3MYBA

Crystal structure of enoyl-coa hydratase mycobacterium smegmatis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
259
structure length
259
Chain Sequence
EPLLLQDRDERGVVTLTLNRPQAFNALSEAMLAALGEAFGTLAEDESVRAVVLAASGKAFCAGHDLKEMRAEPSREYYEKLFARCTDVMLAIQRLPAPVIARVHGIATAAGCQLVAMCDLAVATRDARFAVSGINVGLFCSTPGVALSRNVGRKAAFEMLVTGEFVSADDAKGLGLVNRVVAPKALDDEIEAMVSKIVAKPRAAVAMGKALFYRQIETDIESAYADAGTTMACNMMDPSALEGVSAFLEKRRPEWHTPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Lyase
molecule keywords Enoyl-CoA hydratase
total genus 97
structure length 259
sequence length 259
chains with identical sequence B, C
ec nomenclature ec 4.-.-.-:
pdb deposition date 2010-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3mybA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3mybA01
2Q34A 4LK5A 3QWDA 3TLFA 3OT6A 5INIA 3PGQA 3MT6A 3DJAA 3T8AA 2BZRA 4JYJA 3U9TB 3IAVA 4K3WA 4B3HA 3OMEA 3ZWBA 1XNVA 4DI1A 3QMJA 3H0UA 5G1RA 2PBPA 1HZDA 2VSUA 4FNBA 4GHNA 5FUSA 1OD4A 3OC7A 2FW2A 3KQFA 3SWXA 1RJMA 4RYFA 1NZYB 2ZQQA 5KJPA 5G1QA 3U9RB 4JCTA 1N6DA 4JSBA 4JJTA 2A7SA 5E0SH 5C90A 2VSUE 2F9YB 3TRRA 4K29A 4ASIA 4OMRA 3U9SB 3KTGA 3H0SA 4MI2A 3KTIA 4OG1A 1UYVA 5KDRA 2F9IB 3H0QA 3K8XA 4U0HA 4JYLA 5JBWA 3TVWA 1HNUA 3H81A 1UYRA 3PEAA 1FC9A 3KTJA 2VSUF 3V5IA 2IEXA 4JWVA 3T88A 2WTBA 5FIFA 1DCIA 1O8UA 1XNWA 3QKAA 3SLLA 3TT6A 2Q2XA 5G1SA 2CE3A 2F9YA 4KNPA 3TT7A 3Q0JA 3NJBA 3P2LA 3H02A 1SZOA 4KD6A 2NP9A 3VIVA 2J5SA 1XO6A 5DTWA 4MOUA 1PJHA 4Z0MA 2F6QA 5DZKH 2J5GA 4JFCA 5DUFA 2DUBA 1YG6A 4WCZA 3GF3A 4U18A 1X0UA 3WG5A 2GTRA 3G64A 5INFA 1EF8A 3L3SA 4HNKA 3QXZA 4JVTA 4EMMA 3FDUA 1JXZA 4B3IA 2ZL4A 3R9SA 4FZWA 3KTKA 5JBXA 3DORA 3N6RB 3RSIA 2VSSE 2ZQRA 4WYOB 5C9GA 4ELWA 4U1AA 3P85A 1WDMA 3MFMA 1TYFA 3T8BA 4NEKA 4ZDCA 4JCRA 3R0OA 2DEOA 3QXIA 4YLHA 3R9QA 1Q52A 3R6HA 1N6EA 2FBMA 4GM2A 3RRVA 5DTPA 2Q35A 4KWBA 1OD2A 3ZW8A 2VSSF 4I42A 1WZ8A 4G2RA 4EMPA 1WDLA 3ISAA 3LAOA 5IKLB 4Q1IA 1SG4A 4FN8A 4FNDA 5DU4A 3RSTA 1MJ3A 1VRGA 3FF6A 5DUCA 4RYFH 3K50A 1UYTA 3STAA 3T89A 3JU1A 4ZDFA 1ON3A 3V5EA 1DUBA 5DL1A 3BEZA 2C8TA 2HW5A 2X24A 3BF0A 3ZWAA 4L8KA 4OLQA 3Q7HA 2A81A 5DZKA 5KDRB 5DU6A 3HINA 3T3WA 3GF7A 3QK8A 4NNQA 2VX2A 1HNOA 3P5MA 2X58A 1YG8A 4IZCA 3QYRA 1J7XA 5E0NX 4ZDDA 2VSSA 3M6NA 4RCNA 4ELXA 1EF9A 3I47A 3GLMA 1Q51A 3TV5A 4MXIA 3BPPA 4IZBA 3IBBA 2W3PA 3HRXA 5E0SA 4EMLA 2UZFA 2J5GD 2D3TA 3LKEA 3Q0GA 4ZU2A 3HP0A 2J5II 4FN7A 3M6MA 3ST9A 2F9IA 4ELSA 4I52A 4QFEA 1UIYA 4QIIA 1TG6A 4U0GA 4FZWC 2CBYA 4JCQA 4JCSA 4ZDEA 3MOYA 3GMAA 2VREA 4HC8A 1RJNA 4I4ZA 1FC7A 3TDCA 3H0JA 2ZL3A 3IB9A 1K32A 2PG8A 1XX4A 3TZ3A 3NJDA 1PIXA 4FB8A 4QIJA 4F47A 2J5IA 4WZ8B 2A7KA 3Q1TA 3ZWCA 3R9TA 3KTHA 4IZDA 1XNYA 4FJWD 4U0GH 4U19A 3TVUA 4KPKA 1K39A 1FC6A 1WDKA 3QREA 1W2XA 2ZL2A 5DU8A 3MYBA 2FZSA 2F6IA 3PE8A 3HE2A 1N6FA 5MGBA 1ON9A 5DKPA 4JOTA 5INGA 1FCFA 1Y7OA 4ZDBA 1NZYA 3ZW9A 4B3JA 2ZL0A 2PPYA 2J5IB 4Q0GA 5CTBA 4L6WA 4K2NA 2EJ5A 1EY3A 5CTCA 3GKBA 1UYSA 3HLN1 3PZKA 2VSUC 2QQ3A
chains in the Genus database with same CATH superfamily
2Q34A 4LK5A 3L8IA 3QWDA 3TLFA 3OT6A 5INIA 3PGQA 3MT6A 3DJAA 3T8AA 2BZRA 4JYJA 3U9TB 3IAVA 4K3WA 4B3HA 3OMEA 3ZWBA 1XNVA 4DI1A 3AM1A 3QMJA 3H0UA 5G1RA 2PBPA 1HZDA 2VSUA 4FNBA 3BPTA 4GHNA 5FUSA 1OD4A 3OC7A 2FW2A 3KQFA 3SWXA 1RJMA 4RYFA 1NZYB 2ZQQA 5KJPA 5G1QA 3U9RB 4JCTA 3A4LA 1N6DA 4JSBA 4JJTA 2A7SA 5E0SH 5C90A 2VSUE 2F9YB 3TRRA 4K29A 4ASIA 4OMRA 3U9SB 3KTGA 3H0SA 4MI2A 3KTIA 4OG1A 1UYVA 5KDRA 5HUQA 2F9IB 3H0QA 3K8XA 4U0HA 4JYLA 3RQGA 3W8IB 5JBWA 3TVWA 1HNUA 3H81A 1UYRA 3PEAA 1FC9A 3KTJA 2VSUF 2IEXA 3V5IA 4JWVA 3T88A 2WTBA 5FIFA 1DCIA 1O8UA 1XNWA 3QKAA 3SLLA 3TT6A 2Q2XA 5G1SA 2CE3A 2F9YA 4KNPA 3TT7A 3Q0JA 3NJBA 3P2LA 3H02A 1SZOA 4KD6A 2NP9A 3VIVA 2J5SA 1XO6A 5DTWA 4MOUA 1PJHA 4Z0MA 2F6QA 5DZKH 2J5GA 4JFCA 5DUFA 2DUBA 1YG6A 4WCZA 3GF3A 4U18A 1X0UA 3WG5A 2GTRA 3G64A 5INFA 1EF8A 3L3SA 4HNKA 3QXZA 4JVTA 4EMMA 2P63A 3FDUA 1JXZA 4B3IA 2ZL4A 3R9SA 4FZWA 3KTKA 5JBXA 3DORA 3N6RB 3RSIA 2VSSE 3ADDA 2ZQRA 4WYOB 5C9GA 4ELWA 4U1AA 3P85A 1WDMA 3MFMA 1TYFA 3T8BA 4NEKA 4ZDCA 4JCRA 3R0OA 2DEOA 3QXIA 4YLHA 3A4MA 3R9QA 1Q52A 3R6HA 1N6EA 2FBMA 4GM2A 3RRVA 5DTPA 2Q35A 4KWBA 1OD2A 3ZW8A 2VSSF 4I42A 1WZ8A 4G2RA 4EMPA 1WDLA 3ISAA 3LAOA 5IKLB 4Q1IA 1SG4A 4FN8A 1Y64B 4GEHB 4HDTA 4FNDA 5DU4A 3RSTA 1MJ3A 1VRGA 3FF6A 5DUCA 4RYFH 3K50A 1UYTA 3STAA 3T89A 3JU1A 4ZDFA 1ON3A 3V5EA 1DUBA 5DL1A 3BEZA 2C8TA 2HW5A 2X24A 3BF0A 3ZWAA 4L8KA 4OLQA 3Q7HA 2A81A 5DZKA 5KDRB 5DU6A 3HINA 3T3WA 3GF7A 3O4XE 1UX4A 3QK8A 4NNQA 2VX2A 1HNOA 3P5MA 2X58A 1YG8A 4IZCA 4J2UA 3QYRA 1J7XA 5E0NX 3RQEA 3A4NA 2VSSA 4ZDDA 3M6NA 4RCNA 4ELXA 1EF9A 3I47A 3GLMA 3ADBA 1Q51A 3L8JA 3TV5A 4MXIA 3BPPA 4IZBA 3IBBA 2W3PA 3HRXA 5E0SA 4EMLA 2UZFA 2J5GD 2D3TA 3LKEA 3Q0GA 4ZU2A 3HP0A 2J5II 4FN7A 3M6MA 3ST9A 2F9IA 2YJGA 4ELSA 4I52A 4QFEA 1UIYA 4QIIA 1TG6A 4U0GA 3AJMA 4FZWC 3RQFA 2CBYA 4JCQA 4JCSA 4ZDEA 3MOYA 3GMAA 2VREA 4HC8A 1RJNA 4I4ZA 1FC7A 3TDCA 3H0JA 2ZL3A 3IB9A 1K32A 2PG8A 1UX5A 1XX4A 3TZ3A 3NJDA 1PIXA 3IRBA 4FB8A 4QIJA 4F47A 2J5IA 4WZ8B 2A7KA 3Q1TA 3ZWCA 3R9TA 3KTHA 4IZDA 1XNYA 4FJWD 4U0GH 4U19A 4NARA 3TVUA 4KPKA 1K39A 1FC6A 1WDKA 3QREA 1W2XA 2ZL2A 5DU8A 3MYBA 2FZSA 2F6IA 3W8HB 3PE8A 3HE2A 3ADCA 1N6FA 5MGBA 1ON9A 5DKPA 4JOTA 5INGA 1FCFA 1Y7OA 4ZDBA 1NZYA 3ZW9A 4B3JA 2ZL0A 2PPYA 2J5IB 4Q0GA 5CTBA 4L6WA 4K2NA 2EJ5A 1EY3A 5CTCA 3GKBA 1UYSA 3HLN1 3PZKA 2VSUC 2QQ3A
chains in the Genus database with same CATH topology
2Q34A 4LK5A 3QWDA 3TLFA 3OT6A 5INIA 3PGQA 3MT6A 3DJAA 3T8AA 2BZRA 4JYJA 3U9TB 3IAVA 4K3WA 4B3HA 3OMEA 3ZWBA 1XNVA 4DI1A 3QMJA 3H0UA 5G1RA 2PBPA 1HZDA 2VSUA 4FNBA 3BPTA 4GHNA 5FUSA 1OD4A 3OC7A 2FW2A 3KQFA 3SWXA 1RJMA 4RYFA 1NZYB 2ZQQA 5KJPA 5G1QA 3U9RB 4JCTA 1N6DA 4JSBA 4JJTA 2A7SA 5E0SH 5C90A 2VSUE 2F9YB 3TRRA 4K29A 4ASIA 4OMRA 3U9SB 3KTGA 3H0SA 4MI2A 3KTIA 4OG1A 1UYVA 5KDRA 5HUQA 2F9IB 3H0QA 3K8XA 4U0HA 4JYLA 5JBWA 3TVWA 1HNUA 3H81A 1UYRA 3PEAA 1FC9A 3KTJA 2VSUF 3V5IA 2IEXA 4JWVA 3T88A 2WTBA 5FIFA 1DCIA 1O8UA 1XNWA 3QKAA 3SLLA 3TT6A 2Q2XA 5G1SA 2CE3A 2F9YA 4KNPA 3TT7A 3Q0JA 3NJBA 3P2LA 3H02A 1SZOA 4KD6A 2NP9A 3VIVA 2J5SA 1XO6A 5DTWA 4MOUA 1PJHA 4Z0MA 2F6QA 5DZKH 2J5GA 4JFCA 5DUFA 2DUBA 1YG6A 4WCZA 3GF3A 4U18A 1X0UA 3WG5A 2GTRA 3G64A 5INFA 1EF8A 3L3SA 4HNKA 3QXZA 4JVTA 4EMMA 3FDUA 1JXZA 4B3IA 2ZL4A 3R9SA 4FZWA 3KTKA 5JBXA 3DORA 3N6RB 3RSIA 2VSSE 2ZQRA 4WYOB 5C9GA 4ELWA 4U1AA 3P85A 1WDMA 3MFMA 1TYFA 3T8BA 4NEKA 4ZDCA 4JCRA 3R0OA 2DEOA 3QXIA 4YLHA 3R9QA 1Q52A 3R6HA 1N6EA 2FBMA 4GM2A 3RRVA 5DTPA 2Q35A 4KWBA 1OD2A 3ZW8A 2VSSF 4I42A 1WZ8A 4G2RA 4EMPA 1WDLA 3ISAA 3LAOA 5IKLB 4Q1IA 1SG4A 4FN8A 4HDTA 4FNDA 5DU4A 3RSTA 1MJ3A 1VRGA 3FF6A 5DUCA 4RYFH 3K50A 1UYTA 3STAA 3T89A 3JU1A 4ZDFA 1ON3A 3V5EA 1DUBA 5DL1A 3BEZA 2C8TA 2HW5A 2X24A 3BF0A 3ZWAA 4L8KA 4OLQA 3Q7HA 2A81A 5DZKA 5KDRB 5DU6A 3HINA 3T3WA 3GF7A 3QK8A 4NNQA 2VX2A 1HNOA 3P5MA 2X58A 1YG8A 4IZCA 4J2UA 3QYRA 1J7XA 5E0NX 4ZDDA 2VSSA 3M6NA 4RCNA 4ELXA 1EF9A 3I47A 3GLMA 1Q51A 3TV5A 4MXIA 3BPPA 4IZBA 3IBBA 2W3PA 3HRXA 5E0SA 4EMLA 2UZFA 2J5GD 2D3TA 3LKEA 3Q0GA 4ZU2A 3HP0A 2J5II 4FN7A 3M6MA 3ST9A 2F9IA 2YJGA 4ELSA 4I52A 4QFEA 1UIYA 4QIIA 1TG6A 4U0GA 4FZWC 2CBYA 4JCQA 4JCSA 4ZDEA 3MOYA 3GMAA 2VREA 4HC8A 1RJNA 4I4ZA 1FC7A 3TDCA 3H0JA 2ZL3A 3IB9A 1K32A 2PG8A 1XX4A 3TZ3A 3NJDA 1PIXA 4FB8A 4QIJA 4F47A 2J5IA 4WZ8B 2A7KA 3Q1TA 3ZWCA 3R9TA 3KTHA 4IZDA 1XNYA 4FJWD 4U0GH 4U19A 4NARA 3TVUA 4KPKA 1K39A 1FC6A 1WDKA 3QREA 1W2XA 2ZL2A 5DU8A 3MYBA 2FZSA 2F6IA 3PE8A 3HE2A 1N6FA 5MGBA 1ON9A 5DKPA 4JOTA 5INGA 1FCFA 1Y7OA 4ZDBA 1NZYA 3ZW9A 4B3JA 2ZL0A 2PPYA 2J5IB 4Q0GA 5CTBA 4L6WA 4K2NA 2EJ5A 1EY3A 5CTCA 3GKBA 1UYSA 3HLN1 3PZKA 2VSUC 2QQ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q34 A;  4LK5 A;  3QWD A;  3TLF A;  3OT6 A;  5INI A;  3PGQ A;  3MT6 A;  3DJA A;  3T8A A;  2BZR A;  4JYJ A;  3U9T B;  3IAV A;  4K3W A;  4B3H A;  3OME A;  3ZWB A;  1XNV A;  4DI1 A;  3QMJ A;  3H0U A;  5G1R A;  2PBP A;  1HZD A;  2VSU A;  4FNB A;  4GHN A;  5FUS A;  1OD4 A;  3OC7 A;  2FW2 A;  3KQF A;  3SWX A;  1RJM A;  4RYF A;  1NZY B;  2ZQQ A;  5KJP A;  5G1Q A;  3U9R B;  4JCT A;  1N6D A;  4JSB A;  4JJT A;  2A7S A;  5E0S H;  5C90 A;  2VSU E;  2F9Y B;  3TRR A;  4K29 A;  4ASI A;  4OMR A;  3U9S B;  3KTG A;  3H0S A;  4MI2 A;  3KTI A;  4OG1 A;  1UYV A;  5KDR A;  2F9I B;  3H0Q A;  3K8X A;  4U0H A;  4JYL A;  5JBW A;  3TVW A;  1HNU A;  3H81 A;  1UYR A;  3PEA A;  1FC9 A;  3KTJ A;  2VSU F;  3V5I A;  2IEX A;  4JWV A;  3T88 A;  2WTB A;  5FIF A;  1DCI A;  1O8U A;  1XNW A;  3QKA A;  3SLL A;  3TT6 A;  2Q2X A;  5G1S A;  2CE3 A;  2F9Y A;  4KNP A;  3TT7 A;  3Q0J A;  3NJB A;  3P2L A;  3H02 A;  1SZO A;  4KD6 A;  2NP9 A;  3VIV A;  2J5S A;  1XO6 A;  5DTW A;  4MOU A;  1PJH A;  4Z0M A;  2F6Q A;  5DZK H;  2J5G A;  4JFC A;  5DUF A;  2DUB A;  1YG6 A;  4WCZ A;  3GF3 A;  4U18 A;  1X0U A;  3WG5 A;  2GTR A;  3G64 A;  5INF A;  1EF8 A;  3L3S A;  4HNK A;  3QXZ A;  4JVT A;  4EMM A;  3FDU A;  1JXZ A;  4B3I A;  2ZL4 A;  3R9S A;  4FZW A;  3KTK A;  5JBX A;  3DOR A;  3N6R B;  3RSI A;  2VSS E;  2ZQR A;  4WYO B;  5C9G A;  4ELW A;  4U1A A;  3P85 A;  1WDM A;  3MFM A;  1TYF A;  3T8B A;  4NEK A;  4ZDC A;  4JCR A;  3R0O A;  2DEO A;  3QXI A;  4YLH A;  3R9Q A;  1Q52 A;  3R6H A;  1N6E A;  2FBM A;  4GM2 A;  3RRV A;  5DTP A;  2Q35 A;  4KWB A;  1OD2 A;  3ZW8 A;  2VSS F;  4I42 A;  1WZ8 A;  4G2R A;  4EMP A;  1WDL A;  3ISA A;  3LAO A;  5IKL B;  4Q1I A;  1SG4 A;  4FN8 A;  4FND A;  5DU4 A;  3RST A;  1MJ3 A;  1VRG A;  3FF6 A;  5DUC A;  4RYF H;  3K50 A;  1UYT A;  3STA A;  3T89 A;  3JU1 A;  4ZDF A;  1ON3 A;  3V5E A;  1DUB A;  5DL1 A;  3BEZ A;  2C8T A;  2HW5 A;  2X24 A;  3BF0 A;  3ZWA A;  4L8K A;  4OLQ A;  3Q7H A;  2A81 A;  5DZK A;  5KDR B;  5DU6 A;  3HIN A;  3T3W A;  3GF7 A;  3QK8 A;  4NNQ A;  2VX2 A;  1HNO A;  3P5M A;  2X58 A;  1YG8 A;  4IZC A;  3QYR A;  1J7X A;  5E0N X;  4ZDD A;  2VSS A;  3M6N A;  4RCN A;  4ELX A;  1EF9 A;  3I47 A;  3GLM A;  1Q51 A;  3TV5 A;  4MXI A;  3BPP A;  4IZB A;  3IBB A;  2W3P A;  3HRX A;  5E0S A;  4EML A;  2UZF A;  2J5G D;  2D3T A;  3LKE A;  3Q0G A;  4ZU2 A;  3HP0 A;  2J5I I;  4FN7 A;  3M6M A;  3ST9 A;  2F9I A;  4ELS A;  4I52 A;  4QFE A;  1UIY A;  4QII A;  1TG6 A;  4U0G A;  4FZW C;  2CBY A;  4JCQ A;  4JCS A;  4ZDE A;  3MOY A;  3GMA A;  2VRE A;  4HC8 A;  1RJN A;  4I4Z A;  1FC7 A;  3TDC A;  3H0J A;  2ZL3 A;  3IB9 A;  1K32 A;  2PG8 A;  1XX4 A;  3TZ3 A;  3NJD A;  1PIX A;  4FB8 A;  4QIJ A;  4F47 A;  2J5I A;  4WZ8 B;  2A7K A;  3Q1T A;  3ZWC A;  3R9T A;  3KTH A;  4IZD A;  1XNY A;  4FJW D;  4U0G H;  4U19 A;  3TVU A;  4KPK A;  1K39 A;  1FC6 A;  1WDK A;  3QRE A;  1W2X A;  2ZL2 A;  5DU8 A;  3MYB A;  2FZS A;  2F6I A;  3PE8 A;  3HE2 A;  1N6F A;  5MGB A;  1ON9 A;  5DKP A;  4JOT A;  5ING A;  1FCF A;  1Y7O A;  4ZDB A;  1NZY A;  3ZW9 A;  4B3J A;  2ZL0 A;  2PPY A;  2J5I B;  4Q0G A;  5CTB A;  4L6W A;  4K2N A;  2EJ5 A;  1EY3 A;  5CTC A;  3GKB A;  1UYS A;  3HLN 1;  3PZK A;  2VSU C;  2QQ3 A; 
#chains in the Genus database with same CATH topology
 2Q34 A;  4LK5 A;  3L8I A;  3QWD A;  3TLF A;  3OT6 A;  5INI A;  3PGQ A;  3MT6 A;  3DJA A;  3T8A A;  2BZR A;  4JYJ A;  3U9T B;  3IAV A;  4K3W A;  4B3H A;  3OME A;  3ZWB A;  1XNV A;  4DI1 A;  3AM1 A;  3QMJ A;  3H0U A;  5G1R A;  2PBP A;  1HZD A;  2VSU A;  4FNB A;  3BPT A;  4GHN A;  5FUS A;  1OD4 A;  3OC7 A;  2FW2 A;  3KQF A;  3SWX A;  1RJM A;  4RYF A;  1NZY B;  2ZQQ A;  5KJP A;  5G1Q A;  3U9R B;  4JCT A;  3A4L A;  1N6D A;  4JSB A;  4JJT A;  2A7S A;  5E0S H;  5C90 A;  2VSU E;  2F9Y B;  3TRR A;  4K29 A;  4ASI A;  4OMR A;  3U9S B;  3KTG A;  3H0S A;  4MI2 A;  3KTI A;  4OG1 A;  1UYV A;  5KDR A;  5HUQ A;  2F9I B;  3H0Q A;  3K8X A;  4U0H A;  4JYL A;  3RQG A;  3W8I B;  5JBW A;  3TVW A;  1HNU A;  3H81 A;  1UYR A;  3PEA A;  1FC9 A;  3KTJ A;  2VSU F;  2IEX A;  3V5I A;  4JWV A;  3T88 A;  2WTB A;  5FIF A;  1DCI A;  1O8U A;  1XNW A;  3QKA A;  3SLL A;  3TT6 A;  2Q2X A;  5G1S A;  2CE3 A;  2F9Y A;  4KNP A;  3TT7 A;  3Q0J A;  3NJB A;  3P2L A;  3H02 A;  1SZO A;  4KD6 A;  2NP9 A;  3VIV A;  2J5S A;  1XO6 A;  5DTW A;  4MOU A;  1PJH A;  4Z0M A;  2F6Q A;  5DZK H;  2J5G A;  4JFC A;  5DUF A;  2DUB A;  1YG6 A;  4WCZ A;  3GF3 A;  4U18 A;  1X0U A;  3WG5 A;  2GTR A;  3G64 A;  5INF A;  1EF8 A;  3L3S A;  4HNK A;  3QXZ A;  4JVT A;  4EMM A;  2P63 A;  3FDU A;  1JXZ A;  4B3I A;  2ZL4 A;  3R9S A;  4FZW A;  3KTK A;  5JBX A;  3DOR A;  3N6R B;  3RSI A;  2VSS E;  3ADD A;  2ZQR A;  4WYO B;  5C9G A;  4ELW A;  4U1A A;  3P85 A;  1WDM A;  3MFM A;  1TYF A;  3T8B A;  4NEK A;  4ZDC A;  4JCR A;  3R0O A;  2DEO A;  3QXI A;  4YLH A;  3A4M A;  3R9Q A;  1Q52 A;  3R6H A;  1N6E A;  2FBM A;  4GM2 A;  3RRV A;  5DTP A;  2Q35 A;  4KWB A;  1OD2 A;  3ZW8 A;  2VSS F;  4I42 A;  1WZ8 A;  4G2R A;  4EMP A;  1WDL A;  3ISA A;  3LAO A;  5IKL B;  4Q1I A;  1SG4 A;  4FN8 A;  1Y64 B;  4GEH B;  4HDT A;  4FND A;  5DU4 A;  3RST A;  1MJ3 A;  1VRG A;  3FF6 A;  5DUC A;  4RYF H;  3K50 A;  1UYT A;  3STA A;  3T89 A;  3JU1 A;  4ZDF A;  1ON3 A;  3V5E A;  1DUB A;  5DL1 A;  3BEZ A;  2C8T A;  2HW5 A;  2X24 A;  3BF0 A;  3ZWA A;  4L8K A;  4OLQ A;  3Q7H A;  2A81 A;  5DZK A;  5KDR B;  5DU6 A;  3HIN A;  3T3W A;  3GF7 A;  3O4X E;  1UX4 A;  3QK8 A;  4NNQ A;  2VX2 A;  1HNO A;  3P5M A;  2X58 A;  1YG8 A;  4IZC A;  4J2U A;  3QYR A;  1J7X A;  5E0N X;  3RQE A;  3A4N A;  2VSS A;  4ZDD A;  3M6N A;  4RCN A;  4ELX A;  1EF9 A;  3I47 A;  3GLM A;  3ADB A;  1Q51 A;  3L8J A;  3TV5 A;  4MXI A;  3BPP A;  4IZB A;  3IBB A;  2W3P A;  3HRX A;  5E0S A;  4EML A;  2UZF A;  2J5G D;  2D3T A;  3LKE A;  3Q0G A;  4ZU2 A;  3HP0 A;  2J5I I;  4FN7 A;  3M6M A;  3ST9 A;  2F9I A;  2YJG A;  4ELS A;  4I52 A;  4QFE A;  1UIY A;  4QII A;  1TG6 A;  4U0G A;  3AJM A;  4FZW C;  3RQF A;  2CBY A;  4JCQ A;  4JCS A;  4ZDE A;  3MOY A;  3GMA A;  2VRE A;  4HC8 A;  1RJN A;  4I4Z A;  1FC7 A;  3TDC A;  3H0J A;  2ZL3 A;  3IB9 A;  1K32 A;  2PG8 A;  1UX5 A;  1XX4 A;  3TZ3 A;  3NJD A;  1PIX A;  3IRB A;  4FB8 A;  4QIJ A;  4F47 A;  2J5I A;  4WZ8 B;  2A7K A;  3Q1T A;  3ZWC A;  3R9T A;  3KTH A;  4IZD A;  1XNY A;  4FJW D;  4U0G H;  4U19 A;  4NAR A;  3TVU A;  4KPK A;  1K39 A;  1FC6 A;  1WDK A;  3QRE A;  1W2X A;  2ZL2 A;  5DU8 A;  3MYB A;  2FZS A;  2F6I A;  3W8H B;  3PE8 A;  3HE2 A;  3ADC A;  1N6F A;  5MGB A;  1ON9 A;  5DKP A;  4JOT A;  5ING A;  1FCF A;  1Y7O A;  4ZDB A;  1NZY A;  3ZW9 A;  4B3J A;  2ZL0 A;  2PPY A;  2J5I B;  4Q0G A;  5CTB A;  4L6W A;  4K2N A;  2EJ5 A;  1EY3 A;  5CTC A;  3GKB A;  1UYS A;  3HLN 1;  3PZK A;  2VSU C;  2QQ3 A; 
#chains in the Genus database with same CATH homology
 2Q34 A;  4LK5 A;  3QWD A;  3TLF A;  3OT6 A;  5INI A;  3PGQ A;  3MT6 A;  3DJA A;  3T8A A;  2BZR A;  4JYJ A;  3U9T B;  3IAV A;  4K3W A;  4B3H A;  3OME A;  3ZWB A;  1XNV A;  4DI1 A;  3QMJ A;  3H0U A;  5G1R A;  2PBP A;  1HZD A;  2VSU A;  4FNB A;  3BPT A;  4GHN A;  5FUS A;  1OD4 A;  3OC7 A;  2FW2 A;  3KQF A;  3SWX A;  1RJM A;  4RYF A;  1NZY B;  2ZQQ A;  5KJP A;  5G1Q A;  3U9R B;  4JCT A;  1N6D A;  4JSB A;  4JJT A;  2A7S A;  5E0S H;  5C90 A;  2VSU E;  2F9Y B;  3TRR A;  4K29 A;  4ASI A;  4OMR A;  3U9S B;  3KTG A;  3H0S A;  4MI2 A;  3KTI A;  4OG1 A;  1UYV A;  5KDR A;  5HUQ A;  2F9I B;  3H0Q A;  3K8X A;  4U0H A;  4JYL A;  5JBW A;  3TVW A;  1HNU A;  3H81 A;  1UYR A;  3PEA A;  1FC9 A;  3KTJ A;  2VSU F;  3V5I A;  2IEX A;  4JWV A;  3T88 A;  2WTB A;  5FIF A;  1DCI A;  1O8U A;  1XNW A;  3QKA A;  3SLL A;  3TT6 A;  2Q2X A;  5G1S A;  2CE3 A;  2F9Y A;  4KNP A;  3TT7 A;  3Q0J A;  3NJB A;  3P2L A;  3H02 A;  1SZO A;  4KD6 A;  2NP9 A;  3VIV A;  2J5S A;  1XO6 A;  5DTW A;  4MOU A;  1PJH A;  4Z0M A;  2F6Q A;  5DZK H;  2J5G A;  4JFC A;  5DUF A;  2DUB A;  1YG6 A;  4WCZ A;  3GF3 A;  4U18 A;  1X0U A;  3WG5 A;  2GTR A;  3G64 A;  5INF A;  1EF8 A;  3L3S A;  4HNK A;  3QXZ A;  4JVT A;  4EMM A;  3FDU A;  1JXZ A;  4B3I A;  2ZL4 A;  3R9S A;  4FZW A;  3KTK A;  5JBX A;  3DOR A;  3N6R B;  3RSI A;  2VSS E;  2ZQR A;  4WYO B;  5C9G A;  4ELW A;  4U1A A;  3P85 A;  1WDM A;  3MFM A;  1TYF A;  3T8B A;  4NEK A;  4ZDC A;  4JCR A;  3R0O A;  2DEO A;  3QXI A;  4YLH A;  3R9Q A;  1Q52 A;  3R6H A;  1N6E A;  2FBM A;  4GM2 A;  3RRV A;  5DTP A;  2Q35 A;  4KWB A;  1OD2 A;  3ZW8 A;  2VSS F;  4I42 A;  1WZ8 A;  4G2R A;  4EMP A;  1WDL A;  3ISA A;  3LAO A;  5IKL B;  4Q1I A;  1SG4 A;  4FN8 A;  4HDT A;  4FND A;  5DU4 A;  3RST A;  1MJ3 A;  1VRG A;  3FF6 A;  5DUC A;  4RYF H;  3K50 A;  1UYT A;  3STA A;  3T89 A;  3JU1 A;  4ZDF A;  1ON3 A;  3V5E A;  1DUB A;  5DL1 A;  3BEZ A;  2C8T A;  2HW5 A;  2X24 A;  3BF0 A;  3ZWA A;  4L8K A;  4OLQ A;  3Q7H A;  2A81 A;  5DZK A;  5KDR B;  5DU6 A;  3HIN A;  3T3W A;  3GF7 A;  3QK8 A;  4NNQ A;  2VX2 A;  1HNO A;  3P5M A;  2X58 A;  1YG8 A;  4IZC A;  4J2U A;  3QYR A;  1J7X A;  5E0N X;  4ZDD A;  2VSS A;  3M6N A;  4RCN A;  4ELX A;  1EF9 A;  3I47 A;  3GLM A;  1Q51 A;  3TV5 A;  4MXI A;  3BPP A;  4IZB A;  3IBB A;  2W3P A;  3HRX A;  5E0S A;  4EML A;  2UZF A;  2J5G D;  2D3T A;  3LKE A;  3Q0G A;  4ZU2 A;  3HP0 A;  2J5I I;  4FN7 A;  3M6M A;  3ST9 A;  2F9I A;  2YJG A;  4ELS A;  4I52 A;  4QFE A;  1UIY A;  4QII A;  1TG6 A;  4U0G A;  4FZW C;  2CBY A;  4JCQ A;  4JCS A;  4ZDE A;  3MOY A;  3GMA A;  2VRE A;  4HC8 A;  1RJN A;  4I4Z A;  1FC7 A;  3TDC A;  3H0J A;  2ZL3 A;  3IB9 A;  1K32 A;  2PG8 A;  1XX4 A;  3TZ3 A;  3NJD A;  1PIX A;  4FB8 A;  4QIJ A;  4F47 A;  2J5I A;  4WZ8 B;  2A7K A;  3Q1T A;  3ZWC A;  3R9T A;  3KTH A;  4IZD A;  1XNY A;  4FJW D;  4U0G H;  4U19 A;  4NAR A;  3TVU A;  4KPK A;  1K39 A;  1FC6 A;  1WDK A;  3QRE A;  1W2X A;  2ZL2 A;  5DU8 A;  3MYB A;  2FZS A;  2F6I A;  3PE8 A;  3HE2 A;  1N6F A;  5MGB A;  1ON9 A;  5DKP A;  4JOT A;  5ING A;  1FCF A;  1Y7O A;  4ZDB A;  1NZY A;  3ZW9 A;  4B3J A;  2ZL0 A;  2PPY A;  2J5I B;  4Q0G A;  5CTB A;  4L6W A;  4K2N A;  2EJ5 A;  1EY3 A;  5CTC A;  3GKB A;  1UYS A;  3HLN 1;  3PZK A;  2VSU C;  2QQ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...