3MYWA

The bowman-birk type inhibitor from mung bean in ternary complex with porcine trypsin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCAANSVPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSAYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 0.25-nm X-ray structure of the Bowman-Birk-type inhibitor from mung bean in ternary complex with porcine trypsin.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Trypsin
total genus 51
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mywA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mywA02
3B23B 1LMWB 4X1SU 1UTOA 1C4U2 1K28D 4LK4A 1ZSLA 1P2QA 4K2YA 1GI8B 3A8AA 4KTUA 3Q3KA 1TALA 1L1GA 2F9VA 1GVZA 3CS0A 1H4WA 1QRXA 1QJ6B 5TJXA 3RXTA 3QTVH 4ABBA 3NPSA 1AN1E 1LVMA 5BRRE 2NU1E 1C1RA 2PFEA 1GJDB 5FBIA 1EPTA 2XBYA 3FAOA 2Y7ZA 3DA9B 5LPRA 3Q76A 3SU3A 1TMUH 2G4TA 1C1NA 3SI3H 2ASUB 4U32A 1BTPA 3RC5A 4R8TB 1HCGA 4CRDA 4XBBA 1BMMH 5GWZA 6ESTA 3LH1A 3RXRA 1G32B 3AW1A 2SGDE 1PPZA 1AIXH 1TA6A 1P3EA 1DX5M 1GI7B 1JMOH 2TGDA 2A4RA 4GAWA 4XBCA 4IMZA 5LGOA 4JMYA 4MQAA 1F7ZA 1GCDA 3D49H 1AB9B 1BA8B 1NFXA 3ZYDA 1RRKA 3SBKA 4ABHA 2FEQH 1YC0A 1DXPA 1C2KA 1RJXB 2OBQA 2UWLA 2BX3A 2EI6A 5DP3A 3U69H 4X6PA 1GJAB 1K1NA 1SR5C 3UFAA 3F1SB 4B2CA 3MO6A 1BRAA 2OXSA 1P2JA 1CGJE 1GJ6A 1PJPA 7GCHG 1ZJDA 1O2TA 1SMFE 1MH0A 2QAAA 1N1LA 2ZTZA 1SFIA 3ITIA 4BXWA 1SGFG 4K5ZA 1O35A 2UUYA 3MU4A 4FUDA 4D7FA 4SGBE 1YP9A 3OY6U 1LKAA 2R9PA 4D8NA 1DWEH 4RKJB 1AFEH 5FPTA 1CU1A 2ZDAH 3IWMA 4NA9H 2WV5A 2FDAA 4XBDA 1GL0E 3SZNA 5I25A 3A85A 1VITF 1FY5A 4JCNA 1A0HB 3PROA 4ZXYH 3P17H 1MTVA 2ZGJA 4OS6A 1BHXF 3KCGH 4KELA 3W95A 2ZFFH 3DD2H 1LPZB 1EQ9A 4AOQA 1S5SA 1HAGE 1AHTH 1KXBA 2W26A 2VINA 4Y8YA 1C1SA 3UR9A 2F3CE 1G30B 2W3KA 1HGTH 1BMNH 3BTEE 2ZPSA 4DW2U 5C67A 4U30A 1AFQB 1O36A 2A5KA 2ZGCA 1HYLA 2WYJA 3TJNA 1CSOE 1LHFH 2PUXB 3ZVCA 1AE5A 2HNTE 1UTNA 2OQUA 3OX7U 2ZA5A 1VCPA 3GISB 1UVOA 2SNWA 3RC4A 1J8AA 2VVVA 3MYWA 1EUFA 1ZYOA 5TCAA 4YLUA 1NZQH 2XC4A 1L0ZA 2HPQH 4FUFA 3BEIB 4LXBH 3SN8A 3ZZ8A 2BVRH 1SGQE 1AVGH 5DK1A 1NFWA 1F0RA 1GHYH 1TX6A 4F49A 5CE1A 3RXLA 3ZV8A 5EQSA 1GCTB 4FVBA 2GKVE 2ZDMA 3A7ZA 1HAZB 1GMDF 1GHWH 4XSKU 1IQKA 3SJIA 2B7DH 1QJ1B 1CQQA 2XC5A 5EQRA 3UQOA 3UWJH 4TY7A 3BIUH 3T29A 3GICB 5HM2A 2BMGB 1AWFH 1B5GH 3K6ZA 3ZVBA 3RXDA 2V0BA 4X1RU 1O3GA 4NGAH 4NCYA 4WJG2 1ZLRA 2BD5A 1GBKA 3ATKA 1GJ7B 1UHBB 4ABIA 2IPHA 2FOEA 1EP6A 4BXSA 3M7UA 3B8JA 4NIWA 1GHAG 2VH6A 4ASHA 1F5LA 1BTYA 4E05H 4CRCA 9ESTA 2BVSH 4E7NA 5HXFA 1B0EA 4MTBA 1EOLA 2O8MA 3IG6B 1W10U 2PKSC 4DGJA 1YLDA 2DE9A 6CHAC 4A7IB 4XDEA 1LPKB 2QXHA 1C1MA 3PMBB 4CH8B 1W7XH 3GYLB 4WF8A 2NWNA 3RC6A 1IQEA 2PUQH 3MFJA 1F0TA 2GV7A 2D2DA 2YOLA 2ALPA 4J2YB 3EA9A 1SGYE 1G3BA 5DG6A 4A5TS 1HIAA 2WPMS 2P8OC 4HZHA 1HRTH 4NIXA 5EW2H 1O37A 1OWKA 3DHKH 1QL7A 1AMHA 2XC0A 4Y0YE 3ZVFA 2FTLE 1W2KH 1IHSH 1V2MT 1K9OE 2SFAA 2ZGBH 1YLCA 1XVMA 2FOMB 1QA7A 1JWTA 2Y5GA 4NFEA 1AVWA 4KKDA 3LDXH 4K1SA 3A81A 3TH3H 1Z6JH 1BQYA 3ZZCA 3U9AH 1YPKH 2FPZA 2BD4A 3AW0A 2O8UA 2HPPH 2XBVA 3LOXA 2BDCA 1HLTH 2PTNA 1ZMLA 2ZCHP 1QGFA 4AG2A 1PQ5A 3OYPA 2ZU2A 5A8YA 1DLEA 1LQDB 3OY5U 3FZZA 2J4IA 3SNAA 3E6PH 3EDXB 1BDAA 1Z6EA 2A7CA 4UDWH 1TFXA 3ATLA 3BF6H 5C5NA 1UK2A 1KTTB 1OSSA 4X0WU 4D9RA 3H5CB 4Z6AH 3RXFA 2BM2A 2OLGA 1PPHE 5FX6A 2Q6FA 1K1OA 3KGPA 2I6QA 1YPJH 1ZPZA 2BHGA 2BB4A 2JKHA 4LZ4B 3R3GB 4MNWA 4O3TA 5C1YA 2H1UA 1SHHB 1M9UA 3QTOH 2FTMA 2AMPA 3O8DA 1FIWA 2PLXA 2F9NA 3E3TA 1YPEH 4KTSA 3EGKH 2HVXA 4X8TH 4NG9H 2DE8A 1UCYH 1XUHA 1ANDA 3SV9A 3RXQA 1O2OA 1C5TA 1XUJA 3NK8A 1GVLA 4YLQH 4YO9A 1ZSKA 1FN6A 1LVYA 1H9IE 1AU8A 1AZ8A 2FLRH 2GT8A 2FI5E 4BAQB 1K1IA 2FOFA 1UTKA 2QF3A 1AD8H 1YCPM 2ZHQH 1LVOA 3A86A 4PROA 2J92A 5C2ZA 1TBZH 1QRWA 1JOUB 4FUJA 4XFQA 1RTFB 2JH0D 1UTJA 1WTHD 2P16A 1IQLA 2QYIA 2Y81A 3BTME 3RXGA 2WPLS 3WY8A 3LGWA 3QO6A 3STIA 1IQJA 1IHTH 4FUBA 3M5NA 2OC1A 1O3LA 4CBNA 2FS8A 1YCPH 1LHGH 2BY8X 1MTNC 3SQHE 1FMGA 1BHXB 1ELDE 3NKKA 3MNSA 5LPFA 2ZU1A 1HJAC 2WUBA 3HPTB 4CR5A 2PWXA 3P92A 3RUOA 2CMYA 4UFFH 4MDSA 4I8KA 1WSSH 2R3YA 1OX1A 2AIPA 3SUEA 3M5LA 4GHQA 5C20A 3UOPA 3QLPH 3MWIU 1P3CA 2EC9H 3SNBA 1KYNA 1ZPCA 3RXOA 1Z8RA 4WXVA 1MD8A 2Z9GA 4MPVA 2GZ9A 2CGAA 1RTKA 1GI9B 4NIYA 2UWPA 1HAVB 3EYDA 4AN7A 1TGNA 1O3JA 2PTCE 3GYMA 1FI8A 3LGYA 1N8OB 2O8WA 1E36B 5JB9S 1Y5AT 2CXVA 1C5NH 5E2PA 3U98H 1GBMA 1MTUA 1O2LA 1GG6C 2XBXA 3Q3XA 2VIDA 3NXPA 2XNIA 4JZIA 3K6YA 2C8YB 3F9FA 1QA0A 1L2EA 3BTTE 1VGCB 2SNVA 1PYTD 2ZQ1A 2PGQB 2KAIB 4X2XA 3EE0B 3UIRA 1J14A 1ARBA 3GY4A 1L1NA 4AGJA 2G5NA 1D9IA 1O33A 4CHAB 2Z7FE 1EZXC 3BN9A 3TH2H 1HPGA 5JBBS 5JBTA 2XBWA 5C1XA 1HAPH 2AH4X 1SLWB 2RG3A 1Y3UA 2TIOA 1WAYB 5EG4A 1V2KT 1TRYA 2BLVA 1GI0A 5F6MA 3RXBA 4JZEH 2FYRA 2V3OH 4TPYA 3L3TA 3QN7A 2O8LA 2BD9A 1V2NT 3RXAA 5FAHA 1EZUC 1DLKB 4Y11E 1GHVH 1W0YH 1BBRK 2ZF0H 1XVOA 2ZHWH 1LQEA 1TPOA 2ZKSA 1CHGA 1OP0A 3GY8A 1BUIA 1FY3A 3E8LA 1S6FA 1BTZA 3LH3A 4I8GA 4JYTA 4Y71A 1T4VH 4H42U 1FN8A 3RU4E 1T7CA 1CVWH 2HGTH 3N7OA 5F8TA 3ENSB 1XUGA 3KQEA 1C4Y2 4UFDH 2CN0H 1K2I1 1LHCH 2ZGXH 4RN6A 2GT7A 4ISNA 1GHXH 4AORA 3VXEH 4X2YA 1EB1H 3LT3A 3FFGA 2ZDLA 2A5IA 1PQ8A 1SFQB 4NZLA 1P2MA 2ZFTA 4ZHAA 3PWBA 1P02A 4YOJA 3URCA 2HOBA 2BX4A 3U8TH 1NN6A 2FS9A 4NWKA 1ZGVA 2F83A 2XW9A 4ZHMU 1MTWA 1F0UA 3P70B 4DT7B 1UTLM 1XUFA 4FUCA 3PO1C 3SU6A 1OS8A 1THPB 4YM9A 2GMTB 2HALA 1NPMA 3RU4T 1O2NA 1HJ8A 3T5FH 4B76A 1K1LA 3NUMA 1GMCF 2VB0A 4ZROA 1UMAH 2AMDA 1QJ7B 1P8VC 5DJ7A 2QIQA 4LZ1H 1P57B 1QQUA 4Y7BA 5FXLA 5E0GA 2F9OA 2A4GA 1IQMA 3KIDU 1O2PA 4OS5A 4ZHLU 2A2XH 4BAMB 1FNIA 4ISHH 4NZQA 1H8DH 3I78A 1RXPA 3R0FA 1HAVA 1KDQB 4BAOB 1O2ZA 2G81E 2FI4E 3P6ZB 3SGBE 1RIWC 1OKXA 1TA2A 3SOSA 3AAVA 1ZTJA 3SW2B 1O5BB 1P01A 3S9BA 2YNBA 1NM6A 2BXTH 2GZ8A 1UVUH 1UVSH 1O3BA 1DWBH 1Z8IB 3UR6A 4FXGH 1YCPK 4CRAA 1SB1H 4R0IA 1TNGA 1TB6H 1DWCH 1DPOA 4THNH 1SGNE 1WUNH 1GPZA 1TABE 4BTTB 3BTGE 3ZVAA 4DJZB 1TX8A 1MZDA 1O2GH 2UUFB 1NS3A 1DUEA 3KL6A 5DGJA 5C1UA 1HJ9A 1PFXC 2GDDA 1OWJA 1UHBA 2G51A 1T8NA 1BT7A 2FOBA 3GY2A 2PW8H 4DCDA 3ZVGA 1GDNA 2QXIA 1JBUH 2VWNA 1N8OC 2SGEE 1C5WB 3UNQA 1ESTA 4JZDH 1CO7E 1S82A 1G3CA 4QT8C 3PWCA 2OC8A 1ZHPA 5FCKA 3SU0A 3TNSA 1WTGH 2VWLA 3ZZ9A 1SGRE 3LJJA 1B7XB 1X7AC 2JETC 1ANCA 1NC6A 2CV3A 1O2WA 2P93A 4MG3A 3AVZA 4WWYA 1SBWA 4UEHH 1EB2A 1OWHA 3M61U 1DANH 5ESTE 2ODYB 1QHRB 2AGIX 4CRGA 1W11U 3E16B 4ISLA 1C1UH 1O3HA 1GBEA 1MKXK 2GTBA 2GP9B 2G52A 3STJA 3SV8A 1NRPH 1Q2WA 1O30A 1C1VH 1V2PT 2C8ZB 3PB1E 3MO3A 3RXEA 5EODA 1QB9A 2R2MB 1EATA 1MTSA 1YPHE 3TIUA 2BOKA 1WV7H 2G5VA 1DS2E 1HAOH 2IJOB 3U1IB 5AFZH 3FANA 1EXFA 4DIHH 3F9HA 1GBIA 1O2HA 5DP9A 4D7GA 2XWBI 4OS1A 2VVCA 4AB9A 3BTQE 4CRBA 1C5UA 4B1TA 3GOVB 1A0JA 3SUGA 2FOHA 2BZAA 3RU4D 2HNTF 3TLOA 4SGAE 5T6FA 1WU1A 1FIZA 1Q3XA 3HGPA 1MTNB 4ABAA 3M7TA 4DG4A 5BPEA 4IC6A 1VITH 2QF0A 4BTUB 1VITG 3S0NA 5EPNA 3P8NA 1EAWA 3KN2A 3QGNB 1C4V2 4YOGA 3TK9A 2FYQA 4U2WA 5F03A 1MD7A 1Y3VA 4NIVA 1UVPA 1K21H 3Q00A 2BY9X 4NSVA 3MU5A 3V3MA 1FLEE 1P9UA 6LPRA 1O3KA 1V3XA 3KNXA 3RXSA 2XXLA 1GL1A 4YT7H 1T32A 3PLBA 4FU8A 3A7TA 4FVDA 2J9NA 1QCPA 1SGPE 1S83A 4MLFB 1HAIH 1BRCE 2Z9JA 3SHAH 3EAJA 3SHCH 3TK5A 4Y8ZA 2B9LA 3RLYH 2RA3A 1AO5A 5HYOA 6GCHF 1J9CH 5GJ4B 2ZP0H 4BTIB 5ABWA 1O2UA 2B8OH 4H6TA 1MCVA 4CH2B 1O2RA 1EPTC 4I8HA 3TITA 3ZZDA 1UTPA 2FXRA 1PPFE 1DSUA 1ACBE 1DICA 1SPJA 1TLDA 2PKSB 4ZUHA 4FUEA 4AFSA 1MAXA 1SGDE 1AKSB 1DUAA 4M7GA 4X8VH 5DP7A 1O2YA 3TNTA 2LPRA 1HXFH 3UWIA 5A0BA 1J17T 1P2NA 2OUAA 3M5OA 1XXDA 2R0LA 2H9EH 3SORA 3RMOH 1VJAU 1C5LH 5AF9H 2PSXA 4JZFH 1ETSH 1P11E 2J38A 2VJ1A 4IMQA 1OYQA 5HMAA 4Y8XA 1JRTA 1C5YB 2SGPE 4AYVB 2ILNA 1O3PB 5F8XA 1LVBA 1UCYK 5AHGH 4RKOB 2NU2E 1ABIH 1LHEH 3ZZBA 5FBEA 1QY6A 4D76A 2H9HA 1W8BH 2JETB 1NU9A 4Y6DA 2BDYA 3ZZ5A 1C1PA 2Y5HA 4INKA 1AQ7A 1RTLA 1P2OA 2VIWA 1TNIA 1DSTA 4MNVA 1S0RA 3BEUA 3V0XA 1TNLA 3A89A 4JZ1A 3MNBA 1ZTKA 4GVUA 1THSH 3SU5A 1ID5H 5IDKA 1O3FA 4JYUH 1H1BA 1F2SE 2P8OB 1IAUA 1BTXA 1W12U 2CF9H 1GJ8B 3A84A 1BCUH 1BMAA 1BITA 2ODQA 2AS9A 4E7RG 1K1JA 5F8ZA 1GMDG 1ETTH 3LC3A 1ELCA 2CHAC 1MU8B 1EJAA 2GMTC 4WMFA 3SU1A 3VB4A 1E37B 2ZHFH 2GCTB 2ZPQA 1O2KA 2J2UA 2FP7B 3G01A 9LPRA 3SGAE 3HK6B 1O3AA 3S9AA 1C5PA 1UVTH 1TNJA 2R3UA 3Q77A 1YKTA 3BSQA 2P94A 4OS2A 4B75A 3PLKA 3A8CA 1C2FA 1A4WH 2Z9KA 4HFPB 1AI8H 1DY8A 4NA8A 4AFUA 1P06A 4J1YA 3E90B 3SV7A 4IN2A 3BIVH 3CS7A 3SJ9A 5EW1H 1WOFA 1C2HA 2FOCA 3PMAB 4WXIA 2Y82A 7KMEH 2AGGX 4TYDA 4KP0A 5GIBA 1GBTA 3A7WA 4I32A 5B6OA 2J94A 1P09A 2ZGHA 4HGCA 1V2TT 1C2EA 2STAE 1HJAB 1EKBB 2A4OA 2A0QB 1KTSB 3FP6E 2FOAA 5EPYA 5IYTA 2H2ZA 1J16A 4YZUA 1P2IA 2TGAA 1SVPA 2ZFSA 4NSYA 6GCHG 1THRH 2D8WA 3CP7A 3BG4C 1QTFA 1D6WA 2H5CA 4AGKA 2OQ5A 2QCYA 1BTWA 2BY5X 4ZXXH 4JK5A 1GJ4H 3BTWE 1FDPA 1ELAA 1RD3B 3LGUA 2ZTYA 3DFLA 1YPGH 4XOJA 1FXYA 1BBRE 2FOGA 5T6DA 1DXWA 3A7YA 1DY9A 1CA8B 3FP7E 1GBFA 4NWLA 4I31A 5JBAS 2P3UB 4UFEH 3LC5A 3V12A 4RSPA 2W7UA 3S7HB 1FQ3A 1TMTH 2BDIA 2YNAA 2ZO3H 2K1QA 3SNEA 4K8BA 3CENA 2C8XB 1C5OH 4Q2KA 4VGCB 3SV6A 3PYHA 4IGDA 1PPCE 1GHZA 3RXIA 4ZKOU 1O5GH 4Q7XA 4Y0ZE 1GHBG 1NFUA 1D6RA 1TQ7B 1FUJA 1W7GH 4UFGH 2ZG0H 2P3FH 4DURA 1E34B 2ANKH 1ZMJA 1O31A 1VGCC 4INHA 4FU7A 1BJVA 3A88A 3SQEE 1HUTH 2Z3DA 2KAIA 3E91A 3MHWU 2FODA 2XYAA 4JYVH 1ELVA 4B73A 5HM9A 1C2GA 1E35B 4WH8A 2F91A 4Q80A 1G9IE 2QC2A 2HLCA 4FU9A 2TGTA 4B71A 4YESB 1O5CB 1C5XB 2WPKS 1V2ST 5J4QA 1Z8JB 1UK4A 8KME2 3VGCB 2ANYA 3MU8A 1QFKH 1TBRH 1GDQA 1SOZA 1YPHC 2PR3A 3KQBA 1SGCA 1XKAC 3MNCA 4AX9H 2AGEX 3TGKE 2GCTC 4I33A 1TPSA 3VEQB 1GBLA 2V3HH 3LIWA 4OGXA 2ANMH 1EAXA 1SQTA 1ZHRA 2WINI 1O3CA 3HGNA 2CHAB 3ELAH 2ZIQH 2C4FH 4Z0KA 1UTMA 3BTKE 1KDQA 1O3OA 1QB1A 2GGVB 4Y79A 5JPMH 2VWOA 5LH8A 1L4DA 1CA0B 1U6QA 1BOQA 2FX6A 1HV7A 1QURH 1ESBA 2AEIH 1P04A 2ZFPH 2ZECA 2A1DB 3L6PA 1BIOA 1AUTC 4O9VA 4A1TA 4TPIZ 2JH6D 3TK6A 3TGIE 3RXCA 3U8OH 2PV9B 5FPSA 2EEKA 2ANWA 5ESBA 2ZZUH 4A1VA 1WQVH 2I6SA 3RM2H 5K7RA 4X1NU 2BZ6H 2ZHEH 3EA7A 4FUHA 1O2MA 3ZZ3A 2NU3E 5CHAB 2AERH 1FY1A 1HBTH 4YTAA 1NFYA 3MOCA 1RIWB 1D3TB 1Y8TA 2GZ7A 1E38B 1HNEE 1A3BH 4MPXA 1L4ZA 3BEFB 1FPHH 1GGDB 3UPEA 2ZNKH 1O2XA 2BDHA 3Q3YA 4CR9A 1H8IH 3MH5A 3BTFE 2HNTC 3AASA 2XWAA 1QBOA 3ODFA 2WPIS 1ABJH 1EAIA 3SJKA 1C5QA 3MO9A 2M5TA 7LPRA 1L1JA 5SGAE 4IN1A 2ZFQH 4HTCH 3TPIZ 2C8WB 2A2QH 3RXMA 1GJBB 1LPGB 1P03A 1GHAF 1TNKA 3GY5A 1NRSH 1C2LA 3UREA 3IITA 1ELTA 2G55A 3PV4A 3F9GA 1N6YA 1ZTLA 1PQ7A 2BQ6B 4IBLH 1YYY1 1ZOMA 1NO9H 4ZKNU 1A2CH 1FONA 1FY4A 1ZHMA 3UQVA 5ETXA 1FJSA 1AZZA 4MPUA 1VR1H 2GV6A 1P12E 1TNHA 3M7QA 1ELGA 1W13U 3MU1A 1VZQH 1ANEA 1V2LT 2ZTXA 1K22H 1P9SA 1YF4A 2UUKB 3ATIA 2ZDNA 3A82A 1UK3A 2BXUH 3A8BA 1YPLH 4GPGA 4FUGA 2BVXH 3TU7H 2QXJA 3BTDE 5GCHF 2FO9A 1S85A 2BD2A 3MNXA 5FX5A 1EJMA 1PPBH 3VPKA 1O3NA 1Y3WA 1MZAA 1C9TA 3A80A 5A8ZA 2AFQB 2EA3A 1QL8A 1W0ZU 1DM4B 2W3IA 1O32A 1NRNH 1IQGA 2BY6X 1S81A 3GDUA 5JB8S 1CBWC 1Q31A 1QRZA 2Q1JA 1YM0A 1ZMNA 4ZKSU 1GBCA 1MAYA 5EXLA 3SUFA 1HFDA 3D23A 1W3CA 2PGBB 3FP8E 3RDZA 4OS4A 3QX5H 5I46H 1G2LA 1TRNA 1CT2E 1AY6H 2BLWA 1CT0E 2BDGA 4X6OA 3ZZ7A 1SGEE 2ZU5A 1F0SA 2FIRH 3L33A 1V2OT 1D4PB 3LKWA 2GDEH 3DFJA 1F92A 2CJIA 8LPRA 1HAYB 1MQ5A 2QGRA 1EJNA 1GI3A 1SL3A 1F5KU 1ZGIA 2G8TA 3OU0A 1T31A 1NY22 1RFNA 1BRBE 3PMJA 4K3JA 3RMNH 4X8UH 3PTNA 3LGVA 1FV9A 4O97A 2C93B 4X1PU 2ZPRA 1A61H 5C3NA 1DVAH 3RLWH 3A8DA 4A1XA 4MNYA 3RXVA 2OC7A 2IOTA 1C5MD 2GCHG 1QQ4A 1A7SA 1TYNA 1EAUA 2PHBA 1DDJA 1WQSA 2VIVA 3BG4B 5L2ZH 5G4BA 1TGBA 1GI6A 4UE7H 3SNDA 3HKJB 1Y5UT 1A5HA 1Y59T 2F9PA 2Y80A 4A92A 3GY3A 2ZU3A 5DP4A 4BAHB 2J95A 1Z7KA 1LTOA 3LPRA 1EZQA 4B2BA 4BOHA 1A46H 2GD4B 1AB9C 1GWAA 1Y5BT 3V13A 2BYAX 5J4SA 2TRMA 1ELFA 4INLA 1A1RA 3ZZ6A 2BQ7B 3ZV9A 1BTUA 3OTJE 2FESH 3C1KA 3E1XB 4ZMAH 1TBQH 1HDTH 2P3TB 2ZDVH 1B0FA 3MTYA 1AGJA 1ZJKA 3M5MA 1ZRBA 3FZDA 1C1WH 2Y7XA 1ELEE 4GUXA 4ISOA 1ZR0A 4TWWA 1IQNA 3A7XA 2OCVB 5HGGA 1G3EA 1XKBC 2BDBA 1Z1JA 1D3DB 1MKWH 3T27A 5K0HA 2BD8A 3BTHE 2EI7A 4X6NA 3D65E 4D9QA 1ESAA 1O0DH 1ARCA 1C5RA 5LPEA 2PKAA 1XUKA 3RXHA 3SUDA 3PMHB 1IOEA 1G2MA 2F9BH 1A5IA 2ZC9H 2SGAA 2ZDKA 4ABJA 4GHTA 3QGJA 4O03A 3VFEA 4I8LA 3VB7A 1T8LA 1XUIA 3SV2H 1RGQA 2WYGA 1BZXE 2BTCE 2OINA 3MH4A 8ESTE 1XX9A 4F4OC 1FY8E 4I8JA 3PM3A 1OYTH 5CMXH 4VGCC 5E0JA 1O2VA 1O3EA 1GBDA 3SO3A 1E0FD 2BLOA 4FUIA 4TWYA 1T8MA 2FM2A 4JK6A 4E06H 3M36A 3K2UA 4K8YA 5EXMA 2ULLA 2GCHF 3QUMP 1BBRH 2H9TH 1V2WT 1NU7B 3F68H 2A7JA 2TPIZ 5DO4H 2Z94A 1TE0A 5AFYH 4GSOA 2NU4E 2OD3B 4CRFA 5EU8A 1AWHB 2G4UA 3T28A 3ESTA 1TOMH 2A31A 2WV4A 2ZWLH 3DT0H 3UY9A 4B2AA 2AIQA 4X8SH 5FHTA 3W94A 4IC5A 1GBJA 3VXFH 1TGSZ 3UNRA 3ZVEA 1V2RT 5DP6A 2AMQA 1P2KA 3UTUH 1P0SH 3RP2A 2P95A 2ODPA 3M3VA 1A3EH 3BV9B 1GCTC 3I77A 1BRUP 8GCHF 3LONA 1GI5A 3M3SA 1GMHG 1D3QB 3EQ0H 1HAXB 3K9XB 1V6DA 1EP5A 7ESTE 3BG8A 3VGCC 1EX3A 1T4UH 2STBE 3JZ2B 2R0KA 2HRVA 3KHVA 3PTBA 3SGQE 3RM0H 2P59A 1TRMA 5L2YH 1GBAA 1EPTB 3VB5A 1VJ9U 3QZRA 1V2QT 2Z6BD 2EI8A 2CF8H 7GCHF 2NU0E 1SG8B 2J34A 4H6SB 5JDUB 1SHYA 1SI5H 1GI2A 1RS0A 1AFQC 1CA0C 3M35A 3H7TA 2W5EA 5EOKA 3MI4A 1QBNA 1AE8H 2FMJA 5CHAC 3SI4H 1LO6A 5H4IB 3S69A 1SGIB 4WVPE 1YGCH 6CHAB 3SU4A 4UONA 3P8OA 3TH4H 3TVJB 1V2JT 3RXUA 5PTPA 1NT1A 4K1EA 4BAKB 1NESE 1C5VA 1SLXB 4WMDA 3C27B 2ZFRH 3SJ8A 2C3SA 3PLPA 1QIXB 1SSXA 3FVFB 1AVXA 2VWMA 1KXAA 3GCTG 4GCHF 2PKAB 1O38A 2RCEA 1NRRH 5EXNA 2Q6GA 2BQWB 1QBVH 2ESTE 1KY9A 3P8FA 2ZHDA 1A0LA 4IW4E 4XE4A 1OWEA 1C2DA 2SGQE 3NZIA 2A45B 1O3IA 1HB0B 4K1TA 1BJUA 1VCWA 4UD9H 1KIGH 4X2WA 1P10A 1W14U 4AG1A 2SGFE 1S84A 1G3DA 3QK1A 2XTTB 2A4QA 4MNXA 2FWWA 3RXJA 4HI3A 3E0NB 1CHOG 1Y3XA 2FZZA 3GY7A 1JXPA 3KF2A 5DPAA 4CBOA 2OTVA 1GMHF 1FPCH 1SGFA 3A87A 4ZAEA 3ATMA 1MCTA 1UCYE 1CGHA 3D62A 1C1TA 3RMMH 1KLJH 5GCHG 2QXGA 1MKWK 4MVNA 3ATWA 3GDVA 2ZEBA 1JIMA 1NRQH 1DOJA 1OXGA 1TMBH 2V35A 4B74A 2VIQA 1QB6A 5E8EH 1AKSA 4K60A 2O9QA 1EASA 1GHBF 3GCOA 1YPMH 3MU0A 2FI3E 3T62A 4GLYA 1G37A 1H9HE 2WPJS 3ZVDA 4LOYH 2QV1A 1SQAA 4DIIH 5L30H 5A09A 4AFQA 2R2WU 1CHOF 1HXEH 5A0CA 1O2JA 3UUZA 1K1PA 1S0QA 2A7HA 3ZZAA 4DY7B 3UOUA 2ALVA 5GXPA 1AUJA 3K65B 1LDTT 3M3TA 3TJVA 4NA7A 1GJ5H 1UO6A 5GPIB 4YOIA 1UJ1A 5C5OA 4OGYA 5GDSH 3AAUA 1Z1IA 3B9FH 3QZQA 1MBQA 2ZCLP 1CGIE 1WBGB 1GMCG 1PPGE 1Z8GA 2FLBH 1ORFA 4Y7AA 4ESTE 1GJ9B 1EZSC 2V6NA 3KEEA 1Z71A 1SC8U 1KXCA 3M37A 1MQ6A 4BANB 3SJOA 1JIRA 1C9PA 3HATH 1O3MA 1TOCB 4ZKRU 3MMGA 5JBCS 2D26C 1GDUA 4YT6H 2RDLA 2VGCC 1QR3E 3HK3B 1V2UT 5T3HA 4WY3A 3GCHC 4AYYB 1MU6B 3S7KB 2OC0A 3JZ1B 1KLTA 1EOJA 3QWCH 3RMLH 2FX4A 1BB0B 1ELBA 1PPEE 2Z9LA 3A7VA 3A83A 2A5AA 2VU8E 1FAKH 1O5DH 1GBBA 4U01A 4ABFA 2IN2A 1WYKA 2C90B 2Z3EA 3P8GA 1C1QA 1MKXH 1OWIA 1P05A 5A0AE 2WUCA 4A6LA 3GCHB 5DP8A 1DFPA 1O3DA 2ZQ2A 3S9CA 2UWOA 1SLVB 3V7TA 5DKMA 1BTHH 3UNSA 1Y3YA 2QN5T 3EA8A 1LKBA 2VNTA 1J15A 2BY7X 3U8RH 1CT4E 4TY6A 1TPAE 1ZPBA 1O39A 3GDSA 2GX4A 3LJOA 2OBOA 1C2MA 1MUEB 4X1QU 3TJUA 1C5ZB 3PO1B 8GCHG 2O8TA 5FCRA 1HAHH 1KXFA 2ZU4A 1IQIA 4Q7ZA 1GBHA 3URDA 1SLUB 3I29A 1GVKB 1KSNA 2H6MA 1C2IA 1C5SA 1QL9A 1OPHB 2D1JA 1DT2A 1NTPA 2XCNA 4BNRA 4WMEA 2B0FA 2WPHS 4AB8A 3LU9B 4KGAA 1MBMA 2HWLB 1KXEA 1O5AB 1TPPA 1ZRKA 5EGMA 3ZYEA 4CHAC 1LHDH 1A5GH 4ISIH 1FZZA 3O8BA 2VIOA 2W7SA 1SQOA 5L6NH 4Q7YA 3TGJE 2XRCA 1WCZA 3RXKA 5FPYA 5E2OA 3GCTF 4GCHG 3T2NA 2AYWA 1TGTA 1D3PB 1N6XA 1NROH 4ZH8A 1IQFA 1GI4A 1CBWB 1GG6B 5AVDA 2QY0B 2UUJB 3F6UH 3GCNA 3NCLA 3MH6A 1O2QA 2BD3A 4KTCA 5EQQA 1TQ0B 1ZZZA 1TAWA 1HIAB 3ZZ4A 3O8RA 2H5DA 1BMLA 1GJCB 2BLQA 4OS7A 2VVUA 3LGTA 5E0HA 3E0PB 5A2MH 2VIPA 2OP9A 1KXDA 5DP5A 1OOKB 3VB6A 2TBSA 4AFZA 1XXFA 5T6GA 1TGCA 1ANBA 2XCFA 4Y10E 1O2IA 5JYIA 4ABEA 1DWDH 1O5EH 3H7OA 3T26A 3ODDA 3P95A 3NWUA 3QDZB 1JRSA 4CREA 4ABDA 3MH7A 1ETRH 2BD7A 2BDAA 2JH5D 1SOTA 3SU2A 3KQCA 2A32A 1TIOA 1DE7H 1QNJA 1VCQA 3SNCA 4IS5A 2RA0A 2QA9E 2ZCKP 2VGCB 3VB3A 1OP8A 4ABGA 3F9EA 1MMJN 1FAXA 2TGPZ 2Q6DA 1H9LB 1G36A 2Y6TA 4O3UA 4H4FA 1PYTC 2B5TB 1TONA 4MPWA 2G00A 3OSYA 3LGIA 3O8CA 1TX7A 1O34A 1XMNB 1INCA 2BOHB 1PQAA 2THFB 1IQHA 1KLIH 4WH6A 2Y5FA 4X6MA 1O5FH 3GY6A 2ZI2H 2DUCA 3KQDA 4AZ2B 1GGDC 1O2SA 2GVFA 5A8XA 2VH0A 3U1JB 1K1MA 3RXPA 1F5RA 1OP2A 1TWXB 1C2JA 1V2VT 4NFFA 1XM1A 1YBWA 3DUXH 1T8OA 2Z3CA 4DVAU 3TJOA 1S6HA 3HKIB 1OWDA 1LCYA 4K69A 1UTQA 1C1OA 4I7YH 3T25A 2F9UA 1ZSJA 1DITH 1GI1A 2LNCA 5TCCA 1SGTA 2PSYA 4X2VA 4Y76A 2Z9IA 4DOQA 1CE5A
chains in the Genus database with same CATH superfamily
3B23B 1LMWB 4X1SU 1UTOA 1C4U2 1K28D 4LK4A 1ZSLA 1P2QA 4K2YA 1GI8B 3A8AA 4KTUA 3Q3KA 1TALA 1L1GA 2F9VA 1GVZA 3CS0A 1H4WA 1QRXA 1QJ6B 5TJXA 3RXTA 3QTVH 4ABBA 3NPSA 2L6OA 1AN1E 1LVMA 5BRRE 2NU1E 1C1RA 2PFEA 1GJDB 5FBIA 1EPTA 2XBYA 3FAOA 2Y7ZA 3OEHD 3DA9B 5LPRA 3Q76A 3SU3A 1TMUH 2G4TA 1C1NA 3SI3H 4RT0A 2ASUB 4U32A 1BTPA 3RC5A 4R8TB 1HCGA 4CRDA 4XBBA 1BMMH 5GWZA 6ESTA 2QE7D 3LH1A 3RXRA 1G32B 3AW1A 2SGDE 1PPZA 1AIXH 1TA6A 1P3EA 1DX5M 1GI7B 1JMOH 2TGDA 2A4RA 4GAWA 4XBCA 4IMZA 5LGOA 4JMYA 4MQAA 1F7ZA 2RFKC 1GCDA 3D49H 1AB9B 1BA8B 1NFXA 3ZYDA 1RRKA 3SBKA 4ABHA 2LELA 2FEQH 1YC0A 1DXPA 1C2KA 1RJXB 2OBQA 2UWLA 2BX3A 2EI6A 5DP3A 3U69H 4X6PA 1GJAB 1K1NA 1SR5C 3UFAA 3F1SB 4B2CA 3MO6A 1OHHD 1BRAA 3ZIAD 2OXSA 1P2JA 1CGJE 1GJ6A 1PJPA 7GCHG 1ZJDA 1O2TA 1SMFE 1MH0A 2QAAA 1N1LA 2ZTZA 1SFIA 3ITIA 4BXWA 2F4LA 1SGFG 4K5ZA 1UW7A 1O35A 2UUYA 3MU4A 4Z1MD 4FUDA 4D7FA 4SGBE 1YP9A 3OY6U 1LKAA 2R9PA 3UB0A 4D8NA 1DWEH 4RKJB 1AFEH 5FPTA 1CU1A 2ZDAH 1WDIA 3IWMA 4NA9H 2WV5A 2FDAA 2K8IA 4XBDA 4I86A 1GL0E 3SZNA 5I25A 3A85A 1VITF 1FY5A 2KCPA 4JCNA 1A0HB 3PROA 4ZXYH 3P17H 1MTVA 2ZGJA 4OS6A 1BHXF 3KCGH 4KELA 3W95A 2ZFFH 3DD2H 1LPZB 1EQ9A 4AOQA 1S5SA 1HAGE 1AHTH 1KXBA 2W26A 2VINA 4Y8YA 1C1SA 3UR9A 2F3CE 1G30B 2W3KA 1HGTH 1BMNH 3BTEE 2ZPSA 4DW2U 5C67A 4U30A 1AFQB 1O36A 2A5KA 2ZGCA 1HYLA 2WYJA 3TJNA 1CSOE 1LHFH 2PUXB 3ZVCA 1AE5A 2HNTE 1UTNA 2OQUA 3OX7U 2ZA5A 1VCPA 4FOUC 3GISB 1UVOA 2SNWA 3RC4A 1J8AA 2VVVA 3MYWA 1EUFA 1ZYOA 5TCAA 5GNDA 4YLUA 1NZQH 2XC4A 1L0ZA 2HPQH 4FUFA 3BEIB 4LXBH 3SN8A 3ZZ8A 2BVRH 1SGQE 1AVGH 5DK1A 1NFWA 1F0RA 1GHYH 1TX6A 4F49A 5CE1A 3RXLA 3ZV8A 5EQSA 1GCTB 4FVBA 2GKVE 2ZDMA 3A7ZA 1HAZB 1GMDF 1GHWH 4XSKU 1IQKA 3SJIA 2B7DH 1QJ1B 1CQQA 2XC5A 5EQRA 3UQOA 3UWJH 4TY7A 3BIUH 3T29A 3GICB 5HM2A 1S6LA 2BMGB 1AWFH 1B5GH 3K6ZA 3ZVBA 3RXDA 2V0BA 4X1RU 1O3GA 4NGAH 1E1RD 4NCYA 4WJG2 1VKYA 1ZLRA 2BD5A 1GBKA 3ATKA 4AC9A 1GJ7B 1UHBB 4ABIA 2IPHA 2FOEA 1EP6A 4BXSA 3M7UA 3B8JA 4NIWA 1GHAG 2VH6A 4ASHA 1F5LA 1BTYA 4E05H 4CRCA 9ESTA 2BVSH 4E7NA 5EJ1A 5HXFA 1B0EA 4MTBA 1EOLA 2O8MA 3IG6B 1W10U 2PKSC 4DGJA 1YLDA 2DE9A 5C0UA 4TSFD 4A7IB 6CHAC 4XDEA 1LPKB 2QXHA 1C1MA 3PMBB 4CH8B 1W7XH 3GYLB 4WF8A 2NWNA 3RC6A 1IQEA 2PUQH 3MFJA 1F0TA 2GV7A 2D2DA 2YOLA 2ALPA 4J2YB 3EA9A 1SGYE 1G3BA 5DG6A 4A5TS 1HIAA 2J97A 2WPMS 2P8OC 4HZHA 1HRTH 4NIXA 5EW2H 1O37A 1OWKA 3DHKH 1QL7A 1AMHA 2XC0A 4Y0YE 3ZVFA 2FTLE 1W2KH 1IHSH 1V2MT 1K9OE 2SFAA 2ZGBH 1YLCA 1XVMA 2FOMB 1QA7A 1JWTA 2Y5GA 3CNRA 4NFEA 1AVWA 4KKDA 3LDXH 4K1SA 3A81A 3TH3H 1Z6JH 1BQYA 3ZZCA 3U9AH 1YPKH 3SYJA 2FPZA 2BD4A 3AW0A 2O8UA 2HPPH 3PRDA 2YMSB 2XBVA 3LOXA 2BDCA 1HLTH 2PTNA 1ZMLA 2ZCHP 1QGFA 4AG2A 1PQ5A 3OYPA 2ZU2A 5A8YA 2KM0A 1DLEA 1LQDB 3OY5U 3FZZA 2J4IA 3SNAA 3E6PH 3EDXB 1BDAA 1Z6EA 2A7CA 4UDWH 1TFXA 3ATLA 3BF6H 5C5NA 1UK2A 1KTTB 1OSSA 4X0WU 3VG8A 3H5CB 4D9RA 4Z6AH 3RXFA 2BM2A 2OLGA 1PPHE 5FX6A 2Q6FA 1K1OA 3KGPA 4FETA 2I6QA 2OK5A 5DN6D 1YPJH 1ZPZA 2BHGA 2BB4A 2JKHA 4LZ4B 3R3GB 4MNWA 4O3TA 5C1YA 2H1UA 1SHHB 1M9UA 3QTOH 2FTMA 2AMPA 3O8DA 1FIWA 2PLXA 2F9NA 3E3TA 1YPEH 4KTSA 3EGKH 2HVXA 4X8TH 4NG9H 2DE8A 1UCYH 1XUHA 1ANDA 3SV9A 3RXQA 1O2OA 1C5TA 1XUJA 3NK8A 1GVLA 4YLQH 4YO9A 3F0PA 1ZSKA 3DSGA 1FN6A 1LVYA 1H9IE 1AU8A 1AZ8A 2GT8A 2FLRH 2FI5E 4BAQB 1K1IA 2FOFA 1UTKA 3W1EA 2QF3A 1AD8H 1YCPM 2ZHQH 1LVOA 3A86A 4PROA 2J92A 5C2ZA 1TBZH 1QRWA 1JOUB 4FUJA 4XFQA 1RTFB 2JH0D 1UTJA 1WTHD 2P16A 1IQLA 2QYIA 2Y81A 3BTME 3RXGA 2WPLS 3WY8A 3LGWA 3QO6A 3STIA 1IQJA 1IHTH 3H09A 4FUBA 3M5NA 2OC1A 1O3LA 4CBNA 2FS8A 1YCPH 1LHGH 2BY8X 1MTNC 3SQHE 1FMGA 1BHXB 1ELDE 3NKKA 3MNSA 5LPFA 2ZU1A 1HJAC 2WUBA 3HPTB 4CR5A 2PWXA 3P92A 3RUOA 2CMYA 4UFFH 4MDSA 3FO8D 4I8KA 1WSSH 2R3YA 1OX1A 2AIPA 3SUEA 3M5LA 4GHQA 5C20A 3UOPA 3QLPH 3MWIU 1P3CA 2EC9H 3SNBA 1KYNA 1ZPCA 2QF5A 3RXOA 1Z8RA 4WXVA 1MD8A 2Z9GA 4MPVA 2GZ9A 2CGAA 1RTKA 2AHME 1GI9B 4NIYA 2UWPA 1HAVB 3EYDA 4AN7A 1TGNA 1O3JA 2PTCE 3GYMA 1FI8A 3LGYA 1N8OB 2O8WA 1E36B 5JB9S 4HG6A 1Y5AT 2CXVA 2L74A 1C5NH 5E2PA 3U98H 1GBMA 1MTUA 1O2LA 1GG6C 2XBXA 3Q3XA 2VIDA 3NXPA 2XNIA 4JZIA 3K6YA 2C8YB 3F9FA 1QA0A 1L2EA 3BTTE 1VGCB 2SNVA 1PYTD 2ZQ1A 2PGQB 2KAIB 4X2XA 3EE0B 3UIRA 1J14A 1ARBA 3GY4A 1L1NA 2JJ1D 4AGJA 2G5NA 1D9IA 1O33A 1YY3A 4CHAB 2Z7FE 1EZXC 3BN9A 3TH2H 1HPGA 5JBBS 5JBTA 2XBWA 5C1XA 1HAPH 2AH4X 1SLWB 2RG3A 1Y3UA 2TIOA 1WAYB 5EG4A 1V2KT 1TRYA 2GJGA 2BLVA 1GI0A 5F6MA 3RXBA 4JZEH 2FYRA 2V3OH 4TPYA 3L3TA 3QN7A 2O8LA 2BD9A 1V2NT 3RXAA 5FAHA 1EZUC 2HVYB 4XRNA 1DLKB 4Y11E 3PV2A 1GHVH 2PP6A 1W0YH 2CK3D 5F53A 1BBRK 2ZF0H 1XVOA 2ZHWH 1LQEA 1TPOA 2ZKSA 1CHGA 1OP0A 3GY8A 1BUIA 1FY3A 3E8LA 1S6FA 1BTZA 3LH3A 4I8GA 4JYTA 4Y71A 1T4VH 4H42U 1FN8A 3RU4E 1T7CA 1CVWH 2HGTH 3N7OA 5F8TA 3ENSB 1XUGA 3KQEA 2XOKD 1YWUA 1C4Y2 4UFDH 2CN0H 1K2I1 1LHCH 2ZGXH 4RN6A 2GT7A 4ISNA 1GHXH 4AORA 3VXEH 4X2YA 1EB1H 3LT3A 3FFGA 2ZDLA 2A5IA 1PQ8A 1SFQB 4NZLA 1P2MA 2ZFTA 4ZHAA 3PWBA 1P02A 4YOJA 3URCA 2HOBA 5EJZA 2BX4A 3U8TH 1NN6A 2FS9A 4NWKA 1ZGVA 2F83A 2XW9A 4ZHMU 1MTWA 1F0UA 3P70B 4DT7B 1UTLM 1XUFA 4FUCA 3PO1C 3SU6A 1OS8A 1THPB 4YM9A 2GMTB 2HALA 1NPMA 3RU4T 1O2NA 1HJ8A 3T5FH 4B76A 1BMFD 1K1LA 3NUMA 1GMCF 2VB0A 4ZROA 1UMAH 2AMDA 1QJ7B 1P8VC 5DJ7A 2QIQA 4LZ1H 1P57B 1QQUA 4Y7BA 5FXLA 5KEDA 3KYGA 5E0GA 2F9OA 2A4GA 4Q63A 1IQMA 3KIDU 1O2PA 4OS5A 4ZHLU 2A2XH 4BAMB 1FNIA 4ISHH 4NZQA 1H8DH 3I78A 1RXPA 3R0FA 1HAVA 1KDQB 4BAOB 1O2ZA 2G81E 2FI4E 3P6ZB 3SGBE 1RIWC 1OKXA 1TA2A 3SOSA 3AAVA 1ZTJA 3SW2B 1O5BB 1P01A 3S9BA 2YNBA 1NM6A 2BXTH 2GZ8A 1UVUH 1UVSH 1O3BA 2J98B 1DWBH 1Z8IB 3UR6A 4FXGH 1YCPK 4CRAA 1SB1H 4R0IA 1TNGA 1TB6H 1DWCH 1DPOA 3PV5A 2KCYA 3WW7A 4THNH 1SGNE 3N7EA 1WUNH 1GPZA 1TABE 4BTTB 3BTGE 3ZVAA 4DJZB 1TX8A 1MZDA 1O2GH 2UUFB 1NS3A 1DUEA 3KL6A 5DGJA 5C1UA 1HJ9A 1PFXC 2GDDA 1OWJA 1UHBA 2G51A 1T8NA 1BT7A 2FOBA 3GY2A 2PW8H 4B6FA 4DCDA 3ZVGA 1GDNA 2QXIA 4ACBA 1JBUH 2VWNA 1N8OC 2SGEE 1C5WB 3UNQA 1ESTA 4JZDH 1CO7E 1S82A 4DT4A 1G3CA 4QT8C 3PWCA 2OC8A 1ZHPA 5FCKA 3SU0A 2KR7A 3TNSA 3F2FA 1WTGH 2VWLA 3ZZ9A 1SGRE 3LJJA 1B7XB 1X7AC 2JETC 1ANCA 1H8HD 1NC6A 2CV3A 1O2WA 2P93A 4MG3A 3AVZA 4WWYA 1SBWA 4UEHH 1EB2A 1OWHA 3M61U 1DANH 5ESTE 2ODYB 1QHRB 4F55A 2AGIX 4CRGA 1W11U 3E16B 4ISLA 1C1UH 1O3HA 1GBEA 1MKXK 2GTBA 2GP9B 2G52A 3STJA 3SV8A 3MQKC 1NRPH 1Q2WA 1O30A 1C1VH 1V2PT 2C8ZB 3PB1E 3MO3A 3RXEA 5EODA 1QB9A 2R2MB 1EATA 1MTSA 1YPHE 3TIUA 2BOKA 1WV7H 2G5VA 5DSFA 1DS2E 4ASUD 1HAOH 2IJOB 3U1IB 5AFZH 3FANA 1EXFA 4DIHH 3F9HA 1GBIA 1O2HA 5DP9A 4D7GA 2XWBI 4OS1A 2VVCA 4AB9A 3BTQE 4CRBA 1C5UA 4B1TA 3GOVB 1A0JA 3SUGA 2FOHA 2BZAA 3RU4D 2HNTF 3TLOA 4SGAE 5T6FA 1WU1A 1FIZA 1Q3XA 3HGPA 1MTNB 4ABAA 2KZ4A 3M7TA 4DG4A 5BPEA 5KECA 4IC6A 1VITH 2QF0A 4BTUB 1VITG 3S0NA 5EPNA 3P8NA 1EAWA 3KN2A 3QGNB 1C4V2 4YOGA 3TK9A 1FX0B 2FYQA 4U2WA 5F03A 1MD7A 1Y3VA 4NIVA 1UVPA 1K21H 3Q00A 2BY9X 4NSVA 3MU5A 3V3MA 1FLEE 1P9UA 6LPRA 1O3KA 1V3XA 3KNXA 3RXSA 2XXLA 1GL1A 4YT7H 1T32A 3PLBA 4FU8A 3A7TA 4FVDA 2J9NA 1QCPA 1SGPE 1S83A 4MLFB 1HAIH 1BRCE 2Z9JA 3SHAH 3EAJA 3SHCH 3TK5A 4Y8ZA 2B9LA 3RLYH 2RA3A 1AO5A 5HYOA 6GCHF 1J9CH 5GJ4B 2ZP0H 4BTIB 5ABWA 1O2UA 2B8OH 4H6TA 1MCVA 4CH2B 1O2RA 1EPTC 4I8HA 3TITA 3ZZDA 1UTPA 2FXRA 1PPFE 1DSUA 5IK2D 3N99A 1ACBE 1DICA 1SPJA 1TLDA 2PKSB 4ZUHA 4FUEA 4AFSA 1MAXA 1SGDE 1AKSB 1DUAA 4M7GA 4X8VH 5DP7A 1O2YA 3TNTA 2LPRA 1HXFH 3UWIA 5A0BA 1J17T 1P2NA 2OUAA 3M5OA 1XXDA 2R0LA 2WV9A 2H9EH 3SORA 3RMOH 1VJAU 1C5LH 5AF9H 2PSXA 4JZFH 2KFWA 1ETSH 1P11E 3OTPA 2J38A 2VJ1A 4IMQA 1OYQA 5HMAA 4Y8XA 1JRTA 1C5YB 2SGPE 4AYVB 1KMHB 2ILNA 1O3PB 5F8XA 1LVBA 1UCYK 5AHGH 4RKOB 2IPQX 2NU2E 1ABIH 1LHEH 3ZZBA 5FBEA 1QY6A 4D76A 2H9HA 1W8BH 2JETB 1NU9A 4Y6DA 2BDYA 3ZZ5A 1C1PA 2Y5HA 4INKA 1AQ7A 1RTLA 1P2OA 2VIWA 1TNIA 1DSTA 2VBCA 4MNVA 1S0RA 3BEUA 3OFND 3V0XA 1TNLA 4YXWD 3A89A 4JZ1A 3MNBA 1ZTKA 1COWD 4GVUA 1THSH 3SU5A 1ID5H 5IDKA 1O3FA 4JYUH 1H1BA 1F2SE 2P8OB 1IAUA 2JJ2D 1BTXA 1W12U 2CF9H 2HLDD 1GJ8B 3A84A 1BCUH 1BMAA 1BITA 1MABB 2ODQA 2AS9A 4E7RG 1K1JA 5F8ZA 1GMDG 5C94A 1ETTH 3LC3A 1ELCA 5EIYA 2CHAC 1MU8B 1EJAA 2GMTC 4WMFA 1E1QD 3SU1A 3VB4A 1E37B 2ZHFH 2GCTB 2ZPQA 3WWFA 1O2KA 2J2UA 2FP7B 3G01A 3OAAD 9LPRA 3SGAE 2J98A 3HK6B 1O3AA 3S9AA 1C5PA 1UVTH 1TNJA 2R3UA 3Q77A 1YKTA 3BSQA 2LP6A 2P94A 2KX4A 4OS2A 4B75A 3PLKA 3A8CA 1C2FA 1A4WH 4P02A 2Z9KA 4HFPB 1AI8H 1DY8A 4NA8A 4AFUA 1P06A 4J1YA 3E90B 3SV7A 4IN2A 3BIVH 3CS7A 3SJ9A 5EW1H 1WOFA 1C2HA 2FOCA 3PMAB 3F2GA 4WXIA 2Y82A 5KGOA 7KMEH 2AGGX 4TYDA 4KP0A 5GIBA 1GBTA 3A7WA 4I32A 5B6OA 3WWBA 2J94A 1P09A 2ZGHA 4HGCA 1V2TT 1C2EA 2STAE 1HJAB 1EKBB 2A4OA 2EQNA 2A0QB 1KTSB 3FP6E 2FOAA 5EPYA 5IYTA 2H2ZA 5HIZA 1J16A 2KCOA 4YZUA 1YLNA 3PRBA 1P2IA 2TGAA 1SVPA 2ZFSA 4NSYA 6GCHG 1THRH 2D8WA 3CP7A 3BG4C 1QTFA 1D6WA 2H5CA 4AGKA 2OQ5A 2QCYA 1BTWA 2BY5X 4ZXXH 4JK5A 1GJ4H 3BTWE 1FDPA 1ELAA 1RD3B 3LGUA 2ZTYA 3DFLA 1YPGH 4XOJA 1FXYA 1BBRE 2FOGA 5T6DA 3KQ5A 1DXWA 3A7YA 1DY9A 1CA8B 3FP7E 1GBFA 4NWLA 4I31A 5JBAS 2P3UB 4UFEH 1W0JD 3LC5A 3V12A 4RSPA 2W7UA 3S7HB 1FQ3A 1TMTH 2BDIA 2YNAA 2ZO3H 2K1QA 3SNEA 4K8BA 3CENA 2C8XB 1C5OH 4Q2KA 4VGCB 3SV6A 3PYHA 4IGDA 1PPCE 1GHZA 3RXIA 4ZKOU 3AK5A 1O5GH 4Q7XA 4Y0ZE 1GHBG 1NFUA 3OE7D 1D6RA 1TQ7B 1FUJA 1W7GH 4UFGH 2ZG0H 2P3FH 4DURA 1E34B 2ANKH 1ZMJA 2V7QD 1O31A 1VGCC 4INHA 4FU7A 1BJVA 3A88A 3SQEE 1HUTH 2Z3DA 2KAIA 3E91A 3MHWU 2FODA 2XYAA 2K0QA 4JYVH 1ELVA 4B73A 5HM9A 1C2GA 1E35B 4WH8A 2F91A 4Q80A 1G9IE 2QC2A 2HLCA 4FU9A 2TGTA 4B71A 4YESB 1O5CB 1C5XB 2WPKS 1V2ST 5J4QA 1Z8JB 1UK4A 8KME2 3VGCB 2ANYA 3MU8A 1QFKH 1TBRH 1GDQA 1SOZA 1YPHC 2PR3A 3KQBA 1SGCA 1XKAC 3MNCA 4AX9H 2AGEX 3TGKE 2GCTC 4I33A 1TPSA 3VEQB 1GBLA 2V3HH 3LIWA 4OGXA 2ANMH 1EAXA 1SQTA 1ZHRA 2WINI 1O3CA 3HGNA 2CHAB 3ELAH 2ZIQH 2C4FH 4Z0KA 1UTMA 3BTKE 1KDQA 1O3OA 1QB1A 2GGVB 4Y79A 5JPMH 2JIZD 2VWOA 5LH8A 1L4DA 1CA0B 1U6QA 1BOQA 2FX6A 4XD7D 1HV7A 1QURH 1ESBA 2AEIH 1P04A 2ZFPH 2ZECA 2A1DB 3L6PA 1BIOA 1AUTC 4O9VA 4A1TA 4TPIZ 2JH6D 3TK6A 3TGIE 3RXCA 3U8OH 2PV9B 5FPSA 2EEKA 2ANWA 5ESBA 2ZZUH 3DCLA 1WQVH 2I6SA 3RM2H 4A1VA 5K7RA 4X1NU 2BZ6H 2ZHEH 3EA7A 4FUHA 1O2MA 3ZZ3A 2NU3E 5CHAB 2AERH 1FY1A 1HBTH 4YTAA 1NFYA 3MOCA 1RIWB 1D3TB 1Y8TA 2GZ7A 1E38B 1HNEE 1A3BH 4M9FA 1L4ZA 4MPXA 3BEFB 1FPHH 1GGDB 3UPEA 2ZNKH 1O2XA 2BDHA 3Q3YA 4CR9A 1H8IH 3MH5A 3BTFE 3OEED 2HNTC 3AASA 2XWAA 1QBOA 3ODFA 2WPIS 1ABJH 1EAIA 3SJKA 1C5QA 3MO9A 2M5TA 7LPRA 1L1JA 5SGAE 4IN1A 2ZFQH 5CHBA 4HTCH 3TPIZ 2WPDD 2C8WB 2A2QH 3RXMA 1GJBB 1LPGB 1P03A 1GHAF 1TNKA 3GY5A 1NRSH 1C2LA 3UREA 3IITA 1ELTA 2G55A 3PV4A 3F9GA 1N6YA 1ZTLA 1PQ7A 2BQ6B 4IBLH 1YYY1 1ZOMA 1NO9H 4ZKNU 1A2CH 1FONA 1FY4A 1ZHMA 3UQVA 5ETXA 1FJSA 1AZZA 4MPUA 1VR1H 2GV6A 1P12E 1TNHA 3M7QA 1ELGA 1W13U 3MU1A 1VZQH 1ANEA 1V2LT 2ZTXA 1K22H 1P9SA 1YF4A 2UUKB 1NBME 3ATIA 2ZDNA 5CDFE 3A82A 1UK3A 2BXUH 3A8BA 1YPLH 4GPGA 4FUGA 2BVXH 3TU7H 2KCAA 2QXJA 3BTDE 5GCHF 2FO9A 1S85A 2BD2A 3MNXA 5FX5A 1EJMA 1PPBH 3VPKA 1O3NA 1Y3WA 1MZAA 1C9TA 3A80A 5A8ZA 2AFQB 2EA3A 1QL8A 1W0ZU 1DM4B 2W3IA 1O32A 1NRNH 1IQGA 2BY6X 1S81A 3GDUA 5JB8S 1CBWC 1Q31A 1QRZA 2Q1JA 4P00A 1YM0A 1ZMNA 4ZKSU 1GBCA 1MAYA 5EXLA 3SUFA 1HFDA 3D23A 1W3CA 2PGBB 3FP8E 2EY4C 3RDZA 4OS4A 3QX5H 5I46H 1G2LA 1TRNA 1CT2E 1AY6H 2BLWA 1CT0E 2BDGA 4X6OA 3ZZ7A 1SGEE 2ZU5A 1F0SA 2FIRH 3L33A 1V2OT 1D4PB 3LKWA 2GDEH 2M2AA 3DFJA 1F92A 2CJIA 2IJD1 8LPRA 1HAYB 1MQ5A 2QGRA 1EJNA 1GI3A 1SL3A 1F5KU 1ZGIA 2G8TA 3OU0A 1T31A 1NY22 1RFNA 1BRBE 3PMJA 4K3JA 3RMNH 4X8UH 3PTNA 3LGVA 1FV9A 4O97A 2YMSC 2C93B 4X1PU 2ZPRA 1A61H 5C3NA 1DVAH 3RLWH 3A8DA 3GS9A 4A1XA 4MNYA 3RXVA 2OC7A 2IOTA 1C5MD 2GCHG 1QQ4A 1A7SA 1TYNA 1EAUA 2PHBA 1DDJA 1WQSA 2VIVA 3BG4B 1NBMD 5L2ZH 5G4BA 1TGBA 1GI6A 4UE7H 2V3MA 3SNDA 3HKJB 1Y5UT 1A5HA 1Y59T 2F9PA 2Y80A 4A92A 3GY3A 2ZU3A 5DP4A 4BAHB 2J95A 1Z7KA 1LTOA 3LPRA 1EZQA 4B2BA 4BOHA 1A46H 2GD4B 1AB9C 1GWAA 1Y5BT 3V13A 2BYAX 5J4SA 2TRMA 1ELFA 4INLA 1A1RA 3ZZ6A 2BQ7B 3ZV9A 1BTUA 3OTJE 2FESH 3C1KA 3E1XB 4ZMAH 1TBQH 1HDTH 2P3TB 2ZDVH 2WHXA 1B0FA 3MTYA 1AGJA 1ZJKA 3M5MA 1ZRBA 3FZDA 1C1WH 2Y7XA 1ELEE 4GUXA 4ISOA 1ZR0A 4TWWA 1IQNA 3A7XA 2OCVB 5HGGA 1G3EA 3SZEA 1XKBC 5C17A 2BDBA 1Z1JA 1D3DB 1MKWH 3T27A 5K0HA 2BD8A 3BTHE 2EI7A 4X6NA 3D65E 4D9QA 1ESAA 1O0DH 1ARCA 1C5RA 5LPEA 2PKAA 1XUKA 3RXHA 3SUDA 3PMHB 1IOEA 2J5UA 1G2MA 2F9BH 1A5IA 2ZC9H 2SGAA 2ZDKA 4ABJA 4GHTA 3QGJA 4O03A 3VFEA 4I8LA 3VB7A 1T8LA 1XUIA 3SV2H 1RGQA 2WYGA 1BZXE 3FN8A 2BTCE 2OINA 5HKKD 3MH4A 8ESTE 1XX9A 4F4OC 1FY8E 4I8JA 3PM3A 1OYTH 5CMXH 4VGCC 5E0JA 1O2VA 1O3EA 1GBDA 3SO3A 1E0FD 2BLOA 4FUIA 4TWYA 1T8MA 2FM2A 4JK6A 4E06H 3M36A 3K2UA 4K8YA 5EXMA 2ULLA 2GCHF 3QUMP 1BBRH 2H9TH 1V2WT 1NU7B 3F68H 3EE7A 2A7JA 2TPIZ 1SKYE 5DO4H 2Z94A 1TE0A 5AFYH 4GSOA 2NU4E 2OD3B 4CRFA 5EU8A 1AWHB 2G4UA 3T28A 3ESTA 1TOMH 2A31A 2WV4A 2ZWLH 3DT0H 3UY9A 4B2AA 2AIQA 4X8SH 5FHTA 3W94A 4IC5A 1GBJA 3VXFH 1TGSZ 3UNRA 3ZVEA 1V2RT 5DP6A 2AMQA 1P2KA 3UTUH 1P0SH 3RP2A 2P95A 2ODPA 3M3VA 2RDEA 1A3EH 3BV9B 1GCTC 3I77A 1BRUP 8GCHF 3LONA 1GI5A 3M3SA 1GMHG 1D3QB 3EQ0H 1HAXB 3K9XB 1V6DA 1EP5A 7ESTE 3BG8A 3VGCC 1EX3A 1T4UH 2STBE 3JZ2B 2R0KA 2HRVA 3KHVA 3PTBA 3SGQE 3RM0H 2P59A 1TRMA 4B6EA 1GBAA 5L2YH 1EPTB 3VB5A 1VJ9U 3QZRA 1V2QT 2Z6BD 2EI8A 2CF8H 7GCHF 2NU0E 1SG8B 2J34A 4H6SB 5JDUB 1SHYA 1SI5H 1GI2A 1RS0A 1AFQC 1CA0C 3M35A 3H7TA 2W5EA 5EOKA 3MI4A 1K0HA 1QBNA 1AE8H 2F43B 2FMJA 5CHAC 3SI4H 1LO6A 5H4IB 3S69A 3UAIC 1SGIB 4WVPE 1YGCH 6CHAB 3SU4A 4UONA 3P8OA 3TH4H 3TVJB 1V2JT 3RXUA 5PTPA 1SQRA 1NT1A 4K1EA 4BAKB 1NESE 1C5VA 1SLXB 4WMDA 3C27B 2ZFRH 3SJ8A 2C3SA 3F2HA 3PLPA 5EJLA 1QIXB 1SSXA 3FVFB 5C0TA 1AVXA 2VWMA 1KXAA 3GCTG 4GCHF 2JDID 2PKAB 1O38A 2QF4A 2RCEA 1NRRH 5EXNA 2Q6GA 2BQWB 1QBVH 2ESTE 1H8ED 1KY9A 3P8FA 2ZHDA 1A0LA 4IW4E 4XE4A 1OWEA 1C2DA 2SGQE 3NZIA 2A45B 1O3IA 1HB0B 4K1TA 1BJUA 1VCWA 4UD9H 1KIGH 4X2WA 1P10A 1W14U 4AG1A 2SGFE 4TT3D 1S84A 1G3DA 3QK1A 2XTTB 2A4QA 4MNXA 2FWWA 3RXJA 4HI3A 3E0NB 1CHOG 1Y3XA 2FZZA 2W6JD 1JXPA 3GY7A 3KF2A 5DPAA 4CBOA 2OTVA 1GMHF 1FPCH 1SGFA 3A87A 4ZAEA 3ATMA 1MCTA 5HIYA 1UCYE 1CGHA 3D62A 1C1TA 3RMMH 1KLJH 5GCHG 2QXGA 1MKWK 4MVNA 3ATWA 3GDVA 4F48B 2ZEBA 1JIMA 1NRQH 1DOJA 1OXGA 1TMBH 2V35A 4B74A 2VIQA 1QB6A 5E8EH 1AKSA 4K60A 4ACAA 2O9QA 1EASA 1GHBF 3GCOA 1YPMH 3MU0A 2FI3E 3T62A 4GLYA 1G37A 1H9HE 2WPJS 3ZVDA 4LOYH 2QV1A 4RT1A 1SQAA 4DIIH 5L30H 5A09A 3DSPA 4AFQA 2R2WU 1CHOF 1HXEH 5A0CA 1O2JA 3UUZA 1K1PA 1S0QA 2A7HA 3ZZAA 4DY7B 3UOUA 2ALVA 5GXPA 1AUJA 3K65B 1LDTT 3M3TA 3TJVA 4NA7A 1GJ5H 2XNDD 1UO6A 5GPIB 4YOIA 1UJ1A 1EFRD 5C5OA 2W6ID 4OGYA 3F0OA 5GDSH 3AAUA 1Z1IA 3B9FH 3QZQA 1MBQA 2ZCLP 1CGIE 1WBGB 1GMCG 1PPGE 1Z8GA 2FLBH 1ORFA 4Y7AA 4ESTE 1GJ9B 1EZSC 2V6NA 3KEEA 1Z71A 1WXRA 1SC8U 1KXCA 3M37A 3DSOA 1MQ6A 4BANB 3SJOA 1JIRA 1C9PA 3HATH 1O3MA 1TOCB 4ZKRU 3MMGA 5JBCS 2D26C 2WSSD 1GDUA 3FKSD 4Q4LA 4YT6H 2RDLA 2VGCC 1QR3E 3HK3B 1V2UT 5T3HA 4WY3A 3GCHC 4AYYB 1MU6B 3S7KB 2OC0A 3JZ1B 1KLTA 1EOJA 3QWCH 3RMLH 2FX4A 1BB0B 1ELBA 1PPEE 2Z9LA 3A7VA 3A83A 1QZ8A 2A5AA 2VU8E 1FAKH 1O5DH 1GBBA 4U01A 4ABFA 2IN2A 1WYKA 2C90B 2Z3EA 3P8GA 1C1QA 1E79D 4ZCNA 1MKXH 1OWIA 1P05A 5A0AE 2WUCA 4A6LA 3GCHB 5DP8A 1DFPA 1O3DA 2ZQ2A 3U28C 3S9CA 2UWOA 1SLVB 3V7TA 5DKMA 1BTHH 3UNSA 1Y3YA 2QN5T 1W0KD 1LKBA 2VNTA 3EA8A 1J15A 2BY7X 3U8RH 1CT4E 4TY6A 1TPAE 1ZPBA 1O39A 3F3BA 3GDSA 2GX4A 3LJOA 2OBOA 1C2MA 1MUEB 4X1QU 3TJUA 1C5ZB 3PO1B 8GCHG 2O8TA 4OM9A 5FCRA 1HAHH 1KXFA 2ZU4A 1IQIA 4Q7ZA 1GBHA 3URDA 1SLUB 3NRLA 3I29A 1GVKB 1KSNA 2H6MA 1C2IA 1C5SA 1QL9A 1OPHB 3FOAA 2D1JA 1DT2A 1NTPA 2XCNA 4BNRA 4WMEA 2B0FA 2WPHS 4AB8A 3LU9B 4KGAA 1MBMA 2HWLB 1KXEA 1O5AB 1TPPA 1ZRKA 5EGMA 3ZYEA 4CHAC 1LHDH 1A5GH 4ISIH 1FZZA 3O8BA 2VIOA 2W7SA 1SQOA 5L6NH 4Q7YA 3TGJE 2XRCA 1WCZA 3RXKA 5FPYA 5E2OA 3KYFA 3GCTF 4GCHG 4RI0A 3T2NA 2AYWA 1TGTA 1D3PB 1N6XA 1NROH 4ZH8A 1IQFA 1GI4A 1CBWB 1GG6B 5AVDA 2QY0B 2UUJB 3F6UH 3GCNA 3NCLA 3MH6A 1O2QA 2BD3A 4KTCA 5EQQA 1TQ0B 1ZZZA 2WZQA 1TAWA 1HIAB 3ZZ4A 3O8RA 2H5DA 1BMLA 1GJCB 2BLQA 4OS7A 2VVUA 3LGTA 5E0HA 3E0PB 5A2MH 2VIPA 2OP9A 1KXDA 5DP5A 1OOKB 3VB6A 2TBSA 4AFZA 1XXFA 5T6GA 1TGCA 1ANBA 2XCFA 4Y10E 1O2IA 5JYIA 4ABEA 5B6LA 1DWDH 1O5EH 3H7OA 3T26A 3N7DA 3ODDA 3P95A 3NWUA 3QDZB 1JRSA 4CREA 4ABDA 3MH7A 1ETRH 2BD7A 2JH5D 2BDAA 1SOTA 3SU2A 3KQCA 2A32A 1TIOA 1DE7H 1QNJA 1VCQA 3SNCA 4IS5A 5FL7D 2RA0A 2QA9E 2ZCKP 2YMSD 2VGCB 3VB3A 1OP8A 4ABGA 3F9EA 1MMJN 1FAXA 2TGPZ 2Q6DA 1H9LB 1G36A 2Y6TA 4O3UA 4H4FA 1PYTC 2B5TB 1TONA 4MPWA 2G00A 3OSYA 3LGIA 3O8CA 1TX7A 1O34A 1XMNB 1INCA 2BOHB 1PQAA 2THFB 1IQHA 1KLIH 4WH6A 2Y5FA 4X6MA 1O5FH 3GY6A 2ZI2H 2DUCA 3KQDA 4AZ2B 1GGDC 1O2SA 2GVFA 5A8XA 2VH0A 3U1JB 1K1MA 3RXPA 1F5RA 1OP2A 1TWXB 1C2JA 1V2VT 4NFFA 1XM1A 1YBWA 5T1VA 3DUXH 1T8OA 2Z3CA 4DVAU 3TJOA 1S6HA 3HKIB 1OWDA 1LCYA 4K69A 1UTQA 1C1OA 4I7YH 3T25A 2F9UA 1ZSJA 1DITH 1GI1A 2LNCA 5TCCA 1SGTA 2PSYA 4X2VA 4Y76A 2Z9IA 4DOQA 1CE5A
chains in the Genus database with same CATH topology
3B23B 1LMWB 4X1SU 1UTOA 1C4U2 1K28D 4LK4A 1ZSLA 1P2QA 4K2YA 1GI8B 3A8AA 4KTUA 3Q3KA 1TALA 1L1GA 2F9VA 1GVZA 3CS0A 1H4WA 1QRXA 1QJ6B 5TJXA 3RXTA 3QTVH 4ABBA 3NPSA 1AN1E 1LVMA 5BRRE 2NU1E 1C1RA 2PFEA 1GJDB 5FBIA 1EPTA 2XBYA 3FAOA 2Y7ZA 3DA9B 5LPRA 3Q76A 3SU3A 1TMUH 2G4TA 1C1NA 3SI3H 2ASUB 4U32A 1BTPA 3RC5A 4R8TB 1HCGA 4CRDA 4XBBA 1BMMH 5GWZA 6ESTA 3LH1A 3RXRA 1G32B 3AW1A 2SGDE 1PPZA 1AIXH 1TA6A 1P3EA 1DX5M 1GI7B 1JMOH 2TGDA 2A4RA 4GAWA 4XBCA 4IMZA 5LGOA 4JMYA 4MQAA 1F7ZA 1GCDA 3D49H 1AB9B 1BA8B 1NFXA 3ZYDA 1RRKA 3SBKA 4ABHA 2FEQH 1YC0A 1DXPA 1C2KA 1RJXB 2OBQA 2UWLA 2BX3A 2EI6A 5DP3A 3U69H 4X6PA 1GJAB 1K1NA 1SR5C 3UFAA 3F1SB 4B2CA 3MO6A 1BRAA 2OXSA 1P2JA 1CGJE 1GJ6A 1PJPA 7GCHG 1ZJDA 1O2TA 1SMFE 1MH0A 2QAAA 1N1LA 2ZTZA 1SFIA 3ITIA 4BXWA 1SGFG 4K5ZA 1O35A 2UUYA 3MU4A 4FUDA 4D7FA 4SGBE 1YP9A 3OY6U 1LKAA 2R9PA 4D8NA 1DWEH 4RKJB 1AFEH 5FPTA 1CU1A 2ZDAH 3IWMA 4NA9H 2WV5A 2FDAA 4XBDA 1GL0E 3SZNA 5I25A 3A85A 1VITF 1FY5A 4JCNA 1A0HB 3PROA 4ZXYH 3P17H 1MTVA 2ZGJA 4OS6A 1BHXF 3KCGH 4KELA 3W95A 2ZFFH 3DD2H 1LPZB 1EQ9A 4AOQA 1S5SA 1HAGE 1AHTH 1KXBA 2W26A 2VINA 4Y8YA 1C1SA 3UR9A 2F3CE 1G30B 2W3KA 1HGTH 1BMNH 3BTEE 2ZPSA 4DW2U 5C67A 4U30A 1AFQB 1O36A 2A5KA 2ZGCA 1HYLA 2WYJA 3TJNA 1CSOE 1LHFH 2PUXB 3ZVCA 1AE5A 2HNTE 1UTNA 2OQUA 3OX7U 2ZA5A 1VCPA 3GISB 1UVOA 2SNWA 3RC4A 1J8AA 2VVVA 3MYWA 1EUFA 1ZYOA 5TCAA 4YLUA 1NZQH 2XC4A 1L0ZA 2HPQH 4FUFA 3BEIB 4LXBH 3SN8A 3ZZ8A 2BVRH 1SGQE 1AVGH 5DK1A 1NFWA 1F0RA 1GHYH 1TX6A 4F49A 5CE1A 3RXLA 3ZV8A 5EQSA 1GCTB 4FVBA 2GKVE 2ZDMA 3A7ZA 1HAZB 1GMDF 1GHWH 4XSKU 1IQKA 3SJIA 2B7DH 1QJ1B 1CQQA 2XC5A 5EQRA 3UQOA 3UWJH 4TY7A 3BIUH 3T29A 3GICB 5HM2A 2BMGB 1AWFH 1B5GH 3K6ZA 3ZVBA 3RXDA 2V0BA 4X1RU 1O3GA 4NGAH 4NCYA 4WJG2 1ZLRA 2BD5A 1GBKA 3ATKA 1GJ7B 1UHBB 4ABIA 2IPHA 2FOEA 1EP6A 4BXSA 3M7UA 3B8JA 4NIWA 1GHAG 2VH6A 4ASHA 1F5LA 1BTYA 4E05H 4CRCA 9ESTA 2BVSH 4E7NA 5HXFA 1B0EA 4MTBA 1EOLA 2O8MA 3IG6B 1W10U 2PKSC 4DGJA 1YLDA 2DE9A 6CHAC 4A7IB 4XDEA 1LPKB 2QXHA 1C1MA 3PMBB 4CH8B 1W7XH 3GYLB 4WF8A 2NWNA 3RC6A 1IQEA 2PUQH 3MFJA 1F0TA 2GV7A 2D2DA 2YOLA 2ALPA 4J2YB 3EA9A 1SGYE 1G3BA 5DG6A 4A5TS 1HIAA 2WPMS 2P8OC 4HZHA 1HRTH 4NIXA 5EW2H 1O37A 1OWKA 3DHKH 1QL7A 1AMHA 2XC0A 4Y0YE 3ZVFA 2FTLE 1W2KH 1IHSH 1V2MT 1K9OE 2SFAA 2ZGBH 1YLCA 1XVMA 2FOMB 1QA7A 1JWTA 2Y5GA 4NFEA 1AVWA 4KKDA 3LDXH 4K1SA 3A81A 3TH3H 1Z6JH 1BQYA 3ZZCA 3U9AH 1YPKH 2FPZA 2BD4A 3AW0A 2O8UA 2HPPH 2XBVA 3LOXA 2BDCA 1HLTH 2PTNA 1ZMLA 2ZCHP 1QGFA 4AG2A 1PQ5A 3OYPA 2ZU2A 5A8YA 1DLEA 1LQDB 3OY5U 3FZZA 2J4IA 3SNAA 3E6PH 3EDXB 1BDAA 1Z6EA 2A7CA 4UDWH 1TFXA 3ATLA 3BF6H 5C5NA 1UK2A 1KTTB 1OSSA 4X0WU 4D9RA 3H5CB 4Z6AH 3RXFA 2BM2A 2OLGA 1PPHE 5FX6A 2Q6FA 1K1OA 3KGPA 2I6QA 1YPJH 1ZPZA 2BHGA 2BB4A 2JKHA 4LZ4B 3R3GB 4MNWA 4O3TA 5C1YA 2H1UA 1SHHB 1M9UA 3QTOH 2FTMA 2AMPA 3O8DA 1FIWA 2PLXA 2F9NA 3E3TA 1YPEH 4KTSA 3EGKH 2HVXA 4X8TH 4NG9H 2DE8A 1UCYH 1XUHA 1ANDA 3SV9A 3RXQA 1O2OA 1C5TA 1XUJA 3NK8A 1GVLA 4YLQH 4YO9A 1ZSKA 1FN6A 1LVYA 1H9IE 1AU8A 1AZ8A 2FLRH 2GT8A 2FI5E 4BAQB 1K1IA 2FOFA 1UTKA 2QF3A 1AD8H 1YCPM 2ZHQH 1LVOA 3A86A 4PROA 2J92A 5C2ZA 1TBZH 1QRWA 1JOUB 4FUJA 4XFQA 1RTFB 2JH0D 1UTJA 1WTHD 2P16A 1IQLA 2QYIA 2Y81A 3BTME 3RXGA 2WPLS 3WY8A 3LGWA 3QO6A 3STIA 1IQJA 1IHTH 4FUBA 3M5NA 2OC1A 1O3LA 4CBNA 2FS8A 1YCPH 1LHGH 2BY8X 1MTNC 3SQHE 1FMGA 1BHXB 1ELDE 3NKKA 3MNSA 5LPFA 2ZU1A 1HJAC 2WUBA 3HPTB 4CR5A 2PWXA 3P92A 3RUOA 2CMYA 4UFFH 4MDSA 4I8KA 1WSSH 2R3YA 1OX1A 2AIPA 3SUEA 3M5LA 4GHQA 5C20A 3UOPA 3QLPH 3MWIU 1P3CA 2EC9H 3SNBA 1KYNA 1ZPCA 3RXOA 1Z8RA 4WXVA 1MD8A 2Z9GA 4MPVA 2GZ9A 2CGAA 1RTKA 1GI9B 4NIYA 2UWPA 1HAVB 3EYDA 4AN7A 1TGNA 1O3JA 2PTCE 3GYMA 1FI8A 3LGYA 1N8OB 2O8WA 1E36B 5JB9S 1Y5AT 2CXVA 1C5NH 5E2PA 3U98H 1GBMA 1MTUA 1O2LA 1GG6C 2XBXA 3Q3XA 2VIDA 3NXPA 2XNIA 4JZIA 3K6YA 2C8YB 3F9FA 1QA0A 1L2EA 3BTTE 1VGCB 2SNVA 1PYTD 2ZQ1A 2PGQB 2KAIB 4X2XA 3EE0B 3UIRA 1J14A 1ARBA 3GY4A 1L1NA 4AGJA 2G5NA 1D9IA 1O33A 4CHAB 2Z7FE 1EZXC 3BN9A 3TH2H 1HPGA 5JBBS 5JBTA 2XBWA 5C1XA 1HAPH 2AH4X 1SLWB 2RG3A 1Y3UA 2TIOA 1WAYB 5EG4A 1V2KT 1TRYA 2BLVA 1GI0A 5F6MA 3RXBA 4JZEH 2FYRA 2V3OH 4TPYA 3L3TA 3QN7A 2O8LA 2BD9A 1V2NT 3RXAA 5FAHA 1EZUC 1DLKB 4Y11E 1GHVH 1W0YH 1BBRK 2ZF0H 1XVOA 2ZHWH 1LQEA 1TPOA 2ZKSA 1CHGA 1OP0A 3GY8A 1BUIA 1FY3A 3E8LA 1S6FA 1BTZA 3LH3A 4I8GA 4JYTA 4Y71A 1T4VH 4H42U 1FN8A 3RU4E 1T7CA 1CVWH 2HGTH 3N7OA 5F8TA 3ENSB 1XUGA 3KQEA 1C4Y2 4UFDH 2CN0H 1K2I1 1LHCH 2ZGXH 4RN6A 2GT7A 4ISNA 1GHXH 4AORA 3VXEH 4X2YA 1EB1H 3LT3A 3FFGA 2ZDLA 2A5IA 1PQ8A 1SFQB 4NZLA 1P2MA 2ZFTA 4ZHAA 3PWBA 1P02A 4YOJA 3URCA 2HOBA 2BX4A 3U8TH 1NN6A 2FS9A 4NWKA 1ZGVA 2F83A 2XW9A 4ZHMU 1MTWA 1F0UA 3P70B 4DT7B 1UTLM 1XUFA 4FUCA 3PO1C 3SU6A 1OS8A 1THPB 4YM9A 2GMTB 2HALA 1NPMA 3RU4T 1O2NA 1HJ8A 3T5FH 4B76A 1K1LA 3NUMA 1GMCF 2VB0A 4ZROA 1UMAH 2AMDA 1QJ7B 1P8VC 5DJ7A 2QIQA 4LZ1H 1P57B 1QQUA 4Y7BA 5FXLA 5E0GA 2F9OA 2A4GA 1IQMA 3KIDU 1O2PA 4OS5A 4ZHLU 2A2XH 4BAMB 1FNIA 4ISHH 4NZQA 1H8DH 3I78A 1RXPA 3R0FA 1HAVA 1KDQB 4BAOB 1O2ZA 2G81E 2FI4E 3P6ZB 3SGBE 1RIWC 1OKXA 1TA2A 3SOSA 3AAVA 1ZTJA 3SW2B 1O5BB 1P01A 3S9BA 2YNBA 1NM6A 2BXTH 2GZ8A 1UVUH 1UVSH 1O3BA 1DWBH 1Z8IB 3UR6A 4FXGH 1YCPK 4CRAA 1SB1H 4R0IA 1TNGA 1TB6H 1DWCH 1DPOA 4THNH 1SGNE 1WUNH 1GPZA 1TABE 4BTTB 3BTGE 3ZVAA 4DJZB 1TX8A 1MZDA 1O2GH 2UUFB 1NS3A 1DUEA 3KL6A 5DGJA 5C1UA 1HJ9A 1PFXC 2GDDA 1OWJA 1UHBA 2G51A 1T8NA 1BT7A 2FOBA 3GY2A 2PW8H 4DCDA 3ZVGA 1GDNA 2QXIA 1JBUH 2VWNA 1N8OC 2SGEE 1C5WB 3UNQA 1ESTA 4JZDH 1CO7E 1S82A 1G3CA 4QT8C 3PWCA 2OC8A 1ZHPA 5FCKA 3SU0A 3TNSA 1WTGH 2VWLA 3ZZ9A 1SGRE 3LJJA 1B7XB 1X7AC 2JETC 1ANCA 1NC6A 2CV3A 1O2WA 2P93A 4MG3A 3AVZA 4WWYA 1SBWA 4UEHH 1EB2A 1OWHA 3M61U 1DANH 5ESTE 2ODYB 1QHRB 2AGIX 4CRGA 1W11U 3E16B 4ISLA 1C1UH 1O3HA 1GBEA 1MKXK 2GTBA 2GP9B 2G52A 3STJA 3SV8A 1NRPH 1Q2WA 1O30A 1C1VH 1V2PT 2C8ZB 3PB1E 3MO3A 3RXEA 5EODA 1QB9A 2R2MB 1EATA 1MTSA 1YPHE 3TIUA 2BOKA 1WV7H 2G5VA 1DS2E 1HAOH 2IJOB 3U1IB 5AFZH 3FANA 1EXFA 4DIHH 3F9HA 1GBIA 1O2HA 5DP9A 4D7GA 2XWBI 4OS1A 2VVCA 4AB9A 3BTQE 4CRBA 1C5UA 4B1TA 3GOVB 1A0JA 3SUGA 2FOHA 2BZAA 3RU4D 2HNTF 3TLOA 4SGAE 5T6FA 1WU1A 1FIZA 1Q3XA 3HGPA 1MTNB 4ABAA 3M7TA 4DG4A 5BPEA 4IC6A 1VITH 2QF0A 4BTUB 1VITG 3S0NA 5EPNA 3P8NA 1EAWA 3KN2A 3QGNB 1C4V2 4YOGA 3TK9A 2FYQA 4U2WA 5F03A 1MD7A 1Y3VA 4NIVA 1UVPA 1K21H 3Q00A 2BY9X 4NSVA 3MU5A 3V3MA 1FLEE 1P9UA 6LPRA 1O3KA 1V3XA 3KNXA 3RXSA 2XXLA 1GL1A 4YT7H 1T32A 3PLBA 4FU8A 3A7TA 4FVDA 2J9NA 1QCPA 1SGPE 1S83A 4MLFB 1HAIH 1BRCE 2Z9JA 3SHAH 3EAJA 3SHCH 3TK5A 4Y8ZA 2B9LA 3RLYH 2RA3A 1AO5A 5HYOA 6GCHF 1J9CH 5GJ4B 2ZP0H 4BTIB 5ABWA 1O2UA 2B8OH 4H6TA 1MCVA 4CH2B 1O2RA 1EPTC 4I8HA 3TITA 3ZZDA 1UTPA 2FXRA 1PPFE 1DSUA 1ACBE 1DICA 1SPJA 1TLDA 2PKSB 4ZUHA 4FUEA 4AFSA 1MAXA 1SGDE 1AKSB 1DUAA 4M7GA 4X8VH 5DP7A 1O2YA 3TNTA 2LPRA 1HXFH 3UWIA 5A0BA 1J17T 1P2NA 2OUAA 3M5OA 1XXDA 2R0LA 2H9EH 3SORA 3RMOH 1VJAU 1C5LH 5AF9H 2PSXA 4JZFH 1ETSH 1P11E 2J38A 2VJ1A 4IMQA 1OYQA 5HMAA 4Y8XA 1JRTA 1C5YB 2SGPE 4AYVB 2ILNA 1O3PB 5F8XA 1LVBA 1UCYK 5AHGH 4RKOB 2NU2E 1ABIH 1LHEH 3ZZBA 5FBEA 1QY6A 4D76A 2H9HA 1W8BH 2JETB 1NU9A 4Y6DA 2BDYA 3ZZ5A 1C1PA 2Y5HA 4INKA 1AQ7A 1RTLA 1P2OA 2VIWA 1TNIA 1DSTA 4MNVA 1S0RA 3BEUA 3V0XA 1TNLA 3A89A 4JZ1A 3MNBA 1ZTKA 4GVUA 1THSH 3SU5A 1ID5H 5IDKA 1O3FA 4JYUH 1H1BA 1F2SE 2P8OB 1IAUA 1BTXA 1W12U 2CF9H 1GJ8B 3A84A 1BCUH 1BMAA 1BITA 2ODQA 2AS9A 4E7RG 1K1JA 5F8ZA 1GMDG 1ETTH 3LC3A 1ELCA 2CHAC 1MU8B 1EJAA 2GMTC 4WMFA 3SU1A 3VB4A 1E37B 2ZHFH 2GCTB 2ZPQA 1O2KA 2J2UA 2FP7B 3G01A 9LPRA 3SGAE 3HK6B 1O3AA 3S9AA 1C5PA 1UVTH 1TNJA 2R3UA 3Q77A 1YKTA 3BSQA 2P94A 4OS2A 4B75A 3PLKA 3A8CA 1C2FA 1A4WH 2Z9KA 4HFPB 1AI8H 1DY8A 4NA8A 4AFUA 1P06A 4J1YA 3E90B 3SV7A 4IN2A 3BIVH 3CS7A 3SJ9A 5EW1H 1WOFA 1C2HA 2FOCA 3PMAB 4WXIA 2Y82A 7KMEH 2AGGX 4TYDA 4KP0A 5GIBA 1GBTA 3A7WA 4I32A 5B6OA 2J94A 1P09A 2ZGHA 4HGCA 1V2TT 1C2EA 2STAE 1HJAB 1EKBB 2A4OA 2A0QB 1KTSB 3FP6E 2FOAA 5EPYA 5IYTA 2H2ZA 1J16A 4YZUA 1P2IA 2TGAA 1SVPA 2ZFSA