3MYBA

Crystal structure of enoyl-coa hydratase mycobacterium smegmatis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
259
structure length
259
Chain Sequence
b'EPLLLQDRDERGVVTLTLNRPQAFNALSEAMLAALGEAFGTLAEDESVRAVVLAASGKAFCAGHDLKEMRAEPSREYYEKLFARCTDVMLAIQRLPAPVIARVHGIATAAGCQLVAMCDLAVATRDARFAVSGINVGLFCSTPGVALSRNVGRKAAFEMLVTGEFVSADDAKGLGLVNRVVAPKALDDEIEAMVSKIVAKPRAAVAMGKALFYRQIETDIESAYADAGTTMACNMMDPSALEGVSAFLEKRRPEWHTPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-CoA hydratase
publication title Increasing the structural coverage of tuberculosis drug targets.
pubmed doi rcsb
source organism Mycobacterium smegmatis
molecule tags Lyase
total genus 97
structure length 259
sequence length 259
chains with identical sequence B, C
ec nomenclature ec 4.-.-.-:
pdb deposition date 2010-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.12.10 Mainly Alpha Orthogonal Bundle Lyase 2-enoyl-coa Hydratase; Chain A, domain 2 Lyase 2-enoyl-coa Hydratase, Chain A, domain 2 3mybA02
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3mybA01
3HP0A 5DUCA 2PBPA 2WTBA 2A81A 1EF8A 2CE3A 3QXIA 3SWXA 3IAVA 2VSSE 3TT7A 4IZCA 3PZKA 1K32A 4B3IA 3LAOA 2ZL2A 4RYFH 4Q1IA 3TT6A 3BF0A 3T8AA 4MXIA 5INIA 2FW2A 2F6QA 3QK8A 3TZ3A 4FB8A 2VSUE 3RRVA 4FJWD 1WDLA 4F47A 5JBXA 2ZQQA 4KD6A 1HZDA 3DORA 1SG4A 2VSSF 4FNDA 1OD4A 4WZ8B 4ELWA 4U18A 4JYLA 1FC9A 3KTHA 4KWBA 5CTCA 3KTKA 3RSIA 4JVTA 3TRRA 4L6WA 1N6EA 3PEAA 5KDRB 1EY3A 1N6FA 4ZDDA 3GF7A 5E0SH 3T3WA 4HNKA 3MT6A 2VSUC 2Q2XA 1YG6A 5DZKH 4U19A 4ELXA 3H81A 2VREA 4QFEA 3PGQA 1HNUA 4QIIA 1UIYA 4JYJA 3N6RB 5FUSA 3ZWCA 1Q51A 4KPKA 2Q35A 5DL1A 2Q34A 3T89A 3K50A 3NJDA 4IZBA 3KTJA 4EMPA 2HW5A 1O8UA 3QREA 1WDMA 2NP9A 3DJAA 3P85A 5INFA 3OC7A 4NNQA 4K2NA 4B3HA 1JXZA 3QWDA 5DU4A 3U9RB 2CBYA 2A7SA 2D3TA 3TDCA 4FZWA 5E0NX 1N6DA 5DTPA 5DKPA 4EMLA 1NZYB 4L8KA 2FBMA 2J5II 5DU6A 5KJPA 3QXZA 4K3WA 1NZYA 2DEOA 3HRXA 5IKLB 3NJBA 5MGBA 3R9SA 1W2XA 2VSSA 3H0QA 2J5IB 3VIVA 4U0HA 3STAA 1Q52A 2F9IB 3R6HA 3FDUA 1UYTA 4FN7A 1OD2A 3OMEA 2J5IA 5DU8A 1WDKA 2VX2A 1SZOA 4LK5A 2F9IA 1ON3A 5DUFA 3I47A 3Q0JA 2FZSA 4ASIA 4IZDA 3K8XA 4JWVA 4I42A 1FC6A 4FZWC 3SLLA 2PG8A 3U9TB 1RJMA 1RJNA 4MOUA 4JSBA 3GLMA 3BPPA 5E0SA 5INGA 3HLN1 3KQFA 4WCZA 2ZL3A 3HE2A 5C9GA 3M6MA 1FC7A 3OT6A 5DZKA 2A7KA 3ZWAA 4JJTA 1XNWA 3WG5A 4JCRA 4QIJA 1DCIA 5JBWA 5C90A 3IBBA 2VSUF 5G1QA 4FNBA 3R0OA 3H0JA 4U1AA 4ZDCA 1UYSA 4FN8A 1HNOA 3ZW8A 4I52A 3ZW9A 1K39A 1TG6A 2ZL0A 4I4ZA 4DI1A 1XNVA 3HINA 3KTIA 5DTWA 4JOTA 4JCQA 2PPYA 4U0GH 3FF6A 3TV5A 4ZDBA 1EF9A 4G2RA 1YG8A 4ZDFA 3MYBA 5G1SA 3P5MA 4Q0GA 3GMAA 3JU1A 4OLQA 2ZL4A 1FCFA 2X58A 4KNPA 4EMMA 1VRGA 4RYFA 5CTBA 1Y7OA 3LKEA 2J5SA 3IB9A 3R9TA 4ZDEA 3H0UA 1XX4A 3QKAA 4B3JA 2GTRA 4NEKA 3Q7HA 3H0SA 3TVWA 2ZQRA 2VSUA 3QYRA 2BZRA 1UYRA 2QQ3A 4JFCA 2F9YB 2C8TA 1X0UA 3ST9A 4YLHA 4JCTA 2F9YA 2J5GD 3V5IA 3G64A 4RCNA 4Z0MA 4MI2A 3RSTA 4GHNA 3T8BA 1WZ8A 1PJHA 3GF3A 2X24A 3MOYA 4WYOB 4HC8A 3Q1TA 1UYVA 3L3SA 3TLFA 2EJ5A 4ZU2A 2UZFA 4GM2A 4U0GA 1XO6A 1MJ3A 3KTGA 1ON9A 3R9QA 5KDRA 2DUBA 2J5GA 3ISAA 3MFMA 3V5EA 3TVUA 1XNYA 4OG1A 1J7XA 3GKBA 3M6NA 4ELSA 4JCSA 1TYFA 3BEZA 5G1RA 1DUBA 3H02A 3Q0GA 3T88A 3U9SB 4OMRA 3QMJA 2F6IA 5FIFA 4K29A 3ZWBA 2W3PA 3PE8A 1PIXA 3P2LA 2IEXA
chains in the Genus database with same CATH superfamily
3HP0A 5DUCA 2PBPA 2WTBA 2A81A 1EF8A 2CE3A 3QXIA 3SWXA 3IAVA 3RQEA 2VSSE 3TT7A 4IZCA 3PZKA 1K32A 4B3IA 3LAOA 3W8IB 2ZL2A 4RYFH 4Q1IA 3TT6A 3BF0A 3T8AA 4MXIA 5INIA 2FW2A 2F6QA 3QK8A 3TZ3A 4FB8A 2VSUE 3RRVA 4FJWD 1WDLA 4F47A 5JBXA 2ZQQA 4KD6A 1HZDA 3DORA 1SG4A 2VSSF 4FNDA 1OD4A 3A4LA 4J2UA 4WZ8B 4ELWA 3ADBA 4U18A 4JYLA 1FC9A 3KTHA 4KWBA 5CTCA 3KTKA 3RSIA 4JVTA 3TRRA 4L6WA 1N6EA 3PEAA 5KDRB 1EY3A 1N6FA 4ZDDA 3GF7A 5E0SH 3T3WA 4HNKA 3MT6A 2VSUC 2Q2XA 3RQGA 1YG6A 5DZKH 4U19A 4ELXA 3H81A 2VREA 4QFEA 3PGQA 1HNUA 4QIIA 1UIYA 4JYJA 3N6RB 5FUSA 3ZWCA 1Q51A 4KPKA 2Q35A 5DL1A 2Q34A 3T89A 3K50A 3NJDA 4IZBA 3KTJA 4EMPA 2HW5A 1O8UA 3QREA 1WDMA 2NP9A 3DJAA 3P85A 5INFA 3OC7A 4NNQA 4K2NA 4B3HA 1JXZA 3QWDA 5DU4A 3U9RB 2CBYA 2A7SA 2D3TA 3TDCA 4FZWA 5E0NX 1N6DA 5DTPA 3AJMA 5DKPA 4EMLA 1NZYB 4L8KA 2FBMA 2J5II 5DU6A 5KJPA 3QXZA 4K3WA 1NZYA 2DEOA 3HRXA 5IKLB 3NJBA 5MGBA 3R9SA 1W2XA 2VSSA 3H0QA 2J5IB 4GEHB 3VIVA 4U0HA 3STAA 1Q52A 2F9IB 3R6HA 3FDUA 1UYTA 1Y64B 4FN7A 1OD2A 3OMEA 2J5IA 5DU8A 1WDKA 2VX2A 1SZOA 4LK5A 2F9IA 1ON3A 5DUFA 3I47A 3Q0JA 2FZSA 4ASIA 4IZDA 3K8XA 5HUQA 4JWVA 4I42A 1UX4A 3W8HB 1FC6A 4FZWC 1UX5A 3SLLA 2PG8A 3U9TB 1RJMA 1RJNA 4MOUA 4JSBA 3GLMA 3BPPA 5E0SA 5INGA 3HLN1 3KQFA 4WCZA 2ZL3A 3HE2A 5C9GA 3M6MA 1FC7A 3OT6A 5DZKA 2A7KA 3ZWAA 4JJTA 1XNWA 3WG5A 4JCRA 4QIJA 1DCIA 5JBWA 5C90A 3IBBA 2VSUF 5G1QA 4FNBA 3R0OA 3H0JA 4U1AA 4ZDCA 1UYSA 4FN8A 3AM1A 1HNOA 3ZW8A 4I52A 3ZW9A 1K39A 1TG6A 2ZL0A 4I4ZA 4DI1A 3RQFA 1XNVA 3HINA 3KTIA 5DTWA 4JOTA 4JCQA 4HDTA 2PPYA 4U0GH 3FF6A 3TV5A 4ZDBA 1EF9A 4G2RA 1YG8A 4ZDFA 3MYBA 5G1SA 3P5MA 4Q0GA 3GMAA 3JU1A 4OLQA 2ZL4A 1FCFA 2X58A 4KNPA 4EMMA 1VRGA 2P63A 4RYFA 5CTBA 1Y7OA 3A4NA 4NARA 3LKEA 2J5SA 3IB9A 3R9TA 4ZDEA 3H0UA 1XX4A 3QKAA 4B3JA 2GTRA 4NEKA 3Q7HA 3H0SA 3TVWA 2ZQRA 2VSUA 3QYRA 2BZRA 1UYRA 2QQ3A 4JFCA 2F9YB 2C8TA 1X0UA 3ST9A 4YLHA 4JCTA 2YJGA 2F9YA 2J5GD 3V5IA 3G64A 3ADCA 4RCNA 4Z0MA 4MI2A 3RSTA 4GHNA 3T8BA 1WZ8A 1PJHA 3GF3A 2X24A 3MOYA 4WYOB 4HC8A 3Q1TA 1UYVA 3L3SA 3TLFA 3BPTA 2EJ5A 4ZU2A 2UZFA 4GM2A 4U0GA 1XO6A 1MJ3A 3KTGA 1ON9A 3R9QA 5KDRA 2DUBA 2J5GA 3ISAA 3MFMA 3V5EA 3TVUA 3IRBA 1XNYA 4OG1A 1J7XA 3O4XE 3GKBA 3M6NA 3L8JA 3L8IA 4ELSA 4JCSA 3ADDA 1TYFA 3A4MA 3BEZA 5G1RA 1DUBA 3H02A 3Q0GA 3T88A 3U9SB 4OMRA 3QMJA 2F6IA 5FIFA 4K29A 3ZWBA 2W3PA 3PE8A 1PIXA 3P2LA 2IEXA
chains in the Genus database with same CATH topology
3HP0A 5DUCA 2PBPA 2WTBA 2A81A 1EF8A 2CE3A 3QXIA 3SWXA 3IAVA 2VSSE 3TT7A 4IZCA 3PZKA 1K32A 4B3IA 3LAOA 2ZL2A 4RYFH 4Q1IA 3TT6A 3BF0A 3T8AA 4MXIA 5INIA 2FW2A 2F6QA 3QK8A 3TZ3A 4FB8A 2VSUE 3RRVA 4FJWD 1WDLA 4F47A 5JBXA 2ZQQA 4KD6A 1HZDA 3DORA 1SG4A 2VSSF 4FNDA 1OD4A 4J2UA 4WZ8B 4ELWA 4U18A 4JYLA 1FC9A 3KTHA 4KWBA 5CTCA 3KTKA 3RSIA 4JVTA 3TRRA 4L6WA 1N6EA 3PEAA 5KDRB 1EY3A 1N6FA 4ZDDA 3GF7A 5E0SH 3T3WA 4HNKA 3MT6A 2VSUC 2Q2XA 1YG6A 5DZKH 4U19A 4ELXA 3H81A 2VREA 4QFEA 3PGQA 1HNUA 4QIIA 1UIYA 4JYJA 3N6RB 5FUSA 3ZWCA 1Q51A 4KPKA 2Q35A 5DL1A 2Q34A 3T89A 3K50A 3NJDA 4IZBA 3KTJA 4EMPA 2HW5A 1O8UA 3QREA 1WDMA 2NP9A 3DJAA 3P85A 5INFA 3OC7A 4NNQA 4K2NA 4B3HA 1JXZA 3QWDA 5DU4A 3U9RB 2CBYA 2A7SA 2D3TA 3TDCA 4FZWA 5E0NX 1N6DA 5DTPA 5DKPA 4EMLA 1NZYB 4L8KA 2FBMA 2J5II 5DU6A 5KJPA 3QXZA 4K3WA 1NZYA 2DEOA 3HRXA 5IKLB 3NJBA 5MGBA 3R9SA 1W2XA 2VSSA 3H0QA 2J5IB 3VIVA 4U0HA 3STAA 1Q52A 2F9IB 3R6HA 3FDUA 1UYTA 4FN7A 1OD2A 3OMEA 2J5IA 5DU8A 1WDKA 2VX2A 1SZOA 4LK5A 2F9IA 1ON3A 5DUFA 3I47A 3Q0JA 2FZSA 4ASIA 4IZDA 3K8XA 5HUQA 4JWVA 4I42A 1FC6A 4FZWC 3SLLA 2PG8A 3U9TB 1RJMA 1RJNA 4MOUA 4JSBA 3GLMA 3BPPA 5E0SA 5INGA 3HLN1 3KQFA 4WCZA 2ZL3A 3HE2A 5C9GA 3M6MA 1FC7A 3OT6A 5DZKA 2A7KA 3ZWAA 4JJTA 1XNWA 3WG5A 4JCRA 4QIJA 1DCIA 5JBWA 5C90A 3IBBA 2VSUF 5G1QA 4FNBA 3R0OA 3H0JA 4U1AA 4ZDCA 1UYSA 4FN8A 1HNOA 3ZW8A 4I52A 3ZW9A 1K39A 1TG6A 2ZL0A 4I4ZA 4DI1A 1XNVA 3HINA 3KTIA 5DTWA 4JOTA 4JCQA 4HDTA 2PPYA 4U0GH 3FF6A 3TV5A 4ZDBA 1EF9A 4G2RA 1YG8A 4ZDFA 3MYBA 5G1SA 3P5MA 4Q0GA 3GMAA 3JU1A 4OLQA 2ZL4A 1FCFA 2X58A 4KNPA 4EMMA 1VRGA 4RYFA 5CTBA 1Y7OA 4NARA 3LKEA 2J5SA 3IB9A 3R9TA 4ZDEA 3H0UA 1XX4A 3QKAA 4B3JA 2GTRA 4NEKA 3Q7HA 3H0SA 3TVWA 2ZQRA 2VSUA 3QYRA 2BZRA 1UYRA 2QQ3A 4JFCA 2F9YB 2C8TA 1X0UA 3ST9A 4YLHA 4JCTA 2YJGA 2F9YA 2J5GD 3V5IA 3G64A 4RCNA 4Z0MA 4MI2A 3RSTA 4GHNA 3T8BA 1WZ8A 1PJHA 3GF3A 2X24A 3MOYA 4WYOB 4HC8A 3Q1TA 1UYVA 3L3SA 3TLFA 3BPTA 2EJ5A 4ZU2A 2UZFA 4GM2A 4U0GA 1XO6A 1MJ3A 3KTGA 1ON9A 3R9QA 5KDRA 2DUBA 2J5GA 3ISAA 3MFMA 3V5EA 3TVUA 1XNYA 4OG1A 1J7XA 3GKBA 3M6NA 4ELSA 4JCSA 1TYFA 3BEZA 5G1RA 1DUBA 3H02A 3Q0GA 3T88A 3U9SB 4OMRA 3QMJA 2F6IA 5FIFA 4K29A 3ZWBA 2W3PA 3PE8A 1PIXA 3P2LA 2IEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HP0 A;  5DUC A;  2PBP A;  2WTB A;  2A81 A;  1EF8 A;  2CE3 A;  3QXI A;  3SWX A;  3IAV A;  2VSS E;  3TT7 A;  4IZC A;  3PZK A;  1K32 A;  4B3I A;  3LAO A;  2ZL2 A;  4RYF H;  4Q1I A;  3TT6 A;  3BF0 A;  3T8A A;  4MXI A;  5INI A;  2FW2 A;  2F6Q A;  3QK8 A;  3TZ3 A;  4FB8 A;  2VSU E;  3RRV A;  4FJW D;  1WDL A;  4F47 A;  5JBX A;  2ZQQ A;  4KD6 A;  1HZD A;  3DOR A;  1SG4 A;  2VSS F;  4FND A;  1OD4 A;  4WZ8 B;  4ELW A;  4U18 A;  4JYL A;  1FC9 A;  3KTH A;  4KWB A;  5CTC A;  3KTK A;  3RSI A;  4JVT A;  3TRR A;  4L6W A;  1N6E A;  3PEA A;  5KDR B;  1EY3 A;  1N6F A;  4ZDD A;  3GF7 A;  5E0S H;  3T3W A;  4HNK A;  3MT6 A;  2VSU C;  2Q2X A;  1YG6 A;  5DZK H;  4U19 A;  4ELX A;  3H81 A;  2VRE A;  4QFE A;  3PGQ A;  1HNU A;  4QII A;  1UIY A;  4JYJ A;  3N6R B;  5FUS A;  3ZWC A;  1Q51 A;  4KPK A;  2Q35 A;  5DL1 A;  2Q34 A;  3T89 A;  3K50 A;  3NJD A;  4IZB A;  3KTJ A;  4EMP A;  2HW5 A;  1O8U A;  3QRE A;  1WDM A;  2NP9 A;  3DJA A;  3P85 A;  5INF A;  3OC7 A;  4NNQ A;  4K2N A;  4B3H A;  1JXZ A;  3QWD A;  5DU4 A;  3U9R B;  2CBY A;  2A7S A;  2D3T A;  3TDC A;  4FZW A;  5E0N X;  1N6D A;  5DTP A;  5DKP A;  4EML A;  1NZY B;  4L8K A;  2FBM A;  2J5I I;  5DU6 A;  5KJP A;  3QXZ A;  4K3W A;  1NZY A;  2DEO A;  3HRX A;  5IKL B;  3NJB A;  5MGB A;  3R9S A;  1W2X A;  2VSS A;  3H0Q A;  2J5I B;  3VIV A;  4U0H A;  3STA A;  1Q52 A;  2F9I B;  3R6H A;  3FDU A;  1UYT A;  4FN7 A;  1OD2 A;  3OME A;  2J5I A;  5DU8 A;  1WDK A;  2VX2 A;  1SZO A;  4LK5 A;  2F9I A;  1ON3 A;  5DUF A;  3I47 A;  3Q0J A;  2FZS A;  4ASI A;  4IZD A;  3K8X A;  4JWV A;  4I42 A;  1FC6 A;  4FZW C;  3SLL A;  2PG8 A;  3U9T B;  1RJM A;  1RJN A;  4MOU A;  4JSB A;  3GLM A;  3BPP A;  5E0S A;  5ING A;  3HLN 1;  3KQF A;  4WCZ A;  2ZL3 A;  3HE2 A;  5C9G A;  3M6M A;  1FC7 A;  3OT6 A;  5DZK A;  2A7K A;  3ZWA A;  4JJT A;  1XNW A;  3WG5 A;  4JCR A;  4QIJ A;  1DCI A;  5JBW A;  5C90 A;  3IBB A;  2VSU F;  5G1Q A;  4FNB A;  3R0O A;  3H0J A;  4U1A A;  4ZDC A;  1UYS A;  4FN8 A;  1HNO A;  3ZW8 A;  4I52 A;  3ZW9 A;  1K39 A;  1TG6 A;  2ZL0 A;  4I4Z A;  4DI1 A;  1XNV A;  3HIN A;  3KTI A;  5DTW A;  4JOT A;  4JCQ A;  2PPY A;  4U0G H;  3FF6 A;  3TV5 A;  4ZDB A;  1EF9 A;  4G2R A;  1YG8 A;  4ZDF A;  3MYB A;  5G1S A;  3P5M A;  4Q0G A;  3GMA A;  3JU1 A;  4OLQ A;  2ZL4 A;  1FCF A;  2X58 A;  4KNP A;  4EMM A;  1VRG A;  4RYF A;  5CTB A;  1Y7O A;  3LKE A;  2J5S A;  3IB9 A;  3R9T A;  4ZDE A;  3H0U A;  1XX4 A;  3QKA A;  4B3J A;  2GTR A;  4NEK A;  3Q7H A;  3H0S A;  3TVW A;  2ZQR A;  2VSU A;  3QYR A;  2BZR A;  1UYR A;  2QQ3 A;  4JFC A;  2F9Y B;  2C8T A;  1X0U A;  3ST9 A;  4YLH A;  4JCT A;  2F9Y A;  2J5G D;  3V5I A;  3G64 A;  4RCN A;  4Z0M A;  4MI2 A;  3RST A;  4GHN A;  3T8B A;  1WZ8 A;  1PJH A;  3GF3 A;  2X24 A;  3MOY A;  4WYO B;  4HC8 A;  3Q1T A;  1UYV A;  3L3S A;  3TLF A;  2EJ5 A;  4ZU2 A;  2UZF A;  4GM2 A;  4U0G A;  1XO6 A;  1MJ3 A;  3KTG A;  1ON9 A;  3R9Q A;  5KDR A;  2DUB A;  2J5G A;  3ISA A;  3MFM A;  3V5E A;  3TVU A;  1XNY A;  4OG1 A;  1J7X A;  3GKB A;  3M6N A;  4ELS A;  4JCS A;  1TYF A;  3BEZ A;  5G1R A;  1DUB A;  3H02 A;  3Q0G A;  3T88 A;  3U9S B;  4OMR A;  3QMJ A;  2F6I A;  5FIF A;  4K29 A;  3ZWB A;  2W3P A;  3PE8 A;  1PIX A;  3P2L A;  2IEX A; 
#chains in the Genus database with same CATH topology
 3HP0 A;  5DUC A;  2PBP A;  2WTB A;  2A81 A;  1EF8 A;  2CE3 A;  3QXI A;  3SWX A;  3IAV A;  3RQE A;  2VSS E;  3TT7 A;  4IZC A;  3PZK A;  1K32 A;  4B3I A;  3LAO A;  3W8I B;  2ZL2 A;  4RYF H;  4Q1I A;  3TT6 A;  3BF0 A;  3T8A A;  4MXI A;  5INI A;  2FW2 A;  2F6Q A;  3QK8 A;  3TZ3 A;  4FB8 A;  2VSU E;  3RRV A;  4FJW D;  1WDL A;  4F47 A;  5JBX A;  2ZQQ A;  4KD6 A;  1HZD A;  3DOR A;  1SG4 A;  2VSS F;  4FND A;  1OD4 A;  3A4L A;  4J2U A;  4WZ8 B;  4ELW A;  3ADB A;  4U18 A;  4JYL A;  1FC9 A;  3KTH A;  4KWB A;  5CTC A;  3KTK A;  3RSI A;  4JVT A;  3TRR A;  4L6W A;  1N6E A;  3PEA A;  5KDR B;  1EY3 A;  1N6F A;  4ZDD A;  3GF7 A;  5E0S H;  3T3W A;  4HNK A;  3MT6 A;  2VSU C;  2Q2X A;  3RQG A;  1YG6 A;  5DZK H;  4U19 A;  4ELX A;  3H81 A;  2VRE A;  4QFE A;  3PGQ A;  1HNU A;  4QII A;  1UIY A;  4JYJ A;  3N6R B;  5FUS A;  3ZWC A;  1Q51 A;  4KPK A;  2Q35 A;  5DL1 A;  2Q34 A;  3T89 A;  3K50 A;  3NJD A;  4IZB A;  3KTJ A;  4EMP A;  2HW5 A;  1O8U A;  3QRE A;  1WDM A;  2NP9 A;  3DJA A;  3P85 A;  5INF A;  3OC7 A;  4NNQ A;  4K2N A;  4B3H A;  1JXZ A;  3QWD A;  5DU4 A;  3U9R B;  2CBY A;  2A7S A;  2D3T A;  3TDC A;  4FZW A;  5E0N X;  1N6D A;  5DTP A;  3AJM A;  5DKP A;  4EML A;  1NZY B;  4L8K A;  2FBM A;  2J5I I;  5DU6 A;  5KJP A;  3QXZ A;  4K3W A;  1NZY A;  2DEO A;  3HRX A;  5IKL B;  3NJB A;  5MGB A;  3R9S A;  1W2X A;  2VSS A;  3H0Q A;  2J5I B;  4GEH B;  3VIV A;  4U0H A;  3STA A;  1Q52 A;  2F9I B;  3R6H A;  3FDU A;  1UYT A;  1Y64 B;  4FN7 A;  1OD2 A;  3OME A;  2J5I A;  5DU8 A;  1WDK A;  2VX2 A;  1SZO A;  4LK5 A;  2F9I A;  1ON3 A;  5DUF A;  3I47 A;  3Q0J A;  2FZS A;  4ASI A;  4IZD A;  3K8X A;  5HUQ A;  4JWV A;  4I42 A;  1UX4 A;  3W8H B;  1FC6 A;  4FZW C;  1UX5 A;  3SLL A;  2PG8 A;  3U9T B;  1RJM A;  1RJN A;  4MOU A;  4JSB A;  3GLM A;  3BPP A;  5E0S A;  5ING A;  3HLN 1;  3KQF A;  4WCZ A;  2ZL3 A;  3HE2 A;  5C9G A;  3M6M A;  1FC7 A;  3OT6 A;  5DZK A;  2A7K A;  3ZWA A;  4JJT A;  1XNW A;  3WG5 A;  4JCR A;  4QIJ A;  1DCI A;  5JBW A;  5C90 A;  3IBB A;  2VSU F;  5G1Q A;  4FNB A;  3R0O A;  3H0J A;  4U1A A;  4ZDC A;  1UYS A;  4FN8 A;  3AM1 A;  1HNO A;  3ZW8 A;  4I52 A;  3ZW9 A;  1K39 A;  1TG6 A;  2ZL0 A;  4I4Z A;  4DI1 A;  3RQF A;  1XNV A;  3HIN A;  3KTI A;  5DTW A;  4JOT A;  4JCQ A;  4HDT A;  2PPY A;  4U0G H;  3FF6 A;  3TV5 A;  4ZDB A;  1EF9 A;  4G2R A;  1YG8 A;  4ZDF A;  3MYB A;  5G1S A;  3P5M A;  4Q0G A;  3GMA A;  3JU1 A;  4OLQ A;  2ZL4 A;  1FCF A;  2X58 A;  4KNP A;  4EMM A;  1VRG A;  2P63 A;  4RYF A;  5CTB A;  1Y7O A;  3A4N A;  4NAR A;  3LKE A;  2J5S A;  3IB9 A;  3R9T A;  4ZDE A;  3H0U A;  1XX4 A;  3QKA A;  4B3J A;  2GTR A;  4NEK A;  3Q7H A;  3H0S A;  3TVW A;  2ZQR A;  2VSU A;  3QYR A;  2BZR A;  1UYR A;  2QQ3 A;  4JFC A;  2F9Y B;  2C8T A;  1X0U A;  3ST9 A;  4YLH A;  4JCT A;  2YJG A;  2F9Y A;  2J5G D;  3V5I A;  3G64 A;  3ADC A;  4RCN A;  4Z0M A;  4MI2 A;  3RST A;  4GHN A;  3T8B A;  1WZ8 A;  1PJH A;  3GF3 A;  2X24 A;  3MOY A;  4WYO B;  4HC8 A;  3Q1T A;  1UYV A;  3L3S A;  3TLF A;  3BPT A;  2EJ5 A;  4ZU2 A;  2UZF A;  4GM2 A;  4U0G A;  1XO6 A;  1MJ3 A;  3KTG A;  1ON9 A;  3R9Q A;  5KDR A;  2DUB A;  2J5G A;  3ISA A;  3MFM A;  3V5E A;  3TVU A;  3IRB A;  1XNY A;  4OG1 A;  1J7X A;  3O4X E;  3GKB A;  3M6N A;  3L8J A;  3L8I A;  4ELS A;  4JCS A;  3ADD A;  1TYF A;  3A4M A;  3BEZ A;  5G1R A;  1DUB A;  3H02 A;  3Q0G A;  3T88 A;  3U9S B;  4OMR A;  3QMJ A;  2F6I A;  5FIF A;  4K29 A;  3ZWB A;  2W3P A;  3PE8 A;  1PIX A;  3P2L A;  2IEX A; 
#chains in the Genus database with same CATH homology
 3HP0 A;  5DUC A;  2PBP A;  2WTB A;  2A81 A;  1EF8 A;  2CE3 A;  3QXI A;  3SWX A;  3IAV A;  2VSS E;  3TT7 A;  4IZC A;  3PZK A;  1K32 A;  4B3I A;  3LAO A;  2ZL2 A;  4RYF H;  4Q1I A;  3TT6 A;  3BF0 A;  3T8A A;  4MXI A;  5INI A;  2FW2 A;  2F6Q A;  3QK8 A;  3TZ3 A;  4FB8 A;  2VSU E;  3RRV A;  4FJW D;  1WDL A;  4F47 A;  5JBX A;  2ZQQ A;  4KD6 A;  1HZD A;  3DOR A;  1SG4 A;  2VSS F;  4FND A;  1OD4 A;  4J2U A;  4WZ8 B;  4ELW A;  4U18 A;  4JYL A;  1FC9 A;  3KTH A;  4KWB A;  5CTC A;  3KTK A;  3RSI A;  4JVT A;  3TRR A;  4L6W A;  1N6E A;  3PEA A;  5KDR B;  1EY3 A;  1N6F A;  4ZDD A;  3GF7 A;  5E0S H;  3T3W A;  4HNK A;  3MT6 A;  2VSU C;  2Q2X A;  1YG6 A;  5DZK H;  4U19 A;  4ELX A;  3H81 A;  2VRE A;  4QFE A;  3PGQ A;  1HNU A;  4QII A;  1UIY A;  4JYJ A;  3N6R B;  5FUS A;  3ZWC A;  1Q51 A;  4KPK A;  2Q35 A;  5DL1 A;  2Q34 A;  3T89 A;  3K50 A;  3NJD A;  4IZB A;  3KTJ A;  4EMP A;  2HW5 A;  1O8U A;  3QRE A;  1WDM A;  2NP9 A;  3DJA A;  3P85 A;  5INF A;  3OC7 A;  4NNQ A;  4K2N A;  4B3H A;  1JXZ A;  3QWD A;  5DU4 A;  3U9R B;  2CBY A;  2A7S A;  2D3T A;  3TDC A;  4FZW A;  5E0N X;  1N6D A;  5DTP A;  5DKP A;  4EML A;  1NZY B;  4L8K A;  2FBM A;  2J5I I;  5DU6 A;  5KJP A;  3QXZ A;  4K3W A;  1NZY A;  2DEO A;  3HRX A;  5IKL B;  3NJB A;  5MGB A;  3R9S A;  1W2X A;  2VSS A;  3H0Q A;  2J5I B;  3VIV A;  4U0H A;  3STA A;  1Q52 A;  2F9I B;  3R6H A;  3FDU A;  1UYT A;  4FN7 A;  1OD2 A;  3OME A;  2J5I A;  5DU8 A;  1WDK A;  2VX2 A;  1SZO A;  4LK5 A;  2F9I A;  1ON3 A;  5DUF A;  3I47 A;  3Q0J A;  2FZS A;  4ASI A;  4IZD A;  3K8X A;  5HUQ A;  4JWV A;  4I42 A;  1FC6 A;  4FZW C;  3SLL A;  2PG8 A;  3U9T B;  1RJM A;  1RJN A;  4MOU A;  4JSB A;  3GLM A;  3BPP A;  5E0S A;  5ING A;  3HLN 1;  3KQF A;  4WCZ A;  2ZL3 A;  3HE2 A;  5C9G A;  3M6M A;  1FC7 A;  3OT6 A;  5DZK A;  2A7K A;  3ZWA A;  4JJT A;  1XNW A;  3WG5 A;  4JCR A;  4QIJ A;  1DCI A;  5JBW A;  5C90 A;  3IBB A;  2VSU F;  5G1Q A;  4FNB A;  3R0O A;  3H0J A;  4U1A A;  4ZDC A;  1UYS A;  4FN8 A;  1HNO A;  3ZW8 A;  4I52 A;  3ZW9 A;  1K39 A;  1TG6 A;  2ZL0 A;  4I4Z A;  4DI1 A;  1XNV A;  3HIN A;  3KTI A;  5DTW A;  4JOT A;  4JCQ A;  4HDT A;  2PPY A;  4U0G H;  3FF6 A;  3TV5 A;  4ZDB A;  1EF9 A;  4G2R A;  1YG8 A;  4ZDF A;  3MYB A;  5G1S A;  3P5M A;  4Q0G A;  3GMA A;  3JU1 A;  4OLQ A;  2ZL4 A;  1FCF A;  2X58 A;  4KNP A;  4EMM A;  1VRG A;  4RYF A;  5CTB A;  1Y7O A;  4NAR A;  3LKE A;  2J5S A;  3IB9 A;  3R9T A;  4ZDE A;  3H0U A;  1XX4 A;  3QKA A;  4B3J A;  2GTR A;  4NEK A;  3Q7H A;  3H0S A;  3TVW A;  2ZQR A;  2VSU A;  3QYR A;  2BZR A;  1UYR A;  2QQ3 A;  4JFC A;  2F9Y B;  2C8T A;  1X0U A;  3ST9 A;  4YLH A;  4JCT A;  2YJG A;  2F9Y A;  2J5G D;  3V5I A;  3G64 A;  4RCN A;  4Z0M A;  4MI2 A;  3RST A;  4GHN A;  3T8B A;  1WZ8 A;  1PJH A;  3GF3 A;  2X24 A;  3MOY A;  4WYO B;  4HC8 A;  3Q1T A;  1UYV A;  3L3S A;  3TLF A;  3BPT A;  2EJ5 A;  4ZU2 A;  2UZF A;  4GM2 A;  4U0G A;  1XO6 A;  1MJ3 A;  3KTG A;  1ON9 A;  3R9Q A;  5KDR A;  2DUB A;  2J5G A;  3ISA A;  3MFM A;  3V5E A;  3TVU A;  1XNY A;  4OG1 A;  1J7X A;  3GKB A;  3M6N A;  4ELS A;  4JCS A;  1TYF A;  3BEZ A;  5G1R A;  1DUB A;  3H02 A;  3Q0G A;  3T88 A;  3U9S B;  4OMR A;  3QMJ A;  2F6I A;  5FIF A;  4K29 A;  3ZWB A;  2W3P A;  3PE8 A;  1PIX A;  3P2L A;  2IEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...