3MY5B

Cdk2/cyclina in complex with drb
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
262
structure length
262
Chain Sequence
SVNEVPDYHEDIHTYLREMEVKCKPKVGYMKKQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLAFDLAAPTINQFLTQYFLHQQPANCKVESLAMFLGELSLIDADPYLKYLPSVIAAAAFHLALYTVTGQSWPESLVQKTGYTLETLKPCLLDLHQTYLRAPQHAQQSIREKYKNSKYHGVSLLNPPETLNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein kinase 2
publication title Halogen bonds form the basis for selective P-TEFb inhibition by DRB
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/protein binding/inhibitor
total genus 97
structure length 262
sequence length 262
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00134 Cyclin_N Cyclin, N-terminal domain
B PF02984 Cyclin_C Cyclin, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3my5B01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 3my5B02
1AISB 1P5EB 2BPMB 2WHBB 3BLRB 2UZEB 3MY1B 1VOLA 4BCND 3BHVB 1GUXA 2UUEB 1OL1B 2WFYB 2W99A 5ICPB 2WMAB 1O9KA 2WXVB 2R7GA 3TNWB 3EIDB 2WMBB 1OIUB 3H4CA 1QMZB 3BLHB 1OI9B 4EORB 1XO2A 2C5XB 4YOSA 1OL2B 1OKWB 2W9ZA 3EOCB 3K7AM 5ACBA 4EOJB 1GUXB 5HBEB 1E9HB 4G6LB 4BCKB 2B9RA 1O9KB 1GY3B 4F6SB 1H25B 1H26B 1C9BA 5IDNB 1TFBA 3F5XB 3QHRB 3BLQB 1H1RB 4F7JB 1ZP2A 1G3NC 4Y72B 4BCQD 1OKVB 4EC9B 4F7LB 4YC3B 1JSTB 4IMYB 4CFXB 1UNHD 2PMIB 5L2WB 1BU2A 5HBJB 4NSTB 4BCGB 2EUFA 4BCNB 2PK9B 3DDPB 3RGFB 4EOKB 4CFVB 1W98B 2IVXA 2WEVB 5BNJB 3EJ1B 2X1NB 4ROCA 1JSUB 2WIPB 2C5OB 4CFUD 2CCIB 2IW6B 1VYWB 1AD6A 4OR5B 4CXAB 5HQ0B 2UZBB 5HVYB 2CCHB 4YOOA 3TNIB 1FVVB 5CEIB 2IW9B 4CFMB 1H1SB 5EFQB 5LQFB 3BHUB 5HBHB 4YOZA 2CJMB 3DDQB 4BCIB 2C5VB 3BHTB 1F5QB 1PKDB 4EOOB 2UZDB 4II5B 4BCHB 1H27B 3LQ5B 1N4MA 2BKZB 4F7NB 4EOIB 5HNBB 4CFWB 1H4LD 4ELLA 4BCQB 4UN0A 2I53A 3MIAB 4ROEA 4BCMD 4F70B 1H24B 4FX3B 5IDPB 2WIHB 4BCOB 2C5NB 1JKWA 3TN8B 2JGZB 3MI9B 2PK2A 3POMA 3M03A 4I3ZB 2QDJA 4F6UB 1JOWA 4EOSB 4BCJB 4CFUB 3O0GD 4CFNB 4BCFB 3DOGB 4ELJA 2C6TB 1KXUA 4CRLB 2UZLB 1URCB 1UNGD 2I40B 1D3UB 4TTHA 1VINA 2F2CA 4EOQB 1H1PB 1FINB 2V22B 5I5ZB 3QHWB 3TNHB 4EOLB 2C4GB 4F6WB 5LMKB 1H28B 2PHGA 3MY5B 2W9FA 4KRDB 4EONB 1H1QB 1UNLD 2IW8B 1GH6B 4RODA 4BCMB 4OGRB 4EC8B 3G33B 2G9XB 4F7SB 4KRCB 4EOPB 2W2HA 1OGUB 4BCPB 5CYIB 5IF1B 1OIYB 2W96A 5FGKB 2WPAB 4EOMB
chains in the Genus database with same CATH superfamily
4JX5A 3BLRB 2BS4A 4BCND 1GUXA 5ICPB 1TD6A 2W99A 3A8HB 1OIUB 1XO2A 2C5XB 3K7AM 4M6VA 4FM4B 4EOJB 4HNUA 4G6LB 4Z6YA 2B9RA 1O9KB 4ZGDB 1H25B 5IDNB 1TFBA 3F5XB 4AKHA 3BG9A 1H1RB 4BY1X 4BCQD 1OKVB 3QYBA 4EC9B 1JSTB 2PMIB 2LW4A 2EUFA 3RGFB 4EOKB 4CFVB 3EJ1B 2X1NB 2C5OB 4CFUD 4OR5B 4CXAB 1UGSB 2ZZDB 4BBRM 1IREB 2DD4B 5CEIB 2IW9B 2QF7A 5DQWA 3BHUB 5HBHB 2C5VB 3VKGA 2DXCB 2ZPGB 4F7NB 3TW7A 3QZ9B 4AKIA 2I53A 3MIAB 4BCMD 4FX3B 5IDPB 2JGZB 3MI9B 3HZJA 3M03A 4EOSB 3QZ5B 4BCJB 3HHTB 2PJQA 4JX6A 4CFNB 2C6TB 2UZLB 4JX4A 1URCB 3QWLA 4TTHA 4OB1B 1VINA 4EOQB 1H1PB 2V22B 3VKHA 3TNHB 3DL1A 3BG5A 3DTOA 2AHJB 2IW8B 4OGRB 4EC8B 1OGUB 2CZ0B 4AI6A 1OIYB 2KMGA 3B57A 4EOMB 1P5EB 2BPMB 3VYHB 1UGPB 2WJ9A 2WFYB 1O9KA 2WXVB 5DQVA 2WMBB 3BLHB 3GTMS 1V29B 3EOCB 1E9HB 4BCKB 1GY3B 3QHRB 3BG3A 1ZP2A 2G77A 3A8GB 3QYEA 4Y72B 4LOCA 1UNHD 5HBJB 4NSTB 1AHJB 3DDPB 2IVXA 1UGRB 1JSUB 2WIPB 2UZBB 2DPPB 3TNIB 4BBSM 4YOZA 4BCIB 3DDQB 1F5QB 1PKDB 4II5B 3PO3S 4BCHB 2BKZB 4EOIB 2QQ8A 4CFWB 1H24B 2WIHB 3TN8B 3DJBA 4HLQA 3DOGB 5IHYA 4ELJA 2I40B 2F2CA 1FINB 3HO8A 3X20B 5I5ZB 4EOLB 2C4GB 2PHGA 3MY5B 4EONB 2BS3A 3A8MB 2W2HA 2ZPBB 4BCPB 5FGKB 4HNTA 2UZEB 4HNVA 2R7GA 3TW6A 3TNWB 2ZPHB 1E7PA 3A8LB 3H4CA 4EORB 1OL2B 4QSHA 1OKWB 5ACBA 2BS2A 4F7JB 1G3NC 4F7LB 4NC6A 4YC3B 4IMYB 4CFXB 3X25B 2CYZB 5L2WB 4AKGA 4HL4A 4BCNB 2WEVB 3A8OB 4ROCA 2IW6B 4OB0B 5HQ0B 4MIMA 3VYGB 1FVVB 4MFDA 1H1SB 5LQFB 1ENWA 2CJMB 3BHTB 4EOOB 5EJCA 2UZDB 1H27B 4ELLA 4BCQB 4UN0A 4ROEA 4OB2B 2CZ1B 4F70B 4MFEA 4BCOB 1JKWA 2PK2A 3POMA 2DMEA 2QDJA 1JOWA 4CFUB 3O0GD 1UGQB 3WVDB 4BY7X 2ZPIB 4BCFB 4OB3B 1UNGD 1D3UB 3WVEB 3QHWB 4F6WB 5LMKB 2W9FA 2QDYB 2ZPFB 4BCMB 2G9XB 4KRCB 5CYIB 5IF1B 2DXBB 2W96A 1VOLA 2CZ6B 3QXEB 1AISB 2WHBB 3MY1B 3BHVB 2UUEB 1OL1B 3X28B 2WMAB 3NDQA 3EIDB 1QMZB 1OI9B 4YOSA 2W9ZA 5HBEB 1GUXB 4BXXX 4F6SB 2IN3A 1H26B 1C9BA 3QYGB 3BLQB 1BU2A 4BCGB 2PK9B 2DD5B 3HB9A 1W98B 5BNJB 2CCIB 4ZGEB 1VYWB 1AD6A 5HVYB 2CCHB 3QYHB 4YOOA 4CFMB 2QFZA 2ZPEB 5EFQB 3LQ5B 1N4MA 2CZ7B 5HNBB 1H4LD 1FKMA 2D0QB 1QLBA 4I3ZB 4F6UB 4CRLB 1KXUA 3HBLA 3KHIA 2QGSA 3X26B 1H28B 4KRDB 3X24B 1H1QB 1UNLD 4ZGJB 1GH6B 4RODA 3G33B 4F7SB 4EOPB 2ZCFB 2KR6A 2C5NB 2WPAB
chains in the Genus database with same CATH topology
1AISB 1P5EB 2BPMB 2WHBB 3BLRB 2UZEB 3MY1B 1VOLA 4BCND 3BHVB 1GUXA 2UUEB 1OL1B 2WFYB 2W99A 5ICPB 2WMAB 1O9KA 2WXVB 2R7GA 3TNWB 3EIDB 2WMBB 1OIUB 3H4CA 1QMZB 3BLHB 1OI9B 4EORB 1XO2A 2C5XB 4YOSA 1OL2B 1OKWB 2W9ZA 3EOCB 3K7AM 5ACBA 4EOJB 1GUXB 5HBEB 1E9HB 4G6LB 4BCKB 2B9RA 1O9KB 1GY3B 4F6SB 1H25B 1H26B 1C9BA 5IDNB 1TFBA 3F5XB 3QHRB 3BLQB 1H1RB 4F7JB 1ZP2A 1G3NC 4Y72B 4BCQD 1OKVB 4EC9B 4F7LB 4YC3B 1JSTB 4IMYB 4CFXB 1UNHD 2PMIB 5L2WB 1BU2A 5HBJB 4NSTB 4BCGB 2EUFA 4BCNB 2PK9B 3DDPB 3RGFB 4EOKB 4CFVB 1W98B 2IVXA 2WEVB 5BNJB 3EJ1B 2X1NB 4ROCA 1JSUB 2WIPB 2C5OB 4CFUD 2CCIB 2IW6B 1VYWB 1AD6A 4OR5B 4CXAB 5HQ0B 2UZBB 5HVYB 2CCHB 4YOOA 3TNIB 1FVVB 5CEIB 2IW9B 4CFMB 1H1SB 5EFQB 5LQFB 3BHUB 5HBHB 4YOZA 2CJMB 3DDQB 4BCIB 2C5VB 3BHTB 1F5QB 1PKDB 4EOOB 2UZDB 4II5B 4BCHB 1H27B 3LQ5B 1N4MA 2BKZB 4F7NB 4EOIB 5HNBB 4CFWB 1H4LD 4ELLA 4BCQB 4UN0A 2I53A 3MIAB 4ROEA 4BCMD 4F70B 1H24B 4FX3B 5IDPB 2WIHB 4BCOB 2C5NB 1JKWA 3TN8B 2JGZB 3MI9B 2PK2A 3POMA 3M03A 4I3ZB 2QDJA 4F6UB 1JOWA 4EOSB 4BCJB 4CFUB 3O0GD 4CFNB 4BCFB 3DOGB 4ELJA 2C6TB 1KXUA 4CRLB 2UZLB 1URCB 1UNGD 2I40B 1D3UB 4TTHA 1VINA 2F2CA 4EOQB 1H1PB 1FINB 2V22B 5I5ZB 3QHWB 3TNHB 4EOLB 2C4GB 4F6WB 5LMKB 1H28B 2PHGA 3MY5B 2W9FA 4KRDB 4EONB 1H1QB 1UNLD 2IW8B 1GH6B 4RODA 4BCMB 4OGRB 4EC8B 3G33B 2G9XB 4F7SB 4KRCB 4EOPB 2W2HA 1OGUB 4BCPB 5CYIB 5IF1B 1OIYB 2W96A 5FGKB 2WPAB 4EOMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AIS B;  1P5E B;  2BPM B;  2WHB B;  3BLR B;  2UZE B;  3MY1 B;  1VOL A;  4BCN D;  3BHV B;  1GUX A;  2UUE B;  1OL1 B;  2WFY B;  2W99 A;  5ICP B;  2WMA B;  1O9K A;  2WXV B;  2R7G A;  3TNW B;  3EID B;  2WMB B;  1OIU B;  3H4C A;  1QMZ B;  3BLH B;  1OI9 B;  4EOR B;  1XO2 A;  2C5X B;  4YOS A;  1OL2 B;  1OKW B;  2W9Z A;  3EOC B;  3K7A M;  5ACB A;  4EOJ B;  1GUX B;  5HBE B;  1E9H B;  4G6L B;  4BCK B;  2B9R A;  1O9K B;  1GY3 B;  4F6S B;  1H25 B;  1H26 B;  1C9B A;  5IDN B;  1TFB A;  3F5X B;  3QHR B;  3BLQ B;  1H1R B;  4F7J B;  1ZP2 A;  1G3N C;  4Y72 B;  4BCQ D;  1OKV B;  4EC9 B;  4F7L B;  4YC3 B;  1JST B;  4IMY B;  4CFX B;  1UNH D;  2PMI B;  5L2W B;  1BU2 A;  5HBJ B;  4NST B;  4BCG B;  2EUF A;  4BCN B;  2PK9 B;  3DDP B;  3RGF B;  4EOK B;  4CFV B;  1W98 B;  2IVX A;  2WEV B;  5BNJ B;  3EJ1 B;  2X1N B;  4ROC A;  1JSU B;  2WIP B;  2C5O B;  4CFU D;  2CCI B;  2IW6 B;  1VYW B;  1AD6 A;  4OR5 B;  4CXA B;  5HQ0 B;  2UZB B;  5HVY B;  2CCH B;  4YOO A;  3TNI B;  1FVV B;  5CEI B;  2IW9 B;  4CFM B;  1H1S B;  5EFQ B;  5LQF B;  3BHU B;  5HBH B;  4YOZ A;  2CJM B;  3DDQ B;  4BCI B;  2C5V B;  3BHT B;  1F5Q B;  1PKD B;  4EOO B;  2UZD B;  4II5 B;  4BCH B;  1H27 B;  3LQ5 B;  1N4M A;  2BKZ B;  4F7N B;  4EOI B;  5HNB B;  4CFW B;  1H4L D;  4ELL A;  4BCQ B;  4UN0 A;  2I53 A;  3MIA B;  4ROE A;  4BCM D;  4F70 B;  1H24 B;  4FX3 B;  5IDP B;  2WIH B;  4BCO B;  2C5N B;  1JKW A;  3TN8 B;  2JGZ B;  3MI9 B;  2PK2 A;  3POM A;  3M03 A;  4I3Z B;  2QDJ A;  4F6U B;  1JOW A;  4EOS B;  4BCJ B;  4CFU B;  3O0G D;  4CFN B;  4BCF B;  3DOG B;  4ELJ A;  2C6T B;  1KXU A;  4CRL B;  2UZL B;  1URC B;  1UNG D;  2I40 B;  1D3U B;  4TTH A;  1VIN A;  2F2C A;  4EOQ B;  1H1P B;  1FIN B;  2V22 B;  5I5Z B;  3QHW B;  3TNH B;  4EOL B;  2C4G B;  4F6W B;  5LMK B;  1H28 B;  2PHG A;  3MY5 B;  2W9F A;  4KRD B;  4EON B;  1H1Q B;  1UNL D;  2IW8 B;  1GH6 B;  4ROD A;  4BCM B;  4OGR B;  4EC8 B;  3G33 B;  2G9X B;  4F7S B;  4KRC B;  4EOP B;  2W2H A;  1OGU B;  4BCP B;  5CYI B;  5IF1 B;  1OIY B;  2W96 A;  5FGK B;  2WPA B;  4EOM B; 
#chains in the Genus database with same CATH topology
 4JX5 A;  3BLR B;  2BS4 A;  4BCN D;  1GUX A;  5ICP B;  1TD6 A;  2W99 A;  3A8H B;  1OIU B;  1XO2 A;  2C5X B;  3K7A M;  4M6V A;  4FM4 B;  4EOJ B;  4HNU A;  4G6L B;  4Z6Y A;  2B9R A;  1O9K B;  4ZGD B;  1H25 B;  5IDN B;  1TFB A;  3F5X B;  4AKH A;  3BG9 A;  1H1R B;  4BY1 X;  4BCQ D;  1OKV B;  3QYB A;  4EC9 B;  1JST B;  2PMI B;  2LW4 A;  2EUF A;  3RGF B;  4EOK B;  4CFV B;  3EJ1 B;  2X1N B;  2C5O B;  4CFU D;  4OR5 B;  4CXA B;  1UGS B;  2ZZD B;  4BBR M;  1IRE B;  2DD4 B;  5CEI B;  2IW9 B;  2QF7 A;  5DQW A;  3BHU B;  5HBH B;  2C5V B;  3VKG A;  2DXC B;  2ZPG B;  4F7N B;  3TW7 A;  3QZ9 B;  4AKI A;  2I53 A;  3MIA B;  4BCM D;  4FX3 B;  5IDP B;  2JGZ B;  3MI9 B;  3HZJ A;  3M03 A;  4EOS B;  3QZ5 B;  4BCJ B;  3HHT B;  2PJQ A;  4JX6 A;  4CFN B;  2C6T B;  2UZL B;  4JX4 A;  1URC B;  3QWL A;  4TTH A;  4OB1 B;  1VIN A;  4EOQ B;  1H1P B;  2V22 B;  3VKH A;  3TNH B;  3DL1 A;  3BG5 A;  3DTO A;  2AHJ B;  2IW8 B;  4OGR B;  4EC8 B;  1OGU B;  2CZ0 B;  4AI6 A;  1OIY B;  2KMG A;  3B57 A;  4EOM B;  1P5E B;  2BPM B;  3VYH B;  1UGP B;  2WJ9 A;  2WFY B;  1O9K A;  2WXV B;  5DQV A;  2WMB B;  3BLH B;  3GTM S;  1V29 B;  3EOC B;  1E9H B;  4BCK B;  1GY3 B;  3QHR B;  3BG3 A;  1ZP2 A;  2G77 A;  3A8G B;  3QYE A;  4Y72 B;  4LOC A;  1UNH D;  5HBJ B;  4NST B;  1AHJ B;  3DDP B;  2IVX A;  1UGR B;  1JSU B;  2WIP B;  2UZB B;  2DPP B;  3TNI B;  4BBS M;  4YOZ A;  4BCI B;  3DDQ B;  1F5Q B;  1PKD B;  4II5 B;  3PO3 S;  4BCH B;  2BKZ B;  4EOI B;  2QQ8 A;  4CFW B;  1H24 B;  2WIH B;  3TN8 B;  3DJB A;  4HLQ A;  3DOG B;  5IHY A;  4ELJ A;  2I40 B;  2F2C A;  1FIN B;  3HO8 A;  3X20 B;  5I5Z B;  4EOL B;  2C4G B;  2PHG A;  3MY5 B;  4EON B;  2BS3 A;  3A8M B;  2W2H A;  2ZPB B;  4BCP B;  5FGK B;  4HNT A;  2UZE B;  4HNV A;  2R7G A;  3TW6 A;  3TNW B;  2ZPH B;  1E7P A;  3A8L B;  3H4C A;  4EOR B;  1OL2 B;  4QSH A;  1OKW B;  5ACB A;  2BS2 A;  4F7J B;  1G3N C;  4F7L B;  4NC6 A;  4YC3 B;  4IMY B;  4CFX B;  3X25 B;  2CYZ B;  5L2W B;  4AKG A;  4HL4 A;  4BCN B;  2WEV B;  3A8O B;  4ROC A;  2IW6 B;  4OB0 B;  5HQ0 B;  4MIM A;  3VYG B;  1FVV B;  4MFD A;  1H1S B;  5LQF B;  1ENW A;  2CJM B;  3BHT B;  4EOO B;  5EJC A;  2UZD B;  1H27 B;  4ELL A;  4BCQ B;  4UN0 A;  4ROE A;  4OB2 B;  2CZ1 B;  4F70 B;  4MFE A;  4BCO B;  1JKW A;  2PK2 A;  3POM A;  2DME A;  2QDJ A;  1JOW A;  4CFU B;  3O0G D;  1UGQ B;  3WVD B;  4BY7 X;  2ZPI B;  4BCF B;  4OB3 B;  1UNG D;  1D3U B;  3WVE B;  3QHW B;  4F6W B;  5LMK B;  2W9F A;  2QDY B;  2ZPF B;  4BCM B;  2G9X B;  4KRC B;  5CYI B;  5IF1 B;  2DXB B;  2W96 A;  1VOL A;  2CZ6 B;  3QXE B;  1AIS B;  2WHB B;  3MY1 B;  3BHV B;  2UUE B;  1OL1 B;  3X28 B;  2WMA B;  3NDQ A;  3EID B;  1QMZ B;  1OI9 B;  4YOS A;  2W9Z A;  5HBE B;  1GUX B;  4BXX X;  4F6S B;  2IN3 A;  1H26 B;  1C9B A;  3QYG B;  3BLQ B;  1BU2 A;  4BCG B;  2PK9 B;  2DD5 B;  3HB9 A;  1W98 B;  5BNJ B;  2CCI B;  4ZGE B;  1VYW B;  1AD6 A;  5HVY B;  2CCH B;  3QYH B;  4YOO A;  4CFM B;  2QFZ A;  2ZPE B;  5EFQ B;  3LQ5 B;  1N4M A;  2CZ7 B;  5HNB B;  1H4L D;  1FKM A;  2D0Q B;  1QLB A;  4I3Z B;  4F6U B;  4CRL B;  1KXU A;  3HBL A;  3KHI A;  2QGS A;  3X26 B;  1H28 B;  4KRD B;  3X24 B;  1H1Q B;  1UNL D;  4ZGJ B;  1GH6 B;  4ROD A;  3G33 B;  4F7S B;  4EOP B;  2ZCF B;  2KR6 A;  2C5N B;  2WPA B; 
#chains in the Genus database with same CATH homology
 1AIS B;  1P5E B;  2BPM B;  2WHB B;  3BLR B;  2UZE B;  3MY1 B;  1VOL A;  4BCN D;  3BHV B;  1GUX A;  2UUE B;  1OL1 B;  2WFY B;  2W99 A;  5ICP B;  2WMA B;  1O9K A;  2WXV B;  2R7G A;  3TNW B;  3EID B;  2WMB B;  1OIU B;  3H4C A;  1QMZ B;  3BLH B;  1OI9 B;  4EOR B;  1XO2 A;  2C5X B;  4YOS A;  1OL2 B;  1OKW B;  2W9Z A;  3EOC B;  3K7A M;  5ACB A;  4EOJ B;  1GUX B;  5HBE B;  1E9H B;  4G6L B;  4BCK B;  2B9R A;  1O9K B;  1GY3 B;  4F6S B;  1H25 B;  1H26 B;  1C9B A;  5IDN B;  1TFB A;  3F5X B;  3QHR B;  3BLQ B;  1H1R B;  4F7J B;  1ZP2 A;  1G3N C;  4Y72 B;  4BCQ D;  1OKV B;  4EC9 B;  4F7L B;  4YC3 B;  1JST B;  4IMY B;  4CFX B;  1UNH D;  2PMI B;  5L2W B;  1BU2 A;  5HBJ B;  4NST B;  4BCG B;  2EUF A;  4BCN B;  2PK9 B;  3DDP B;  3RGF B;  4EOK B;  4CFV B;  1W98 B;  2IVX A;  2WEV B;  5BNJ B;  3EJ1 B;  2X1N B;  4ROC A;  1JSU B;  2WIP B;  2C5O B;  4CFU D;  2CCI B;  2IW6 B;  1VYW B;  1AD6 A;  4OR5 B;  4CXA B;  5HQ0 B;  2UZB B;  5HVY B;  2CCH B;  4YOO A;  3TNI B;  1FVV B;  5CEI B;  2IW9 B;  4CFM B;  1H1S B;  5EFQ B;  5LQF B;  3BHU B;  5HBH B;  4YOZ A;  2CJM B;  3DDQ B;  4BCI B;  2C5V B;  3BHT B;  1F5Q B;  1PKD B;  4EOO B;  2UZD B;  4II5 B;  4BCH B;  1H27 B;  3LQ5 B;  1N4M A;  2BKZ B;  4F7N B;  4EOI B;  5HNB B;  4CFW B;  1H4L D;  4ELL A;  4BCQ B;  4UN0 A;  2I53 A;  3MIA B;  4ROE A;  4BCM D;  4F70 B;  1H24 B;  4FX3 B;  5IDP B;  2WIH B;  4BCO B;  2C5N B;  1JKW A;  3TN8 B;  2JGZ B;  3MI9 B;  2PK2 A;  3POM A;  3M03 A;  4I3Z B;  2QDJ A;  4F6U B;  1JOW A;  4EOS B;  4BCJ B;  4CFU B;  3O0G D;  4CFN B;  4BCF B;  3DOG B;  4ELJ A;  2C6T B;  1KXU A;  4CRL B;  2UZL B;  1URC B;  1UNG D;  2I40 B;  1D3U B;  4TTH A;  1VIN A;  2F2C A;  4EOQ B;  1H1P B;  1FIN B;  2V22 B;  5I5Z B;  3QHW B;  3TNH B;  4EOL B;  2C4G B;  4F6W B;  5LMK B;  1H28 B;  2PHG A;  3MY5 B;  2W9F A;  4KRD B;  4EON B;  1H1Q B;  1UNL D;  2IW8 B;  1GH6 B;  4ROD A;  4BCM B;  4OGR B;  4EC8 B;  3G33 B;  2G9X B;  4F7S B;  4KRC B;  4EOP B;  2W2H A;  1OGU B;  4BCP B;  5CYI B;  5IF1 B;  1OIY B;  2W96 A;  5FGK B;  2WPA B;  4EOM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...