3MYWA

The bowman-birk type inhibitor from mung bean in ternary complex with porcine trypsin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCAANSVPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCAAAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSAYPGQITGNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWIQQTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title The 0.25-nm X-ray structure of the Bowman-Birk-type inhibitor from mung bean in ternary complex with porcine trypsin.
pubmed rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 51
structure length 223
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mywA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mywA02
4OS2A 2AGGX 1H8DH 1O3JA 2H1UA 4UFEH 4GUXA 1NESE 3GISB 1YLDA 1PQ7A 4A5TS 1C1PA 1DITH 1YCPK 1K1OA 3M37A 2EEKA 2IN2A 4R0IA 1C2EA 2R3UA 5GIBA 1FY8E 3K6ZA 4AYVB 1W2KH 2CMYA 3ATKA 1AKSB 3PTBA 2F9OA 1O37A 1PPHE 3T26A 5DP6A 3RP2A 3V0XA 1W7GH 2FYQA 3MU0A 4ISLA 4BAMB 4KELA 2P59A 3URCA 2Y7ZA 1GBBA 4WMFA 1TNHA 3SZNA 3PMJA 2PSXA 2J38A 1QRWA 1NZQH 4AFUA 1ZTLA 4NSYA 2FI4E 2VU8E 2CHAB 5I25A 1O5FH 2P3TB 2FXRA 2ZF0H 2FYRA 2BDIA 2GDEH 1PQ8A 1C5LH 1T4VH 1TPPA 1TX6A 5HMAA 4ABHA 1G32B 3A7XA 1ZR0A 2OP9A 4X1PU 1BIOA 1EASA 1Y5BT 4NFFA 5FX6A 1KSNA 1QRXA 1O5CB 4GHTA 3TU7H 2IPHA 3DD2H 1GJ6A 2FX4A 3UR9A 4RKOB 3SUEA 1GCTC 2BDAA 1YKTA 1YPJH 1XUIA 2BQWB 4A7IB 4CH8B 1GHAF 2FOBA 1AIXH 1NC6A 2J34A 3BEUA 1UHBA 1SGDE 3CS7A 4R8TB 4X2XA 4B1TA 4MDSA 2P95A 1FPHH 1O5GH 4X2VA 2Z9KA 1SGPE 1UCYH 2P3FH 3RXLA 1C2IA 2ZGHA 1SC8U 2A1DB 3MH4A 2AERH 1C5OH 1S0RA 1SFIA 1LPZB 4B76A 1IHTH 1TALA 3E91A 2I6QA 1C1OA 3SV9A 1C5MD 4AX9H 4ZMAH 1O2SA 2BXUH 4ABAA 2HPPH 1OWIA 2OXSA 1O0DH 2AYWA 1TPAE 1VITF 1P12E 3PLKA 1LMWB 2SGFE 3QGNB 1THPB 2A4GA 3A8AA 1BUIA 4THNH 3QTOH 3VXEH 3PV4A 2OQ5A 1DXPA 3FAOA 1GDQA 1CA0B 1P10A 2ZC9H 4O3UA 4Y8XA 5EG4A 4RN6A 3GY2A 2WPKS 1CGIE 1OKXA 1TIOA 2J4IA 2ZFTA 3A81A 1O2JA 2ZEBA 4BAQB 3MU5A 4KTUA 2ALPA 4HZHA 1UTOA 3BEIB 4GHQA 2XC5A 1MTSA 5C1UA 1M9UA 2VIWA 2AMQA 2SFAA 3SV6A 1AE8H 4WJG2 2A7HA 1F0RA 1GBFA 3A7TA 1IQIA 3MH6A 1ELCA 4PROA 4AB8A 1O39A 1P9SA 2OLGA 4JYVH 1LKBA 2HNTC 4CRGA 5JBBS 3A7VA 1NRNH 4K1EA 6CHAB 1C5QA 1SGCA 1O2WA 1GBTA 3ZYEA 1A61H 1V6DA 2PTNA 2ZIQH 4CR9A 1SQAA 4FU7A 1DE7H 2HALA 1K1LA 3SHCH 1J17T 2EA3A 1JRTA 2PGQB 1C9TA 1UTNA 1MU6B 9ESTA 3RC6A 2HRVA 1BJUA 5JPMH 1WCZA 4RKJB 2GP9B 3UFAA 3A83A 2C90B 5FBEA 9LPRA 1BRAA 2ZGCA 1FAXA 2PGBB 4WWYA 5E2PA 3RXKA 4JCNA 1HAVA 1EATA 1D3QB 1DLEA 5FPSA 2GZ8A 5E0HA 2WUCA 2VH0A 4E06H 2H5CA 4OS7A 4FUFA 1DOJA 1YYY1 1NFXA 2FTLE 1O38A 2WPHS 3RXCA 1XXFA 2PWXA 1TB6H 3VB6A 2Y5HA 3MO3A 1TABE 4IMQA 1TMUH 2XC4A 3HGNA 4FUJA 3M7QA 2F3CE 1VGCB 2ZHDA 5T6GA 1HDTH 5DP7A 1O2MA 2BB4A 3P8GA 2BLQA 2ODYB 1GVZA 3W94A 1PYTC 5A8YA 2ZWLH 5FAHA 2QXJA 2VIOA 2Z3DA 4IS5A 3SU5A 1BBRH 5A8ZA 4WY3A 1G36A 5C20A 1SOZA 1TX7A 3U98H 5EGMA 4D7FA 4ZXXH 3UNQA 1XMNB 2Z7FE 1ZLRA 2ZGJA 1EZUC 2JH0D 4XSKU 1PPEE 3ZZ9A 1O3MA 3SU1A 1RIWC 5F8ZA 3RM2H 1Y3XA 2GKVE 2BY5X 2UWLA 2ZDMA 3QLPH 3M5LA 3KQEA 1GJ7B 4AGKA 1GVLA 2SGQE 4F4OC 3BTWE 1TA6A 1WUNH 1BT7A 3MYWA 1V3XA 2QV1A 3SJKA 2BLOA 1X7AC 5GJ4B 4ZKNU 1C5NH 1UK3A 2PV9B 1EAUA 3TNTA 1SGTA 1V2QT 2BOKA 1GCDA 4GPGA 2H9TH 1P01A 4Y0YE 1UO6A 2QC2A 4D9RA 1G9IE 2BXTH 3MH5A 1O5AB 2G51A 1Z71A 2GGVB 4K8YA 2BOHB 1O2GH 1Z8GA 1O3AA 2O8UA 3SI4H 3TH4H 1HLTH 5FPTA 2FDAA 4CRAA 1O31A 1UHBB 3ZVFA 2TGAA 2GZ9A 3MU4A 5EQQA 4AOQA 2ESTE 1CA8B 1QL9A 1TWXB 2FOMB 1V2JT 1AU8A 3QTVH 1TNJA 1C4Y2 1BQYA 3CENA 2BYAX 4BTUB 3P6ZB 8LPRA 1SGQE 1GCTB 2R0LA 1MKWK 1MU8B 2THFB 4AFQA 1SHHB 2FOAA 2Z9GA 1N8OC 3LU9B 4ZHMU 5HYOA 1ELVA 1QY6A 4U2WA 1GBDA 2KAIA 1C5TA 2FX6A 1VCPA 3Q76A 1AQ7A 4I8GA 2UWOA 1SB1H 4UFFH 4UD9H 1YP9A 2HVXA 2PHBA 1MTVA 3M5NA 1Y59T 2VIQA 3MOCA 1V2MT 1DS2E 3RM0H 4I7YH 2WPMS 4DURA 3MU8A 4XBCA 3OYPA 2DE8A 6GCHF 1HJ9A 1MTUA 1GG6B 3OY6U 3GY5A 2VVUA 4CR5A 1C9PA 3A8BA 1WV7H 1XM1A 2GMTC 4JZ1A 4NCYA 1ELFA 1VCWA 1Z1IA 2R0KA 1JBUH 2FS8A 2P93A 2ZU2A 1A1RA 4RSPA 1GMCG 5FBIA 3NCLA 5GCHF 3ZV8A 1H9LB 2VVCA 5C1YA 2BY7X 2FOFA 2SNVA 1CBWC 1BRUP 3ZV9A 3ZVBA 3T27A 3GCNA 2H6MA 4ABFA 1CHOF 5CMXH 1IHSH 3DA9B 2NU1E 2SNWA 1FQ3A 1P2QA 5H4IB 3ATLA 1KXBA 2B8OH 5DKMA 1NU9A 5BPEA 3H7TA 5FPYA 1SLUB 3GY3A 2AIPA 3UTUH 3SGQE 5FXLA 3RXHA 3MO6A 4IC5A 1CO7E 1ELEE 5AFZH 1GHBF 4H6TA 1KTSB 4IN1A 3LGIA 1UVOA 1QNJA 3EA7A 3KHVA 1K2I1 1V2VT 2ZTZA 1LVYA 4UEHH 4MTBA 5TCCA 4ISOA 2XXLA 1K1IA 5GPIB 1TQ0B 1K21H 3SUGA 5BRRE 4SGBE 3RXFA 2XC0A 1T32A 2AEIH 3HK6B 3UPEA 1G2MA 2BHGA 4OS1A 1ZOMA 1GBHA 2QF3A 2OC8A 4IN2A 1XVOA 1SMFE 1BZXE 4AORA 1KLIH 3URDA 1IQNA 2VWLA 2Y7XA 3QO6A 1EPTC 1Z1JA 2ZZUH 1TMBH 3PYHA 1ZGVA 3STIA 4ZKSU 2BD9A 3L33A 2BDYA 4NWKA 2ZI2H 4OS4A 2OBOA 1GJ8B 4DJZB 3NK8A 2ILNA 1CQQA 4J1YA 2QA9E 1SI5H 2CF9H 2BVSH 3RC5A 1Y5AT 5HM9A 1EPTA 1P02A 1UCYK 2JKHA 4KTCA 1JRSA 3DT0H 3ATWA 1UVPA 4GSOA 2K1QA 1ZTJA 1TBRH 4K1TA 1GWAA 3LPRA 1XX9A 3M61U 1OWDA 5ESBA 3LDXH 3F68H 1TNIA 4CBOA 2BD8A 3N7OA 1QJ6B 2J95A 4ESTE 2ANWA 3H7OA 1BTYA 2AMDA 1BHXB 5HM2A 1SVPA 1YPEH 1RIWB 1C1VH 1MAYA 2OBQA 1RTKA 4FXGH 1E36B 3VGCC 2PSYA 2QF0A 2Q1JA 1A4WH 2FIRH 5C3NA 1QCPA 2A7CA 1DSUA 1W0YH 1XUFA 5IDKA 4HFPB 1O2TA 1DX5M 4B74A 1ARCA 3KQCA 2CGAA 3A7WA 1MCVA 1KYNA 1THSH 2C3SA 2ZO3H 1N6XA 4B2BA 3KNXA 4X1RU 4AFZA 7GCHF 1EB1H 3OY5U 3RXGA 5DP8A 3K2UA 1ZHRA 4ZXYH 1CT2E 1AY6H 2RCEA 2FODA 2G8TA 3BTDE 1YLCA 1C2LA 4OS5A 3KGPA 3RLWH 1XUGA 1B0FA 1TGBA 6ESTA 2RA3A 1NTPA 3K6YA 4TY7A 3EYDA 1LPKB 2KAIB 2NWNA 1W12U 1C2JA 2BX4A 1HXEH 4Y7BA 5A8XA 1DM4B 2F91A 1QGFA 2EI7A 3AVZA 1PJPA 3LJOA 2A5AA 3E0PB 5DP9A 1KTTB 4LOYH 3SUFA 3KEEA 1MD7A 2FI3E 3LOXA 5F8XA 1N8OB 4JZIA 1ESTA 4DCDA 1ZRBA 1J15A 3V3MA 3RU4D 1TYNA 1TOMH 2W3IA 2ZHFH 3OSYA 3PMHB 1OP2A 1V2NT 4CBNA 3SU3A 3TITA 2UUFB 1HCGA 1RXPA 2BY8X 3BTFE 1WQVH 3I78A 1QIXB 1GBCA 2XW9A 4MNVA 1DDJA 4YESB 4MVNA 1UTMA 2AH4X 2D2DA 1UTKA 1GHZA 2B5TB 2ZCHP 3CP7A 1YCPM 4ISIH 3L3TA 2C8YB 2DE9A 2VWOA 2XTTB 1ZYOA 2GVFA 1SQTA 3NPSA 2A4OA 1C5UA 3A84A 2BTCE 5ESTE 2HNTE 5C67A 1UTQA 3GCTF 5GDSH 1ETSH 4VGCB 1AI8H 3JZ1B 3LIWA 1IQFA 1QB9A 2ZGXH 1P11E 2P8OC 1QB1A 2GMTB 2O9QA 3V7TA 1ABIH 3EA9A 5F03A 2M5TA 1AUTC 1O2VA 3QUMP 2BM2A 4Q7ZA 2ODQA 1GVKB 4NIVA 1CGJE 1ELTA 3UNRA 3BTTE 1UVUH 2H2ZA 1CBWB 1EOLA 1JOUB 2TIOA 1HUTH 1GHVH 3SV2H 1HAZB 1J14A 3ZZDA 1RTFB 2UUJB 1K1JA 1GHAG 1EB2A 2NU3E 5CE1A 4XE4A 2HLCA 5T3HA 3QGJA 2FMJA 2H9HA 2Z3CA 1LTOA 1Z6JH 1Y8TA 2GD4B 1PPBH 4ZROA 1S82A 2GZ7A 1GDUA 1WBGB 2VNTA 1AFQC 1LVMA 2NU2E 4FUIA 1C5VA 2FPZA 4X8VH 4I8KA 4NGAH 5JBTA 1K28D 3LGTA 4FUGA 4TPYA 2Q6GA 3S69A 4NA7A 4UONA 4F49A 4ZKRU 1WTGH 4H42U 2ZFSA 2F9NA 4MNYA 2HWLB 3MTYA 7ESTE 3S7HB 3O8RA 3RU4E 1L2EA 1VITG 1RS0A 3ZZ6A 4UE7H 2P94A 3SQEE 2V0BA 1CGHA 3BTGE 4YT7H 1A3EH 4K2YA 1GJ4H 3ZVDA 1O2UA 1Q31A 2WV4A 1EPTB 3NXPA 1OYTH 4A1XA 1P2MA 1IQKA 3MMGA 1O3EA 5JDUB 1ELDE 5E0JA 4TPIZ 1T4UH 5ABWA 2ZU5A 3TIUA 2B0FA 3RMNH 1C1UH 1EZSC 2VIPA 5EW1H 1DWBH 1ID5H 3BG4C 3RMMH 1LVBA 3MNXA 3SU6A 4AN7A 3E0NB 4IGDA 4Q80A 2ZA5A 4TWYA 1ZSLA 4NA8A 2XBXA 3ODFA 2ZQ1A 1O2LA 4Q7YA 1V2KT 2LPRA 2G5NA 2QIQA 1N1LA 4Y10E 1FY1A 1O2IA 2XNIA 3A80A 1O5DH 2PKSC 2Z9JA 3S9BA 4ABJA 4M7GA 1HAYB 1O33A 3RXQA 1UTLM 3GY8A 2GDDA 1JIMA 5TCAA 2FO9A 1PPGE 3QWCH 2A2QH 1SBWA 1KXFA 1GI6A 1ZPZA 2F9PA 1D9IA 2ZCLP 4NG9H 1AGJA 3VGCB 2OC7A 1V2UT 2V35A 3ATMA 3LKWA 3SI3H 4U32A 3B8JA 3M7TA 4CREA 3MI4A 4DT7B 4A1TA 2F9UA 5A0BA 5EQRA 1EJNA 1A3BH 1UJ1A 2AFQB 2WUBA 4O9VA 4YLQH 1SG8B 1HB0B 2PW8H 3FANA 3PMAB 1TMTH 3ZZAA 1O3GA 3H5CB 3MFJA 3TJOA 1WYKA 3B23B 5EPNA 1C1QA 4E7RG 2TPIZ 1XUJA 1YGCH 3A8CA 2Y5GA 3BIVH 5EQSA 1H1BA 3PO1B 3PTNA 3V13A 2A32A 3QN7A 2VVVA 4X6PA 4ISNA 2YNAA 1JWTA 4CRFA 3STJA 2I6SA 3S9CA 2BD2A 2GCHF 1LKAA 1FN6A 4Q7XA 1GI9B 2ANMH 5DP5A 3AW0A 3RXEA 5DJ7A 4ASHA 4B71A 1O3HA 1YPKH 4BAKB 3BF6H 3U69H 3RMOH 1EQ9A 1TONA 4BNRA 1B0EA 5LPRA 4SGAE 1ZMJA 2FLRH 3M3SA 3HGPA 1OP8A 1ESAA 3A87A 1NT1A 2GTBA 1AB9B 1Z7KA 1TAWA 1AZ8A 1S0QA 1ETRH 3MU1A 3UY9A 1QQ4A 2VH6A 3RXIA 5JBAS 3EGKH 1KXDA 1ZZZA 1W3CA 4BXSA 5EW2H 2BVRH 3RXTA 1P2JA 4MPVA 3RXRA 1LHDH 4O03A 2F9BH 3TJNA 4K69A 4FUHA 5TJXA 4NIYA 1QTFA 2W7UA 4CH2B 2FZZA 3RXSA 2ZHWH 1BDAA 3TK9A 1BTHH 3D23A 1YF4A 2C8ZB 1SL3A 2P8OB 3U8TH 4Z6AH 2BD4A 2BX3A 1DWCH 3F1SB 4OS6A 5DK1A 1H9IE 1IQJA 4I8LA 2C8WB 4IBLH 1C4U2 4I31A 1LHCH 2ODPA 1G3BA 2A5KA 2FOEA 1QURH 1WSSH 1YC0A 4X6MA 4ABDA 1TX8A 3SJIA 2ZTYA 4GCHG 4KKDA 2G00A 1SSXA 1SGIB 2EI8A 1JIRA 2ZECA 1GI5A 2ZFRH 1Y3UA 2GT8A 2R9PA 4NA9H 4UFDH 4ZKOU 2WPIS 3SU0A 1GJ5H 5IYTA 1WOFA 1BOQA 1QQUA 1MQ5A 1K22H 1E35B 1F92A 3E1XB 1E38B 2A5IA 1AFQB 1VJAU 4NZQA 3P8FA 1NPMA 3F9GA 1D3PB 4BXWA 2FP7B 2FS9A 1CE5A 4YTAA 1YPGH 1V2RT 1P3CA 1SGEE 1G3EA 1SQOA 1W10U 3EA8A 3R0FA 3FP7E 3BSQA 4I32A 3TVJB 5I46H 1NFWA 1AVGH 1FIZA 1GL1A 2PTCE 1TGSZ 5A09A 1N6YA 1WU1A 4HTCH 1Y3WA 6GCHG 4Q2KA 1HNEE 4B2CA 3ATIA 3O8DA 1D4PB 1GI4A 1TGCA 1BMAA 1ZPCA 1BTXA 2VINA 1P8VC 2GCTC 1C1WH 1RGQA 1PPCE 4NZLA 4X8SH 1HAXB 4DG4A 4MNXA 3LGYA 1DY8A 4YOIA 5GCHG 4K3JA 2HGTH 3A7YA 2Y5FA 1CT0E 1O2NA 1BMMH 4ZHLU 1O36A 4A6LA 4ZH8A 1TRYA 4X2WA 1CHOG 3BG4B 3SW2B 1KXCA 5EXMA 4INKA 1ANEA 3F9HA 3ITIA 1MTNC 2RDLA 4YOJA 1GBMA 1HFDA 1GMHF 4JYUH 1SOTA 2C8XB 3A8DA 1DPOA 2R3YA 2JETC 5E0GA 4IMZA 2TGDA 2BDHA 2PKSB 4ABEA 1A5IA 5EU8A 3KCGH 1GHBG 1PFXC 1QHRB 3FP8E 2BD5A 2A0QB 1FN8A 4K60A 3GOVB 3NUMA 1QL7A 4DGJA 3TLOA 3SNEA 3DFJA 1BA8B 1ZGIA 1EZXC 2ZDVH 3PM3A 1C5YB 2OINA 1O35A 2BLWA 2RG3A 1C5PA 5B6OA 1SGRE 4TWWA 1GHXH 3U8RH 4DIIH 3K9XB 1AZZA 3HKIB 1GMDF 1LHGH 1QL8A 1ZJDA 5FHTA 2ANYA 1HAVB 1Z8JB 1TOCB 2PLXA 1FY5A 1V2OT 4HGCA 2D8WA 1GJBB 3SJOA 3SV7A 1GI2A 1EP5A 2O8MA 2ZU1A 3UIRA 4B2AA 1W0ZU 2XRCA 3RU4T 2TGTA 1O2PA 1IQHA 2TBSA 2QXHA 3VEQB 1QJ1B 4X1NU 3G01A 3FVFB 2VIDA 1BTZA 1FY3A 3ZZBA 1Z6EA 1PQAA 1OWEA 2QXIA 1JXPA 2FTMA 3QDZB 3IWMA 3SORA 1AFEH 4D9QA 3LH3A 4MNWA 3GYLB 1S85A 2AIQA 1MBMA 1TPOA 1TQ7B 1T7CA 3CS0A 1A46H 1YPHC 1MQ6A 1OXGA 1ZRKA 5DPAA 3VB4A 1UCYE 1MKXH 4D8NA 1GJ9B 2BQ7B 3ZZCA 3JZ2B 1GGDC 1HAPH 1T8OA 4K1SA 1J16A 3O8BA 5AHGH 3PLPA 3EE0B 3GY4A 3E90B 5CHAC 1LVOA 2XWAA 1NFYA 1O34A 8GCHF 5FX5A 2XWBI 3VB7A 7GCHG 1EKBB 1CA0C 1K1NA 2ZDAH 2QGRA 4X6NA 1GBEA 3ENSB 1AVXA 2A2XH 4Y8YA 1VCQA 4B73A 1KIGH 3BIUH 2Y81A 1TBQH 3RMLH 2VJ1A 1J8AA 1L1GA 1OWKA 3RC4A 3E3TA 2B9LA 3VXFH 1ZHPA 5T6DA 1C2HA 1UVTH 2OQUA 3BTKE 3WY8A 4MPWA 1A7SA 3TPIZ 2QN5T 1DANH 1V2LT 1QA0A 2QXGA 4X1QU 5ETXA 3M35A 1MH0A 3BV9B 4H4FA 1SLXB 2ZPSA 3W95A 1EX3A 2V3HH 1KLJH 1BITA 1O3IA 2ZFPH 6CHAC 3ZZ5A 2J2UA 1FAKH 1VJ9U 1BTUA 1QA7A 1NRRH 3Q77A 1O2HA 2WYGA 5JB9S 4CHAC 1G30B 4CRBA 1C5RA 4O3TA 3GYMA 1GDNA 1HIAA 2FI5E 3PROA 1A0LA 1BB0B 4K8BA 3RDZA 3SNCA 2OUAA 5C5NA 3K65B 2Z3EA 3GCTG 1C1MA 3HATH 1GJDB 2H9EH 3I77A 4Y71A 4FVBA 3T5FH 1PYTD 3LC5A 3LJJA 3ZVCA 4YZUA 5L2YH 3AASA 3RLYH 1MBQA 1ZTKA 2G4TA 3BG8A 3V12A 4XBDA 3ZZ7A 2O8TA 1TGNA 4XBBA 1EJMA 2ALVA 1AN1E 1P04A 4Y7AA 2IJOB 2OC1A 1SGYE 1RTLA 1S5SA 2Q6FA 3UWJH 3KIDU 1VGCC 4AG1A 1G37A 1MZAA 1QBVH 1XKAC 8KME2 3SGBE 1O2RA 2P3UB 3GY6A 3TGKE 1ELBA 4YO9A 1O2KA 1SFQB 3LT3A 4I33A 3TGJE 1GI0A 1MTNB 3LC3A 1JMOH 1T8LA 1F7ZA 2ZCKP 5L2ZH 3VPKA 1MTWA 1SR5C 5JYIA 1BHXF 1A5GH 2JETB 3SU4A 1E0FD 4WH6A 5GWZA 2OC0A 5L6NH 4WMEA 1RD3B 1BBRE 4UFGH 1EAWA 2YNBA 3ZZ4A 5J4QA 4GVUA 1BBRK 1W7XH 3I29A 5AFYH 4WMDA 3SV8A 1C1NA 2ZTXA 5G4BA 4E05H 1KDQA 1EJAA 4NWLA 2BD3A 3SNAA 2WPLS 1V2ST 1C2DA 1L4DA 3SN8A 2SGEE 2ZDKA 1GBLA 3UOPA 3ZVAA 2J92A 3EDXB 4AB9A 3QZQA 1NRPH 2BQ6B 1TNKA 4Z0KA 1MAXA 3ZZ8A 2GT7A 1FXYA 3TH3H 2C4FH 5AVDA 2XYAA 1EOJA 4MPUA 1KLTA 1IAUA 3SJ8A 1ORFA 3BTHE 1ZJKA 1AE5A 1P2IA 2A31A 3DHKH 5A0AE 5EXLA 4NIWA 4X0WU 3E8LA 4BTTB 4U30A 2A45B 3D49H 2XBWA 4O97A 3MWIU 4YLUA 2QAAA 1LPGB 1DXWA 1C5WB 5EODA 1THRH 1C2MA 1GJCB 2FM2A 4FUBA 1DFPA 3BTME 2SGAA 2BY6X 3D62A 1XUKA 3SJ9A 2B7DH 1ELGA 4HI3A 3LH1A 4AG2A 2ZQ2A 4U01A 3UREA 2BD7A 1P57B 1UTJA 4Y11E 1S6HA 3RXUA 1Y3YA 1TRNA 1INCA 1DLKB 5DG6A 1QBNA 1FMGA 3QK1A 3SU2A 2EC9H 3MO9A 1ZMLA 1H9HE 1B7XB 2Z9LA 4JYTA 2VWMA 5T6FA 1O3PB 5DP4A 2FOHA 5AF9H 3LGWA 5E8EH 5JB8S 1S6FA 4BANB 2G5VA 4BAHB 2D1JA 4BOHA 4FVDA 1O2OA 1BRBE 1V2PT 4IW4E 2SGPE 3SUDA 1QJ7B 3FFGA 3Q00A 3GICB 1F5KU 1FPCH 1C5ZB 4TY6A 1WQSA 3MHWU 1O3OA 3VFEA 1QB6A 1LHEH 1ELAA 1GGDB 1Y3VA 2ULLA 3ZVEA 1KY9A 4FU9A 4J2YB 1MMJN 5GXPA 1AO5A 5CHAB 1GI8B 5LGOA 1FLEE 3Q3XA 1GG6C 2ZHQH 1BTWA 3T28A 2VB0A 3ZVGA 1O5EH 2IOTA 5JBCS 4YM9A 1NY22 2CN0H 1UVSH 2CF8H 3ESTA 4LXBH 1ANBA 3QX5H 4DY7B 2BVXH 4DW2U 2HPQH 2A7JA 4ISHH 1HXFH 2ZFFH 2EI6A 3RXPA 2QYIA 2ASUB 1ZSKA 4MG3A 2GCHG 1OWJA 2GV6A 5FCKA 3F6UH 3SBKA 1RRKA 5C1XA 1CT4E 3D65E 2ZHEH 4Y79A 4XDEA 2ZP0H 1F5LA 3S0NA 1P2NA 1HJAC 1O3DA 1EAIA 3PWCA 1U6QA 1C5XB 5E2OA 4AFSA 1F0UA 1CHGA 1Y5UT 1HIAB 2W26A 1UTPA 1YM0A 1GI3A 3ZYDA 5K0HA 1FV9A 2ZG0H 2BZAA 2P16A 1UK4A 1E34B 4X2YA 1LCYA 1A2CH 2FLBH 2WYJA 4JZFH 2WINI 3AAVA 1XXDA 1PPZA 1KXAA 2XCFA 4QT8C 1BTPA 2ZDNA 1IQGA 3A82A 2V6NA 3AAUA 3T2NA 4NFEA 1HAOH 4CHAB 2QCYA 1Z8RA 1O5BB 2BMGB 3OTJE 3MH7A 1DUEA 4JZDH 3SGAE 3TH2H 5F8TA 1C1TA 4Y6DA 1A5HA 1WAYB 2STAE 1S81A 4OGXA 2BDCA 2NU0E 4X8TH 4YOGA 4BTIB 2G52A 3KF2A 1ETTH 3Q3KA 1NN6A 3RXMA 1FY4A 3DUXH 2PR3A 1ZMNA 1GJAB 4K5ZA 1YCPH 1ACBE 2VIVA 1QBOA 1H8IH 4DVAU 1MUEB 1P9UA 2F9VA 1YBWA 2BY9X 1MZDA 4NIXA 4INLA 3VB3A 1H4WA 1O3BA 2GX4A 2WV5A 1Q2WA 1HYLA 1D3DB 1O2YA 1IOEA 4ZUHA 3GCHC 1KDQB 1OPHB 1SLWB 2F83A 1C1RA 2J9NA 2UUYA 1HJ8A 4MLFB 3KN2A 1F2SE 2BZ6H 1V2WT 1O2QA 1P03A 3R3GB 4AZ2B 1FDPA 5EXNA 3GDSA 3EQ0H 5FCRA 1E37B 1MKXK 1SHYA 4Y76A 4JK6A 4I8HA 4Y0ZE 5DGJA 1GHWH 4BAOB 1GI7B 2W7SA 1W14U 5C2ZA 1SLVB 1EP6A 1YPMH 2A4QA 2J94A 4FU8A 1HAIH 3U8OH 4LK4A 4MQAA 1ZSJA 1AHTH 1O3FA 2JH5D 3E16B 3O8CA 3QZRA 2VGCC 1B5GH 2FWWA 3M3VA 2ZDLA 2YOLA 1SGFA 1L1JA 1BRCE 3EAJA 2BDBA 5L30H 1FI8A 3KQBA 1O3NA 3UUZA 1MCTA 3P8NA 1D6RA 2CXVA 1FIWA 3C1KA 3GY7A 3TJVA 1O3CA 3OX7U 1LDTT 3UNSA 3M3TA 1LHFH 4LZ1H 3FZDA 1CSOE 4YT6H 1C2KA 1A0HB 2R2WU 3TK5A 2QY0B 3PMBB 1YPHE 1C5SA 1CU1A 2WPJS 5HGGA 1GBJA 3Q3YA 3A88A 1AMHA 1WTHD 4WF8A 2W3KA 3UQOA 4NSVA 2PKAA 3T62A 4WXVA 4GCHF 4X6OA 1D6WA 3TJUA 1LO6A 3MNBA 4A92A 1W8BH 3P95A 4ABGA 1GMHG 1DICA 2Z9IA 3F9EA 2OCVB 1XUHA 4JK5A 3U1JB 3C27B 1NROH 1FZZA 1P2OA 1EXFA 1D3TB 3ZZ3A 1AVWA 3A86A 1P0SH 2BDGA 1K9OE 3UWIA 2H5DA 2ZU4A 1VZQH 4X1SU 3A85A 1K1MA 1NO9H 1Z8IB 7KMEH 1HAHH 1YPLH 1ZHMA 3B9FH 3SHAH 2Z94A 1MD8A 4KTSA 5A0CA 1W11U 1TNGA 5HXFA 4E7NA 2XBVA 2O8LA 3SO3A 2Y80A 4D76A 5LH8A 2AS9A 1GMDG 5C5OA 4CRCA 3S9AA 1DWEH 4VGCC 2ZPQA 4XOJA 3TGIE 1NU7B 2DUCA 1IQEA 3M5MA 4KGAA 1ANDA 3PLBA 5J4SA 1NFUA 2ZNKH 2XCNA 2G81E 2UUKB 1F0SA 1HV7A 1TNLA 3SNBA 1F0TA 3L6PA 4ZAEA 1CVWH 3MNSA 1OSSA 5EOKA 3GDVA 2GV7A 4H6SB 3IITA 1EUFA 2D26C 2C93B 1G3DA 3P70B 1HPGA 1P05A 2CHAC 1LQEA 2SGDE 1BJVA 2ANKH 2Y6TA 3RXAA 1VR1H 2R2MB 1HJAB 1AKSA 3E6PH 1DY9A 1GBIA 1O30A 3LONA 1Q3XA 4B75A 4ABIA 3BEFB 3S7KB 1FNIA 1TBZH 1OWHA 3GCOA 3RXVA 1BMNH 1GMCF 3DFLA 3TK6A 3NKKA 1HBTH 3KQDA 4JZEH 1FONA 1TFXA 4WVPE 1IQLA 2FOCA 1VITH 3MNCA 2ZFQH 2JH6D 3RXOA 2HOBA 1C2FA 4TYDA 1GPZA 4ZHAA 2PUQH 5SGAE 4LZ4B 4IC6A 2XBYA 3PWBA 1ABJH 1QFKH 2FEQH 1QRZA 4WH8A 1SPJA 1DUAA 1TPSA 3HKJB 4GAWA 3T25A 6LPRA 3FP6E 1O3LA 8GCHG 1T31A 5DO4H 1NRQH 3NWUA 1IQMA 3RXJA 2VWNA 4XFQA 5LPFA 1UK2A 3ELAH 4INHA 2FESH 1AWHB 4Y8ZA 1EZQA 1OS8A 1GBKA 3RXBA 1NRSH 1GI1A 1AWFH 1HAGE 1NS3A 2FOGA 1OX1A 3U1IB 5EPYA 1ZPBA 2O8WA 3M36A 3GDUA 1K1PA 1GHYH 1TA2A 1O2XA 1PPFE 1FUJA 1XKBC 1ANCA 2Z6BD 4X8UH 2ZPRA 4DOQA 3RUOA 3BTQE 1G3CA 2Y82A 3FZZA 1GBAA 1T8NA 3SQHE 3HK3B 1NM6A 1S84A 3PB1E 1AUJA 2CJIA 2BLVA 3IG6B 3UOUA 1RFNA 4AYYB 1DVAH 1RJXB 1BMLA 3GCHB 1C1SA 2ZKSA 1L0ZA 1TGTA 2ZGBH 4AGJA 4OGYA 4UDWH 3UR6A 5K7RA 3VB5A 2AGIX 4FUCA 2PUXB 3SNDA 1P2KA 3ODDA 2AMPA 2V3OH 5PTPA 2HNTF 1OYQA 1UMAH 3P8OA 2STBE 3P92A 2OD3B 1FJSA 4GLYA 2PFEA 2VGCB 3BN9A 4JMYA 1G2LA 4I8JA 1MKWH 2RA0A 7LPRA 1F5RA 4KP0A 1KXEA 4MPXA 2G4UA 3F9FA 1ESBA 3KL6A 1BCUH 2Q6DA 1L1NA 2PKAB 1DT2A 3TNSA 3T29A 2LNCA 3LGUA 1AD8H 3PO1C 4FUDA 3LGVA 1HGTH 1TE0A 5A2MH 2ZU3A 5LPEA 2A4RA 1GL0E 3SOSA 1A0JA 1J9CH 3BTEE 2W5EA 3M7UA 1V2TT 2CV3A 8ESTE 4WXIA 1L4ZA 1HRTH 3A7ZA 4ABBA 5F6MA 4CRDA 1DSTA 1TLDA 3A89A 1OP0A 2OTVA 1TRMA 4D7GA 1T8MA 4DIHH 3UQVA 3P17H 1SGFG 5DP3A 1O32A 2GCTB 2TRMA 3HPTB 3RXDA 1P09A 3NZIA 1W13U 1LQDB 2G55A 2AGEX 1PQ5A 1QR3E 1XVMA 1O3KA 2NU4E 1C4V2 1OOKB 1C2GA 1AB9C 3M5OA 1O2ZA 1S83A 3AW1A 3OU0A 2UWPA 1P06A 1EAXA 4FUEA 3U9AH 4A1VA 2TGPZ 1P3EA 1DWDH 1ARBA 1SGNE
chains in the Genus database with same CATH superfamily
4OS2A 2AGGX 1H8DH 1O3JA 2XNDD 2H1UA 4UFEH 4GUXA 1NESE 3GISB 1YLDA 1PQ7A 4A5TS 1C1PA 1DITH 1YCPK 1K1OA 2W6JD 2EEKA 2IN2A 3M37A 4R0IA 1C2EA 2R3UA 5GIBA 1FY8E 3K6ZA 4AYVB 1W2KH 5CHBA 2CMYA 3ATKA 1AKSB 3PTBA 2F9OA 1O37A 1WXRA 1PPHE 3T26A 5DP6A 3RP2A 3V0XA 1W7GH 2FYQA 3MU0A 4ISLA 4BAMB 4KELA 2P59A 3URCA 2Y7ZA 1GBBA 4WMFA 1TNHA 3SZNA 5C0UA 3PMJA 2PSXA 2J38A 1QRWA 1NZQH 4AFUA 1ZTLA 4NSYA 2FI4E 2VU8E 2CHAB 5I25A 1O5FH 2P3TB 2FXRA 2ZF0H 2FYRA 2BDIA 2GDEH 1PQ8A 1C5LH 1T4VH 1TPPA 1TX6A 5HMAA 4ABHA 1G32B 3A7XA 1ZR0A 2OP9A 4X1PU 1BIOA 1EASA 1Y5BT 4NFFA 5FX6A 1KSNA 3OTPA 1QRXA 1O5CB 4GHTA 3TU7H 2IPHA 3DD2H 1GJ6A 2FX4A 3UR9A 3W1EA 3FN8A 4RKOB 3SUEA 1GCTC 2BDAA 1YKTA 1YPJH 1XUIA 2BQWB 4A7IB 4CH8B 2J98B 1GHAF 2FOBA 1AIXH 1NC6A 2J34A 3BEUA 1UHBA 1SGDE 3CS7A 4R8TB 4X2XA 4B1TA 4MDSA 1FPHH 1O5GH 2P95A 4X2VA 2Z9KA 1SGPE 1UCYH 2P3FH 3RXLA 1C2IA 2ZGHA 2HVYB 1SC8U 2A1DB 3MH4A 2AERH 1C5OH 1S0RA 1SFIA 1LPZB 4B76A 1IHTH 1TALA 3E91A 2I6QA 5KECA 1C1OA 3SV9A 1C5MD 2JJ2D 4AX9H 4ZMAH 1O2SA 5B6LA 2BXUH 4ABAA 2HPPH 1OWIA 2OXSA 1O0DH 2AYWA 1TPAE 1VITF 1P12E 3PLKA 1LMWB 2SGFE 3QGNB 1THPB 2A4GA 2RFKC 3A8AA 1BUIA 4THNH 3QTOH 3VXEH 3PV4A 2OQ5A 1DXPA 3FAOA 1YLNA 1GDQA 1CA0B 1P10A 2ZC9H 4O3UA 4Y8XA 5EG4A 4RN6A 3GY2A 2WPKS 1CGIE 5EJ1A 1OKXA 1TIOA 2J4IA 2ZFTA 3A81A 1O2JA 3PV5A 2ZEBA 4BAQB 3MU5A 4KTUA 2ALPA 4HZHA 3GS9A 1UTOA 3BEIB 4GHQA 2XC5A 1MTSA 5C1UA 1M9UA 2VIWA 2AMQA 2SFAA 3SV6A 1AE8H 4WJG2 2A7HA 1F0RA 1GBFA 2IPQX 3A7TA 1IQIA 3MH6A 1ELCA 4PROA 4AB8A 1O39A 1P9SA 2OLGA 4JYVH 1LKBA 2HNTC 4CRGA 5JBBS 3A7VA 1NRNH 3DSOA 4K1EA 6CHAB 1C5QA 1SGCA 1O2WA 1GBTA 3ZYEA 1A61H 1V6DA 2PTNA 2ZIQH 4CR9A 1SQAA 4FU7A 1DE7H 2HALA 1K1LA 3SHCH 2GJGA 1J17T 2EA3A 1JRTA 2PGQB 1C9TA 1UTNA 1MU6B 9ESTA 3RC6A 2HRVA 1BJUA 5JPMH 1WCZA 4RKJB 3UB0A 2GP9B 3UFAA 3A83A 2C90B 5FBEA 9LPRA 1BRAA 2ZGCA 1FAXA 2PGBB 4WWYA 5E2PA 3RXKA 4JCNA 1HAVA 1EATA 1D3QB 1DLEA 5FPSA 2GZ8A 5E0HA 2WUCA 5FL7D 2VH0A 4E06H 2H5CA 4OS7A 4FUFA 1DOJA 1YYY1 3FOAA 1NFXA 2FTLE 1O38A 2WPHS 3RXCA 1XXFA 2PWXA 1TB6H 3VB6A 2Y5HA 3MO3A 1TABE 4IMQA 1TMUH 2XC4A 3HGNA 4FUJA 3M7QA 2F3CE 1VGCB 2ZHDA 5T6GA 1HDTH 5DP7A 1O2MA 2BB4A 3P8GA 2BLQA 2ODYB 1GVZA 3W94A 1PYTC 1NBME 5A8YA 2ZWLH 5FAHA 2KM0A 2QXJA 2VIOA 2Z3DA 4IS5A 3SU5A 1BBRH 5A8ZA 4WY3A 1G36A 5C20A 1SOZA 1TX7A 3U98H 5EGMA 4D7FA 4ZXXH 3UNQA 1KMHB 1XMNB 2Z7FE 1ZLRA 2ZGJA 1EZUC 2JH0D 4XSKU 1PPEE 3ZZ9A 1O3MA 3SU1A 1RIWC 5F8ZA 3RM2H 1Y3XA 2GKVE 2BY5X 2UWLA 2ZDMA 3QLPH 3M5LA 3KQEA 1GJ7B 4AGKA 1GVLA 2SGQE 4F4OC 3BTWE 1TA6A 1WUNH 2LELA 3MYWA 1BT7A 1V3XA 2QV1A 3SJKA 2LP6A 2BLOA 1X7AC 5GJ4B 4ZKNU 1C5NH 1UK3A 2PV9B 1EAUA 3TNTA 1SGTA 1V2QT 2BOKA 1GCDA 4GPGA 2J97A 2H9TH 1P01A 4Y0YE 1UO6A 2QC2A 4D9RA 1G9IE 2BXTH 3MH5A 1O5AB 2G51A 1Z71A 2GGVB 4K8YA 2BOHB 1O2GH 1Z8GA 1O3AA 2O8UA 1QZ8A 3SI4H 3TH4H 1HLTH 5FPTA 2FDAA 4CRAA 1O31A 1UHBB 3EE7A 3ZVFA 2TGAA 2GZ9A 3MU4A 5EQQA 4AOQA 2ESTE 3WWBA 1CA8B 1QL9A 1TWXB 2KR7A 2FOMB 1V2JT 1AU8A 3QTVH 1TNJA 1C4Y2 1BQYA 3CENA 2BYAX 4BTUB 3P6ZB 8LPRA 1SGQE 1GCTB 2QE7D 2R0LA 1MKWK 1MU8B 2THFB 4AFQA 1SHHB 2FOAA 2Z9GA 1N8OC 3LU9B 4ZHMU 5HYOA 1ELVA 1QY6A 4U2WA 1GBDA 2KAIA 1C5TA 2FX6A 1VCPA 3Q76A 2F4LA 1AQ7A 4I8GA 2UWOA 1SB1H 4UFFH 4UD9H 2KFWA 1YP9A 2HVXA 2PHBA 1MTVA 3M5NA 3OEED 1Y59T 2VIQA 3MOCA 1V2MT 1DS2E 3RM0H 4I7YH 2WPMS 4DURA 3MU8A 4XBCA 3OYPA 2DE8A 6GCHF 1HJ9A 1MTUA 5KEDA 1GG6B 3OY6U 3GY5A 2VVUA 4CR5A 1C9PA 3A8BA 1WV7H 1XM1A 2GMTC 4JZ1A 4NCYA 1ELFA 1VCWA 1Z1IA 2R0KA 1H8ED 1JBUH 2FS8A 2P93A 2ZU2A 1A1RA 4RSPA 1GMCG 5FBIA 3NCLA 5GCHF 3ZV8A 1H9LB 2VVCA 5C1YA 2BY7X 2FOFA 2SNVA 1CBWC 1BRUP 3ZV9A 3ZVBA 3T27A 4ASUD 3OEHD 3GCNA 2H6MA 1SKYE 4ABFA 1CHOF 5CMXH 1IHSH 3DA9B 2NU1E 2SNWA 1FQ3A 1P2QA 5H4IB 3ATLA 1KXBA 2B8OH 5DKMA 1NU9A 5BPEA 3H7TA 5FPYA 1SLUB 3GY3A 2AIPA 3UTUH 2KX4A 3SGQE 5FXLA 3RXHA 3MO6A 4IC5A 1CO7E 1ELEE 5AFZH 1GHBF 4H6TA 1KTSB 4IN1A 3LGIA 1UVOA 1QNJA 3EA7A 3KHVA 1K2I1 1V2VT 2ZTZA 1LVYA 4UEHH 4MTBA 5TCCA 4ISOA 2JDID 1MABB 2XXLA 1K1IA 5GPIB 1TQ0B 1K21H 3SUGA 5BRRE 4SGBE 3RXFA 2XC0A 1T32A 2EY4C 2AEIH 3HK6B 3UPEA 1G2MA 2BHGA 4OS1A 1ZOMA 1GBHA 2QF3A 2OC8A 4IN2A 1XVOA 1SMFE 1BZXE 4AORA 1KLIH 3URDA 1IQNA 2VWLA 2Y7XA 3QO6A 1EPTC 3UAIC 1Z1JA 2ZZUH 1TMBH 2M2AA 3PYHA 1ZGVA 3STIA 4ZKSU 2BD9A 3L33A 2BDYA 4NWKA 2ZI2H 4OS4A 4OM9A 2OBOA 1GJ8B 4DJZB 3NK8A 2ILNA 1CQQA 4J1YA 2QA9E 1SI5H 3F2HA 2CF9H 2BVSH 3RC5A 4RT0A 1Y5AT 5HM9A 1EPTA 1P02A 1UCYK 2JKHA 4KTCA 1JRSA 3DT0H 3ATWA 1UVPA 4GSOA 2K1QA 1ZTJA 1TBRH 4K1TA 1GWAA 3LPRA 1XX9A 3M61U 1OWDA 3PRDA 5ESBA 3LDXH 3F68H 1TNIA 4CBOA 2BD8A 3N7OA 1QJ6B 2J95A 4ESTE 2ANWA 3H7OA 1BTYA 2AMDA 1BHXB 5HM2A 1SVPA 1YPEH 1RIWB 1C1VH 1MAYA 2OBQA 1RTKA 4FXGH 1E36B 3VGCC 2PSYA 2QF0A 2Q1JA 1A4WH 2FIRH 5C3NA 4B6EA 1QCPA 2A7CA 1DSUA 1W0YH 1XUFA 5IDKA 4HFPB 1O2TA 1DX5M 4B74A 1ARCA 3KQCA 2CGAA 3A7WA 1MCVA 1KYNA 4ACBA 1THSH 2C3SA 2ZO3H 1N6XA 4B2BA 3KNXA 4X1RU 4AFZA 7GCHF 1EB1H 3OY5U 3RXGA 5DP8A 3K2UA 1ZHRA 4ZXYH 1CT2E 1AY6H 2RCEA 2FODA 2G8TA 3BTDE 1YLCA 1C2LA 4OS5A 3KGPA 3RLWH 1XUGA 1B0FA 1TGBA 6ESTA 2RA3A 1NTPA 3K6YA 4TY7A 3EYDA 1LPKB 2KAIB 2NWNA 1W12U 1C2JA 2BX4A 1HXEH 4Y7BA 5A8XA 1DM4B 2F91A 1QGFA 2EI7A 3AVZA 1PJPA 3LJOA 2A5AA 3E0PB 5DP9A 1KTTB 4LOYH 3SUFA 3KEEA 1MD7A 2FI3E 3LOXA 5F8XA 1N8OB 4JZIA 1ESTA 4I86A 3OE7D 1ZRBA 4DCDA 1J15A 4TSFD 3RU4D 3V3MA 1TYNA 1TOMH 2W3IA 2ZHFH 3OSYA 3PMHB 1OP2A 1V2NT 4CBNA 3SU3A 3TITA 2UUFB 1HCGA 1RXPA 2BY8X 3BTFE 1WQVH 3I78A 1QIXB 1GBCA 2QF4A 2XW9A 4MNVA 1DDJA 4YESB 4MVNA 1UTMA 2AH4X 2D2DA 1UTKA 1GHZA 2B5TB 2K0QA 2ZCHP 3CP7A 1YCPM 4ISIH 3L3TA 2C8YB 2DE9A 2YMSD 2VWOA 2XTTB 1ZYOA 1VKYA 2GVFA 1SQTA 3NPSA 2A4OA 2KCAA 1C5UA 2RDEA 3A84A 2BTCE 5ESTE 2HNTE 5C67A 1UTQA 3GCTF 5GDSH 1ETSH 4VGCB 1AI8H 3JZ1B 3LIWA 1IQFA 3DCLA 1QB9A 2ZGXH 1P11E 2P8OC 1QB1A 2GMTB 2O9QA 2XOKD 3V7TA 1ABIH 3EA9A 5F03A 2M5TA 1AUTC 1O2VA 3QUMP 2BM2A 4Q7ZA 2ODQA 1GVKB 4NIVA 1CGJE 1ELTA 3UNRA 3BTTE 1UVUH 2H2ZA 1CBWB 1EOLA 1JOUB 2TIOA 1HUTH 1GHVH 3SV2H 1HAZB 1J14A 3ZZDA 5GNDA 1RTFB 2UUJB 1K1JA 1GHAG 1EB2A 4AC9A 2NU3E 4XD7D 5CE1A 4XE4A 2HLCA 5T3HA 3QGJA 2FMJA 2H9HA 2Z3CA 1LTOA 1Z6JH 1Y8TA 2GD4B 1PPBH 4ZROA 1S82A 2GZ7A 1GDUA 1WBGB 2VNTA 3MQKC 1AFQC 1LVMA 2NU2E 4FUIA 1C5VA 2FPZA 4X8VH 4I8KA 4NGAH 5JBTA 1K28D 3LGTA 4FUGA 4TPYA 2Q6GA 3S69A 4NA7A 4UONA 4F49A 4ZKRU 1WTGH 4H42U 2ZFSA 2F9NA 4MNYA 2HWLB 3MTYA 7ESTE 3S7HB 3O8RA 3RU4E 1L2EA 1VITG 1RS0A 3ZZ6A 4UE7H 2P94A 3SQEE 2V0BA 1CGHA 3BTGE 4YT7H 1A3EH 4P00A 4K2YA 1GJ4H 5EJLA 3ZVDA 1O2UA 3WW7A 1Q31A 2WV4A 1EPTB 3NXPA 1OYTH 4A1XA 1P2MA 1IQKA 3MMGA 1O3EA 3KYGA 5JDUB 1ELDE 5E0JA 4TPIZ 1T4UH 5ABWA 2ZU5A 3TIUA 2B0FA 3RMNH 1C1UH 1EZSC 2VIPA 5EW1H 1DWBH 1ID5H 3BG4C 3RMMH 1LVBA 3MNXA 3SU6A 4AN7A 3E0NB 4IGDA 4Q80A 2JIZD 2ZA5A 4TWYA 1ZSLA 4NA8A 2XBXA 3ODFA 2ZQ1A 1O2LA 4Q7YA 1V2KT 2LPRA 2G5NA 2QIQA 1N1LA 1NBMD 4Y10E 1FY1A 1O2IA 2XNIA 3A80A 1O5DH 2PKSC 2Z9JA 3S9BA 4ABJA 4M7GA 1HAYB 1O33A 3RXQA 1UTLM 3GY8A 2GDDA 1JIMA 5TCAA 2FO9A 1PPGE 3QWCH 2A2QH 1SBWA 1KXFA 1GI6A 1ZPZA 2F9PA 1D9IA 2ZCLP 4NG9H 1AGJA 3VGCB 2OC7A 1V2UT 2V35A 3ATMA 3LKWA 3SI3H 4U32A 3B8JA 3M7TA 4CREA 3MI4A 4DT7B 4A1TA 2F9UA 5A0BA 5EQRA 1EJNA 1A3BH 1UJ1A 2AFQB 2WUBA 4O9VA 4YLQH 1SG8B 1HB0B 2PW8H 3FANA 3PMAB 1TMTH 3ZZAA 1O3GA 3H5CB 3MFJA 3ZIAD 3TJOA 1WYKA 3B23B 5EPNA 1C1QA 4ACAA 4E7RG 2TPIZ 1XUJA 1YGCH 3A8CA 2Y5GA 3BIVH 5EQSA 1H1BA 3PO1B 3PTNA 3V13A 2A32A 3QN7A 2VVVA 4X6PA 4ISNA 2YNAA 1JWTA 4CRFA 3STJA 2I6SA 3S9CA 2BD2A 2GCHF 1LKAA 1FN6A 5EJZA 4Q7XA 1GI9B 2ANMH 5DP5A 3AW0A 3RXEA 5DJ7A 4YXWD 4ASHA 4B71A 1O3HA 1YPKH 4BAKB 3BF6H 3U69H 3RMOH 1EQ9A 1TONA 4BNRA 1B0EA 5LPRA 4SGAE 3N7DA 1ZMJA 2FLRH 3M3SA 3HGPA 1OP8A 1ESAA 3A87A 1NT1A 2GTBA 1AB9B 1Z7KA 1TAWA 1AZ8A 1S0QA 1ETRH 3MU1A 3UY9A 1QQ4A 2VH6A 3RXIA 5JBAS 3EGKH 1KXDA 1ZZZA 1W3CA 4BXSA 5EW2H 2BVRH 3RXTA 1P2JA 4MPVA 3RXRA 1LHDH 4O03A 2F9BH 3TJNA 4K69A 4FUHA 5TJXA 4NIYA 1QTFA 2W7UA 4CH2B 2FZZA 3RXSA 2ZHWH 1BDAA 4F48B 3TK9A 1BTHH 3D23A 3SZEA 1YF4A 2C8ZB 1SL3A 2P8OB 3U8TH 4Z6AH 2BD4A 2BX3A 1DWCH 3F1SB 4OS6A 5DK1A 5F53A 1H9IE 1IQJA 4I8LA 2C8WB 4IBLH 1C4U2 4I31A 1LHCH 1G3BA 2FOEA 2A5KA 2ODPA 1QURH 1WSSH 1YC0A 4X6MA 4ABDA 1TX8A 3SJIA 2ZTYA 4GCHG 4KKDA 2G00A 1SSXA 1SGIB 2EI8A 1JIRA 2ZECA 1GI5A 2ZFRH 1Y3UA 2GT8A 2R9PA 4NA9H 4UFDH 4ZKOU 2WPIS 3SU0A 1GJ5H 5IYTA 1WOFA 4Q4LA 1BOQA 1QQUA 1MQ5A 1K22H 1E35B 1F92A 3E1XB 1E38B 2A5IA 1AFQB 1VJAU 4NZQA 3P8FA 1NPMA 3F9GA 2OK5A 1D3PB 4BXWA 2FP7B 2FS9A 3F2FA 1CE5A 4YTAA 1YPGH 1V2RT 1P3CA 1SGEE 1G3EA 1SQOA 1W10U 3EA8A 3R0FA 3FP7E 2L74A 3BSQA 4I32A 3TVJB 5I46H 1NFWA 1AVGH 1FIZA 1GL1A 2PTCE 1TGSZ 5A09A 1N6YA 1WU1A 4HTCH 1Y3WA 6GCHG 4Q2KA 2WZQA 1HNEE 4B2CA 3ATIA 3O8DA 1D4PB 1GI4A 1TGCA 1BMAA 1ZPCA 1BTXA 2VINA 1P8VC 2GCTC 1C1WH 1RGQA 1PPCE 4NZLA 4X8SH 2KCPA 1HAXB 4Q63A 4DG4A 4MNXA 3LGYA 1DY8A 4YOIA 5GCHG 4K3JA 2HGTH 3A7YA 2Y5FA 1CT0E 1O2NA 1BMMH 4ZHLU 1O36A 4A6LA 4ZH8A 1TRYA 4X2WA 1CHOG 3BG4B 3SW2B 1KXCA 5EXMA 4INKA 1ANEA 3F9HA 3ITIA 1MTNC 2RDLA 4YOJA 1GBMA 1HFDA 5T1VA 3H09A 1GMHF 4JYUH 1SOTA 2C8XB 3A8DA 1DPOA 2R3YA 2JETC 5E0GA 4IMZA 2TGDA 2BDHA 2PKSB 4ABEA 1A5IA 5EU8A 3KCGH 1GHBG 1PFXC 1QHRB 3FP8E 2WV9A 5C17A 2BD5A 2A0QB 1FN8A 4K60A 3GOVB 3NUMA 1QL7A 4TT3D 4DGJA 3TLOA 3SNEA 3DFJA 1BA8B 1ZGIA 1EZXC 1W0KD 2ZDVH 3PM3A 1C5YB 2OINA 1O35A 2BLWA 2RG3A 1C5PA 4P02A 5B6OA 1SGRE 4TWWA 1GHXH 3U8RH 4DIIH 3K9XB 1AZZA 3HKIB 1GMDF 1LHGH 1QL8A 1S6LA 1ZJDA 5FHTA 2ANYA 1HAVB 1Z8JB 1TOCB 2PLXA 1FY5A 2EQNA 5KGOA 1V2OT 4HGCA 2D8WA 1GJBB 3SJOA 4XRNA 3SV7A 1GI2A 1EP5A 2O8MA 2ZU1A 3UIRA 4B2AA 1W0ZU 2XRCA 1WDIA 3RU4T 1OHHD 2TGTA 1O2PA 1IQHA 2TBSA 2QXHA 3VEQB 1QJ1B 4X1NU 3G01A 3FVFB 2VIDA 1BTZA 3WWFA 1FY3A 3ZZBA 1Z6EA 1PQAA 1OWEA 2QXIA 1JXPA 2FTMA 3QDZB 3IWMA 3SORA 1AFEH 4D9QA 3LH3A 4MNWA 3GYLB 1S85A 2AIQA 1MBMA 1TPOA 1TQ7B 1T7CA 2AHME 3CS0A 1A46H 1YPHC 1MQ6A 3F0PA 1OXGA 1ZRKA 5DPAA 3VB4A 1UCYE 1MKXH 4D8NA 1GJ9B 2BQ7B 3ZZCA 3JZ2B 1GGDC 1HAPH 1T8OA 4K1SA 1J16A 3O8BA 5AHGH 3PLPA 3EE0B 3GY4A 3E90B 5CHAC 1LVOA 2XWAA 1NFYA 1O34A 8GCHF 5FX5A 2XWBI 3VB7A 7GCHG 1EKBB 3KYFA 1CA0C 1K1NA 2ZDAH 2QGRA 4X6NA 1GBEA 3ENSB 1AVXA 2A2XH 4Y8YA 1VCQA 4B73A 1KIGH 3BIUH 2Y81A 1TBQH 3RMLH 2VJ1A 2WSSD 5DN6D 1J8AA 1L1GA 1OWKA 3RC4A 3E3TA 2B9LA 3VXFH 1ZHPA 5T6DA 1C2HA 2KZ4A 1UVTH 2OQUA 3BTKE 3WY8A 4MPWA 1A7SA 3TPIZ 2QN5T 1DANH 1V2LT 1QA0A 2QXGA 4X1QU 5ETXA 3M35A 1MH0A 3BV9B 4H4FA 1SLXB 2ZPSA 3W95A 1EX3A 2V3HH 1KLJH 1BITA 3U28C 1H8HD 1O3IA 2ZFPH 6CHAC 3ZZ5A 2J2UA 3PV2A 1FAKH 1VJ9U 1BTUA 1QA7A 1SQRA 1NRRH 3Q77A 1E1QD 5HKKD 1O2HA 3OAAD 2WYGA 5JB9S 4CHAC 1G30B 4CRBA 1C5RA 4O3TA 3GYMA 1GDNA 1HIAA 2FI5E 3PROA 1A0LA 1BB0B 4K8BA 3RDZA 3SNCA 2OUAA 5C5NA 3K65B 2Z3EA 3GCTG 1C1MA 3HATH 1GJDB 2H9EH 3I77A 4Y71A 4FVBA 3T5FH 1PYTD 3LC5A 3LJJA 3ZVCA 4YZUA 4RI0A 5L2YH 3AASA 3RLYH 1MBQA 1ZTKA 2G4TA 3BG8A 3V12A 4XBDA 3ZZ7A 2O8TA 1TGNA 4XBBA 1EJMA 2ALVA 1AN1E 1P04A 4Y7AA 2IJOB 2OC1A 5HIYA 1SGYE 2K8IA 5C94A 1RTLA 1S5SA 4B6FA 4Z1MD 2Q6FA 3UWJH 3KIDU 1VGCC 4AG1A 1G37A 1MZAA 1QBVH 1XKAC 8KME2 2V7QD 3OFND 1K0HA 3SGBE 1O2RA 2P3UB 3GY6A 1EFRD 3TGKE 1ELBA 4YO9A 1O2KA 1SFQB 3LT3A 4I33A 3TGJE 1GI0A 1MTNB 3LC3A 1JMOH 1T8LA 1F7ZA 2ZCKP 5L2ZH 3NRLA 1COWD 3VPKA 1MTWA 1SR5C 5JYIA 1BHXF 1A5GH 2JETB 3SU4A 1E0FD 4WH6A 5GWZA 2OC0A 5L6NH 4WMEA 1RD3B 1BBRE 4UFGH 1EAWA 2YNBA 3ZZ4A 5J4QA 4GVUA 1BBRK 1W7XH 3I29A 5AFYH 4WMDA 3SV8A 1C1NA 2ZTXA 5G4BA 4E05H 1KDQA 1EJAA 4FETA 4NWLA 2BD3A 3SNAA 3PRBA 2WPLS 1V2ST 1C2DA 1L4DA 3SN8A 2SGEE 2ZDKA 1GBLA 3UOPA 3ZVAA 2J92A 3EDXB 4AB9A 3QZQA 1NRPH 2BQ6B 1TNKA 2L6OA 4Z0KA 1MAXA 3ZZ8A 2GT7A 1FXYA 3TH3H 2C4FH 3N99A 5AVDA 2XYAA 1EOJA 4MPUA 1KLTA 1IAUA 3SJ8A 1ORFA 3BTHE 1ZJKA 1AE5A 1P2IA 2A31A 3DHKH 5A0AE 5DSFA 5EXLA 4NIWA 4X0WU 3E8LA 4BTTB 4U30A 2A45B 3D49H 2XBWA 4O97A 3MWIU 4YLUA 2QAAA 1LPGB 1DXWA 1C5WB 5EODA 1THRH 1C2MA 1GJCB 2FM2A 4FUBA 1DFPA 3BTME 2SGAA 2BY6X 3D62A 1XUKA 3SJ9A 2B7DH 1ELGA 4HI3A 3LH1A 4AG2A 2ZQ2A 4U01A 3UREA 2BD7A 1P57B 1UTJA 4Y11E 1S6HA 3RXUA 1Y3YA 1TRNA 1INCA 1DLKB 5DG6A 2JJ1D 1QBNA 1FMGA 3QK1A 3SU2A 2EC9H 3MO9A 1ZMLA 1H9HE 1B7XB 2Z9LA 2J5UA 4JYTA 2VWMA 5T6FA 1O3PB 5DP4A 2FOHA 5AF9H 3LGWA 5E8EH 5JB8S 3F3BA 1S6FA 4BANB 2G5VA 4BAHB 2D1JA 4BOHA 4FVDA 1O2OA 1BRBE 1V2PT 4IW4E 2SGPE 3SUDA 1QJ7B 3FFGA 3Q00A 3GICB 1F5KU 1FPCH 1C5ZB 4TY6A 1WQSA 3MHWU 1O3OA 3VFEA 1QB6A 1LHEH 1ELAA 1GGDB 1Y3VA 2ULLA 2W6ID 1KY9A 3ZVEA 4FU9A 4J2YB 1MMJN 5GXPA 1AO5A 5CHAB 1GI8B 5LGOA 1FLEE 3Q3XA 1GG6C 2ZHQH 1BTWA 3T28A 2VB0A 3ZVGA 2IOTA 1O5EH 5JBCS 4YM9A 1NY22 2CN0H 1UVSH 2CF8H 3ESTA 4LXBH 1ANBA 3QX5H 4DY7B 2BVXH 4DW2U 2HPQH 2A7JA 4ISHH 1HXFH 2ZFFH 2EI6A 3RXPA 2QYIA 2ASUB 1ZSKA 4MG3A 2GCHG 1OWJA 2GV6A 5FCKA 3F6UH 3SBKA 1RRKA 5C1XA 1CT4E 3D65E 2ZHEH 4Y79A 4XDEA 2ZP0H 1F5LA 3S0NA 1P2NA 1HJAC 1O3DA 1EAIA 3PWCA 1U6QA 1C5XB 5E2OA 4AFSA 1F0UA 1CHGA 1Y5UT 1HIAB 2W26A 1UTPA 1YM0A 1GI3A 3ZYDA 5K0HA 1FV9A 2ZG0H 2F43B 2BZAA 2P16A 1UK4A 1E34B 4X2YA 1LCYA 1A2CH 2FLBH 2WYJA 4JZFH 2WINI 3AAVA 1XXDA 1PPZA 1KXAA 2XCFA 4QT8C 1BTPA 2ZDNA 1IQGA 3A82A 2V6NA 1BMFD 3AAUA 3T2NA 4NFEA 1HAOH 4CHAB 2QCYA 1Z8RA 4ZCNA 1O5BB 2BMGB 1YWUA 3OTJE 3MH7A 1DUEA 4JZDH 3SGAE 3TH2H 5F8TA 1C1TA 4Y6DA 3SYJA 1A5HA 1WAYB 2STAE 1S81A 4OGXA 2BDCA 2NU0E 4RT1A 4X8TH 4YOGA 4BTIB 5EIYA 2G52A 3KF2A 1ETTH 3Q3KA 1NN6A 3RXMA 1FY4A 3DUXH 2KCOA 2PR3A 1ZMNA 1GJAB 4K5ZA 1YCPH 1ACBE 2VIVA 1QBOA 1H8IH 4DVAU 1MUEB 1P9UA 2F9VA 1YBWA 2BY9X 1MZDA 4NIXA 4INLA 3VB3A 1H4WA 1O3BA 2GX4A 2WV5A 1Q2WA 1HYLA 1D3DB 1O2YA 1IOEA 1W0JD 4ZUHA 3GCHC 1KDQB 1OPHB 1SLWB 2F83A 1C1RA 2J9NA 2UUYA 1HJ8A 4MLFB 3KN2A 1F2SE 2BZ6H 1V2WT 1O2QA 1P03A 3R3GB 3FO8D 4AZ2B 1FDPA 5EXNA 3GDSA 3EQ0H 5FCRA 1E37B 1MKXK 1SHYA 4Y76A 4JK6A 4I8HA 4Y0ZE 2YMSC 5DGJA 5C0TA 1GHWH 4BAOB 1GI7B 2W7SA 1W14U 5C2ZA 1SLVB 1EP6A 1YPMH 2A4QA 2J94A 4FOUC 4FU8A 1HAIH 3U8OH 4LK4A 4MQAA 1ZSJA 1AHTH 1O3FA 2JH5D 3E16B 3O8CA 3QZRA 2VGCC 1B5GH 2FWWA 3M3VA 2ZDLA 2YOLA 1SGFA 1L1JA 1BRCE 3EAJA 2BDBA 5L30H 1FI8A 3KQBA 1O3NA 3UUZA 1MCTA 3P8NA 1D6RA 2CXVA 1FIWA 3C1KA 3GY7A 3TJVA 1O3CA 3OX7U 1LDTT 3UNSA 3M3TA 1LHFH 4LZ1H 3FZDA 1CSOE 4YT6H 1C2KA 1A0HB 2R2WU 3TK5A 2QY0B 3PMBB 1YPHE 1C5SA 1CU1A 2WPJS 5HGGA 1GBJA 3F0OA 3Q3YA 3A88A 5CDFE 1AMHA 1WTHD 4WF8A 2W3KA 3UQOA 4NSVA 2PKAA 4M9FA 3T62A 4WXVA 4GCHF 4X6OA 1D6WA 3TJUA 1LO6A 3MNBA 4A92A 1W8BH 3P95A 4ABGA 1GMHG 1DICA 2Z9IA 3F9EA 2OCVB 1XUHA 4JK5A 3U1JB 3C27B 1NROH 1FZZA 1P2OA 1EXFA 1D3TB 3ZZ3A 1AVWA 3A86A 1P0SH 2BDGA 1K9OE 3UWIA 2H5DA 2ZU4A 1VZQH 4X1SU 3A85A 1K1MA 1NO9H 1Z8IB 7KMEH 1HAHH 1YPLH 1ZHMA 3B9FH 3SHAH 2Z94A 1MD8A 4KTSA 5A0CA 1W11U 1TNGA 5HXFA 4E7NA 2XBVA 2O8LA 3SO3A 2Y80A 4D76A 5LH8A 2AS9A 1GMDG 5C5OA 4CRCA 3S9AA 1DWEH 4VGCC 2ZPQA 4XOJA 3TGIE 1NU7B 2DUCA 1E79D 1IQEA 3M5MA 4KGAA 1ANDA 3PLBA 5J4SA 1NFUA 2ZNKH 2XCNA 2G81E 3F2GA 2UUKB 1F0SA 1HV7A 1TNLA 3SNBA 1F0TA 3L6PA 4ZAEA 1CVWH 3MNSA 1OSSA 5EOKA 3GDVA 2GV7A 4H6SB 3IITA 1EUFA 2D26C 2CK3D 2C93B 1G3DA 3P70B 5HIZA 1HPGA 1P05A 2CHAC 1LQEA 2SGDE 1BJVA 2ANKH 2Y6TA 3RXAA 1VR1H 3DSPA 2R2MB 1HJAB 1AKSA 2WPDD 3E6PH 1DY9A 1GBIA 1O30A 3LONA 1Q3XA 4B75A 4ABIA 5IK2D 3BEFB 3S7KB 1FNIA 1TBZH 1OWHA 3GCOA 3RXVA 1BMNH 1GMCF 3DFLA 3TK6A 3NKKA 1HBTH 3KQDA 4JZEH 1FONA 1TFXA 4WVPE 1IQLA 2FOCA 1VITH 3MNCA 2ZFQH 2JH6D 3RXOA 2HOBA 1C2FA 4TYDA 1GPZA 4ZHAA 3KQ5A 2PUQH 5SGAE 4LZ4B 4IC6A 1UW7A 2XBYA 3PWBA 1ABJH 1QFKH 2FEQH 1QRZA 4WH8A 1SPJA 1DUAA 1TPSA 3HKJB 4GAWA 3T25A 6LPRA 3FP6E 1O3LA 8GCHG 1T31A 5DO4H 1NRQH 3NWUA 1IQMA 3RXJA 2VWNA 3VG8A 4XFQA 5LPFA 1UK2A 3ELAH 4INHA 2FESH 1AWHB 4Y8ZA 1EZQA 1OS8A 1GBKA 3RXBA 4HG6A 1NRSH 1GI1A 1AWFH 1HAGE 1NS3A 2J98A 3AK5A 2FOGA 1OX1A 3U1IB 5EPYA 1ZPBA 2KCYA 2O8WA 3M36A 3GDUA 1K1PA 1GHYH 1TA2A 1O2XA 1PPFE 1FUJA 1XKBC 2PP6A 1ANCA 2Z6BD 4X8UH 2ZPRA 4DOQA 3RUOA 3BTQE 1G3CA 2Y82A 3FZZA 2VBCA 1GBAA 1T8NA 3SQHE 3HK3B 1NM6A 1S84A 3PB1E 1AUJA 2CJIA 2BLVA 3IG6B 3UOUA 1RFNA 4AYYB 1DVAH 1RJXB 1BMLA 3GCHB 1C1SA 2ZKSA 1L0ZA 2HLDD 1TGTA 2ZGBH 4AGJA 4OGYA 4UDWH 3UR6A 3DSGA 3FKSD 3VB5A 2AGIX 5K7RA 2QF5A 4FUCA 2PUXB 3SNDA 1P2KA 2YMSB 2AMPA 3ODDA 2V3OH 5PTPA 2HNTF 1OYQA 1UMAH 3P8OA 2STBE 3P92A 2OD3B 1FJSA 4GLYA 2PFEA 2VGCB 3BN9A 4JMYA 1G2LA 4I8JA 1MKWH 2RA0A 7LPRA 1F5RA 4KP0A 1KXEA 1E1RD 4DT4A 4MPXA 2G4UA 3F9FA 1ESBA 3KL6A 1BCUH 2Q6DA 1L1NA 2PKAB 1DT2A 3TNSA 2WHXA 3T29A 2LNCA 3LGUA 1AD8H 3PO1C 4FUDA 3LGVA 1HGTH 1TE0A 5A2MH 2ZU3A 3CNRA 4F55A 5LPEA 2A4RA 1GL0E 3SOSA 1A0JA 1J9CH 3BTEE 2W5EA 3M7UA 1V2TT 2CV3A 8ESTE 4WXIA 1L4ZA 1HRTH 3A7ZA 4ABBA 5F6MA 4CRDA 1DSTA 1TLDA 3A89A 1OP0A 2OTVA 1TRMA 4D7GA 1T8MA 3N7EA 4DIHH 3UQVA 3P17H 1SGFG 5DP3A 1O32A 2GCTB 2TRMA 3HPTB 3RXDA 1P09A 1YY3A 3NZIA 1W13U 1LQDB 2G55A 2AGEX 1PQ5A 1QR3E 1XVMA 1O3KA 1C4V2 1OOKB 2NU4E 1C2GA 1AB9C 1FX0B 1O2ZA 3M5OA 1S83A 2V3MA 2IJD1 3AW1A 3OU0A 2UWPA 1P06A 1EAXA 4FUEA 3U9AH 4A1VA 2TGPZ 1P3EA 1DWDH 1ARBA 1SGNE
chains in the Genus database with same CATH topology
4OS2A 2AGGX 1H8DH 1O3JA 2H1UA 4UFEH 4GUXA 1NESE 3GISB 1YLDA 1PQ7A 4A5TS 1C1PA 1DITH 1YCPK 1K1OA 3M37A 2EEKA 2IN2A 4R0IA 1C2EA 2R3UA 5GIBA 1FY8E 3K6ZA 4AYVB 1W2KH 2CMYA 3ATKA 1AKSB 3PTBA 2F9OA 1O37A 1PPHE 3T26A 5DP6A 3RP2A 3V0XA 1W7GH 2FYQA 3MU0A 4ISLA 4BAMB 4KELA 2P59A 3URCA 2Y7ZA 1GBBA 4WMFA 1TNHA 3SZNA 3PMJA 2PSXA 2J38A 1QRWA 1NZQH 4AFUA 1ZTLA 4NSYA 2FI4E 2VU8E 2CHAB 5I25A 1O5FH 2P3TB 2FXRA 2ZF0H 2FYRA 2BDIA 2GDEH 1PQ8A 1C5LH 1T4VH 1TPPA 1TX6A 5HMAA 4ABHA 1G32B 3A7XA 1ZR0A 2OP9A 4X1PU 1BIOA 1EASA 1Y5BT 4NFFA 5FX6A 1KSNA 1QRXA 1O5CB 4GHTA 3TU7H 2IPHA 3DD2H 1GJ6A 2FX4A 3UR9A 4RKOB 3SUEA 1GCTC 2BDAA 1YKTA 1YPJH 1XUIA 2BQWB 4A7IB 4CH8B 1GHAF 2FOBA 1AIXH 1NC6A 2J34A 3BEUA 1UHBA 1SGDE 3CS7A 4R8TB 4X2XA 4B1TA 4MDSA 2P95A 1FPHH 1O5GH 4X2VA 2Z9KA 1SGPE 1UCYH 2P3FH 3RXLA 1C2IA 2ZGHA 1SC8U 2A1DB 3MH4A 2AERH 1C5OH 1S0RA 1SFIA 1LPZB 4B76A 1IHTH 1TALA 3E91A 2I6QA 1C1OA 3SV9A 1C5MD 4AX9H 4ZMAH 1O2SA 2BXUH 4ABAA 2HPPH 1OWIA 2OXSA 1O0DH 2AYWA 1TPAE 1VITF 1P12E 3PLKA 1LMWB 2SGFE 3QGNB 1THPB 2A4GA 3A8AA 1BUIA 4THNH 3QTOH 3VXEH 3PV4A 2OQ5A 1DXPA 3FAOA 1GDQA 1CA0B 1P10A 2ZC9H 4O3UA 4Y8XA 5EG4A 4RN6A 3GY2A 2WPKS 1CGIE 1OKXA 1TIOA 2J4IA 2ZFTA 3A81A 1O2JA 2ZEBA 4BAQB 3MU5A 4KTUA 2ALPA 4HZHA 1UTOA 3BEIB 4GHQA 2XC5A 1MTSA 5C1UA 1M9UA 2VIWA 2AMQA 2SFAA 3SV6A 1AE8H 4WJG2 2A7HA 1F0RA 1GBFA 3A7TA 1IQIA 3MH6A 1ELCA 4PROA 4AB8A 1O39A 1P9SA 2OLGA 4JYVH 1LKBA 2HNTC 4CRGA 5JBBS 3A7VA 1NRNH 4K1EA 6CHAB 1C5QA 1SGCA 1O2WA 1GBTA 3ZYEA 1A61H 1V6DA 2PTNA 2ZIQH 4CR9A 1SQAA 4FU7A 1DE7H 2HALA 1K1LA 3SHCH 1J17T 2EA3A 1JRTA 2PGQB 1C9TA 1UTNA 1MU6B 9ESTA 3RC6A 2HRVA 1BJUA 5JPMH 1WCZA 4RKJB 2GP9B 3UFAA 3A83A 2C90B 5FBEA 9LPRA 1BRAA 2ZGCA 1FAXA 2PGBB 4WWYA 5E2PA 3RXKA 4JCNA 1HAVA 1EATA 1D3QB 1DLEA 5FPSA 2GZ8A 5E0HA 2WUCA 2VH0A 4E06H 2H5CA 4OS7A 4FUFA 1DOJA 1YYY1 1NFXA 2FTLE 1O38A 2WPHS 3RXCA 1XXFA 2PWXA 1TB6H 3VB6A 2Y5HA 3MO3A 1TABE 4IMQA 1TMUH 2XC4A 3HGNA 4FUJA 3M7QA 2F3CE 1VGCB 2ZHDA 5T6GA 1HDTH 5DP7A 1O2MA 2BB4A 3P8GA 2BLQA 2ODYB 1GVZA 3W94A 1PYTC 5A8YA 2ZWLH 5FAHA 2QXJA 2VIOA 2Z3DA 4IS5A 3SU5A 1BBRH 5A8ZA 4WY3A 1G36A 5C20A 1SOZA 1TX7A 3U98H 5EGMA 4D7FA 4ZXXH 3UNQA 1XMNB 2Z7FE 1ZLRA 2ZGJA 1EZUC 2JH0D 4XSKU 1PPEE 3ZZ9A 1O3MA 3SU1A 1RIWC 5F8ZA 3RM2H 1Y3XA 2GKVE 2BY5X 2UWLA 2ZDMA 3QLPH 3M5LA 3KQEA 1GJ7B 4AGKA 1GVLA 2SGQE 4F4OC 3BTWE 1TA6A 1WUNH 1BT7A 3MYWA 1V3XA 2QV1A 3SJKA 2BLOA 1X7AC 5GJ4B 4ZKNU 1C5NH 1UK3A 2PV9B 1EAUA 3TNTA 1SGTA 1V2QT 2BOKA 1GCDA 4GPGA 2H9TH 1P01A 4Y0YE 1UO6A 2QC2A 4D9RA 1G9IE 2BXTH 3MH5A 1O5AB 2G51A 1Z71A 2GGVB 4K8YA 2BOHB 1O2GH 1Z8GA 1O3AA 2O8UA 3SI4H 3TH4H 1HLTH 5FPTA 2FDAA 4CRAA 1O31A 1UHBB 3ZVFA 2TGAA 2GZ9A 3MU4A 5EQQA 4AOQA 2ESTE 1CA8B 1QL9A 1TWXB 2FOMB 1V2JT 1AU8A 3QTVH 1TNJA 1C4Y2 1BQYA 3CENA 2BYAX 4BTUB 3P6ZB 8LPRA 1SGQE 1GCTB 2R0LA 1MKWK 1MU8B 2THFB 4AFQA 1SHHB 2FOAA 2Z9GA 1N8OC 3LU9B 4ZHMU 5HYOA 1ELVA 1QY6A 4U2WA 1GBDA 2KAIA 1C5TA 2FX6A 1VCPA 3Q76A 1AQ7A 4I8GA 2UWOA 1SB1H 4UFFH 4UD9H 1YP9A 2HVXA 2PHBA 1MTVA 3M5NA 1Y59T 2VIQA 3MOCA 1V2MT 1DS2E 3RM0H 4I7YH 2WPMS 4DURA 3MU8A 4XBCA 3OYPA 2DE8A 6GCHF 1HJ9A 1MTUA 1GG6B 3OY6U 3GY5A 2VVUA 4CR5A 1C9PA 3A8BA 1WV7H 1XM1A 2GMTC 4JZ1A 4NCYA 1ELFA 1VCWA 1Z1IA 2R0KA 1JBUH 2FS8A 2P93A 2ZU2A 1A1RA 4RSPA 1GMCG 5FBIA 3NCLA 5GCHF 3ZV8A 1H9LB 2VVCA 5C1YA 2BY7X 2FOFA 2SNVA 1CBWC 1BRUP 3ZV9A 3ZVBA 3T27A 3GCNA 2H6MA 4ABFA 1CHOF 5CMXH 1IHSH 3DA9B 2NU1E 2SNWA 1FQ3A 1P2QA 5H4IB 3ATLA 1KXBA 2B8OH 5DKMA 1NU9A 5BPEA 3H7TA 5FPYA 1SLUB 3GY3A 2AIPA 3UTUH 3SGQE 5FXLA 3RXHA 3MO6A 4IC5A 1CO7E 1ELEE 5AFZH 1GHBF 4H6TA 1KTSB 4IN1A 3LGIA 1UVOA 1QNJA 3EA7A 3KHVA 1K2I1 1V2VT 2ZTZA 1LVYA 4UEHH 4MTBA 5TCCA 4ISOA 2XXLA 1K1IA 5GPIB 1TQ0B 1K21H 3SUGA 5BRRE 4SGBE 3RXFA 2XC0A 1T32A 2AEIH 3HK6B 3UPEA 1G2MA 2BHGA 4OS1A 1ZOMA 1GBHA 2QF3A 2OC8A 4IN2A 1XVOA 1SMFE 1BZXE 4AORA 1KLIH 3URDA 1IQNA 2VWLA 2Y7XA 3QO6A 1EPTC 1Z1JA 2ZZUH 1TMBH 3PYHA 1ZGVA 3STIA 4ZKSU 2BD9A 3L33A 2BDYA 4NWKA 2ZI2H 4OS4A 2OBOA 1GJ8B 4DJZB 3NK8A 2ILNA 1CQQA 4J1YA 2QA9E 1SI5H 2CF9H 2BVSH 3RC5A 1Y5AT 5HM9A 1EPTA 1P02A 1UCYK 2JKHA 4KTCA 1JRSA 3DT0H 3ATWA 1UVPA 4GSOA 2K1QA 1ZTJA 1TBRH 4K1TA 1GWAA 3LPRA 1XX9A 3M61U 1OWDA 5ESBA 3LDXH 3F68H 1TNIA 4CBOA 2BD8A 3N7OA 1QJ6B 2J95A 4ESTE 2ANWA 3H7OA 1BTYA 2AMDA 1BHXB 5HM2A 1SVPA 1YPEH 1RIWB 1C1VH 1MAYA 2OBQA 1RTKA 4FXGH 1E36B 3VGCC 2PSYA 2QF0A 2Q1JA 1A4WH 2FIRH 5C3NA 1QCPA 2A7CA 1DSUA 1W0YH 1XUFA 5IDKA 4HFPB 1O2TA 1DX5M 4B74A 1ARCA 3KQCA 2CGAA 3A7WA 1MCVA 1KYNA 1THSH 2C3SA 2ZO3H 1N6XA 4B2BA 3KNXA 4X1RU 4AFZA 7GCHF 1EB1H 3OY5U 3RXGA 5DP8A 3K2UA 1ZHRA 4ZXYH 1CT2E 1AY6H 2RCEA 2FODA 2G8TA 3BTDE 1YLCA 1C2LA 4OS5A 3KGPA 3RLWH 1XUGA 1B0FA 1TGBA 6ESTA 2RA3A 1NTPA 3K6YA 4TY7A 3EYDA 1LPKB 2KAIB 2NWNA 1W12U 1C2JA 2BX4A 1HXEH 4Y7BA 5A8XA 1DM4B 2F91A 1QGFA 2EI7A 3AVZA 1PJPA 3LJOA 2A5AA 3E0PB 5DP9A 1KTTB 4LOYH 3SUFA 3KEEA 1MD7A 2FI3E 3LOXA 5F8XA 1N8OB 4JZIA 1ESTA 4DCDA 1ZRBA 1J15A 3V3MA 3RU4D 1TYNA 1TOMH 2W3IA 2ZHFH 3OSYA 3PMHB 1OP2A 1V2NT 4CBNA 3SU3A 3TITA 2UUFB 1HCGA 1RXPA 2BY8X 3BTFE 1WQVH 3I78A 1QIXB 1GBCA 2XW9A 4MNVA 1DDJA 4YESB 4MVNA 1UTMA 2AH4X 2D2DA 1UTKA 1GHZA 2B5TB 2ZCHP 3CP7A 1YCPM 4ISIH 3L3TA 2C8YB 2DE9A 2VWOA 2XTTB 1ZYOA 2GVFA 1SQTA 3NPSA 2A4OA 1C5UA 3A84A 2BTCE 5ESTE 2HNTE 5C67A 1UTQA 3GCTF 5GDSH 1ETSH 4VGCB 1AI8H 3JZ1B 3LIWA 1IQFA 1QB9A 2ZGXH 1P11E 2P8OC 1QB1A 2GMTB 2O9QA 3V7TA 1ABIH 3EA9A 5F03A 2M5TA 1AUTC 1O2VA 3QUMP 2BM2A 4Q7ZA 2ODQA 1GVKB 4NIVA 1CGJE 1ELTA 3UNRA 3BTTE 1UVUH 2H2ZA 1CBWB 1EOLA 1JOUB 2TIOA 1HUTH 1GHVH 3SV2H 1HAZB 1J14A 3ZZDA 1RTFB 2UUJB 1K1JA 1GHAG 1EB2A 2NU3E 5CE1A 4XE4A 2HLCA 5T3HA 3QGJA 2FMJA 2H9HA 2Z3CA 1LTOA 1Z6JH 1Y8TA 2GD4B 1PPBH 4ZROA 1S82A 2GZ7A 1GDUA 1WBGB 2VNTA 1AFQC 1LVMA 2NU2E 4FUIA 1C5VA 2FPZA 4X8VH 4I8KA 4NGAH 5JBTA 1K28D 3LGTA 4FUGA 4TPYA 2Q6GA 3S69A 4NA7A 4UONA 4F49A 4ZKRU 1WTGH 4H42U 2ZFSA 2F9NA 4MNYA 2HWLB 3MTYA 7ESTE 3S7HB 3O8RA 3RU4E 1L2EA 1VITG 1RS0A 3ZZ6A 4UE7H 2P94A 3SQEE 2V0BA 1CGHA 3BTGE 4YT7H 1A3EH 4K2YA 1GJ4H 3ZVDA 1O2UA 1Q31A 2WV4A 1EPTB 3NXPA 1OYTH 4A1XA 1P2MA 1IQKA 3MMGA 1O3EA 5JDUB 1ELDE 5E0JA 4TPIZ 1T4UH 5ABWA 2ZU5A 3TIUA 2B0FA 3RMNH 1C1UH 1EZSC 2VIPA 5EW1H 1DWBH 1ID5H 3BG4C 3RMMH 1LVBA 3MNXA 3SU6A 4AN7A 3E0NB 4IGDA 4Q80A 2ZA5A 4TWYA 1ZSLA 4NA8A 2XBXA 3ODFA 2ZQ1A 1O2LA 4Q7YA 1V2KT 2LPRA 2G5NA 2QIQA 1N1LA 4Y10E 1FY1A 1O2IA 2XNIA 3A80A 1O5DH 2PKSC 2Z9JA 3S9BA 4ABJA 4M7GA 1HAYB 1O33A 3RXQA 1UTLM 3GY8A 2GDDA 1JIMA 5TCAA 2FO9A 1PPGE 3QWCH 2A2QH 1SBWA 1KXFA 1GI6A 1ZPZA 2F9PA 1D9IA 2ZCLP 4NG9H 1AGJA 3VGCB 2OC7A 1V2UT 2V35A 3ATMA 3LKWA 3SI3H 4U32A 3B8JA 3M7TA 4CREA 3MI4A 4DT7B 4A1TA 2F9UA 5A0BA 5EQRA 1EJNA 1A3BH 1UJ1A 2AFQB 2WUBA 4O9VA 4YLQH 1SG8B 1HB0B 2PW8H 3FANA 3PMAB 1TMTH 3ZZAA 1O3GA 3H5CB 3MFJA 3TJOA 1WYKA 3B23B 5EPNA 1C1QA 4E7RG 2TPIZ 1XUJA 1YGCH 3A8CA 2Y5GA 3BIVH 5EQSA 1H1BA 3PO1B 3PTNA 3V13A 2A32A 3QN7A 2VVVA 4X6PA 4ISNA 2YNAA 1JWTA 4CRFA 3STJA 2I6SA 3S9CA 2BD2A 2GCHF 1LKAA 1FN6A 4Q7XA 1GI9B 2ANMH 5DP5A 3AW0A 3RXEA 5DJ7A 4ASHA 4B71A 1O3HA 1YPKH 4BAKB 3BF6H 3U69H 3RMOH 1EQ9A 1TONA 4BNRA 1B0EA 5LPRA 4SGAE 1ZMJA 2FLRH 3M3SA 3HGPA 1OP8A 1ESAA 3A87A 1NT1A 2GTBA 1AB9B 1Z7KA 1TAWA 1AZ8A 1S0QA 1ETRH 3MU1A 3UY9A 1QQ4A 2VH6A 3RXIA 5JBAS 3EGKH 1KXDA 1ZZZA 1W3CA 4BXSA 5EW2H 2BVRH 3RXTA 1P2JA 4MPVA 3RXRA 1LHDH 4O03A 2F9BH 3TJNA 4K69A 4FUHA 5TJXA 4NIYA 1QTFA 2W7UA 4CH2B 2FZZA 3RXSA 2ZHWH 1BDAA 3TK9A 1BTHH 3D23A 1YF4A 2C8ZB 1SL3A 2P8OB 3U8TH 4Z6AH 2BD4A 2BX3A 1DWCH 3F1SB 4OS6A 5DK1A 1H9IE 1IQJA 4I8LA 2C8WB 4IBLH 1C4U2 4I31A 1LHCH 2ODPA 1G3BA 2A5KA 2FOEA 1QURH 1WSSH 1YC0A 4X6MA 4ABDA 1TX8A 3SJIA 2ZTYA 4GCHG 4KKDA 2G00A 1SSXA 1SGIB 2EI8A 1JIRA 2ZECA 1GI5A 2ZFRH 1Y3UA 2GT8A 2R9PA 4NA9H 4UFDH 4ZKOU 2WPIS 3SU0A 1GJ5H 5IYTA 1WOFA 1BOQA 1QQUA 1MQ5A 1K22H 1E35B 1F92A 3E1XB 1E38B 2A5IA 1AFQB 1VJAU 4NZQA 3P8FA 1NPMA 3F9GA 1D3PB 4BXWA 2FP7B 2FS9A 1CE5A 4YTAA 1YPGH 1V2RT 1P3CA 1SGEE 1G3EA 1SQOA 1W10U 3EA8A 3R0FA 3FP7E 3BSQA 4I32A 3TVJB <