8A 1P2UA 1F2UB 5BQPA 2GLXA 2O0HA 3P2YA 3ANXA 2AD5A 3EVAA 4QYXA 1Z73A 3ESCA 3GN1A 3T3GA 3L6BA 4LDNA 3S6JA 2GN1A 3ZLTA 3OX2A 5B3JA 1OYVA 2ZTVA 3KZXA 5IW8A 1IOZA 3RJMA 2DOKA 3W9BA 3ZHTA 4CMBA 4Z9FA 4W5OA 2X6RA 3KDAA 2MSCB 3Q3HA 3SFZA 3BQNB 3A25A 3I1FA 3KEFA 3LY8A 4XJVA 1NXXA 2QL6A 4QDUA 3UV3A 1W4LA 1G20E 3ETGA 4BE4A 1THTA 4DAEA 1FBTA 1EVEA 4JIGA 2PMDA 1EWVA 3AONB 3AUSA 4W5HA 4EHBA 3E7FA 3UJ7A 3EXFA 4CEIA 5COAA 3CFIA 5FFMA 3WLOA 3QVTA 1KDPA 3ZD9A 2O1XA 2Q2WA 1Z2NX 4ZREA 3NW9A 4Z7QB 4JQOA 4HAXA 1PT8A 3SEAA 3W5AA 2YQ5A 2Q4RA 3BK2A 3K2BA 4P5EA 1Z47A 3QOWA 1F12A 3LQYA 2II6A 3M4YA 4IH9A 5JG7A 9GPBA 3GI1A 2DPGA 4I8XA 4EHAA 5LXTB 4YJGB 1KP9A 1BS1A 1E18A 3NNDA 3R3HA 4XWAA 5K3BA 3RNOA 4D02A 3M6VA 1N5JA 2WC1A 1XFDA 2HPAA 3AL0C 2CNOA 4ER0A 3Q2IA 4X20A 3HBLA 1F4LA 4RQTA 2ZIXA 2DLNA 2AYYA 4ALKA 4ZFNA 4UHKA 4GIBA 1OR8A 3MB8A 5F1KA 4KPFC 3IPXA 4K7JA 5LWQA 4PYLA 2ZWMA 4JR0A 4O8CA 4WOPA 1OBHA 3ZBUA 5A1TA 3W1VA 1P4HA 4RV4A 3AY3A 5KREA 4QOHA 1J1IA 2JGFA 3NZEA 2DBZA 4RNDB 5FTJA 4EX6A 4KR3A 1NYLA 2MSDB 3FRIA 3TKLA 2ODBA 3RBZA 1RAEA 4RL6A 2XYRA 1YB1A 3UPTA 3WMWA 5EGNA 5ITVA 1WU7A 1SG6A 2O3JA 3L8MA 1J7KA 2A7XA 1T4DA 5D5PA 3SLKA 2ID9A 2H7XA 3Q3VA 3RHSA 2AGVA 3HDQA 1OJLA 1FVHA 3M6AA 1UINA 2D06A 4CL0A 2VR1A 4PNPA 3C45A 1MJNA 2CVHA 4UNSA 3IQWA 5ADHA 2ZVDA 4E08A 1NN3A 1LPPA 4D9GA 4X65B 3GJ3A 2R47A 1F8XA 3W5SA 1W96A 4YRNA 1FFAA 1NDUA 1G64A 2R79A 5JTTA 2PZLA 4H7IA 3ABOB 4FFBA 1WSBA 4TYWA 2HF2A 1Y9DA 2JD2A 4D9EA 3B1XA 3H4IA 4G9EA 5JI2E 1E77A 3RYFB 5D7NA 3ASYA 3LVRE 1SXHA 4UEJA 3I5MA 3LH5A 3FLBA 4RK5A 4QDZA 4RLQA 1COWA 1P44A 1JV2B 1Y82A 3COPA 4P53A 4TMXA 1UOQA 3HXTA 1NRXA 1YDMA 2D5IA 3CZQA 2GN6A 3TX2A 2PBRA 4ZTZB 1U8XX 4MV3A 4BRZA 3DTYA 2EJTA 5BV0A 1MAWA 4MS1B 3O0DA 3ZD7A 4AL4A 1GPKA 3E9YA 4ZV9A 1GZSA 1JXOA 1USUA 2ECQA 2QV7A 3KG2A 4ADSG 4I1VA 2J0EA 1MV5A 2IWRA 3CNLA 4C0XA 1JEQA 2DMRA 5PGMA 3VNUA 5AVWA 3NM5A 1U2EA 4Q1AA 2OD9A 4BB6A 3G0CA 5AKEA 3AG5A 2MT9A 2G9RA 2P0YA 4JJFA 3K4HA 2WJ6A 3B20A 1VMEA 5CHEA 3RIMA 2NU9A 4HB3A 1YZFA 4RYLA 4B3DA 3PUWA 3MJRA 4I6JA 1M2EA 5IK2A 2IS4A 3B9QA 4P32A 4Z0TA 1V6SA 2NT3A 1JFTA 4WA7A 3HWWA 3U4DA 1GD1O 3AR3A 2WF6A 4IZOA 3ZXSA 1DXHA 3TZLA 1OVMA 3OFVA 4BUCA 1LI7A 1LZLA 3TECE 4II2A 3DDCA 5K2OA 2RGNA 3IHLA 3WIDA 1FRFS 3MK31 1P3JA 1NBMD 1ONOA 4LNHA 4G2TA 4JJIA 2QWXA 4OBEA 4BQFA 1RIFA 2PZBA 4KWTA 1Z3IX 3K9BA 2XQGA 2WSLA 4HWRA 4IXNA 3LFUA 4FVTA 3LE8A 1FFXA 4MARA 4E30A 2BTEA 4UW9A 1KI2A 3F67A 1J99A 1R1DA 3H8SA 4QHYA 4X3OA 1PZHA 1XZAA 3EIOA 4Q7EA 1YWGO 2AE1A 5DBGA 2XTMA 3VZPA 1HY3A 5DTRA 5AW7A 1DCKA 4DQLA 1KY4A 2YASA 5LP6C 5FUVA 3TGWA 1MORA 3IAHA 5F23A 1CE8B 3BA6A 3EOBI 4L51A 5DEIA 1Z4MA 3VC7A 5DM4A 3JTEA 1ZS9A 3LLSA 1JIKA 4DBLC 4JNCA 4L57A 3ZWDA 2ZUFA 4RYDA 4M98A 1NI3A 4RPCA 2B6HA 1AN9A 3BWVA 3IP1A 2F3UA 1XZMA 3UWMA 3RARA 2PX0A 4QUGA 4FI3F 4HF7A 1KU6A 3TUIC 3QXHA 2IS6A 1E99A 3EA5A 3OLWA 4MPTA 2PE5A 2X4IA 2BFEB 4NDNE 4HBZA 4LF9B 1YMQA 3M6UA 1WMFA 2BUCA 1F2TB 1QYDA 3Q5GA 5HQTA 2AUTA 2YWEA 4M1TA 2Z2XA 3AVPA 3T3MB 2VCEA 2OBYA 4X92A 1R8JA 5EUMA 5CYFA 3A8TA 3U7IA 1TZKA 2WDPA 2VZ9A 4DOMA 3IKLA 3GP8A 1OB2A 1BIFA 4LBZA 2IH5A 4QGHA 1C81A 3A4NA 4YUVA 4W9NC 2XUGA 4LF8B 3HVIA 4YRDA 4M0PA 1GTMA 4FHZA 1K2VN 3AR9A 1L4EA 1N8SA 3GAFA 5LVAA 1VJ5A 1M7GA 2FWPA 5EIBD 1SXJE 3E2IA 3I4FA 4J6EA 1QKJA 4G0WA 3IB3A 3IUBA 2OLKA 3AX6A 4OA8A 5CITA 1UDBA 4DMMA 1GUFA 3O4IA 2FA9A 3PDIA 4WESB 2I3ZA 2O2YA 1ZGGA 4N5HX 4DRYA 1Y7LA 2C04A 5K6RA 1CYDA 3B7WA 1YS2X 3GFSA 4YMIA 3TDMA 1T34A 1Z2EA 5SY4A 3E0QA 3VSEA 4UOZA 1T9CA 1TRKA 2HB6A 4G9GA 4IWXA 5BNWA 4L8YA 1Q19A 3VH1A 5C5CA 1NBHA 3K1YA 2GPAA 5AW3A 1VL8A 2GFHA 2HY7A 4XR9A 1QRRA 4XAQA 2L42A 2WOOA 4RVNA 4NX2A 4QGAA 5EPEA 4JYZA 1IHUA 4Q3KA 4QFBA 3GV0A 1MAVA 3S2YA 2JFNA 3TIVA 4DWOA 1WW3A 1NW9B 1QP0A 3NP9A 4DLUA 3DHWC 2GBCA 1N9ZA 5BVHB 1TVCA 3AHIA 3QTTA 3F4KA 2MSNA 5ERYA 3CFAL 1HEYA 3KXPA 3LC7O 4PSAA 4RVDA 1R27A 4K6KA 5DW0A 2IGTA 5JNRA 2ZBUA 5DXFA 3GRYA 3RIGA 2QN1A 4UMEA 3OJWA 3KWLA 3E7DA 3LCJA 4TYPA 3NGLA 1TJPB 1XXHA 2O05A 3O47A 4MAAA 1P2VA 4IIBA 3WWEA 4KCGA 4IJ5A 3VKVA 1L8OA 1RPNA 5KKCA 2CYCA 3OZXA 2LDXA 3CLRD 4QAJA 4PSUA 2O8FA 4O33A 1UL1X 2FX5A 4MRSA 4DLAA 1SKUA 3LCUA 1WB6A 3WB2A 1SR8A 2J3HA 1H2AS 1O5IA 4R40A 5IVIA 2QIPA 2W2LD 2VRCA 3AG6A 4A5SA 3ZLJA 5TJ9A 5JWHA 3J81A 3I1YA 1ZJ5A 4MLDA 3GJ4A 2PL5A 3LVFO 4MV1A 3RVSA 1IN7A 5MF6A 2O0KA 4BMXA 3PD1A 1ZBDA 1DKMA 1I2MA 1SQSA 2W6JD 2D0PB 3PCRB 1DOHA 1QH8A 2B1RA 1PF7E 3GG9A 3UG7A 4F72A 4HGYA 5J3JA 2BCGY 4FGUA 1EX6A 3R7DA 1WXFA 2Q3JA 5M5BA 2FR0A 1QIHA 1H22A 4D82A 4ZJPA 1TEXA 3AHFA 1T3LA 4RPLA 4H60A 3OFNA 1ECPA 4MINA 3W5VA 5JD5A 4BBZA 4NPHA 4DSAA 5T6MA 2UXCB 1ESCA 3D6NB 2QP9X 2OXCA 4HX5A 2ORED 4FONA 3B48A 2DECA 2IZ5A 2OFFA 3GRCA 5EI5A 4DLWA 4XPZA 5CBPB 2PLRA 2QTGA 1BMQA 4LHXA 4O4LA 1C3XA 3FZQA 1Q2UA 2Z5FA 1GKUB 3K0AA 4IHJA 5ECDA 1KVRA 1U1DA 3GVIA 1PR2A 4LBYA 3CJRA 1LBIA 1M2GA 4DIKA 5DKFA 2K4MA 3O2NA 2OBXA 1T1IA 1ZI8A 2VUIB 3EWNA 1QIEA 3PZRA 1OGIA 2PT5A 4ASUA 5FBQB 1IHXA 4HYYA 2Q4OA 4IQGA 1JHOA 2W00A 4FYMA 1V6CA 2C4TA 3JASB 3R77A 4Y8VA 4ZRNA 5C52B 2PKXA 3WDKA 4KPUA 1C80A 3MTJA 4NLLA 5EIXA 1K3TA 1XTQA 3JD3A 1GN9A 1MT3A 1WLYA 2HJ9A 1I1NA 4ZYUA 2XOKA 5MN5A 2IHNA 3LRTA 3TTYA 3F9RA 3F6PA 3AOEA 1P8JA 1RLIA 4ISBA 1NUUA 2B8NA 1Y6JA 2RI0A 4H08A 1MB0A 2AZ4A 2XMZA 3R76A 2DG2A 4DUZB 3QVGA 1SK9A 3IMGA 2R6ZA 4V24A 2HMTA 3THSA 4IRUB 1NG9A 2KJQA 3FSJX 4TQ9A 3SNKA 5A04A 3L1KA 3BB4A 5K0ZA 2JGLA 1S9HA 2XVXA 2H31A 3IPAA 1AURA 1VRWA 4EJ6A 2AVNA 2EWMA 3JQ9A 1QV9A 3LPAA 5TQ2A 1BJRE 4JELA 4M83A 4BQQA 4XUCA 2WFZA 721PA 3IL2A 4MAMA 4TRNA 4LYDA 4A8JC 4UHFA 2ZRAA 3QKRB 4M0DA 4MUGA 4ATNA 3LDFA 2JH3A 3PEVA 2C2WA 5KTRA 3VM6A 3B53X 5LQUA 2PSEA 5FNZA 2IWHA 2BFWA 3NHLA 3W6UA 4O2RA 3NAQA 3LRPA 5GM1A 1QPGA 5I45A 1KJJA 1FYDA 3ZV3A 1RAGA 1FS4A 2ZYHA 3K1JA 4IAOA 1AHHA 4WBXC 3QFHA 1Q14A 4XA8A 2J46A 2PG3A 2XMQA 5E6RA 3U5TA 3ELDA 2XDWA 2R86A 4YV7A 1JW9B 3DL0A 1I80A 2GVNA 2IPXA 3R40A 1KC1A 3GZJA 1M5TA 4ER7A 3SQOA 5LJIA 3W5BA 4PXSA 3TTSA 4YLEA 2ZIGA 4NU8X 5D6NA 2G1KA 1BNCA 1I7SB 1OBCA 3SHQA 2H4YA 6YASA 1RPZA 1GM5A 4EJSB 4KAAA 3ZHQA 3PU6A 1V8OA 3B36A 2E89A 4PVCA 4Y2VA 5K3FA 2YNMA 4MWTA 3C4VA 4KFRA 3FRHA 3V80A 3MLAA 2D54A 3RJ5A 4GO1A 4Q1EA 2HNBA 3AM4A 3T4UA 3NTVA 3ZCQA 5JZOA 2I3DA 3VAZA 2GK4A 3IALA 1ZGBA 1S96A 2QTHA 3RLIA 4HNSA 1ODIA 1MDFA 3CEAA 2GRUA 4H0CA 1DO2A 2VPXA 1K7CA 2FFJA 1AQIA 1U2PA 2E1PA 2NUPB 4ALIA 2YY5A 3NS7A 4BV9A 4TUYB 2YVLA 1EESA 3HB1A 2W2MA 4HYTA 1X6VA 1C8KA 4TL8A 2AG8A 4DR1B 3O2SB 5HF9A 1Y1TA 1JPVA 3RIXA 4FHGA 2VNIA 1EKXA 2AHRA 5JU6A 1MEEA 2KS6A 3OU2A 9MHTA 2NQ8A 2O14A 4UUBA 4JI5B 4AJ1A 2BBTA 1GQSA 1RXCA 4KE7A 1FNDA 3BD8A 5FWAA 3ZKAA 3D3KA 1JGTA 1OAOC 1O58A 4MVJP 1T0UA 4LJ6A 2HLDD 4EW6A 1EA5A 1A9XA 1GG9A 1Z5NA 2QR3A 4E5SA 3FWNA 4JLUA 5DZSA 2IXAA 3DFFA 5EYPA 3QW2A 4ROTA 3USCS 3N2ZB 4YP6A 4GG1A 3ASVA 1ENOA 4MWGA 2XUPA 1GNQA 2R11A 3OCUA 4PRKA 2ILVA 3O8DA 4TXLA 1U1IA 1VA4A 4JI4B 1G8MA 2WOJA 4YR9A 3LSTA 3DMNA 3ISJA 3RFTA 1G4HA 3WIBA 4LXQA 3LXMA 2C7PA 1DJNA 2J9YB 5FOVA 5HBGA 1G3QA 1EE9A 1H2XA 3FNFA 3K4QA 5C3UA 2A92A 3ZNPA 1N2BA 1Q1BA 2P4SA 4BV2A 4CM6A 1VIAA 1GRCA 3FBWA 3G9QA 3SKXA 1MNQA 3ORHA 1TAGA 4R3UC 4EABA 1KR5A 3HACA 4QOSA 3O82A 2BR3A 4JL5A 3WMXA 1UIRA 4A0RA 4BATA 1YZTA 3MZ0A 4F2HA 4DR5B 3G8YA 3QNMA 1P1KA 3ZWXA 4Z9YA 1PL8A 1AGNA 4BNTA 4US2R 4C0JA 2VATA 1FQWA 2OAP1 4BJ5A 1YBFA 2HSWA 2VHVA 3IOMA 3VOAA 3QV2A 3W9SA 2X6QA 2ONYA 1MIOB 1T15A 4NDAA 2EFHB 3S2EA 3CZAA 1E2DA 3IP7A 3AK4A 3T9BA 1W6RA 2JEZA 1AM4D 2VF8A 5JHHB 1Y9JA 1VSTA 1X70A 1IPEA 1KYXA 3DMDA 4B6PA 4BPBA 3WZ2A 2PRYA 1WDWB 1GGKA 2V5AA 9ABPA 4IS2A 4YRFA 1G8KA 3IJ5A 4GOKA 3SM3A 3WL5A 3QY9A 4CDGA 3KU4A 1DFHA 3JWIA 1MQ8B 4UAJA 1TE2A 2HTFA 4LVNA 4PYNA 1EFDN 2XE4A 3CBQA 9LDTA 1N6NA 1OLXB 1R8SA 1RHRA 3CSUA 3DJFA 1OYOA 1PK7A 1CFJA 2HQ1A 4M0EA 1JHDA 5EJEA 3FCAA 2HDHA 4OHWA 3IA7A 1DFGA 4X1YA 5BMVA 4G01B 1NMXA 2PGJA 3OZDA 4RSGA 5HHTA 3AUJB 4KE6A 4EL5A 5A9RA 2I52A 3VR3D 4B7AA 5FR1A 4WXHA 3KKNA 1N77A 2EFCB 1F48A 3BWCA 4M1YA 5E2BA 4RPIA 5K3SA 5JMWA 1KFEB 1KAGA 1MB3A 3AUKA 3B2QA 3ETJA 4TLCA 5C3MA 3RWOA 1LX6A 1J21A 3NQ41 3L0YA 5FDFA 5IKXA 1AG9A 3VZRA 1IY9A 4ZCTA 3OZ7A 2GAOA 5T8KC 1ZHOA 4X54A 4RK7A 3UPDA 1W4ZA 1THMA 4JI1B 4JI8B 3KB1A 2FH5B 4M1QA 2R8XA 5ILQA 1WD5A 3KEOA 5JDIC 5MFZA 3A2KA 3MAAC 2OHGA 2Z6AA 2GZMA 2IEAA 3EMDA 2X2EA 3DTTA 2W43A 1FSFA 4URWR 1JXAA 1TUEA 2P2YA 4J1SA 2C99A 3I01A 5G02A 4D81A 2HMAA 2J9GA 4UDYX 3DAHA 1ZA1A 4IKPA 4LGYA 2EKQA 1H42A 1QIJA 4XPIA 4QQNA 3RGGA 1ZR2A 4MA4A 3OIDA 2BKUA 2G1AA 2Q4BA 2V7VA 1UKBA 1Q21A 2C7BA 1NF9A 1VGRA 4KRXA 2G9NA 4BNXA 5C1DA 1WHTA 4FDUA 2OCXA 3HL0A 1CDOA 1L5SA 2VHWA 4XWTA 3I9KA 1YC2A 4UZFA 2M6KA 4DJEC 5ALVA 1TEZA 2PPLA 4OATA 1W8IA 1P9RA 3PUXA 4KQGA 3UMBA 1UZAA 1I3CA 1GTVA 3G68A 3M8KA 3VC1A 1JLSA 3CHYA 4HEA1 2BM8A 2ZBPA 1W2WB 3DOHA 3ZI4A 1TZJA 4R1OA 4Q39A 5CDYA 1SM4A 1Z6PA 4OQPA 3WDMA 5JBNA 2C78A 3DV9A 2HV8A 3TMYA 1EUQA 5JSFA 1UBKS 2Q9BA 2HADA 1B23P 4ESHA 1RS0A 2BGIA 2JKVA 4IDBA 1KYTA 1PZFA 2HO4A 3UJ8A 5KNBA 1Y7HA 4L78A 4YAGA 1TYCA 3VTAA 2ZI5A 4R1QA 2C5FA 2B4TO 4DCNA 4Z6KA 5CA1A 4ITRC 3DE6X 4O63O 2VQDA 3QP9A 2CNKA 4DJJA 1TF5A 2DHDA 5DNDA 2QY6A 2QYOA 2RI6A 1TIPA 2R7NA 3A4YA 4G4GA 1JIIA 1WDMA 2B8TA 1ZCZA 1Y1KE 2IDMA 1OFUA 4BNKA 1WMEA 4YJ2F 5A6SA 3UKJA 3THOA 4X45A 1VBKA 4BFVA 3W5CA 1RPJA 5LBUA 1VE1A 1Y34E 4KXXA 5KNCA 4X3PA 5KYWA 1Q7CA 1YS7A 2H29A 2CL7X 5FHQA 3ZNNA 1O6FA 2GN8A 3GA5A 3U3KA 4J2TA 3LRXA 4D9CA 4COKA 2BFBB 3EVCA 2F62A 2VPQA 5SYMA 4WEQA 2Q27A 3MA0A 3HA3A 3Q6MA 4G9BA 4B3SB 1GAXA 5H16A 2C84A 3TRJA 2Z3VA 3NVAA 1YQUA 1UJ2A 1X7ZA 2AQ8A 4GGPA 1GO2A 1QJCA 4X63A 3TLKA 3WA7A 1VE9A 2H1CA 2JARA 4KPYA 1JEDA 4G1MB 1BCSA 3E7XA 5AI8A 5JW6A 1T6YA 1YQ9A 2OPBA 3C70A 3U3DA 5KINB 3AOEC 3PUVA 1CXZA 2IEGA 4OHRA 5LLSA 3TLYA 2A0UA 2YXLA 4HXEB 4KHPB 3I09A 4Z99A 3SY8A 1FVOA 4FZVA 1USIA 1CR0A 1AO0A 3PDIB 4WESA 2GA8A 2MTBA 2CK3D 1P5FA 3H8JA 4KSCA 4B3IA 2QXUA 1KY2A 1CP2A 2YVUA 4W5RA 2V7GA 1GRNA 2P4UA 3ANLA 2G36A 3K96A 1PQPA 1OWLA 1XQWA 2A84A 1ZQ9A 5FUQA 2CFTA 3EPHA 2HEIA 5AM5A 3CLTC 2OR3A 5CNMA 3KV3O 4B44A 3WTBA 5IJXA 4PO1A 1PW7A 3SIWA 1XLVA 3SZRA 4JC5A 3VOTA 2BGMA 2QMHA 1RXWA 3K73O 1L5HB 5U9CA 3V1YA 2BSAA 4N5LA 1O0CA 2PAFA 1KEUA 4LZPA 3CCFA 2CJXA 3RU7A 4NXNB 1E2JA 2PUTA 4O4IB 3GVHA 1HTBA 1PVVA 1PG2A 3FOWA 3KT8A 3L1IA 3NRJA 1CT9A 1IAVA 1W0JA 5E4YA 2OYRA 1K5PA 1HR0B 1E2PA 1FNMA 1PFVA 2XA1A 4PZCA 1X86B 4AS3A 5LOVA 2X42A 3KB8A 1IE3A 3ZQ4A 4AMGA 2PVSA 4C7BA 1GGVA 5BRAA 4MYDA 5L3QA 2W6PA 4GQIA 4BRUA 2VKTA 4ZQEA 1AF4A 2A52A 3U7HB 1I3KA 1SCKA 1PLKA 4TV8B 1BU8A 4QYIA 4F4HA 1C3VA 4OYYA 3COVA 3E81A 1QYRA 2QMOA 4JYCA 4KQ2A 2XB9A 2CZCA 3GQBB 4UPDA 1L4KA 4WA8A 4Z8YA 4BJ3A 4CV2A 1JDBC 1SHUX 3DE7X 3V4OA 2O8FB 3IHKA 3S8YA 4G0OA 3ZDEA 2W6JA 3EIQA 1NURA 2ZR8A 2ZYDA 2CXUA 1Q1QA 2C4NA 3PT5A 3ZYCA 2ZPAA 1RKXA 3PC2A 2BFFA 1E5QA 4OYHA 2W6IA 2Q2QA 3VNSA 1TJNA 4MR7A 3HWX1 4G0MA 2AC2A 5BYKA 1SKQA 2UUOA 3HC7A 2ABWA 5B2FA 3TGLA 3TZ6A 1ZCBA 3D1VA 3HEBA 2ZWAA 2PX4A 3JR7A 1RAIA 5L7TA 3A32A 1QMPA 3V4FA 1NF2A 1UT5A 4OMUA 4R2LA 4CMIA 1ZVKA 3CVJA 1OUMA 3LLUA 4D5GA 5BW0B 1T8RA 4NZPA 3PNKA 4FOSA 5JATA 3D3WA 1OOEA 4HVAA 3KTAB 2BP7B 3UJ9A 3EXHA 2VJBA 3DZDA 4ACBA 1SBQA 4FGLA 4NU5A 1C1DA 2VHXA 2PGAA 2WNSA 4JP3A 1NKSA 2IF2A 2NTYC 4H35A 5EIHA 3A3OA 3NOXA 3OQIB 4NSNA 4BFTA 3SR3A 4AJPA 3MOGA 4KBYA 5JBIA 1P4SA 4TKVA 5EUBA 2VDJA 2WF8A 4HH4A 4FZJA 4MUNA 3DOIA 4K9RA 4BRWA 3LWBA 5F98A 1KI8A 1KVUA 3UUWA 2IEIA 3DKVA 1J22A 3EXG1 2OAGA 5AKXA 1F06A 1XI2A 3TLMA 4WEOA 4JXZA 1HFJA 3OG9A 3GLGB 1EQAA 4MITA 1NVGA 2PT7A 1RMYA 2D1YA 3L8HA 1D4AA 2RB5A 1ISFA 1HE8B 4N3AA 4RKYA 2WY2D 3PX7A 4OXRA 3SN6A 4C4SA 4CT4B 2VDKB 4WQMA 2J7PA 5D1HA 2BGJA 4PHGA 4RADA 4YRRA 4ARZB 5LUBA 3VNRA 2CUZA 1MMFB 1QWOA 1OIXA 1QS0A 5DSXA 3FRJA 2JD1A 4ARAA 4DIUA 3T1HB 4EF4A 5CFNA 2WKRA 1HYBA 3MPOA 1PWEA 3CR3C 3F71A 3FPSA 1IQRA 1PWXA 4TZ6A 1JH8A 4OBBA 1XL1A 2PMBA 2FN4A 3AL3A 4JKYA 2IYVA 5AI9A 3JATA 4U2CA 3KKKA 1VCHA 4DBLE 5BVGA 5I3ZA 4FBLA 2Z57A 3PP8A 4INJA 1I94B 3ROKA 2RHWA 2YW9A 2FUEA 2Y9MB 1I33A 1IHYA 1FIUA 1AS2A 1E2UA 2GYUA 4ZYLA 1UDRA 2FFBA 4MCAA 5J2TA 4RF2A 1AKRA 1OU4A 1BHSA 4IF6A 2P0EA 2R1VB 4KQHA 4EKEA 5L3QB 1EP3B 2FF7A 2J5QA 2QG4A 2W2NA 2I7DA 3Q7IA 4HUQA 4MQ4A 4NK5A 4X9XA 4CQMB 2Q5LA 3I2GA 4YUXA 1J8FA 2H2IA 2NVBA 3REFA 2L82A 2NSYA 3TXYA 3F0TA 4ND8A 2WQZA 4XB1A 3ZBTA 1PGOA 3LX8A 4NC9A 2V7PA 4JS0A 3X1DA 4EQZA 4F2GA 4QU9A 5GZ1A 4EA8A 1TJ4A 4RABA 1A82A 1NW8A 4F6RB 4BZWA 2UXBB 1OASA 2B4YA 1W1IA 3BB1A 2WB4A 3LUPA 4PLGA 2Z2ZA 2FLWA 2YBDA 4QO7A 3UUGA 1YI1A 1EE2A 3C5HA 1W4BA 4DLSA 1ZIDA 2PH3A 5HX7A 2FE4A 5LCXA 3ICVA 1ZGAA 4HLUC 2WWVD 1GTZA 3E8MA 4D4IA 1YV9A 2LBPA 2JLUA 2BMWA 2DFLA 4HPXB 1MTOA 3EZLA 2SBTA 1MUUA 4XIFA 1UFOA 1W9HA 1NUQA 1SUDA 2H65A 2HXGA 2Q62A 3CX6A 3IIKA 4RE6A 5TVGA 4YRKA 5I01A 3ZJ4A 5KDOA 3Q88A 1MJGA 4FNAA 3PL5A 4Q16A 1SQ5A 3ESAA 1KDZA 4MVJG 4C06A 4E4RA 1U9IC 3A1TA 4JD5A 3QUTA 3ZC3A 4D0SA 2ZPTX 1IZYA 3HNRA 1VLVA 1K8ZB 3F6CA 4GOLD 1CUEA 4FKZA 4M0UA 4X7MA 1UBNA 2BRUC 2X7XA 3S44A 1ZWLA 3CF4A 4CMHA 4O4HF 8AT1A 3T5MA 3G8CA 2J7PD 4JFRA 1L7PA 2QNRA 1D04A 2QLFA 5E9WA 2Y99A 2QL5A 3ANTA 3B3QA 5FNVF 5JQWA 1PQWA 3R3JA 3TDNA 3T3HA 2EF0A 3VC3A 4CHTA 4JGGA 1NBAA 1LNSA 2BI7A 5K6TA 5C8XA 4NS4A 1A77A 3MC1A 3AIOA 1L4UA 3PLRA 3LK6A 2FSPA 4CEJB 4KRYA 2QVCA 3OUTA 4MW7A 4CKEA 3T9DA 5AJTA 3RODA 2JANA 2QRVB 4Y0NA 4HYQA 3TZEA 4ID3A 3KYDA 4OHKA 1OTYA 3DWEX 4J16C 1NPTO 1E2QA 2QN9A 4EUNA 3LPDA 1CJTC 4AP9A 2J8ZA 2MYTA 4CLHA 1H3NA 1HDYA 4E3ZA 4JDPA 2XRZA 1WUHS 5CJ2A 5BUQA 1BKSB 2VDPB 3FTDA 1CYEA 4L8WB 4HPWA 4MI3A 5ALRA 2OCKA 3DVAB 3UMVA 2G4CA 3G6KA 2ZUEA 1KMCA 2HJSA 2RJNA 2DQ4A 3M2TA 4V0MA 1DIBA 4GD3Q 3VVBA 2OBFA 3COJA 2XCLA 2PRJA 5FFNA 5FORA 4N5IX 4R1SA 1UJBA 4IJMA 2C29D 3FSGA 3B85A 3L7CA 1ISSA 1QPZA 2BE7A 4GRAA 4RJKA 2ZR0A 2QMEA 1RTTA 1WL8A 2ADMA 3GGJA 4GZMA 4M54A 4J3JA 4ER5A 5BQXA 1T24A 2GD0A 2XD9A 3JD4A 4I55B 4D8WA 3LBHA 4AX4A 3O83A 3OQIA 1Y3BE 3NYIA 2AMJA 1JDJA 2WMOB 4WUTA 1XVUA 1RI4A 2MYPA 2Q1SA 1WOYA 4HGPA 4N48A 5E7IA 4CIDA 3QPBA 4JVMA 3F97A 3C6XA 3D3JA 2VH1A 2CCGA 2IHZA 1LBSA 2Y4OA 2F64A 3BCHA 2BP7A 4PHTA 4TTTS 3KKEA 4YCLA 2R0QC 3EFEA 2D0DA 1G2QA 4IWYA 5AH0A 1YKGA 2GI4A 4KQWA 3BDIA 1T8PA 5C31A 4KQJA 2QMQA 5KOHA 2H5IA 4EENA 5LQMA 1T8YA 1CS0B 3LXRA 4N7RA 2Q49A 3TOSA 1MLDA 3HJUA 3OOWA 4YJFA 2HA4A 3GH1A 5IVPA 2TMDA 4YT2A 1SXJD 1R0YA 4YFVA 3PT9A 3AJRA 1UXJA 4V03A 3VKGA 1DAFA 3K94A 3AZOA 3QW4B 3ONFA 3KOUA 1QE3A 1J2TA 2UZ1A 3TKYA 2Y92A 5CG2A 4UDOA 1DQSA 2EGGA 5HUQA 1A96A 1T9ZA 2C3YA 1NE7A 2LV8A 1R7RA 2E0IA 3BE4A 2E5FA 3R24A 1NQTA 4RZHA 4AFNA 1KFBB 4K3UA 4LXTA 1KKMA 4DJ5X 4TLDA 3BJMA 4MCJA 3QLJA 4OMCA 5AW2A 4ENTA 2VYNA 4LZLA 2AXPA 2ZS7A 4O3MA 1GSAA 3F3YA 5ALTA 4MYCA 4DQDA 3MF4A 5ALHA 2P35A 4DIMA 5EWLA 4E2WA 3D5QA 2XGJA 5IBQA 4E4YA 1CE8A 1N1GA 3NANA 2UZ3A 4AZ0A 5K0SA 3FPEA 1DJQA 3G2QA 2C3MA 1TTPB 4K0KB 4GKKB 4Y6PA 3PR2B 3ZWCA 5GGXA 3EF0A 4DPLA 1EK0A 4FLEA 4Y2JA 1D2NA 4QOEA 5DYWA 5LXTF 2P4EA 3L6RA 1VG8A 1Z9BA 1EFHA 1GKYA 4ZQBA 4KXFB 1E9DA 2PZKA 3RB8A 1SN7A 4JC0A 4CG1A 3N2KA 2P5SA 2O4UX 4G23A 3LBAA 1JHXA 2HZ7A 3KOXA 3STUA 1XDGA 1Y7TA 1QTIA 2G83A 3CZ5A 1UP4A 2NU6B 4N7JA 2EKZA 1NMQA 1FMLA 1UDCA 2DUUA 2TRSB 3IBTA 4X0EA 5HFAA 4EPTA 3JQAB 4C4RA 3ZGZA 5D3MA 2C9MA 1NBME 3CE9A 3I9NA 3VPBA 1Z8FA 1JSZA 2Q5OA 4GPZA 1SJ9A 5CP8A 4D6PA 1FRNA 1JFFA 3NCTA 2NADA 3D0OA 3QELB 3BDVA 2LCIA 3FDFA 3GLFA 4BX0A 4F5WA 2QJOA 5CLLA 1KA9H 3TQRA 2CE7A 1PTJC 4IJUA 4UEKA 5LC1A 2Q7DA 1T1EA 3RV3A 4EHJA 1T2AA 3WBFA 2ZUVA 3GT0A 1LZKA 4Y3UA 1M2KA 3MN1A 3FYCA 1PHPA 5CG1A 3FCSB 3KWFA 2QKYA 4G2NA 3UWPA 1KBZA 1QFMA 3X2EA 2FG7C 3KSUA 4IX1A 3IDZA 5U1PA 2QLMA 3ZCRA 4ERNA 3RC7A 4ZRMA 1ZGCA 3WMFA 4BO2A 4NJMA 1XRQA 3QBJA 3OJLA 2QQFA 3F98A 2WTUA 1XZJA 4UMVA 5FX2A 2IUTA 6PFKA 4B7CA 1MP0A 3KVOA 4BLSA 3J7TA 1FPQA 2H2DA 4HX9A 2YWBA 1JHRA 2H2GA 1RYFA 1J8VA 4HATA 4QPJC 4AJEA 2C7QA 4DHEA 3K1ZA 4NXMB 4FD2A 4O4LF 2Z6QA 3KB2A 1CY0A 4OVKA 2DJIA 3VYRB 4ZT7A 2GN4A 2PXXA 4I66A 4F6CA 3KR2A 2PKYX 5DNAA 4AY5A 1W0KD 2AFHA 2O2CA 3K0FB 3ECAA 4KC0A 3THYA 4Q21A 1KR2A 1PI3A 3FUVA 3MS4A 4UBMA 4EW3A 3THWB 3IQIX 3DBLA 2AEJA 4MX8A 1EPUA 3AHDA 4OLHA 2IH4A 2WJJA 3CF4G 1JQEA 5FPYA 2LUOA 1A5SB 1K4YA 2JVKA 2VK8A 3N8HA 1FX1A 4KSYA 1KXZA 2OGZA 2ZUTA 3AM1A 3D6AA 1ECFA 5AJVB 5KMGB 1ZSYA 5CT6A 3VHXB 3OQ1A 1ZO8A 1OYWA 2AI3A 4DM7A 1U8TA 4C4XA 1FW6A 3ELYA 5EIEA 2COKA 5NLLA 3EXG2 3SOZA 3NHKA 1P5JA 1IVSA 5I4CA 4AW9A 1NNUA 3FJ1A 4TT8A 1YVPA 2BONA 2G9QA 2AFHE 2FSHA 2XGGA 2ZJ2A 4JUBA 4YONB 2R6DA 1GDDA 3GQBA 4GLJA 4IR7A 2HAEA 2A5DA 4JYBA 4BO9A 4L5JA 2PFKA 2V6IA 4LGCA 4BNZA 2Z2JA 3IKJA 4JP1A 4YJKA 5H9VA 2B34A 3WLMA 4JJ6A 5C4IA 4W1SA 5AVQA 4ZDIA 3C3YA 2WAMA 5I3CA 1C4KA 4LJ9A 3SMVA 4NK4A 1VJRA 4TKUA 3G2PA 3U4CA 4ARIA 4I9NA 3T5TA 5HQJA 3IEUA 4R1MA 4L0DA 2FPRA 3EIUA 4K03A 2ZE6A 4ND6A 5I7AA 2JHGA 1FXWA 4RH3A 2ZIZA 3QEBZ 3UJNA 3PKIA 3HMQA 4G63A 4C1NA 4KFCA 3GVXA 2AV6A 3RBVA 3ZG6A 1U5CA 3GO4A 4CM7A 2PCLA 1QXSA 1XRLA 1ZHHA 2GN0A 1MRZA 4J3FA 2XB4A 4KDFA 4RAQA 3SI7A 1V41E 1NF3A 4IHQA 2IT1A 3EJWA 3IT0A 1HFEL 4B7UA 4MUKA 1TO1E 4RGBA 4GP7A 1E2EA 2C8KA 1IUNA 4BEVA 4HDRA 3IAM6 3OLYA 4O1MA 3N0VA 5FPKA 4XGIA 4ZVOA 4C0SA 3STHA 2VQFB 1NJ1A 2BTQA 5AK4A 1UT8A 3SSOA 1G41A 4BBPA 1RZ3A 1B43A 4NNPA 3S0JA 2HCJB 2PPVA 2Q3MA 2ATIA 1YIAA 2W83A 2JH8A 1ZX1A 4JJ4A 4O29A 1KXJA 1LTHR 4HZGA 1AHIA 4BBAA 2PA0A 4E5PA 4UEOA 4W5TA 1TO6A 1NZJA 3JX9A 1UBFA 3QE0A 3IE0A 5T4BA 4G1UC 5E95A 3U9SA 4M8NE 4QT0A 1LGYA 3GFRA 1U3TA 1FU4A 2QUKA 4UUAA 1XXLA 5EHNA 3SC3A 4IX9A 1E8DA 1E1CA 2YJTD 4X24A 5DIFA 2BL4A 3L43A 1N5IA 1R4MA 2GEDA 3DR3A 3BD7A 4UZSA 1DWQA 1GYRA 4D43A 4CG0A 2C3PA 3NBUA 2IYZA 4LCEA 2XUJA 3GPDG 3VSDA 1QS0B 4P58A 4D7AA 3VNAA 1S89A 1C0KA 3OE1A 4KMOA 3WL6A 3ZKWA 2VAXA 5EY5B 1CETA 4ZQCB 3NWEA 1JWBB 2ZGVA 4WKGA 4HH3C 5F7ZA 1M34A 3Q5EA 2PSHA 2UUCB 3OEHA 1D2EA 5G40A 4UBOA 1PGPA 2Y1DA 3ZV7A 2OCAA 5JVDA 2XQVA 3FCEA 4OF4A 4LDAA 3UH0A 4JBNA 4JLBA 2VHTA 4QO8A 2NXCA 2P2SA 4COOA 2B5OA 2XBLA 1UUFA 2RBGA 2UZ1B 4GMXA 4QEKA 4MW5A 4CF3A 4DTCA 3JYHA 2GJ4A 4MR8A 4HXGA 2ZXEA 1MVNA 1DDOA 3IAAA 2ICAA 1L5GB 1PJLA 2W37A 2ZAYA 1HDEA 4NHEA 3WC4A 1X1EA 4C89A 4I5FA 4WXRA 1E3MA 1XOIA 2P7HA 1HLPA 2QZ4A 1P19A 3LVQE 5AM1A 2PNFA 4KQMA 4UDXX 1TECE 1CQXA 2V6JA 3AQ4A 2E18A 3ANMA 1K4MA 1I1QB 3GH3A 2F8LA 2JW5A 1J06A 2QUZA 3DVRX 3SU8A 4BMVA 3FKSA 3B7PA 1XMOB 3U3XA 4KU4A 4ZAYA 2BF7A 1OLUA 3M0EA 3EHDA 5JMTA 5LYJA 3PG5A 3BPSA 2GO7A 3PX2A 2C5LA 2FWJA 4RV9A 3NEYA 3H6HA 3PVZA 5A9SB 2HWYA 1GR1A 1EHCA 3PHIA 1R6VA 1IUKA 4M60A 1XCGB 2HJHA 4YRMA 4RE5A 1HPLA 1SRRA 3OT4A 1ZFNA 1H4QA 2PTGA 1QP4A 1M3SA 2QAJA 3GXOA 3X1YA 4CF5A 1V8ZA 3KJGA 5IVDA 3NASA 2CEAA 4H6XA 4L4XA 2WWIA 1NN0A 3VO8A 2N1BA 3TD2A 1JQJC 3DVQX 3DAFA 4GF5A 4JJKA 3EG9B 4CV3A 2O2GA 2OP1A 3GUUA 4F86A 1H0RA 4H7EA 4Q24A 2CMFA 5FHRA 3DZBA 3SYKA 2QRJA 1T1SA 3GG2A 1XTJA 3G2JA 5IT9A 4EQ6B 1J0XO 5FBHA 4AN4A 5EMKA 2ZYWX 4GZ6A 1J90A 1Y1SA 1FMFA 2E48A 3R5HA 4MGKR 3CKMA 2A1TS 2V65A 2QRUA 1XZHA 1TUGA 4LVOA 4PX3A 2NU8B 4URHA 3OY2A 4MIYA 3RC3A 2AFHB 3RUCA 2GBGA 4BB9A 1M6VB 1PR0A 1KYIA 4MQMA 4MHSA 1N2EA 5EIOA 4PXAA 2Y1EA 3MTDA 1SIUA 2HRDA 4J7CA 4QOGA 1MH9A 1AC5A 2X8LA 3UK7A 1Y6QA 4IDDA 2XCSB 2ZKLA 2BHLA 2JZNA 4P4SB 7ABPA 4UHBA 1JDNA 2XMBA 5L4SA 3IB6A 4PLHA 5FR2A 3SBEA 3VISA 1VPDA 2J9FB 1N34B 4N9QA 2D1QA 1TDJA 5TQVA 4KQCA 1JN0A 2X5KO 3FDZA 5DCYA 4RCYA 4E88A 1EUYA 5EQFA 2P5UA 3ENWA 3L77A 2YHBA 2MJLA 4J0DA 1VQ1A 2CNWD 1D09A 3DT9A 1LK5A 1T2DA 2B30A 4KX3A 2XNJA 3VPFA 2GM4A 5BYAA 4J29A 2M98A 3WB0A 3Q7QA 1BXRA 1NXVA 2NXNA 1GNVA 2Z58A 2QD1A 2GAIA 1P5RA 3O3CA 4L5CA 4NRDA 3RS9A 3WIVA 5KNDH 1A9RA 3A26A 1UMKA 1SBNE 2CUTA 1H69A 2AL7A 2C0QA 3QFFA 4EY3A 1E3EA 1G7TA 1AUQA 1HDCA 1LDNA 1QYXA 4KQEA 3RVRA 4RK4A 2RHHA 2JF0A 4BYGA 3F8TA 3OQBA 2OXIA 3WE7A 3PS9A 2FEKA 5LNK6 1H66A 1F8GA 4EEKA 2X4LA 2PZ8A 1SH7A 3IUMA 3R3ZA 4CL8A 3U7RA 2JIMA 4AG3A 4KH0A 1FDWA 3AUAA 3MBIA 1F7VA 3UT0A 1WZIA 2PGLA 3A2NA 4XDHA 1CVLA 5D8DA 4ZMSA 1YTUA 1PG5A 4FOTA 3ZQUA 4KZKA 3JRWA 1P1FA 1Z0JA 1MN6A 2GSWA 4NOLA 1EK5A 5JLJA 1F60A 5IYZB 2YWGA 2FN8A 3T3DA 4BIIA 1QFJA 1JIQA 2MR6A 1VJCA 2PU5A 4I2NA 4L3VA 1W73A 3SM9A 5TIIA 1QAQA 2ZJAA 3OZGA 1RJ9A 5KCMA 4BO1A 5F2NA 1AMUA 5HRUA 1XMXA 3DZGA 4WNCA 1P9NA 2Y77A 3EGDA 4P86A 2H6EA 5I7OA 2FW6A 1RXSA 3TG8A 3FY4A 4MVJA 1EBFA 1USVA 1LQ2A 4HLNA 3B5JA 4O2BB 1BHQ1 5IJWA 1Y33E 3MQ2A 4MQFA 4QJBA 3IBSA 2DBYA 4ZARA 2WWRA 3R7SA 1C3JA 5C9ZA 4LFCB 3KUXA 4F1KA 4PM4A 4DJTA 1FXUA 4UCFA 1OI7A 3N59A 4R1PA 1QGOA 1B8PA 2RKBA 4FHCA 3X1KA 4MQBA 3RS7A 1T43A 2R6JA 4PC1A 5HCUA 1U3VA 1U11A 2NUAA 1QAMA 1Y3FE 3O8OB 4M4SA 1SXJA 3I72A 4A91A 3K8YA 3F5SA 4X62B 5G3YA 2VA9A 4P31A 3SK0A 5AI0A 5EJIA 3U19A 3WGKA 4G09A 3MGBA 4MI1A 4OGFA 4QJ5A 5EFZA 4E6EA 3IS3A 2J1LA 2V9CA 1JYEA 1TEHA 2FMFA 3AF1A 4E31A 3H2IA 1BVYF 2GEJA 4EY6A 1WQ4A 4BWYA 1KIMA 2O2XA 2F17A 2ZDGA 1CQWA 4PBRA 4UPEA 5DTEA 2CJWA 3E9MA 4YPOA 1UBHS 3OFKA 4NV0A 3HDYA 3JSXA 2WE8A 4W5WA 3P9CA 1A2KC 3ED1A 4FX2A 3D6TB 3R9XB 1P7CA 3DC2A 4P8RA 1WMSA 3AJDA 3PC3A 2A5YB 2E6KA 3QU9A 4QFMA 5BOSB 4CKWB 3M4ZA 2XWJI 3UV6A 1EDEA 1WEKA 1UPXA 3CW9A 3QMMA 1QHGA 4RD0A 2IZ6A 3K2EA 5EKTA 3U26A 3FBTA 4DDVA 5HMLA 1V2GA 3W77A 4CNQA 2CXNA 2O0MA 5EMHA 4G89A 3ZCUA 1Q0UA 3I2KA 4Z4HA 1U9IA 3WGOA 5MGNA 3N9IA 4LYGA 4DKJA 1XCLA 2OL4A 2WEKA 5IT0A 1UWLA 3EIXA 1XJCA 2IZ0A 3N0WA 4DNOA 2Z98A 1ZCFA 2Q6KA 4ENSA 4IGAA 3T99A 1XPOA 5EZYA 1PG0A 3H2JA 5FWXA 1C50A 1P80A 2Y05A 3GP5A 4DC9A 1VRVA 1L5QA 2PEZA 4RHYA 3IUSA 5A5VA 5ALGA 1DAMA 4UE2A 1E79D 1G0OA 5JS8A 2O3RA 3VHLB 4YRTA 1M1NB 5ALZA 1DO0A 1FW8A 3HP4A 1FP4A