3MYYA

Structure of e. coli chey mutant a113p bound to beryllium fluoride
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTPATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation of CheY by Mutation at an allosteric site
rcsb
source organism Escherichia coli k-12
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
total genus 45
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3myyA00
2QVCA 3KCNA 1ISSA 3N53A 1P6QA 3LTEA 5DCLA 4LZLA 3UK0A 4OG2A 1F4VA 1A0OA 1A04A 4JAVC 1Z25A 3TD9A 1YK0A 4N03A 2M1ZA 2P4UA 1E6LA 2FTKE 1OXBB 4YLEA 4WUTA 4D6YA 4ETMA 2QXYA 4UHJA 3H1FA 1EFAA 2X7XA 3HCWA 5ABPA 2QVGA 2FSPA 2IPAB 5KC9A 3FDFA 3HDVA 3TMYA 4Z99A 1DRKA 3SG0A 2WB4A 3C97A 2GKGA 4RZSA 4NCAA 4MS3B 5HM6A 2V0NA 3DZDA 2FW0A 4YO7A 2PMCA 3MIZA 3OM1A 1QNLA 2MYUA 3HZHA 1RPJA 3MMNA 3CFYA 2QR3A 3BRQA 3Q7SA 5JNWA 4RXUA 2PE5A 3HV2A 1PNRA 5C5CA 1JYFA 4JB0A 2PL9A 2QU7A 1DRJA 3RQIA 4EYGA 1ZY2A 2QW1A 4RK1A 3T95A 3QLVA 4EVRA 1I3CA 2FLKA 4G0QA 3MA0A 3N0RA 5EWMB 1YTUA 4FE4A 1P6UA 2OENG 5C5EA 3LUKA 5KQGA 3OQNA 2PUCA 3C3KA 3FFXA 2WMYA 3F7NA 3O1HB 3OMWA 1XHEA 1GCGA 3LUHA 4GNRA 4MLCA 4NICA 3O2SB 4KV7A 1DP4A 2W42A 2WJWA 1YS7A 3B2NA 3NNSA 1NXOA 1MAVA 4DN6A 4WT7A 1TVMA 2E4UA 3KG2A 1H9CA 1C0EA 2H3HA 2FEKA 3TX6A 1EWKA 3H75A 5BRJA 3ILYA 2BGGA 5IULC 3QLVC 1ABFA 3CNBA 4KFCA 2IKSA 1T34A 1JDNA 1M2EA 3HUTA 2YHAA 2R25B 3FMVA 3NBMA 3N0WA 2FVYA 5KWSA 2PUEA 2HSGA 4IRXA 4CBVA 3QEMA 3LUAA 1MVOA 1NXXA 4G0PA 1DC7A 4MGEA 4KRFA 3H1GA 4KPYA 1YMVA 4N41A 4OTZA 5T3YA 3CS3A 3I09A 3CZ5A 3KLNA 4S04A 1CYEA 2IDMA 4PYRA 3IP5A 1OXKB 2VUIB 4XFKA 3UUGA 5JS1A 2E4XA 3CRNA 3RVNA 2HJ9A 3RVMA 3DGFC 1SRRA 4MS1A 1BDIA 2NT3A 1R8JA 3LUFA 2RDMA 1ZH4A 2XDYA 3NHMA 5EWJB 3CU5A 1USGA 1DBQA 2JVIA 3EJWA 4HNQA 5TQJA 4DQDA 3KSMA 4PZ0A 1RZRD 3CZCA 4XASA 5FWYA 3HM9A 2PUAA 2MYNA 1K66A 3QX9A 3MM4A 5GOTA 1USIA 2R48A 2MYTA 3KHTA 5JNUA 1DCKA 5FBKA 4N47A 5KI6A 4MRMB 2GI4A 2E4ZA 4MS3A 4Y9TA 3OLXA 5IBQA 3H6HA 3HXMA 1ABEA 1ZN2A 2YHBA 1U2QA 3OO0A 4MLDA 2FQWA 1TLFA 4IF4A 4Z4HA 2IPLA 4RWEA 1Z12A 1M2FA 1AB6A 3K9CA 4IILA 4F06A 3QEMB 1D4ZA 3RVKA 5GQSA 3DLBA 1FFSA 3HEBA 2RJOA 1DJMA 4DADA 4KMRA 2R4QA 2IPNA 2J48A 1YK1A 4RV5A 3JY6A 3KYJB 4RK0A 1E6KA 1NATA 4WXMA 4N0QA 4FB4A 2WJAA 1JFTA 3OMXA 5D2CA 2FMHA 5PNTA 4RK4A 4MR7B 3CHYA 3JVIA 4Z9BA 1PEYA 2PAFA 4QYMA 4G0YA 4LE2A 1ZGZA 2MSLA 1YIOA 4XLTA 5FWXB 1ZESA 3VNBA 4F12A 4JOQA 1VLZA 3GA5A 3L49A 3LUJA 1MB0A 4KVFA 4TN5A 3A10A 4RS3A 5FBHA 1TM2A 9ABPA 2IYNA 5CNKA 3W9SA 1CHNA 2B1JA 4W5TA 1QPZA 2CWDA 2FQXA 4KQCA 3OM0A 4EVQA 4M88A 1E6MA 1SD5A 4MR7A 4D6XA 8ABPA 1FSPA 4GPAA 4Q6BA 3R0JA 1PHRA 3L6UA 3ILHA 2A9PA 3GRCA 4KK4A 4PEVA 4EGSA 5KC8A 2VYCA 4YR7A 5IEBA 2DRIA 4Q6WA 3A3KA 4F11A 3TO5A 2LUOA 4RKRA 5IX8A 3BBLA 3CLKA 4L85A 5DTEA 4RK5A 3GT7A 2HQOA 2CHEA 4JASB 3LOPA 3SY8A 2JRLA 4Z4FA 2QSJA 4Z4EA 4EYOA 1DCMA 1BAPA 3I5AA 4WZZA 2ZWMA 3LUCA 3S99A 3LKBA 4MR8B 4MR9B 4NQRA 3N8IA 4KNYA 1Z18A 3QLTA 3T38A 3N0XA 4XARA 5HSGA 3RVLA 2PUDA 5CHYA 2LIVA 1RZRA 4RY8A 5IUNC 2B4AA 1BDJA 3QELB 1FFWA 2QV0A 2ZAYA 1Z26A 3E61A 3EAFA 4W5QA 4Z9AA 3DGEC 3IPAA 3BRSA 4MQFA 3RH0A 5EWMA 2WY2D 3OLZA 1CEYA 2E4VA 4G86A 3OO1A 1W25A 3T6KA 2WRZA 1E2BA 1JL3A 4QPJC 1KMIY 4RY0A 5JNSA 5KQLA 2I6FA 1FQWA 3RVPA 1EWTA 1Z16A 3H6GA 5HKOA 1J56A 3RVRA 3CKMA 4RXTA 1HEYA 3SM9A 4W5RA 4G0XA 3OQMA 1KGSA 2LBPA 2PKXA 1NTRA 3MQ4A 1URPA 2FN8A 3H5LA 4RY9A 1C4WA 2JBAA 3IPCA 2MSKA 2NZVG 1DZ3A 5CNMA 3MF4A 3OQOA 3QK7A 3KJXA 4F8JA 1XHFA 1DBPA 1U04A 1GUBA 5F64A 4MS4A 1JBEA 2JCGA 4IGAA 4OLBA 1L5ZA 3LUDA 4Z0NA 2CD7A 2VK2A 2PL1A 3HK2A 1BVHA 5JS2A 3EDCA 4XAQA 2FN9A 1RNLA 3MYYA 4YGXB 7ABPA 2A9OA 1YMUA 1U8TA 3LUGA 3EODA 2IPMA 3H1EA 1D1PA 4P98A 1W9HA 2FMKA 3EULA 2MYPA 3NNDA 3H5IA 4L4UA 3FFTA 4KQ9A 4NCBA 1LJUA 2GBPA 3KLOA 5TQ0A 3RVJA 4EY3A 3URMA 4LRQA 5KQMA 5JNTA 4G0ZA 4F3TA 2WWVD 1U0SY 3KTOA 3GBVA 2ID9A 5CNIA 4MQEA 1Y1LA 4RK6A 4RKQA 1FFGA 4YS6A 2FEPA 5HQJA 1MIHA 2FMFA 1MB3A 2LPMA 5KQPA 4MQFB 1D1QA 1YVUA 2E4YA 2FKAA 4FE7A 4B09A 1B00A 2AYXA 1QP0A 4O5AA 1F51E 1D2AA 3C3WA 4EYKA 3EQ2A 5TPWA 6CHYA 3OLVA 1IIBA 2FXIA 3O74A 1EAYA 5IUKC 1EHCA 1Z13A 3H5WA 1JLKA 1Z2DA 5TQ2A 1TJYA 3A0UA 3GYBA 2Q5CA 4RK7A 1QQBA 4HNSA 5FWYB 1SXGA 3O2JA 3C3MA 2OQRA 4E7OA 4TMYA 1VKRA 4YP9A 3Q9SA 1NXWA 2L18A 4MR9A 4MR8A 2GX6A 4ZMRA 4RSMA 1NXPA 3JPWA 1PEAA 4MRMA 3K4HA 3GV0A 3SAJA 5FWXA 4NV3A 5I4CA 2H0AA 4YV7A 4H60A 2NZUG 1RXEA 3E3MA 5DKFA 1Z2EA 4PICA 1JHZA 2A9RA 3IP7A 4ZYLA 1ZAYA 4S05A 1VPWA 1QQAA 4RXMA 1S8NA 1JYEA 1P8AA 3UKJA 3SQNA 4MPTA 3HSYA 4LE1A 3FGZA 3H5TA 4OLAA 3KKEA 3ROTA 5JNVA 2NT4A 3G1WA 4O1IA 1UDRA 5TPZA 3IP6A 3QLUC 5EWLB 2LP4Y 1XWWA 4HNRA 1QO0D 1GLGA 3O1JC 2FMIA 1JF8A 2JB9A 1Z17A 1P2FA 4KZKA 2L17A 4H3KB 4IMIB 4LDAA 4E7PA 3A0RB 1M5TA 5B3JC 3KYIB 3JPYA 3SNKA 2RGYA 3Q41A 2M98A 3IP9A 3HJFA 1LBIA 3O21A 1SXHA 3DLHA 3O2QB 5TPWB 3GWGA 4P1ZA 5TPZD 1L5YA 1D5WA 1U2PA 3Q7TA 4KK3A 1BDHA 5T7BA 5TQ2B 4WXEA 3CG4A 3LFTA 5EWJA 2FEWB 1WETA 2IOYA 3JVDA 5JNRA 2A9QA 3F6CA 3I42A 4KREA 2N9UA 2NUBA 4YRZA 2L2QA 1RXIA 1K68A 1LJLA 5IEJA 3HUUA 4ZJPA 4ZPJA 2PUBA 1ZDMA 1KRWA 2O20A 4IMJB 3GBPA 3NNNA 4G0OA 6ABPA 1JDPA 3RVSA 5BQ3A 4JB2A 2F8SA 4JA2A 1JH9A 3M9WA 4Z4GA 4LDZA 1JFSA 2HPHA 2JVJA 4EUKA 5ED4A 5DGCA 2QZJA 3QEKA 3FFWA 4RDCA 4JP1A 3IDOA 5IC5A 3H5VA 1ISRA 2FLWA 2ID7A 5B3JA 4MS4B 4PE5B 4WWHA 3JS5A 4QYWA 3LMKA 1PNTA 1JX6A 5EWLA 3D8UA 3O75A 3HS3A 4MAAA 2KYRA 3P9YA 1ZITA 4W5NA 4MS1B 3TB6A 2JK1A 4ETIA 1GUDA 4MQEB 1JFVA 1LBHA 1M5UA 1AB5A 1USKA 4OATA 4RU1A 1QP7A 3M9XA 1ZHHA 2JVKA 2CHFA 3HDGA 1ZH2A 5DLEA 1QKKA 1DG9A 1JWLA 3CG0A 3ROFA 3KS9A 3DBIA 3NHZA 4EVSA 3N75A 1BA2A 4O1HA 2GWRA 1KRXA 3GL9A 1QMPA 1QP4A 2P9HA 4EYQA 1DC8A 4MYRA 4ML3A 4YCSA 3QX8A 1NY5A 2RJNA 2E4WA 2PJUA 3Q15C 5E3JA 4LE0A 3C6QA 3OLYA 3QLUA 1QO0A 4G0MA 3F73A 2F8TA 1TMYA 4QICA 1VRVA 4OBBA 2L19A 4ETNA 4UHKA 3G85A 4LX8A 3CTPA 3HO1A 1PUXA 3QELA 3RVQA 2VUHB 1SXIA 3O1IC 5IUJC 3Q7RA 5TE9A 3BILA 3JTEA 3RVOA 4N76A 4YWHA 2MSWA 4Q7EA 3T8YA 3HVRA 4D74A 3H5OA 2PUGA 1Z15A 3OLWA 1APBA 1GCAA 1YS6A 3EQZA 3I45A 4ZMSA 2HQBA 5TQ0B 1ZGGA 2FQYA 1A2OA 4Z4CA 4W5OA 1ZVVA 5BR1A 4TLMB 3VNAA 2PLNA 4TLLB 3D02A 1EWVA 4G97A 1NXSA 5BRAA 1LK0A 4XXHA 4H3HB 2JBAB 4N0PA 3F6PA 3N6VA 1NXTA 2TMYA 2R47A 2HQRA 4HYEA 5CNJA 1DCFA 1DBWA 3M6MD 1NXVA 2AYZA 2PUFA 3EGCA 4Z4IA 3LKVA 3BREA
chains in the Genus database with same CATH superfamily
4Q4DA 4U3JB 1ISSA 1ICIA 1P6QA 5K0EA 4JDPA 1KVQA 1FBNA 1DBIA 2FGJA 1WAMA 3NHYA 2QUBA 2M1ZA 1RFGE 1E6LA 3H2IA 3ZJVA 3TMAA 5I9BA 3R7BA 4BC1A 3JASA 4BIMA 1Y34E 1RCFA 3T35A 1EFAA 4A10A 1E7WA 3HCWA 4M1OA 4NG4A 4AO8A 1I2MA 4RZ3A 2WPNA 1ULZA 4BC0A 5JT1A 2W2LA 2PL5A 5E6SA 4M37A 3SG0A 5FYQA 1QG6A 4NCAA 5EE9A 1PVOA 3UAZA 2V0NA 5CLIA 4KLNA 3VC7A 3SX2A 4QRHA 1LVHA 1IB6A 4FGLA 3X1MA 4YFVA 2Z8XA 4GIBA 2IOHA 1P0QA 3CM0A 1YVDA 3O38A 2GFHA 2IIPA 3HV2A 5THQA 2Y4NA 1JYFA 1DQPA 2P3LA 3CY6A 1BGXT 2AMLA 4NJOA 2QU7A 5A9SA 1A2BA 1NW8A 2HMYB 1ZNQO 3EZGA 2XVAA 2FE1A 5E3HA 5HM8A 3M1YA 4WH0A 3R3XA 3WGQA 2VAPA 3EEYA 3UFXA 4G0NA 2VKQA 2XWBF 1Q0RA 2NVOA 5EWMB 3SEZA 2P4SA 5EXTA 5KQGA 1XDDA 3JQPA 1B2LA 1RWOA 4JUCA 2EP5A 5TEVA 4EO9A 1VL5A 2E89A 4Z51A 2C9BA 3ZYCA 3QEJA 2JIDA 1YO6A 2O14A 1ML4A 1BX1A 2AZ4A 4AG3A 3DKVA 3BZWA 3OH8A 2IQ5A 1XZFA 3BVPA 4LJ8A 1A71A 1N4DA 3WNBA 2RK4A 3BF8A 3HP1A 2VJCA 3NT5A 2V9PA 4EK9A 1C9MA 6YASA 2Y66A 1JXAA 5A0VA 2I62A 2O05A 3P2JA 4EA8A 1YZQA 2BZSA 3G6WA 5J1SB 2QZZA 2JANA 1JJBA 1ZK2A 5DEOA 3TBHA 1VMDA 1W5FA 4G1VA 4MB0A 1RHJA 3CNBA 2WYUA 2VK1A 4LCEA 4G65A 1L4MA 2PBFA 1M2EA 3L7CA 3MWEA 4LI0A 4WADA 3SS9X 5KU1A 2VRWA 5ULLA 4J4HA 1YSCA 4AB1A 3W34A 4CIDA 3E70C 1ZD9A 2V3WA 5KNCD 4H7IA 1JA9A 1BVRA 2J9RA 2IU3A 5JFGA 3KWJA 1JG3A 1YT5A 1WU8A 2FRVA 3FPKA 2VSXA 1CP3A 4GLOA 3P0RA 5ECDA 1KYXA 2DFPA 2O6HA 2Q9AA 1QGOA 1LKZA 1CX9B 2WJYA 3X1ZA 1NPYA 5C3MA 2CFCA 4N41A 3C3YA 1E2IA 1P7VA 4DMFA 4GR5A 3JQAA 4KHPB 3KSRA 2BONA 3PXXA 1DAFA 1E58A 1F1BA 2E87A 3IEIA 2LD4A 4XFKA 2WUWE 4CF5A 4KR7A 1MGPA 1QFXA 1T2NA 2TSYB 3F5QA 5D8DA 4N5HX 1G42A 2W83A 3LSTA 4BO9A 4DMLA 3BKWA 2JAWA 4EJMA 5SZIA 1RIFA 4IWYA 4IJMA 3VPHA 4UOZA 1KAGA 3HR8A 4E15A 3KV3O 4ZYXA 4ZOLF 3JWHA 5D86A 4KAXA 5FOXA 2GFQA 4M46A 4CKXA 1ZU5A 2CUNA 1MO3A 3IXQA 3VC2A 1NDUA 1ODLA 2CZCA 2JIOA 3GCDA 2LCQA 1H5QA 2Q28A 5C34B 2YHIB 1U2QA 2CEAA 3FLEA 1PJ3A 2ZIWB 4L4SA 3SHWA 2VTEA 4KRXA 4MEBA 5DXAA 3QFFA 4ZHSA 4FE3A 1GTJ1 2WHPA 5JPCA 3R9WA 1PS9A 2ECPA 4L4XA 1CUHA 5CR9A 2SBTA 1TK9A 1XLWA 3GAMA 1DAHA 1AQNA 4EY6A 1II8A 3JY6A 1X7DA 5K0SA 4DV0B 3FKSA 1DO0A 2EBHX 4MROA 2H17A 3RR2A 5A9RA 16PKA 3T3OA 2QTWB 3M6FA 2PO5A 3N2NA 1E62A 5K99A 4MW1A 1E9BA 1EG7A 2HWYA 2H2DA 3LQ1A 4O2BB 5I7OA 1AH2A 1ZS9A 1WXDA 2XYHA 5L3ZA 3DQPA 3PDIA 4QU8A 2UYOA 2YC4C 2H5LA 3FB1A 3VNBA 2HIGA 4RF5A 1N2CA 2Q21A 3VAAA 3GELA 3FSJX 4GX1A 1KXZA 3GFGA 4MV6A 1SPXA 4TN5A 3WYAA 3ZZTA 2OD9A 4CM4B 4EJSA 4X7BA 4L28A 3QU5A 2B4KA 4TQGA 5ALWA 3TG8A 5EZQA 1FJGB 5AKKA 2W22A 1UOQA 2ZBVA 3ESDA 2GM5A 1M2VA 2V5VA 1Z0SA 2B1JA 2WHRA 3RRFA 3WG9A 3AFMA 3OM0A 5EEHA 4V0LA 1WXFA 5P8WA 3WLJA 4F0JA 3PNLA 3PSAA 1T15A 1I4DD 1ORWA 4G41A 3UJ3X 4E6PA 2AUNA 2Z9BA 2AD5A 3EYAA 3F6YA 3GJ5A 4FHDA 1X1RA 1U3WA 4KK4A 4PEVA 4BV3A 4EGSA 5FPKA 3NTRA 5KC8A 1X7XB 2B3TA 2XZDA 2VP5A 3ESYA 4QRIA 3W5JA 2IEZA 1CEEA 3TO5A 1CNFA 3CLKA 5A0FA 1V39A 2WTXA 2WQZA 3ZIUA 5JBQA 1VPEA 4MVJP 1YUNA 2FPPB 3K1ZA 3M82A 4UTOA 4ETWA 1A95A 2Q4OA 4JC4A 2J5BA 4LGCA 1X1EA 2XVXA 1B8OA 1LRLA 3D3NA 3GN2A 3KHSA 4PO8A 3RRXA 1SAYA 4M4SA 4YJFA 1M73E 3W04A 3JQFA 4MYDA 2CV2A 4FMCF 1UINA 4BNDA 5A3JA 1U9JA 2DTDA 3DZGA 4LJ5A 1K6IA 1RP1A 2JIMA 3NWJA 4JJEA 4AXXA 4ZYTA 4R69A 4D1YA 5ALRA 4A7PA 4ZPXA 1TXGA 1RQRA 2SHKA 3ETJA 3BRCA 4LPKA 2GEUA 3T3NA 2R7AA 5B3AA 2JBWA 2C0CA 1XNRB 2CFIA 5BMVA 3KKZA 5FAKA 2IU0A 5HTOA 3BE5A 1VCNA 4IV5A 2PNJA 1J1ZA 2AG6A 3E6AA 4EELA 4OP1A 4HXYA 3D6VA 3KSDO 1J2RA 3O4VA 1V96A 3KAPA 4L15A 4W5RA 5FUBA 3TTTA 5DASA 2H59A 4GH5A 4OEHA 4E0BA 4YK7A 3SIRA 3VAZA 4K6CA 5DX0A 1E1DA 3OWXA 3MQ4A 4ZCRA 5BQOA 2J0SA 3OA0A 1X7XA 3BH7A 1R6AA 1SQGA 2EX1A 2J7PD 4F2PA 1RXSA 1AC5A 2AOTA 4YJ3B 1O0CA 1NNUA 4YMUA 4JT8A 1QRTA 4BCCA 3EC7A 1XRSB 1U04A 1PO7A 1Z68A 2HDWA 3E7WA 4K2HA 4QEZA 4TTQA 2IH2A 4OLBA 1JKMA 3E5HA 1FFXA 4LZJA 3LUDA 3FPCA 3NAMA 3EGXB 4W9MC 2WJ4A 1YBMA 2QYOA 1JG2A 1K98A 1UFVA 2Q4BA 3U1VA 1BVHA 3H2YA 4IAOA 4W82A 5KSOA 2YKGA 3AUTA 4Q7KA 1PQUA 3ZIAA 1BYUA 2FPXA 2I6QA 1R16A 3RS2A 3T9BA 4D0RA 3OPYI 1G7SA 2QNBA 1OH6A 5T67A 1ZD3A 5DNWA 4C22A 4IQ8A 3OCUA 3KXDA 1GZ7A 4JOBA 3QVVA 1QV7A 4YLYA 4P4NA 1Z4LA 4A82A 1KZ4A 4JKIA 2Z9CA 1SOWA 3AONB 1FFGA 2VRCD 1P3DA 1Z0AA 3PL5A 2JLVA 4RD2A 4OXIA 4M83A 4ENRA 4RTNA 3GO4A 1V7ZA 1ANKA 3B13B 5KQPA 5I47A 3BF7A 4MLZA 4OF4A 1VGQA 2N47A 4Q12A 3ANYB 1VP3A 1LWOA 1LZKA 3BE8A 3BQNB 3KHKA 4Y2TA 3X0DA 2XRFA 2GPNA 1IJEA 3IH5A 1GG5A 3Q85A 4RVSA 1ONBA 1ZKMA 2FXIA 2YASA 4I8XA 4NJEB 4RFLA 2R86A 3WZLA 4DLUA 3QKSB 4HB3A 5SY6A 3K1AA 4HK4A 4LYEA 4DLSA 1Z2DA 4ER6A 1X7ZB 2Y9PB 1G18A 3WGVA 1ISJA 1M8GA 2ZUUA 3IURA 2JZOA 2Q5CA 1S2GA 5ALFA 1FRVA 2CK3D 1ISPA 4KZPA 4NXMB 1FYWA 1FU7A 3FPEA 6REQA 3E7PA 4MH0R 4NX2A 3SYLA 2SKDA 2C2XA 4JEMA 1XNGA 5JVDB 5DTIA 1NXWA 1KJNA 3WNQA 4DGSA 5JHHB 2L18A 1D6MA 1C7QA 3F8TA 3UW1A 1OAOC 4PO3X 1I6LA 3RABA 5I51A 3HVIA 1IC6A 3DAFA 3SAJA 3QV2A 3ZU5A 1YJCA 4DZZA 1TVCA 2JHPA 1ICEA 1J2JA 1K27A 1PBTA 4L9WA 3O6VA 4X66B 2ZUBA 2HCFA 2VNKA 3M6LA 1Z4NA 4EY4A 3GPCA 3BMNB 3O91A 5LLDA 2N0SA 2HRCA 2P5YA 4ATNA 5JALA 1HLGA 2B94A 2O48X 4FQ8A 4XWKA 2B2XA 2WKPA 5EGSA 1WJGA 6AT1A 1N3LA 3EC2A 4QAJA 4ZZIA 3WP1B 4UUOA 1JEYA 1KYIA 3O9MA 2PX0A 3HJGA 1BX0A 4LYAA 2GFIA 2CSUA 1T6NA 4TWAA 4W4TA 5GGYA 3T7IA 4IICA 5EWLB 2ZR7A 4NCKA 3U37A 4AWBA 4OMUA 4KIWA 3VSCA 4DB2A 5A1JA 1KP3A 1FXWF 5KOHA 2VJNA 1VLHA 1KO5A 4IHAA 1GPH1 2Z5VA 4DILA 5FLKA 4MQUA 1VE1A 3FWHA 2QUAA 4U2BA 2YVLA 1TQ2A 3FPJA 4JVNA 3SFVA 5ITSA 4EWLA 2CYBA 4UM9D 5GV7A 1B23P 2IIVA 2AZDA 1V3VA 2RGYA 3BIXA 1OIWA 1TF7A 2J59A 3E1SA 4JP8A 4QO7A 5EZYB 3V97A 5AUNB 4O08A 5I3CA 3ELBA 1V9CA 4KUGA 3A6DA 3KV1A 5IMSA 2ILVA 3L40A 5J3JA 3D7LA 3GW8A 4A9AA 1L5YA 4JBWA 3EZLA 4FC7A 4JWKA 1WDWB 4I50F 4IXMA 3UW3A 5EIBC 3UOAB 1WETA 3FOBA 3L6DA 5IF3A 2YTZA 4GMFA 5G4KB 3WRYA 4DG8A 5DRTA 2WLSA 4P92A 4R1PA 3R8XA 5A7FA 3KTAB 4Y1RB 1T5TA 3D6NB 4YRLA 2W58A 3IMFA 4ZIRA 4DEYA 1MX1A 4C4ZA 5A5EA 4ZK6A 3ZDQA 3IJPA 4BKQA 2W43A 5L45A 2AHOA 3L7BA 1U3CA 4QLOA 1JDPA 3JVEA 3C1TA 1P80A 2V9CA 3GFBA 3KVRA 4ZV9A 3SXUA 4EG6A 5EN4A 1I1HA 1W48A 4PYIA 4P8RA 2BJVA 1G4HA 3OM8A 3LDHA 1JFSA 2B35A 5HCIA 1KI3A 2IBSA 2DHRA 3EUFA 1FSGA 5DE3A 4YX9A 5TIIA 1ZU4A 2CUZA 4H6PA 5A5DA 4NBRA 1C3OB 1EIWA 1UOOA 2X1LA 1FDOA 3HU1A 1Q7TA 4HB0A 3I61A 3KQLA 3HY6A 2CVPA 3HFJA 1RBYA 3GDHA 3I1JA 4EYEA 3ICEA 2OCKA 1XJCA 3I6IA 3HI6A 4L5CA 3PZRA 1PJ8A 2P7HA 1JEEA 4R16A 2CL7X 1YCGA 1RYMA 4YRDA 4D8WA 4DZTA 1OFIA 1UBEA 1NBWB 3UCXA 4QBKA 5CCEA 3HL4A 1OVGA 3LVRE 4ABYA 1CIJA 4UULA 4FLEA 1VSUA 2HSJA 1YDHA 3GNSA 4N3BA 5C4GB 3L0ZA 5FOSA 5JWHA 3G02A 5EJMA 1KZ9A 1SUEA 3A1FA 3G8CA 3JZMA 1JWLA 4PGFA 3BFXA 3S29A 2ZS9A 3N75A 1BA2A 1FXWA 2GWRA 3PLNA 4PSAA 4Y30A 1LBTA 2V7PA 4ALIA 1QP4A 4X20A 5K7SA 3DE4X 4QC2A 2BGTA 5AHRA 4WBXC 3THXB 2ZIXB 2BWJA 3QX8A 4RCVA 4BQSA 2QRKA 1C9JA 3R3WA 1U7HA 3PFCA 4HKTA 3GRVA 4RESA 5G0SA 4R1UA 5T4HA 5K5EA 3AVVA 1T5BA 3UQYS 1UIMA 3ZLVA 2ZZMA 4OBWA 1JZSA 4IHJF 3ADPA 2NU8B 2X4DA 3LQYA 1M1NA 4HMPA 5F76A 5HZHA 5D3MB 1K8RA 1SXJE 1KP9A 2SCUA 3PIRA 1GRRA 2XQVA 3O1IC 4JK3A 5COQA 1F6BA 2F1HA 4AMZA 4EHFA 1B93A 3JAKB 3UB4A 4N76A 1WF3A 3DG9A 2R6GA 2X1MA 5B64A 4F2GA 3AF0A 3HZOA 3C1UA 5D5QA 1IVSA 3G7NA 4QYSA 1N2CB 5AT1A 2VHCA 4FGZA 5B1DA 5IS2A 1CDOA 3EQZA 1K3FA 2JJ8A 2X6QA 3FUCA 4KSBA 3VNQA 4JFAA 1H4SA 3PS9A 4NU8X 4BTLA 4BLRA 2IEAA 5FADA 2MSEB 4NMMA 4XD7D 1XA4A 2WWFA 1UT8A 5CLGA 5EYPA 2OM6A 3ENKA 4C05A 2Q3FA 4GXTA 3DBHB 2QD1A 2P9QA 1CRZA 2V03A 4EG4A 2P35A 1LK0A 1XQ9A 2OYSA 2WFAA 4M9XA 4ZJUA 4KPGA 4U6QA 2JBAB 4CKBA 3AHJA 2GXAA 2VYVD 3IEUA 1O77A 1Y6GA 5L4SA 1F3OA 2PHZA 3BWCA 1RI3A 3M6MD 1HOTA 1F60A 5AO9A 4D57A 3PGJA 1T6YA 1A7AA 3PDCA 3JQ8B 5ALMA 2RSLA 4O4HB 4AU1A 4YXFA 1A04A 4JAVC 5K8IA 2XYVA 3T9EA 1Z25A 1SUDA 1E2DA 2FFRA 1S6YA 1MV5A 3ZY2A 2OGSA 3BIWA 3CRMA 4IQ0A 1ZP6A 1A5SB 4LOIA 3M70A 4KPFC 1WB6A 1L1FA 3ZC3A 4BMCA 4LOJA 5GY7A 1JHQA 2VHQA 2YY5A 1VI2A 4WJZA 5D5HA 2DU8A 3IMGA 3H05A 3PHHA 1H2WA 3EPRA 4CI9A 1L7RA 3LIPA 3JU3A 4WLUA 3V1YA 4WKCA 5AW7A 4F4FA 4I0WB 4RZSA 3U7QA 3U44A 4Q0MA 3GBSA 4KXNA 5EXDA 2JGNA 1SUIA 2PGXA 4NNPA 3VYUB 1XZIA 2FFQA 4LXHA 3TQIA 1E7MA 1CC1S 2ID4A 4I8IA 1E6CA 2B8NA 2IL1A 1UKVY 2Y92A 3S70A 3TX2A 2GPWA 1N5RA 1AZTA 2GVNA 2LVBA 1MP0A 3AYZB 1E9AA 4JENA 3TTVA 1GUZA 2JFNA 1JR3A 3VV2A 3SR0A 4ARVA 3TEMA 5CDFE 1A97A 2OLJA 3GWZA 3NYQA 1ETUA 2FUG6 4FVTA 4F3NA 1JQ5A 5JSFA 3FKSD 1N3IA 2B4YA 1T1IA 1I7DA 4OHYA 3U7GA 4E3ZA 2FB9A 4FYPA 3HACA 3O03A 1PNOA 1M1UA 3LPLA 4URFA 5FUWA 2GAJA 2WUDA 3N2LA 4G6ZA 1BHQ1 2JIBA 1AKUA 4LGMA 4YEDA 2FSIA 3ZCVA 2W6ZA 4CCWA 4F97A 1SOVA 3TSWA 2GF9A 4MZXA 2JG3A 1PGQA 4RZIA 5IT0A 1YHYA 3KXIA 1KSFX 4PQEA 1TFUA 3K9GA 4HDSB 1Z0UA 3TW6A 2O8EB 2PLRA 2H3HA 2FEKA 3ODGA 3STYA 5BRJA 4PRKA 1KI6A 2OLKA 3E7FA 1UKAA 4NS4A 2IKSA 3NUQA 4LECA 1FFEA 2YHAA 4OSPA 4WACA 1NRWA 3FMVA 4ZT6A 2YWXA 3BB4A 1OLSB 2O4UX 4L6CA 4ARZB 2BFAA 5KYXB 1UK9A 3LWNA 1UJ6A 1L8LA 2NPOA 5LP6C 4EFNA 3RASA 3K8QA 4DREA 4TMWA 2XHZA 1CR1A 2WJIA 3NIGB 2GHIA 4M0MA 1S2DA 4DMMA 2CZGA 2X5JO 3U3MA 2J3MA 1M6VB 1XKLA 3OLCX 5F33A 1WW3A 4QOGA 4TUYF 3TQRA 3WBBA 3ZDFA 4XVUA 3HY4A 4Y67A 1JLSA 2QRQA 4KMOA 4KG7A 3CA8A 1Q6YA 2XQGA 1WSDA 1XDUA 2ZU0C 4UXJA 4YAOA 1GKLA 5T41A 5K05A 2WFMA 4BRZA 1MJ5A 1QCCA 1VG9B 2FWRA 3F6BX 1FW6A 1WA5A 1HNXB 5BSVA 1W581 4D81A 1XQ6A 1A1SA 1ZH4A 3NHMA 1TD1A 3W5SA 4ZTBA 4EUNA 3CZCA 4TM7A 2CUTA 3AJAA 4IVNA 1RYBA 2QZ4A 2AKAB 1L8OA 1GGNA 5FTMA 1GSHA 4AZSA 2YJGA 1D07A 3V7YA 2JJMA 1C29B 1GAWA 1RP7A 2JHCA 3F6EX 4U7FA 3SN6A 3U62A 1U5CA 3E9CA 1CCWA 1TVKA 4BUCA 4DWVA 2WM9B 3H6HA 3NTOA 5FPYA 5IVKA 2DUNA 3HKEB 1KYWA 3DL7A 5IP5A 1UKZA 4LKRA 1GPDG 4MUEA 2XDWA 3RROA 4AMBA 3P97A 5AKJA 3AOEA 2VPWA 3D5TA 4OGFA 2I3AA 1Y3IA 3CRQA 4Z4HA 1ZRNA 4AJKA 1M2FA 4BWGA 3P52A 4HOYA 2Q3HA 4Q4AB 3ULKA 1FA9A 5AW4A 4NY1A 5JO9A 3II6X 4QG7A 3RWMB 2VWGA 3B12A 2GHQA 2AOWA 4M1ZA 5EQDA 3S2EA 4BV2A 2G9VA 4QPCA 1CRPA 2WTNA 4X6LA 1TYAE 1ECGA 4AAYA 1NATA 3VV3A 3AO0B 4EUHA 1N5OX 3HJUA 2AD1A 1V5IA 1B8VA 2WJAA 5DBIA 2YS7A 3TGPA 1DS6A 3KQTA 1BCRB 2I3GA 3H5NA 3IAM1 4OM7A 2JGEA 4WEQA 5CAEB 2PPLA 4V0RA 4OL0A 1JXMA 1L5OA 3C85A 3MB8A 2YMQA 4Y9DA 1XTQA 2VL7A 4NWIA 3HDTA 3RU9A 1VLZA 4AJ2A 3BA1A 3VH2A 5CXXA 3GRRA 1RHUA 3K1TA 4O4HA 5E7MA 2ISSD 3Q11A 1CDDA 4I6GA 4BZZA 2H2AA 2NTEA 1JI3A 3JVUA 3AU8A 4G0WA 2ZRGA 3SVZA 3AVWA 2CWDA 5AKIA 4D3DA 3GEBA 3A7EA 3A9VA 3P4UA 3IODA 3HRKA 4NV0A 5H16A 3NAZA 2OGTA 2P2ZA 4N65A 4YBRA 5MFZA 4C07A 1E0DA 5DN6D 4Y0AA 5ECWA 4WRRA 1FMTA 3O95A 3UVEA 1X1TA 2Q0SA 1HDXA 2XMBA 3KOYA 3PX3A 5FI0B 1SXQA 4J2OA 3EMVA 4S1OA 4JOSA 5CXQA 1FSZA 3O8CA 2H18A 3LTNC 1ZQ9A 4Y2PA 5DTEA 2MSNA 2BTQA 2DT8A 2JLAA 3JRWA 1GPJA 2CHEA 4J16C 4TGLA 4ZO8A 2GD2A 3AY0A 3LGXA 3PUJA 2FMUA 7MHTA 3C6MA 3JARA 3UJNA 4W9RA 2ZWMA 1TYBE 1JR4A 3EN0A 1ADFA 1KEVA 1D0VA 4BFXA 1FQKA 1IVNA 1PR0A 1QYVA 2RAPA 3PDJA 3QVTA 2HBRA 5E0OA 3LVBA 2RGUA 2Q3BA 4IIBA 2C7PA 1XL0A 2A0KA 3ZX5A 4YUXA 4LTNA 3F3MA 4RY8A 2B4AA 2F2TA 1F38A 4NZNA 3SYTA 3WE7A 4DJAA 1DFIA 4GSKA 5CFZA 3R40A 2HT1A 3IULA 4IIEA 2WIFA 4ARUA 2CFOA 4XM1A 5WRFA 2F90A 3DEYX 2C5LA 3HUDA 5B30A 2DXIA 1E32A 3KZKA 1ZW6A 2WRZA 3KDSE 3AB8A 2J7KA 3RYCB 4RY0A 4GAEA 1YL7A 1B0ZA 2VWQA 2WEKA 3DDWA 4UM7A 4Y8VA 2W2KA 4HMQA 3SM9A 3OQMA 3LT5A 1KGSA 1VJRA 4ANFA 5EHXA 3RAEC 1SIOA 3UAVA 2OV8A 5AM3A 4C7VA 4OAPA 3MJ4A 3VQTA 3B6MA 4GPEA 3ZNOA 1XI2A 3CNOA 3U7QB 2C2YA 1NMZA 3DZ8A 2F43B 1KYTA 2X22A 3QK7A 1XHFA 2IFTA 3SKVA 3JWGA 4TWZA 3W0LB 1IXSB 3DAYA 1UFRA 2D1FA 1Q0PA 3VOBA 3EZNA 3K2EA 3K3PA 3EVNA 2NO0A 2XEDA 4FDMA 3E9ZA 1MLDA 3EXHC 4O4IF 5KQSA 2O2ZA 3ETLA 5ES3A 1OOEA 3KJEA 4UHBA 2JFQA 4YRAA 3MTEA 3QFHA 2BVNA 3A1NA 4X91A 3SQLA 3HY3A 1AK9A 2RAVA 1EFTA 1V5EA 2X6TA 1G3QA 3NB0A 4RA6A 1FE8A 4DIBA 3H1EA 4ZVSA 1KOFA 721PA 4RMJA 4B3RB 1LBQA 3BXXA 5JOQA 3FFTA 1H6BA 3X43A 3RUHA 2AS0A 1MORA 5I01A 2GBLC 4R1TA 1P7WA 1NI4A 4P84A 1T36B 1N8TA 3MCTA 2G4LA 1ULHA 2CCGA 3CXUA 4LQDA 1MT0A 3C7TA 3DMNA 1JI0A 4RLSA 1BX3A 4L02A 3X1KA 1XCOA 4B8WA 3MC1A 3TTUA 5ECYA 4IQGA 3GJ8A 3MPUA 4JWTA 1CJTC 4EYSA 3OCXA 1L4BA 2X8AA 2PCLA 3URKA 1JHYA 2QD4A 5DM70 4YT2A 1ZSNA 1KFEB 2L69A 1F51E 1YA6A 3I2JA 1T10A 1M6NA 1X8XA 2QN3A 4UAVA 3HYRA 1Y8RA 1ZIXA 3LX6A 6CHYA 5LJIA 4AKIA 2NTJA 4CJXA 3IKJA 1Y63A 4UTZA 1PK7A 4E4TA 4AZ3A 2MU1A 2UVQA 1Z39A 3DWEX 4R1NA 3VH4A 2R00A 3RNOA 1GEEA 3C43A 4JI1B 4QULA 3RSQA 3P8ZA 5FTJA 2KX7A 2AXPA 1O95C 4W5HA 1L3IA 1U3FA 3O2JA 3B7WA 4NJMB 3TJZA 4BBPA 5KQRA 2IODA 3AFHA 4IOMA 4MUAA 1MQAA 1Y5MA 1GZVA 1WDMA 2HJRA 2Z2IA 4U6NA 1EESA 5ARBA 1TEZA 4YRGA 2ZB8A 3GLGA 4N8DA 1OI4A 2V7GA 4ZRMA 1HT3A 1D4OA 2VP3A 4KCGA 4XLZA 3K4HA 3QXSA 1P0PA 2G06A 3M4XA 4G24A 1P3Y1 3IQDB 3WXBA 1N75A 4FKBA 4F92B 5FPSA 3F9RA 2AFIE 3KOZA 2IYZA 3BCUA 2PX2A 2AEJA 2J87A 1Y9JA 4EL5A 5GIPE 4PONA 4RAQA 1VPWA 1JMYA 1G4AE 1N2GA 4LISA 1N7IA 1PN3A 4GVPA 3WAKA 1LD3A 5FL3A 1ENOA 2JI9A 3OCWA 3QVGA 4V3CA 5EHNA 3KKEA 4J1TC 4O4IA 4GC9A 1OC4A 4MQMA 3SZ3A 1RI4A 3M34A 4KR6A 4KW7A 3LAWA 2VPZA 2JPDA 4QT4A 3LU1A 3OQPA 2IITA 4BLPA 3W8EA 1H65A 2VK8A 3AR7A 2A67A 5EJ8A 4KI7A 3GEDA 2GM4A 1DJNA 1NLMA 3UZUA 2A1UB 3C3EA 3M81A 4BB6A 3DDZX 2HLPA 1U0RA 2FW1A 4P2BA 1RWXA 1L6RA 1W85B 5U1PA 4R2XA 2HAEA 2Z95A 1RJEA 2VH5R 5ESRA 3A2LA 3AK4A 3F5SA 3TVTA 3CLRD 2B1IA 2H29A 4OYHA 5G1PA 4IDFA 5TPZD 2GZHA 1U9CA 4S2EA 1RYEA 3LCJA 4N0DA 1MQ8B 3PFGA 2JLUA 2G76A 1Y0BA 1V3TA 2X9NA 5IW8A 2X6RA 5JTUA 3U7HB 5JNRA 1ZVMA 2OGWA 2ST1A 2Q5IA 3DEKA 4OHZA 1UBRS 4XFDA 1Q3KA 3NAQA 3NH6A 4M21A 4LZNA 4L8YA 1UBOS 1W4CA 1PIWA 1JFFA 3KLBA 4Y6QA 1JALA 5JCXA 4ZVOA 4PSCA 4ABTA 1P0MA 4LV6A 2J09A 3QFSA 4P7BA 1KRWA 2FP4A 1XU9A 3AP3A 1W19A 4YRRA 2E1RA 1LU9A 2ZBDA 2ZRIA 2R8RA 3AT1A 1L7XA 4HDCA 4S0XA 1BN7A 1QUFA 1AHIA 1M34E 1SKMA 1R0RE 1CQPA 1QFJA 1RT9A 3CXRA 3BIOA 2ZW9A 2OO5C 4WIAA 3V8MA 4G5QA 4YQZA 1GZ3A 3E9RA 1BTOA 4KWCA 3U13A 3DUWA 3GUCA 4CM5A 2KB0A 2XPCA 1QHGA 4HEQA 1ISRA 4IZOA 1VZ2A 4IVRA 3RAJA 2XTAA 1IXKA 1K9VF 3SLRA 4LF9B 4PE5B 3OG9A 5K2MA 1KBOA 4ER7A 1UM9B 1SN7A 3KBOA 3CX8A 2ZRQA 5F3DA 3FHJA 2CNOA 2FU5C 4WCVA 2GCGA 3PHGA 3H04A 3LX4A 5DNCA 2XUAA 3K0FB 2VH1A 3OU7A 4XVCA 2Q3EA 3PUKA 4XZ3A 4QIHA 1F2TB 1KMQA 1DVRA 2JAOA 3HE3A 3CH4B 3Q7QA 2Y1XA 4WZ6A 1QDEA 4X1IB 5DX1A 3FDZB 3T3HA 4P81A 1X8LA 3HH8A 4IKEA 1II0A 4N40A 1A9XA 221PA 3K6JA 3S7TA 3QY9A 2O50A 4TL6A 4YP6A 3K5HA 3I01M 1QMPA 1M2NA 3HKCB 4US0R 4DPKA 4D9NA 2ZIVB 1GYPA 5GP1A 3KPUA 4LVCA 3D3WB 1TPYA 1WHTA 3PZBA 5IDQA 3EEOA 1AUQA 1B6TA 4PAQA 3OICA 4V03A 3FNQA 3S28A 4HH3C 1PFUA 2RHWA 3QNUA 2IY7A 5E2IA 4CGYA 3PE6A 3NM6B 2HPZA 4EW1A 5JASA 4GKJB 1OX4B 3QU4A 4OSEA 4EJ0A 2VYND 2DVMA 3AR5A 5ALHA 5GMOA 5U4QA 1PZGA 4F46A 5CEEA 2WQ6A 1ZJ6A 3PP8A 3MBIA 1JAHA 1TZBA 3RVQA 4GPBA 4HVLA 3IT1A 5EZ6B 3E3LA 5HF8A 5L3VA 1XTZA 1SQ6A 3RVOA 2Q49A 2XWQA 5KKAA 2I3BA 2J0UA 2ZB4A 2I3DA 3CH6A 4O8ZA 5HS6A 1GZHB 3OCZA 2V6IA 4OKSA 3KR0A 3BE6A 3TRDA 5MF6A 2OKCA 5ELXA 2DBYA 5CW1A 1MX9A 5AH0A 2PUGA 3KB2A 1M1YA 2GB4A 4UXHA 4Q3AA 4TTVA 2ZI4A 1IG3A 2QX8A 2R84A 1WE2A 5JFOA 3HR4A 2PLNA 5FF9A 1MAAA 2PANA 2VDVE 3A11A 4BNNA 3U9LA 3TTXA 2JRCA 1PFWA 2G83A 2O3RA 4UOQA 1E2FA 2ZUEA 1F9AA 2H0RA 5FIUA 3VJLA 3PPYA 2C8LA 2O19A 5LA6B 1POXA 3F7TA 4X1IA 2PTGA 3R6WA 1CKEA 4MWZA 5GJCA 4BFCA 2HQRA 3DC2A 3KOWA 3K92A 3W6OA 5ICCA 3FRJA 5K20A 3LXMA 4J0KA 3MUOA 4X44A 3WRXA 1YJAA 2EBWA 1FJ2A 2YJ5A 3B60A 3L46A 4Y7DA 4CM4A 2WJ3A 2IHZA 4RULA 4FOOA 3EZXA 2Y9MB 3OZUA 4FOSA 1NHWA 4K6MA 4N03A 4EB8A 4PN3A 5H3HA 1T4DA 2QG4A 4JL8A 1O87A 4RJTA 2E7ZA 3AP1A 2AQIA 3U7RA 2I1WA 5KIAA 1GRCA 1T2DA 2C2KA 3KELA 4UDYX 1J22A 2DUWA 2QTVB 5EFOA 3JD1A 3REGA 1RMYA 1LTKA 3ZE7A 3N87A 3HDVA 4DCGA 5ALYA 2HA2A 2FEXA 4IGIA 5CA0B 3PLRA 4TV9B 2R1UA 4OQZA 5AKXA 3L8YA 1N6RA 5C8YA 4YMIA 1PT6A 3RFXA 1Y1RA 2C9ZA 4AMYA 3CPJB 4FSHA 3AESA 4N7RA 1GY8A 3HCNA 1IJKA 2C84A 3UJAA 2ZB7A 2ZJBA 3G9UA 1QAOA 3QMPA 3D5EA 1ZICA 2X2OA 3ESZA 3L3BA 2FQ1A 3VISA 1RRCA 2HW8A 1WCXA 1SKBA 3Q9LA 3Q3VA 4DR7B 1GDHA 4XGRA 3PT5A 3H17A 3SOPA 2VNAA 4QPZA 5DHSA 4AM8A 2F9MA 5D85A 5GAJA 1PR2A 2JKYA 2XDQA 4RD6A 4DF3A 1XCBA 1OLUB 4DXHA 4DPLA 1KPHA 1E3LA 1I7LA 1IDN1 1K8XB 2OENG 1G20B 2Q3MA 4UTVA 1WBDA 4HFJA 3C3KA 3P9ZA 4UVDA 1VLVA 3QEOA 2A4MA 1DUIA 3O2SB 3UJ9A 2YVQA 1GSOA 3DOHA 4KL8S 4NEQA 4TV8A 3VR5H 2ZB3A 3IJRA 1KEZA 2AXNA 3H9JA 2PMWB 2Q5FA 1SUFA 1ODSA 3BEDA 4KLRA 1XRJA 1SELA 2NNWB 3GDGA 5FV4A 1HDGO 1CQJB 1EWKA 4L5AA 4PXAA 5K6AA 4YB8A 1JR6A 5FJIA 2FPRA 3KT0A 3QLVC 4A4DA 3DHNA 4P9NA 1H85A 4CQLA 1GM5A 1O3YA 1ILWA 3LY7A 3OOHA 3K1JA 3UG6A 2D5CA 4DY6A 1GILA 1SCKA 1XEXA 3DVRX 1NVGA 3OUUA 4MHSA 4ZU1X 1PWEA 2FWNA 4MIOA 2JDIA 5CA0A 4F71A 1W5SA 3CEAA 2Z8ZA 5KOHB 1YMVA 2Z30A 1R0ZA 1VJDA 1ORRA 1GUYA 3DT8A 1YU6A 1KKUA 5IJ0B 4EF6A 4TKMA 3KPYA 5D7BA 4PYRA 1GIAA 1VSBA 5BR8B 2DB3A 1PFGA 1T0JB 2I7VA 1GGJA 2QR5A 3UHFA 3L1IA 4BX9A 5KKCA 4A36A 3LXXA 4ENPA 2DKOA 3FTPA 4C2AA 5FLXA 1TYZA 3ITDA 1DBQA 1ES9A 1GKYA 2BBSA 5TQJA 2VC2B 3SFZA 1ZKDA 3HM9A 3OT4A 4TV8B 2O2XA 3GP5A 4M0UA 4EW6A 4HF7A 2I54A 1Z5NA 2DPYA 3OQ6A 2HUNA 2GUWA 2GN4A 2ZIFA 1A9RA 4QODA 3GP8A 2A0FA 4TLBA 1TJ3A 3ICQB 2NN3C 2QN9A 2VDPB 3GD5A 1QGUA 4Q9HA 4FCTA 3R3YA 3IP8A 4XQEA 3UYLA 3K0HA 3EXHA 5EXEA 2IT1A 1HL3A 2RHCA 5E1MA 4I1UA 1GT91 3SLKA 4OQFA 2QM7A 1U1IA 4G25A 4RTKA 3H4VA 2YXPX 3L43A 3FOEC 2Q6TA 3OVMA 1PDOA 2X58A 4YXWA 1L1QA 1D4ZA 1TO2E 2A5DA 2GGSA 2PT6A 3OPXA 1L4HA 5TS2A 3WLLA 4DIUA 1Z2CA 4P82A 2QNRA 4M1SA 1LW6E 1M7GA 2H11A 2C98A 3NKFA 4S1NA 2PJRA 4D25A 3ZZNA 1J5EB 4IOJA 2R6ZA 3BB1A 3IV9A 3EZ9A 5EI5A 2Q3JA 3TCKA 1S3SA 2YCLA 4O2RA 1YZGA 5BUSA 1KJ9A 1IWPB 1MC1A 2VG8A 3HPQA 1VL0A 3OOJA 2FMHA 5D2CA 4YONB 3ZWAA 4FYYA 5BR7A 3GNTA 4LE2A 2BZGA 4KAAA 1C8LA 4MVJM 4X60A 4PZEA 1DKQA 1QK5A 2ZYTX 2G1AA 1C3VA 3OU6A 4LY6A 4AX8A 2QZ9A 4DIOA 2GRUA 4OD0A 1Y1KE 1R3DA 2Z5LA 3TZHA 1ZGBA 2GPSA 3OPNA 4K6HA 3CO5A 1XPUA 2CV0A 1DJLA 3G1UA 5DYGA 3L0IB 5EMKA 3V42A 1BKDR 2PUTA 3B89A 2CC2A 5KJEA 1JWBB 1TB4A 1L5NA 1D2CA 1HQYE 2Y0DA 3BRWD 3K9QO 3OF5A 3PNVA 4W7IA 3DZHA 3OCJA 4BUZA 1E2EA 2C0QA 3DVAB 1FRFS 3OX4A 4QU9A 4YR7A 1Q0QA 4RQTA 2A4KA 1F8YA 3IKVA 4JQSA 4OYRA 1RBQA 1G8PA 3DNMA 1G5PA 1ZI6A 2WVAA 3HG7A 3LS2A 4RKRA 4Y6OA 3TFQA 2IUTA 2BE9A 2CBZA 2P30A 4LC0A 1XAGA 2XRMA 4BYGA 4L9RA 2FFHA 2QUZA 3KD3A 4B80A 1PGJA 3KQVA 1MMFB 1DAGA 3CRW1 4MUHA 4KRYA 2OORA 4QNNA 1W1UA 4AJOA 4HQ6A 1HZJA 3Q2IA 4WZZA 5LMZA 2HF9A 3WBFA 3S99A 1EFCA 1MW9X 4AKHA 1FNCA 4J49A 4C2TA 2PGJA 2QB5A 2Q1TA 4XOUA 2HK7A 1Y42X 4RQBA 5KCZA 1YR2A 1Z6XA 2M1XA 4QL3A 2I2AA 1R8YA 4ZN6A 4U5XA 3EIWA 1I13A 4Z9XA 3W90A 3NHRA 1FFWA 3EYWA 2LKDA 1JAYA 2QQ5A 5BSHA 4WCFC 1Q83A 4NMXB 4RMIA 2PGAA 4QFDA 5DYTA 4MV9A 2WY2D 4QG3A 3HXKA 5KDDA 2I8AA 1A4UA 3MFQA 3OO1A 2X2EA 1HG1A 2WYHA 4RHEA 5LZ4A 4ADSG 1WXEA 4RCYA 1IVYA 2I6FA 3M5CA 3K96A 4CMKA 1KO4A 4OBEA 3LQ2A 4Q3NA 4B74A 1Z83A 1ESNA 1U8UA 4KWHA 3ES9A 3BZBA 5JJ5A 4ZAYA 3I32A 1NTRA 4XYEA 4D4HA 3HN2A 3PJEA 4HO1X 3N7TA 3IT3A 5HZGA 5IJZA 1V7PC 2ONKA 1QANA 3KT6A 4FT2A 1GGFA 3PV0A 1C41A 2VCEA 4B35A 3I76A 4JC8A 1LQ2A 3TF5A 2FQQA 3PC8C 2WE8A 4JLBA 3RS8A 3VR6D 5LL6P 2VQEB 4LDNA 1QYCA 3QRWA 1AKWA 2WFZA 2WD8A 3F96A 4DG9A 2GN9A 3A6PC 1FS4A 4PGHA 3IQZA 2ZR0A 3TK1A 1IQRA 1DQNA 3LUGA 3WZ2A 3FWKA 3G9ZA 2HK8A 1T2AA 4HUQA 1UXIA 4QXRA 1GXSA 1NQTA 4M60A 2UXCB 1ADGA 4BNMA 3RI3A 4NH0A 2DKNA 1A2KC 5LFAA 1HR0B 1Y6QA 3IQEA 4GLFA 1Y4DE 3I58A 1XVUA 4FNOA 1W59A 3GEMA 2BEKA 4WLOA 4EG3A 4JLPA 4MV7A 4B9AA 5JSZB 3M3PA 1JDJA 4WNYA 2FMFA 2N1BA 2HO5A 2A5LA 4TSRA 2Z56A 1ZCFA 4JZKA 4MV8A 4N0EA 4BZPA 1XVAA 3LLUA 3PXGA 5TARA 1P2DA 3FGPA 4MQFB 1JG1A 5AI0A 3T5DA 4AI6A 3W8NA 3A3NA 3ED1A 5H59A 3TZCA 3VVMA 1RJWA 5BSFA 1V6AA 3NXKA 4M76B 1DAPA 3VDNB 1KPGA 3HKDA 4WBSA 2DLDA 4XD2A 3G2MA 5K03A 3PVCA 3Q6NA 3GQBA 2VT7A 5A7HA 1UC9A 4QSMA 4FWTA 2R1VB 3AF5A 5IUKC 5J2UF 1XNJA 2C58A 3ZV5A 3DB1A 5TQ2A 1E7SA 5BNZA 5B6JA 1C80A 4U0JA 2OA0A 2MWMA 1I4LD 1KHTA 3HN7A 4HNSA 4JJIA 3DHYA 2O2SA 2EL7A 4MUJA 4QT0A 3R0VA 4E46A 2YIJA 4MA4A 1YZKA 3ZHZA 2P9EA 3EIOA 1NF3A 4TWRA 2VSFA 2NZ2A 1B3BA 1XXHA 3ZQ4A 1FS5A 4PHFA 1Z6GA 2SCUB 3L7KA 4MI3A 3I9OA 4RZ2A 2PGDA 4WX2B 4B17A 3FHTA 1JDBB 1PUIA 4PFJA 4EUFA 2BPOA 1RAAA 2EZ8A 1D04A 4YRTA 2X1VA 3X44A 3L0BA 3FF1A 4ENWA 2VEDA 2ZU6A 4IF6A 3TPZA 1Z73A 3IAFA 2NZUG 2C78A 3FSEA 5BW8A 5ER9A 4CIWA 1T8WA 4MUNA 3ZCQA 1R0SA 1LV7A 2CJPA 1NYLA 2ZBPA 2PQ6A 1QE5A 3HCFA 4OCZA 1DWOA 1M72A 2JGFA 1KZGB 4K8OA 5B37A 3S2IA 1QVVA 1U8AA 2FZCA 2I7XA 1U9YA 1G291 2JJYA 4OHKA 3PE4A 4O1IA 3VO1A 1QB7A 2WUFA 3JQ8A 4KXVA 5E9WA 3OOEA 2Z08A 4EKGA 4XDZA 1XWWA 4HNRA 1GL9B 4DARA 3MRSA 5HJ5A 1BCRA 4BNHA 2G17A 3DXYA 3TAXA 2J45A 3RGGA 4F9EA 2KBEA 4QX6A 3V9PA 4R71A 2A92A 4LDAA 1Z9BA 1E6UA 2ZPTX 1W4LA 1YB1A 2RGNC 4A3SA 1M76A 1XX6A 5F7ZA 3IP9A 2XTJA 4Q66C 3HJFA 3WLMA 3DLHA 2ORWA 3AVPA 1FDRA 5C3UA 1J7KA 3K70C 1IBLB 1AKTA 3GWGA 2HIMA 4BMOB 1T1RA 2GJ9A 1JW9B 2JL1A 3N2ZB 4L3WA 5TQ2B 3B85A 4ZO6A 4BX2A 1PQ4A 4HVTA 4EZEA 1KBQA 1SBZA 4BKUA 2F3QA 1ZUNB 2AA3A 2YV4A 5H80A 2WIAA 4UVHA 3EDYA 3PEFA 1E9CA 5CYOA 1U0OC 1NLYA 3BL8A 1U0JA 1NBMD 2W71A 3CF2A 3JZAA 3GPLA 2VK4A 5CTJA 2JASA 5IYZF 1PZMA 2O20A 4G01B 4IMJB 5LLSA 2VJLA 4ENVA 1A4RA 1KS9A 2AMVA 4NECA 1OKKD 2YXDA 4B3DA 5AJUA 4ZJYA 1OBVA 1Z5UA 1L4LA 1ZLYA 2B7BA 2OBFA 3GEIA 4O8CA 3KQKA 3EFOA 4M0LA 2ZUSA 3E15A 2HPHA 3WGUA 2ZRDA 4JNCA 1IAVA 1JIIA 1YAHA 2QUHA 4MEAA 1IUPA 2LGJA 2Y6UA 2EVWX 5DGCA 1SVNA 5LDHA 4IO0A 3KVNA 4IH1A 4RX1A 2DJ5A 5AICA 2RB5A 1USVA 1PR6A 2I4IA 3DYBA 4HR7A 2VHEA 1XQWA 1PHPA 4A1FA 1PGPA 2RHLA 3GVPA 3SVTA 2H4YA 1E3SA 1G59A 3JQEA 3AOEC 3C3XA 1JPVA 1CRWG 3EUEA 4PBTA 5DNVA 3RRBA 1MJHA 1M0WA 4LCJA 4DLTA 5J23A 2IZ1A 1V0JA 5JYCA 1S9DA 2ZB2A 4IOLA 2BP7B 2PQ0A 1H8EA 3OZFA 3HEMA 4AF8A 4OA8A 2UZ1A 3KZNA 4RU1A 1NN5A 1U3GA 3STHA 3SYMA 4BTEA 4GMHA 4DNQA 2Y1EA 3U4QB 1F2UA 2CLFB 1MABA 2O2IA 3HCEA 1YBAA 3IEKA 2FSVA 3FYDA 2DH6A 4LJ6A 4M7PA 1MB2A 1MOPA 1MX5A 1M34B 4XWWA 1GVHA 1QTRA 4CQMD 4L6IA 2ECKA 5EP3A 1YBHA 5JVDA 1M0SA 4QFBA 1KZYC 2F43A 3A7DA 4YQEA 2O8FA 5KYXA 2GPTA 1IZ8A 3B6ZA 1E5LA 4ENQA 5EJ2A 3DEFA 4P3KA 1U7XA 4FEGA 2PJUA 3TIVA 4REOA 1JIKA 2ILTA 2CFTA 3PXDA 4HLDA 4PHHA 3Q3CA 1SUBA 3HCOA 4GP6A 3M3DA 3IILA 3OPMA 3G5UA 5CVDA 5DV9A 1T9GR 4GICA 2G5PA 1KY4A 2YOFA 3D31A 1O6CA 1LV8A 1DG1G 2L19A 4GDMA 4GQIA 1LLUA 3IUQA 3PUYA 3W1EA 4H08A 1OI3A 3S1AB 1PUXA 4G5FA 2R4TA 4OQMA 4ZI3A 1GNLA 3DHWC 2IE8A 3DO5A 4XFJA 3QMMA 4OK6A 4H4DA 3BWXA 4JYCA 3MWEB 1K89A 4NHOA 5THKA 3K9HA 2P69A 2ROQA 3RF6A 3T8YA 5A06A 1XMOB 1H4QA 2HYIC 1P2VA 5EQJB 4TMVA 2OV6A 4X63A 3OJFA 4HX2A 1FL9A 2A7XA 1IEWA 3EUAA 1QK3A 1PR5A 3WX0A 4AZ0B 3QWBA 4PXYA 1NVMB 4OI2A 1OH5A 2UV8A 3N2KA 2IEDA 4EHAA 3BD9A 1IPFA 5AOVA 4XCQA 4UASA 5JNTA 3CNLA 4QUDA 2A3NA 1XU4A 1ORIA 2B4RO 2QHXA 3PXUA 4G4SO 3SJZA 1V37A 3PXEA 1OXVA 2R68A 2KE5A 1AK1A 1KR2A 3DZBA 4JVSB 3I73A 1MFZA 2HF7A 4KIGA 2ZSEA 4TLEA 2ZWPA 4UHDA 3L1UA 4G8BA 4PAOA 1RQGA 1GL6A 1IDOA 2CYAA 2DM6A 2AYZA 4TWBA 2PUFA 2M6LA 3S8YA 1N9GA 4KVGA 1E9SA 1CTQA 1P2BA 1VYTA 2P0EA 2YFQA 3JQ7B 1HK7A 4NENA 1GITA 1K3TA 1RRKA 4H6VA 3L02A 2VDWB 2WIBA 2VQSA 3EXAA 1R0BA 3NDJA 1V45E 2AK2A 5JJLA 1YGPA 3KQYA 5DO9A 4BE4A 1RWBA 1EBBA 2QS9A 3MFYA 3PVSA 3IVXA 5BWCA 3R7WA 3ZW7A 1QS0B 2G8NA 3TZ6A 1QZTA 3ZUPA 2G72A 4G56A 2X3FA 3NHWA 4DSNA 1NWHA 3H8SA 4NC9A 3O8OB 1WVIA 3WRYC 4OQXA 4DCCA 5ALGA 3RHSA 5AKLA 2F9FA 3NAGA 4L8FA 1WZCA 4LZAA 5D00A 1BWRA 1TRKA 2H48A 1VKNA 2VSOA 1Y3AA 2Y27A 3A14A 3DTYA 2FW0A 1TZKA 3GRKA 4P08A 4PQRA 3RIMA 4F5WA 1V8DA 2AFHB 4FHEA 1YDFA 4E5PA 5H5JA 1CZHA 2ATXA 3HZHA 3H0CA 4MDYA 2PPVA 3IUMA 3EIFA 4L6AA 4MV4A 1NJ2A 2AW5A 1A8QA 5K3SA 4CHTA 1PAUA 3CN9A 3W1WA 3MJHA 1PQPA 1QBGA 1CZNA 4C04A 4GOOD 3E58A 4U2KA 4JLUA 3DAHA 4J2HA 1GTG1 2BDTA 3HA3A 1E9RA 1IULA 2I7DA 4P3NA 1FP4B 1B76A 4Q5IA 2QMHA 1EDEA 3MA0A 2GSDA 2DHCA 4OGGA 5G02A 2IWRA 4BVHA 4F6RA 3WKEA 1EGHA 1TAGA 5MN4A 1NUUA 2BR3A 1Y8ZA 4FFVA 1YCHA 1I36A 1RLTA 5FHRA 2R5FA 1QGZA 4OLHA 5KNCA 4FYJA 4ALNA 2HEIA 4EX7A 4YRJA 3H8JA 4WXHA 2QTFA 5J5VA 3RJTA 3TI7A 2P3OA 4AWAA 4DN6A 4BP9A 2ZS7A 2J0EA 1LF5A 2B8EA 3DBLA 3DXXA 3P0JA 4X65B 1L4EA 4PW0A 2YMLA 4XTCS 1C0EA 4ND8A 1H9CA 1QHEA 4X7RA 3UHOA 1YI1A 4OHXA 4P4SA 1NDQA 4KFCA 2FHSA 4UDXX 3WSVA 3CKLA 1AXGA 2DWOA 4GM1A 2JD2A 5CFQA 2GSWA 3BRWA 5CLQA 1WCIB 3MCZA 3WHPA 4ZK2A 4B3IA 3A36A 4D96A 5HCNA 3EQ8A 4LOKA 4UCWA 3VYVA 1HY3A 5JSZA 5BVGA 1GQ2A 4ASUD 4OJMX 2WYIA 1SBHA 1B0UA 3MINB 2P4HX 1W96A 1F48A 2D0DA 3B9QA 3OEHA 4B0PA 3BHMA 3PYXA 1H1LB 4OTZA 3S3TA 4QOEA 3ZU2A 2JGDA 2HWWA 4CDMA 1P18A 1X9IA 3QTTA 4H1TA 3V1MA 4HDRB 4ONEA 4RADA 1O0BA 4U7TB 4E70A 2I5PO 3FUWA 3RVMA 1BDIA 3DBHA 4FOTA 4TTJA 3RF7A 3BMQA 1AUOA 1R8JA 2VF8A 2HHCA 2RDMA 3GROA 4QBGB 3HBLA 4DQDA 2XI4A 3EJWA 4DUPA 1D4FA 1JU4A 1IPHA 2F3RA 2JBHA 3DTVA 3KSMA 4M99A 2HDHA 4FBMA 1SA0A 4MULA 2MYNA 3A32A 1NTOA 1ZK4A 1WTAA 4NBNA 4QPDA 4UTXA 4WECA 4EVQA 4YRMA 2I91A 2P41A 2E0IA 3H9UA 3L4EA 5F35A 1P2GA 4ME6A 1EAMA 3MW8A 4M54A 4AYTA 2GWHA 4BNWA 4N47A 1L5QA 1NN3A 2V7QA 3IQHX 3RLFA 2XOKD 5L4NA 3AVXA 1T9CA 3OU2A 3PQFA 2KW5A 2WHXA 3CNEA 3HI4A 3U7IA 3T94A 1L3BA 1IHXA 3PWTA 2Q6IA 1UXOA 2X0IA 3HB1A 3EBLA 3ICVA 4II3A 4LYHA 4IMPA 1TEVA 2B9EA 4JODA 1QHFA 4Q7LA 3WJAA 2NQTA 1ZPDA 2WM8A 1WW8A 2CHVA 3MTAA 1X1BA 3BULA 3QFTA 5DMXA 3CLSD 4MI6A 2BN4A 2GEJA 2ZT5A 3HBFA 4OU5A 4DDTA 5JZ9A 3DLBA 5H3LA 4G2TA 5EIEA 2W90A 2EWWA 3IVMA 4OJQA 1H6CA 3H9EO 3IKMB 2PWAA 2VPTA 3GGDA 7MDHA 2WBLC 4RK0A 1Y81A 1E6KA 2OCAA 4W99A 4N0QA 3VOAA 4BB0A 2A58A 3IR7A 2CXPA 5EMMA 1GDTA 2HKIA 4GGOA 4PWZA 4P0PB 2ZIXA 3ISTA 1SZDA 1DTWA 4BCBA 3MJSA 3N2EA 1OIVA 2EFHB 3E03A 3GMDA 4I2VA 3BE4A 3GJ6A 4LCBA 2CLCX 4PCAA 1FF9A 4D45A 4EKNB 1CZRA 3E1GA 4US1R 4URHA 5KVAA 2AJTA 2FMXA 3LDUA 2ZSDA 4Q1BA 3SJAA 1KETA 3ZQJA 1JHUA 2P9YA 3M2PA 2NW6A 2QI9F 4NOKA 2O2CA 3X1DA 1OGYA 3V4PB 2OM2A 5JRJA 5C35A 4I4TF 4B3GA 1WLYA 5DYYA 1REQA 4KV9A 1PJ2A 4EA9A 1OPRA 1SD5A 2QROA 1JQLB 2XW6A 4TZKA 1NL3A 1LUAA 2VZ0A 3SEFA 1B2RA 3KAKA 3R0JA 1FNMA 4KMMA 5CA1B 3GJYA 1KE1A 1W4BA 5JNLA 2Q27A 4BUJA 2J31A 2V7UA 2QZPA 1AQLA 4BNTA 4GXNA 5CG1A 3HVKA 2I33A 2W6JD 3A25A 3O4IA 5ALTA 5CFOA 4J6EA 1J6UA 3OEYA 5A3RA 4YPFA 2G4VA 3COWA 3WP0A 1JJ7A 2I34A 3NHKA 3O4GA 2Z3VA 3NVDA 3O82A 3TQTA 2BGIA 2Q1WA 2BC9A 3I5AA 5K3AA 4DQXA 2XUFA 1KIAA 1C4KA 2WG1A 4I1SA 4NQRA 3N8IA 2VBIA 3QKTA 4KNYA 3K4PA 4G63A 4YJ2B 3DS8A 2O0KA 2OGZA 3RVLA 4DDUA 3CZRA 4I36A 3UCFA 4BMVA 3CWQA 5CHYA 2CXXA 1IN7A 4XYLA 3MLAA 3NP9A 1EA5A 3WIUA 2I6SA 2VSQA 3RK1A 1WOMA 3WIVA 3P2IA 2RC5A 4XPIB 2RD2A 1Q21A 3AESB 3REFA 1MH9A 5JNSA 2HRZA 4CKYA 1PVDA 3JSAA 3AEXA 5AKZA 3CKMA 1R6TA 2VZLA 3OPVA 1YNSA 1JXOA 1T5OA 2LBPA 3OA2A 3QENA 3WL3A 1N5DA 1EVEA 1B41A 3GVCA 5E4YA 1G8MA 3DE1X 2GRJA 4K2AA 4UAUA 5FL7A 2XCRB 1KO1A 3GGSA 2FP3A 2NZVG 1M34A 3NC0C 4JCOA 4O33A 2H3EA 2DFDA 5E9JA 4MTCA 3TL6A 5MDHA 2F4VB 3VR4H 5HHTA 4F8JA 1YFJA 4QGAA 4I4TB 4BE7B 3CONA 2AE2A 1RLUA 2MR5A 2DHEA 2PRSA 4IGAA 3RJMA 4GC5A 4OQLA 1DXOA 2EHJA 4ALKA 5IZ4A 4FOPA 4IDDA 4Z0NA 3S44A 1X9GA 4BKRA 2VS1A 1TYEB 4MUXA 1SWVA 3MINA 2AFIB 3D7SA 3RUEA 4D8VA 4O2AF 1FCJA 3K0FA 2OAGA 4TROA 2AWNA 3MYYA 3CX6A 5K3DA 3PEYA 1UPTA 4QVGA 2DBZA 1QPGA 3HKBB 4O29A 1QP8A 1Q1GA 3K6SB 2P7IA 3IAM6 3W3AA 1D1PA 1PJTA 1ZIOA 1B3RA 2HPVA 2Y0PA 3BTVA 3CE9A 1NHGA 2XZPA 5FQOA 3FDZA 3GLGB 3IUJA 4DDVA 1LJUA 3D3EA 2W6PA 4J0CA 1U0GA 1GG2A 1XYVA 2V3CC 4MWBA 3GBVA 3LLCA 4RHFA 3R0ZA 2R00C 3WYEA 3CUVA 1XFDA 2FX2A 1DRWA 3LX8A 4EJSB 1HGXA 3IAXA 4J7CA 2PZGA 3ESCA 3ENVA 4ZMBA 1SG6A 5TMPA 3L8DA 3K0SA 3RSGA 3EDOA 1Z3CA 1IBCA 1KMHB 3ICCA 1D1QA 2AQKA 2WWWA 1YZFA 4IJ6A 1B00A 1F2VA 2AYXA 2AMJA 2B4QA 4UUPA 5FUYA 3S1AA 5JWRA 2VP6A 3I05A 3TTYA 3T5PA 1MQSA 1PWXA 3WB1A 2Q99A 3UFXB 3OZXA 4JJFA 2GVDC 2G3YA 1B16A 5D6NA 2B7CA 2IS4A 3Q8LA 4W7SA 4E2ZA 1P1IA 1XTJA 1I4OA 4GZ5A 3C8DA 3QOYA 2QJTA 3GYBA 3NQ41 1WBJB 4O0LA 3RWOA 3B3QA 3ZD9A 1GP2A 5B58C 3QF4B 4G1CA 3SFTA 4LJYA 5U4XA 1B6SA 2FPPA 4LRYA 1ZK1A 3GZNB 3HCAA 2JCXA 4JLSA 3GFQA 5BSGA 4RABA 3LPNA 1OLOA 1PEAA 2A0YA 2OUIA 3OFSA 3QPAA 5JECA 4XTRA 1HZZC 2I2WA 2CN1A 1FK8A 2AI1A 5AP9A 5SZJA 1EFHA 3CURA 2QMZA 5G1OA 4YV7A 3DVSX 1QC5A 1ZOIA 2QE6A 4I9HA 3ZE9A 1CJBA 3PDHA 3NETA 5D5PA 2ZAGA 2B5VA 3DM5A 1O6BA 1N9ZA 1SA0B 2JFZA 4NQZA 5KJ1A 2MINA 1XGKA 3LT0A 4G5YA 2QLTA 5JFTA 3H7AA 4TSFA 3AG6A 2C82A 4E12A 2OHFA 1K2WA 2VDWA 1C7FA 1VZ3A 1BJKA 3CH5A 4O2AA 5HIIA 5B7PA 2D2EA 2ODAA 1OSNA 2X2PA 2CBXA 3C8MA 4Q01A 1NRXA 4YN3A 1R0WA 4B31A 2W6MA 3DXZA 4DUGD 4YVFA 4YMVA 4AJHA 3DLTA 3T4UA 3VU3A 1GLGA 1AXRA 5AXDA 2AI2A 3AI3A 2JC3A 3WHKA 3P0FA 4PG4A 1ZR4A 3IDFA 3S1SA 4HJXA 1R2QA 2XT9A 1FP4A 1L4GA 2Z5FA 1G3RA 2I87A 2PKRA 4P33A 4PYMA 3EAQA 3G0HA 2XCSB 1L7OA 4QTUB 4YUVA 3QE9Y 2X0NA 4E2WA 1LBIA 4OHCA 3ZD8A 4BXOB 3ENWA 1XHLA 2QN2A 3PTZA 4IL5A 2OMEA 4EJSC 1MJNA 1WW2A 2ZRAA 4KK3A 3U3JA 4HAYA 4BGUA 4KMSA 4OIFA 2C5GA 1L7BA 1X1QA 3CGWA 2GO7A 5JSQA 1OBCA 3NBKA 4ZOQI 2P9CA 3O31A 4KREA 1BMDA 3N8DA 3GDOA 4CKCA 4YJHB 4GUAA 3L1VA 3Q2KA 1BJTA 4AUKA 3W5BA 2ZXEA 5FX2A 1LJLA 2HV9A 5IEJA 3KL4A 1NFRA 4UREA 5AM5A 4QQRA 3HU2A 2NADA 4TL9A 5DWDA 5HUJA 4D9IA 5BYJA 1PZEA 5TX7A 4QTTB 3W06A 2QQEA 2GCOB 3JR7A 4M89A 1QWOA 2V59A 3LNTA 4MQBA 5ADUS 2QMOA 3A2MA 4FT4A 3FPAA 1SVOA 4R51A 4UEQA 2HD4A 3VBEA 2CDBA 2FW7A 1Z4KA 4E5KA 1KK2A 2IVZA 3FE2A 4WGFA 4ZT7A 2Z6AA 1EFPA 1O97D 1HETA 3TLXA 4JJKA 5C7YA 3IBYA 1MO6A 3L0SA 1W0JA 3R9IA 1F2UB 2P1DA 3K2QA 1HM5A 1VE6A 1ZIPA 3R3SA 1V6SA 2RG7A 4DCNA 5C1OA 1DEXA 4MAAA 1LPNA 3VGJA 3H86A 3DFFA 4L4RA 2AJCA 3N58A 5BXYA 1GL7A 4KI0A 1UZUA 1Q6ZA 3ECCA 1L9KA 5KAMA 1GUDA 5B57C 2FW8A 4CQLB 3IXMA 3M1AA 1IMJA 3Q4GA 5FOUA 3WGHA 3H1PA 4WXYB 4E1AA 2GN6A 3QVXA 2V97A 121PA 2RGWA 2ZETA 3KEFA 3ZI7A 3Q6MA 3WNVA 4BFYA 1ULAA 1DKRA 4W1PA 3IP3A 1GNVA 2K2WA 3EXFA 3ROFA 3LHKA 3LGAA 5E8RA 4F2HA 3REQA 1TKAA 1W2WB 2H2HA 3PFNA 1TQDA 4H3VA 3CE6A 3Q98A 4X45A 4DCSA 3BJMA 1CUGA 1HQDA 2Q62A 5KDLA 3TTWA 1C7EA 2HIHA 1JKJB 2UYGA 3EGDA 3ICOA 2RJNA 3BAFA 5FBWB 1G7CA 1MJGM 2OQ2A 4Z6KA 5C80A 5K01A 4LXGA 2ZM6B 1QHYA 4A16A 3OLYA 3SI7A 1WM1A 4G0MA 3MERA 3KETA 1J2YA 1ZGCA 2WPDA 4DV5B 3U4MA 1AQJA 1OFHA 4DLNA 4LWPA 3PRJA 4Q9LA 2N3ZA 4JT2A 4QEKA 1ZK0A 4F7DA 4PG5A 4ROSA 2HBZA 1NNSA 2GXUA 2KSQA 3ZHXA 4F56A 1P1BA 1VMEA 1TRHA 3KQPA 3OMLA 5C8ZA 1AHPA 2GA9A 1TKBA 4MCHA 2WV9A 4B87A 3E05A 4L4YA 3DWFA 4RVFA 3FW1A 4S1WA 1UZNA 1ZM9A 3O3CA 3OUZA 2MSCB 2YN4A 3GB9A 3R75A 1E79D 3L04A 1FYFA 2CXUA 4JJGA 1CF4A 4O2LA 3Q0IA 4DV2B 2JKZA 5DWVA 1GZSA 4N39A 5AVQA 2PDAA 5A02A 1Z4QA 3MQFA 3P96A 3QE3A 3SQXA 1SC4A 1WMFA 5AI9A 3SIPA 1KHHA 3BHNA 1RYFA 4A0RA 3GNLA 4FFLA 4MVJH 3TLCA 2YHIA 3REQB 4B8YA 2Z4SA 3G8BA 1GG8A 1AUVA 4HLNA 2PSFA 3IR5A 3PR2B 4IX9A 1UC4B 4EB6B 1CRQA 3W5UA 3WWCA 2QT9A 3CLTC 2B5OA 5CTAA 4XYBA 1THMA 4IZIA 2PV0A 1GV0A 3WQRA 2WJVA 2QUJA 3CUWA 3OX2A 1XTSA 2HXYA 3LTEA 4PQYA 2A9JA 2QTNA 4K81B 1QWSA 5G1NA 1F4VA 1QO7A 1A0OA 3ZN2A 2ORYA 1EUCA 4B3HA 4DTIA 5ALVA 5KSWB 1NBHA 2H1OA 3TD9A 3CLVA 5L6LB 1Z7BA 1F0KA 2Q5EA 5BW5A 1RZRD 1DKUA 1THZA 4G89A 1N0WA 2O2JA 1FNBA 4NCXA 1DWUA 2FCAA 1FUIA 1A8UA 1O6ZA 1EEHA 1OZAA 2A86A 3NLLA 3OIYA 3OFJA 4Y7CA 2M6KA 4E5MA 3K71B 1GCIA 1X15A 1I9GA 1EVYA 4KAFA 2D7DA 2YXBA 5LXTB 3FAKA 4RBNA 2P9ZA 2ZGVA 2A84A 2FZLA 5HM6A 4TVKA 5ESDA 1EFKA 4MQ6A 2E3JA 5EL0A 1SMKA 3ZGYA 4HD8A 5BR4A 1SB8A 2QR3A 4EUSA 3CBGA 2Z58A 3E9YA 1NW4A 3P9KA 4QOIA 1A2QA 2ABWA 3KWLA 3NYRA 4CQMB 1PNRA 2QG6A 4WN3A 4URUR 2HFKA 1BSVA 1NZJA 1XE3A 2C88A 2JI8A 1MAHA 2ZYGA 1Q91A 3GIWA 3L8MA 3PHLA 3P9SA 1AKYA 1ZY2A 2B2CA 4B48A 3A28A 2V96A 5CGQB 4AURA 4K88A 1BU5A 1M6YA 1KMCA 1QVZA 3PC6A 1XK7A 1P1CA 2VYNA 3L1KA 2RI1A 2OL4A 3FWPA 4IZHA 4JLNA 5CK4A 4BQNA 2D3TA 3R6LA 4B7UA 5A4FS 4B3SB 1GGMA 4ITUA 2XODA 1FP7A 4WE3A 4B76A 4C4AA 1Q92A 1XAIA 3NNSA 1Y8CA 3R5HA 3KZVA 4ZOAA 3U7JA 2I9KA 2QTMA 4L5YA 3ZWNA 4DRZA 4PM4A 3VNRA 3AM4A 4PV7A 3T34A 3GD7A 3UWKA 3SWWA 1E92A 3KCQA 4RH1A 5ENDA 1YB6A 2PA0A 5EFZA 3T1OA 1NVVR 2CB0A 4ESHA 2BGWA 2J8ZA 4CUKA 4CTNA 3DOIA 4M1EA 1NLFA 5EESA 5CCDA 3GA7A 3K9NA 2J3EA 4RTMA 2UUCB 1T5HX 3NBMA 3NG1A 5EIHA 4C7KA 3BXFA 4DCVA 3AVOA 3D6JA 5FBQB 5SZKB 4I3HA 3MRVA 3NRJA 2KBFA 1P1JA 1VL1A 3BMOA 4IRXA 4FFOA 1DOHA 3BPSA 4B85A 3WIBA 1P7ZA 3BIFA 4KDEA 5MHTA 2JS7A 3T9FA 1A72A 1IHPA 2ADFA 5T64A 2GUGA 4RIGA 1EK6A 1NIJA 1NBME 4WFJA 1V6CA 1WOYA 1C5KA 2CHQA 1X1CA 2QDKA 3D7NA 3F9IA 3NVAA 5F2KA 3FYHA 4PLPA 3UMBA 1CYDA 1NF2A 3R5TA 4D97A 2DFLA 4IO1A 4MS1A 1QGAA 5SY9A 3EGVA 4NOMA 4D8XA 4XX0A 3TPFA 2D1QA 5JAUA 4B40A 4P80A 1EWYA 2FUCA 2G0AA 4MHOA 5HKLA 5HZMA 4OHWA 5KTRA 4OX9B 1GA6A 2FDXA 3QX9A 4NYJR 5IJXA 3STWA 4LOHA 3NVKI 4I46A 1G60A 1FFAA 1H9AA 1HE3A 4RVHA 5I7VA 4X1YB 1UMBB 1WSBA 1VG8A 4IJQA 5C31A 1LK5A 5TEWA 1PSZA 2DTXA 3LDFA 4EAQA 3QUQA 4JI8B 2XMZA 3AB3A 3PYMA 3UJDA 3RDPA 1DRVA 2IUEA 2VP4A 4MX8A 3IMKA 3DLAA 5DM4A 3KOMA 4B1FA 2RGDA 2O6LA 3KXLA 1U0BB 4XR9A 2ERCA 3CQ9A 5EUMA 1X7YA 3I12A 1LVUA 3RKUA 2PZEA 4P5EA 4LYFA 4BNKA 4JYBA 5CB4B 2XNDD 4RTJA 5JSYA 2EYUA 1RW4A 1VXOA 3TS1A 5LOVB 2ZREA 3SC2B 2JCSA 4GBED 4RV5A 3TG2A 1ZRSA 2J3DA 3PEEA 1U0FA 4H31A 2VTVA 4R0VA 3TLMA 1BD3A 3UC5A 4I4LA 3FGNA 5KAPA 3PNYA 4RK4A 5F5LA 3B1FA 4DZRA 3RS0A 3BCHA 1QC5B 1FTWA 2PAFA 3DW1X 4FNAA 5EJIA 2P1RA 3R2JA 4L8VA 4KXUA 1E2GA 3H8WA 1ODKA 3H19A 4FYKA 4PF1A 5EP2A 4PTLA 4MUIA 4YXWD 3OIDA 5I7RA 1EVZA 4U4AA 4AK9A 3UK2A 2O2DA 4XSHA 1E64A 2ZTUA 3FHLA 1EGQA 2V0CA 4MW7A 1YULA 3NANA 3FX2A 3HUEA 1K7EB 1Y48E 2PCJA 3GVHA 3Q5EA 1D2GA 2GNAA 9ABPA 3AF6A 5CNKA 3SK0A 4UQPA 2B21A 3SICE 1PSWA 2FEAA 1XQXA 1YR6A 3KC2A 3PCXA 3TAHA 4X54A 2RBEA 3DD1A 3G2LA 2XYRA 1MVLA 4FUQA 2VYCA 2Z3ZA 4ODIA 1XTVA 5L8VA 4LTDA 1SD1A 2BT4A 3EY9A 1KOJA 3X2EA 3X1YA 1BS1A 1QHNA 2XGMA 3HPRA 5DBFA 4D9JA 4Q1EA 1M2OA 2GARA 2JRLA 4E33A 1OQAA 5FBVB 4IHQA 4XE5A 3R24A 1DCMA 1NBEA 1Z2AA 2P6PA 3D6UA 5IDXA 5AI8A 3PNMA 2XZOA 4GQAA 3ZD7A 2CDAA 1UZMA 2FOXA 2OHJA 1TD9A 2JLBA 1M74A 3OP1A 3HDJA 1FP2A 3UIEA 3NIBA 2DUJA 2OFXA 1ZGAA 1V3UA 2I6GA 4PO9A 1T8PA 2G36A 5KMGA 2Z6UA 1A76A 3U49A 3DE5X 2YRXA 2QP3A 4F85A 3K8OE 3E61A 4H7DA 1KMMA 5KTSA 5AI6A 1IL0A 3WLTA 1F20A 1W25A 4A27A 4BQQA 2EFEB 3GXBA 4Q9JA 1PFKA 3CEMA 4LK2A 4YALA 3IHWA 1UH5A 2NTNA 3EXEB 1H0SA 3PUZA 4MYTA 4RXTA 3RVRA 3V2IA 3Q0EA 2TRSB 3SU8A 3AZQA 2PVSA 3WYNA 5ICSA 2DEUA 1EK1A 1M9NA 3GT3A 1IEVA 1I3OA 1URPA 3IP1A 4TSFD 2AX4A 2H9IA 3EBPA 4MUKA 3QPBA 5EPUA 1XRRA 2VPIA 3ITEA 1GPBA 3PPXA 5C8YB 3KJXA 1K5PA 4MDEA 1Y1QA 1DBPA 3M6VA 5FQNA 4BQOA 1ZG3A 4YP5A 1I24A 3C8ZA 2H2FA 1XDZA 4B44A 3N9IA 3OZAA 3SYKA 3DNFA 2W2VA 2PXXA 2XCQA 4MNTA 4XEUA 3HK2A 4FFNA 5TVGA 2SNIE 1UWLA 2GH1A 4DC1A 4GG1A 4TOIA 4COOA 2VDKB 1XMXA 2YXEA 5IDYA 1DMRA 3A1SA 5AVVA 5LDGA 8GPBA 2F7SA 4G5RA 1F8UA 5ALJA 4DAEA 3HO8A 5ECGC 2XV1A 2R11A 1P72A 1Z82A 1JQJC 3E53A 4QD3A 4IIJF 4CDNA 1QHHA 2O7QA 4CLHA 1Z8NA 1A27A 1QH8B 4KQ9A 2E37A 3VTKA 4QDXA 4Q9AA 2CVHA 3HCPA 3RS9A 1J0DA 1SZCA 3C5WP 2VP0A 3RC7A 1UF9A 3RC1A 7REQB 1PDVA 2CLDX 2H85A 1ZNWA 4HCJA 1KGDA 3VVBA 1VI6A 4OHOA 3EH2A 1QF9A 5TXGA