3MYYA

Structure of e. coli chey mutant a113p bound to beryllium fluoride
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
128
structure length
128
Chain Sequence
ADKELKFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTPATLEEKLNKIFEKLGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Chemotaxis protein cheY
publication title Activation of CheY by Mutation at an allosteric site
rcsb
source organism Escherichia coli k-12
total genus 45
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3myyA00
1M2FA 8ABPA 4N0QA 3GBVA 4UHKA 4N03A 3IP7A 1ZITA 2JB9A 4GPAA 4YWHA 5IEBA 3KLNA 4TMYA 2A9QA 4FE7A 2QXYA 1NXOA 4D6XA 2L2QA 5IULC 5ABPA 5JNVA 4MLCA 1Z12A 1GUDA 4MS1B 1NXPA 1OXKB 2PJUA 4MQFB 1DZ3A 5EWMA 4D74A 3E3MA 4IMIB 1XWWA 4H3KB 4KV7A 3ROFA 2A9OA 3F7NA 1D4ZA 3IPCA 2FMFA 4KZKA 4EY3A 1K66A 4MLDA 4N0PA 2FSPA 3C3KA 1LJLA 2R47A 4EVQA 4F11A 3I45A 2AYZA 2R25B 5IX8A 2FTKE 1USIA 2PUDA 4XARA 3KCNA 4G0ZA 1BDJA 1JYFA 4JA2A 1YK0A 3JPWA 5TE9A 5D2CA 2HPHA 4EUKA 1A2OA 3A0RB 2IPNA 2QZJA 4PEVA 1JYEA 4IGAA 3FFWA 3EQZA 4ETNA 4TN5A 4Z4CA 3QLVA 3IPAA 3EQ2A 4KNYA 2MYNA 2IYNA 2RJNA 1ABFA 3K4HA 1Z25A 2B1JA 5DCLA 3S99A 1RPJA 1D2AA 3O1HB 2X7XA 3MYYA 3G85A 3UK0A 3KS9A 3LUAA 4E7OA 1DRJA 3OLXA 3T95A 4RK1A 3GBPA 5IC5A 1KRXA 5BR1A 4KQCA 2FW0A 2HJ9A 3O2SB 1SXGA 1EAYA 2CHEA 3NBMA 3NNDA 3OLYA 3C6QA 4MS3B 3ROTA 3CU5A 3N0RA 4KRFA 2FN8A 1YMUA 1U04A 4RXUA 3CHYA 3T8YA 4KREA 2NZUG 1NXVA 1EHCA 2FLKA 3KTOA 1MIHA 3L6UA 3N0WA 3MM4A 4HNQA 5JNSA 3C3WA 4G0XA 4LDAA 3Q15C 3LUHA 1CYEA 2GKGA 3FFTA 1KRWA 3CFYA 1ZH4A 3QK7A 2FEPA 4RK0A 5TQ2A 3HDGA 4RSMA 3CTPA 5CNKA 3IP5A 4YO7A 1Z13A 3H5LA 3H5WA 2A9RA 5CNJA 4YR7A 4RKRA 3T6KA 2E4XA 3L49A 3RVLA 3KKEA 4IMJB 3K9CA 3H5IA 1LBIA 2KYRA 2GWRA 1T34A 1JX6A 2QW1A 2IKSA 2QU7A 4RZSA 4MS4B 4EYQA 4KFCA 5TPWA 1AB5A 1JF8A 5DGCA 3O75A 3A10A 3BBLA 4ZJPA 3DGEC 2E4ZA 4L4UA 1DRKA 1GCGA 4H3HB 5I4CA 2GX6A 1U2QA 4W5NA 4NCBA 1MVOA 4XXHA 5FWXA 3EJWA 3IP6A 1NXSA 4G0YA 1NATA 4ETIA 1D1PA 1ZDMA 4MPTA 4RK4A 4W5RA 1Z15A 1P8AA 4FB4A 3JPYA 3KJXA 2VUHB 4W5OA 4O1IA 5JNUA 1NXXA 3ILHA 4HNSA 5HQJA 5E3JA 4OATA 4D6YA 4DQDA 4XASA 1CHNA 2IOYA 3QLTA 4JOQA 4MAAA 5EWLA 1ABEA 4M88A 4KVFA 1QMPA 1JFSA 3LMKA 3KHTA 1PEAA 4Q6WA 4WXEA 4RS3A 2L18A 1W9HA 3LFTA 2NT3A 1TMYA 4EVRA 3DGFC 4MS4A 3OQOA 5FWYA 3SM9A 2FMKA 1EWKA 5BQ3A 3O21A 2JVJA 3RVMA 4RDCA 1NTRA 2MSLA 1ISSA 3R0JA 4Z4EA 5DLEA 4ZPJA 3OM1A 1DJMA 3M9WA 1YK1A 2F8SA 2CHFA 2Q5CA 3FFXA 3HEBA 1E6KA 5FBHA 4MYRA 4OLAA 1TLFA 3HCWA 3Q7SA 3TX6A 4P1ZA 3HJFA 4JASB 3BILA 3LUGA 4Y9TA 5DTEA 3OO0A 4OG2A 1DCFA 4WZZA 1BA2A 2FXIA 2PLNA 5JS1A 4B09A 2VUIB 3RVPA 1W25A 4EGSA 4Z4IA 2WJAA 4LRQA 1JH9A 3RVQA 2WB4A 3QELB 2JBAB 2NZVG 5TPZD 3NNSA 4N47A 4LE2A 1JHZA 3UKJA 4IRXA 1Z17A 1JL3A 1KMIY 3T38A 3TMYA 2H3HA 1M2EA 1BAPA 1TJYA 3D02A 3HSYA 3IDOA 1C4WA 3W9SA 4MQEB 3OQMA 2GI4A 2WWVD 4JB0A 9ABPA 2JVKA 1PHRA 1DG9A 2MYTA 1XHFA 4MR7B 1DCKA 4H60A 3C3MA 2P9HA 3G1WA 3KG2A 4ZMSA 3CRNA 1LK0A 5T3YA 3H5VA 2FKAA 4EYKA 4MS1A 4EYGA 2XDYA 5BRJA 1JDPA 1A04A 4MQFA 4OTZA 4MR8B 1SXIA 1Z18A 3DLBA 4KK4A 1E6MA 1F51E 4MRMB 3MA0A 1L5ZA 1QP7A 1RZRD 3RQIA 1TM2A 2M98A 4ETMA 6ABPA 3D8UA 1DBWA 4NCAA 4Z9AA 3N8IA 2M1ZA 4O1HA 4TLMB 3OO1A 2L19A 1NXTA 1ZGGA 3QELA 1ZGZA 3LUDA 4OLBA 4EYOA 2JBAA 3C97A 7ABPA 5TQ0B 1RNLA 1ZH2A 5HKOA 2FQXA 3SG0A 3O1JC 4NV3A 3H1FA 2WRZA 3HM9A 1PNRA 3OMXA 3KYIB 4ZMRA 2ID9A 4RK5A 3LUFA 3TB6A 1J56A 2PUGA 1ZAYA 3HO1A 3RVSA 3I09A 1EWVA 3JTEA 4KPYA 1DC7A 1YS6A 2IPLA 5EWJB 1QO0D 3MMNA 3RVRA 4S04A 1ZN2A 3HK2A 4MR7A 1I3CA 1YIOA 5IUNC 1PEYA 3FGZA 2E4YA 3OLWA 2IPMA 3EAFA 2LPMA 2OQRA 2FEWB 3LKBA 3O2QB 1FFGA 5PNTA 4G0QA 4MR8A 1AB6A 5JNTA 2PUAA 3QEMB 4G0OA 3SAJA 2FEKA 5KQLA 1APBA 1ZESA 4MRMA 3CZ5A 4LZLA 5CNIA 1H9CA 1Z2DA 4MR9B 1USGA 3F6CA 3QX9A 4XAQA 2QV0A 1NXWA 3O1IC 5FBKA 4Z4FA 4MS3A 1B00A 4CBVA 4G86A 4PZ0A 3RVJA 4WWHA 2PL9A 3DZDA 3N6VA 2JCGA 3HUUA 3B2NA 3HS3A 2E4WA 3CZCA 4XLTA 3NHZA 4F12A 3LUJA 3MQ4A 3KSMA 3SY8A 3P9YA 5CNMA 3H6HA 5TPZA 4HNRA 2WY2D 3HXMA 3HDVA 3SNKA 1QQAA 4NQRA 2L17A 2N9UA 4RWEA 5DKFA 1Z2EA 2A9PA 1FQWA 5T7BA 3EGCA 1U2PA 4QICA 4WT7A 1GCAA 1YS7A 4QPJC 4P98A 2HQBA 4YV7A 2I6FA 5EWMB 2MSKA 3FMVA 5CHYA 2OENG 4L85A 3QLUC 1Y1LA 5B3JC 3E61A 2FMHA 3QEMA 3UUGA 4ZYLA 1TVMA 1GLGA 1LJUA 5KQMA 3EODA 1MB3A 4JAVC 1L5YA 1D1QA 2FMIA 3N75A 3GV0A 2J48A 3QLUA 5B3JA 3DBIA 5JNWA 2MYUA 2PUFA 3SQNA 3CG0A 3CS3A 1ZY2A 2YHBA 4ML3A 5KQGA 2W42A 4KMRA 4IF4A 5HM6A 3LUCA 2LBPA 1RXIA 2PUBA 2JVIA 1IIBA 3MF4A 2ID7A 4Z4GA 5IBQA 4N76A 4Z9BA 4G0PA 4F06A 3GWGA 3NNNA 3M6MD 4RY0A 4YRZA 4Q7EA 6CHYA 3ILYA 1MB0A 4QYWA 3RVKA 1BVHA 4KQ9A 4W5QA 1YVUA 2QVGA 1YMVA 3LKVA 4DADA 3RH0A 2ZWMA 2R4QA 3KLOA 1QO0A 1LBHA 2P4UA 3FDFA 1ISRA 2FN9A 2DRIA 2RGYA 4TLLB 1DCMA 5TQJA 3GT7A 1Z26A 3A3KA 3BREA 5C5EA 1CEYA 4Z4HA 4Z0NA 4YLEA 2TMYA 3EDCA 3H1GA 1BDHA 2PE5A 1A0OA 4Q6BA 3O2JA 1K68A 1MAVA 3GA5A 5GQSA 2BGGA 2RJOA 1JWLA 2IDMA 1QPZA 4WXMA 2F8TA 1P2FA 1DBQA 3H5OA 4LDZA 4QYMA 2PKXA 2YHAA 1C0EA 3Q41A 3QLVC 4RK6A 2PMCA 1FFWA 3N53A 1GUBA 1U0SY 1SXHA 1RXEA 1DC8A 3OLZA 3BRQA 3JY6A 1ZVVA 1WETA 3CNBA 4HYEA 4PYRA 5TQ2B 3LTEA 4GNRA 3GL9A 3H75A 4LE0A 2FQYA 5C5CA 3Q9SA 2CD7A 1M5UA 1Z16A 4N41A 2LP4Y 1XHEA 3URMA 3OM0A 4JP1A 2B4AA 4RY8A 3JS5A 3JVDA 4F3TA 1QQBA 3EULA 1QNLA 2MSWA 4MQEA 4F8JA 1VLZA 3HZHA 5TPWB 3VNAA 3QEKA 3CG4A 3I5AA 5IEJA 3M9XA 4LX8A 4O5AA 2FVYA 3HVRA 3HV2A 2PAFA 2CWDA 2FQWA 4EVSA 1VRVA 3TO5A 4G97A 3JVIA 2NUBA 1JBEA 3GYBA 2VYCA 4PICA 5FWXB 1VPWA 3N0XA 1PNTA 2VK2A 1QKKA 4IILA 1JLKA 2QR3A 2WJWA 4FE4A 5KC9A 5JS2A 1JFVA 2E4UA 1SD5A 3H6GA 4MGEA 1HEYA 1EWTA 1PUXA 2JRLA 4RK7A 1SRRA 3HUTA 3Q7TA 4XFKA 3Q7RA 1M5TA 3MIZA 4E7PA 3F73A 2GBPA 1DBPA 5EWLB 1JDNA 2RDMA 2MYPA 4NICA 5IUKC 5TQ0A 3NHMA 5KWSA 1FFSA 3KYJB 3GRCA 4G0MA 1JFTA 2PUCA 1U8TA 3IP9A 3OQNA 2LIVA 4RXMA 2JK1A 2WMYA 5BRAA 1F4VA 4Z99A 3RVOA 4UHJA 5ED4A 3F6PA 1KGSA 2ZAYA 3CLKA 4PE5B 4RKQA 2IPAB 4RU1A 4LE1A 5JNRA 5FWYB 2V0NA 5EWJA 4RV5A 3TD9A 5KQPA 1FSPA 3OLVA 2E4VA 2PL1A 4WUTA 4JB2A 3OMWA 1UDRA 3DLHA 2AYXA 1D5WA 2HQRA 3H1EA 1EFAA 2R48A 5IUJC 2FLWA 2QSJA 3RVNA 1QP4A 1OXBB 4YS6A 2HQOA 1E6LA 1USKA 3BRSA 4OBBA 1R8JA 3CKMA 4DN6A 2HSGA 1BDIA 1YTUA 4MR9A 4YGXB 3LUKA 1NY5A 4YP9A 1P6UA 2LUOA 3QX8A 2O20A 4W5TA 1RZRA 3VNBA 2PUEA 3LOPA 5GOTA 3H5TA 4RY9A 4S05A 2H0AA 1ZHHA 1DP4A 1P6QA 5KC8A 3A0UA 1E2BA 4YCSA 2NT4A 3O74A 3I42A 1QP0A 4RXTA 1VKRA 2QVCA 4KK3A 1URPA 5F64A 1S8NA 5KI6A 5HSGA
chains in the Genus database with same CATH superfamily
2C2MA 4EG6A 2RGWA 2CMFA 1L5KA 1PZMA 1XZNA 2J9FA 4UM5A 3SX4A 4BNUA 1REQA 2F4NA 3QUBA 3RUHA 3FZNA 1Z7YA 1DFHA 3N2NA 1OIWA 4REQA 4FE7A 1J0EA 5IDQA 1CU1A 1QS0B 2L2QA 4R2XA 5BNFA 2IYPA 4NAUA 1Z12A 4JVSB 1EZZA 3QVSA 2W71A 2OC9A 4LF6B 2PJUA 4ZWNA 2W83A 3M81A 3ZBUA 3ICPA 5ILGA 2XNCA 4PGHA 4XVQA 3IDZA 1OT5A 3RASA 5GINE 3LK7A 4GZ5A 2PZMA 2XYGA 1N8SA 3PSAA 3UYLA 5AWFC 1UAAA 2PMBA 4KLAA 4TTJA 4X3PA 1UKVY 5AT1A 2XGSA 5FLXA 1XTSA 3WDMA 1DFGA 4XR9A 3RTBA 3UH1A 3X1XA 4CMBA 4DR4B 2FPMA 3JQAD 4WBNF 1D2GA 2R6FA 2EBWA 2EGHA 1IZZA 1USIA 2EC5A 4LDQA 4QG7A 1PTKA 3ZEIA 3A4TA 3BM5A 1BX1A 5IDXA 3GLKA 3VBEA 3FPBA 4AIRA 3VSCA 3FWKA 4LBYA 5FV4A 2HPHA 4R3UC 4ZAFA 4KO2S 1XUOA 1QCYA 1Z08A 4U7DA 4O2AA 1C4XA 4DRXA 3LQ4A 3ASUA 3IEUA 2O6LA 4B75A 3RYIA 1CFJA 1HSOA 2EEZA 3HB5X 2QUJA 1JW9B 2WAOA 5L4NA 4RHFA 5AOCA 3NVDA 3BL8A 1EKXA 1PZEA 1HA3A 2P2SA 3S99A 5FBRB 4A8TA 4ZZ0A 1PWXA 4CLDA 5CYOA 2SBTA 4PRYA 4BGIA 4IWYA 2GH1A 3EYAA 2QNBA 3OLXA 1ZMBA 3PUZA 4IOJA 1Z6YA 2Q99A 5HDQA 2RGBA 3ZNNA 3N5KA 1LA2A 5K0NA 2A3NA 3F47A 3ZD9A 1MC8A 4J0EA 4QUAA 2QM7A 3DTVA 3VI4B 3DOOA 4BLVA 4IXNA 5HNKA 4UAGA 1TI7A 1CJUC 2CXTA 1QH8A 3TXXA 3GP5A 2VNIA 3L5OA 3CZ4A 3CMMA 4II3A 5CFMA 3DE7X 3IIIA 2ZYDA 3I9LA 3VSEA 5JIBA 3N58A 3N0WA 1C9EA 3MM4A 3T5PA 1GVHA 1W59A 4QREA 4KIJA 1B1CA 3WLRA 1W0JA 3CFYA 3SBXA 3PQ8A 2PX5A 4MINA 3UGKA 3WO0A 3C3BA 2C9MA 2GJAA 1DS6A 3CUTA 4HLNA 1JG2A 4BP8A 1B7GO 5FF9A 5BNZA 2BEJA 2VHQA 3CQ9A 4BKUA 3OZIA 4XVCA 1IJFA 1N6HA 2WVJA 1N5JA 1ZX1A 1ZD3A 3TIGA 3BHMA 1HFEL 3GLGB 4QGGA 3RRFA 4WOCA 2D7JA 4YR7A 1Z45A 3CH7A 3G8CA 4OHCA 4WECA 2QGFA 3LYLA 5EFOA 3ECCA 2ZATA 4I9FA 4M9CA 4ZCIA 1GSOA 3BJRA 4IMJB 2QGZA 1FFXA 3DCJA 1VLQA 3H84A 4M1EA 2YWHA 3Q7PA 4X6LA 3H5IA 5KU7A 2XOKD 2WWYA 5CD1A 1C9KA 5GJVC 3BIJA 2R5FA 2IKSA 4MWDA 1XZPA 4TWAA 4K40A 5JPCA 1VGQA 3A10A 3QKIA 4KNWA 4ZJPA 5INTA 3ZZTA 4BB0A 1HDEA 1DAGA 3BFPA 2D3TA 1U2QA 1AQNA 5J23A 3HO6A 2IZZA 1R7RA 2UKDA 3F8SA 4Y1FA 6AT1A 3PPYA 4G63A 8MHTA 2FR8C 2AW5A 2YYYA 1CP3A 1E1DA 1YGPA 2VNJA 5CDTA 4AJJA 4F85A 3EG9B 4EBBA 2VUHB 4AK9A 2G63A 4DQKA 1F2TA 1MX5A 4C7MA 3TW4A 2ZBDA 4Q66C 5D5PA 4OB7A 3VR2A 5IK2A 5TF0A 3RUIA 3K9FC 4NI5A 3MB5A 4YP5A 5B3LA 1JDJA 2HT1A 8OHMA 1H2ZA 1P1KA 2PGXA 2DWCA 2FW9A 2WF9A 1ABEA 3G7SA 4JUCA 4NU8X 4ZVKA 4CR6A 1CNFA 3FPFA 2O7NA 4NCIA 1XTIA 5E7IA 1TQ2A 2XCQA 4UHCA 2HNAA 2OZLB 3ZWKA 3S2YA 2Q9AA 5CP8A 1O03A 4XB6B 1Z0JA 2L18A 3K5WA 2B8WA 3HB0A 1AHHA 4OHKA 3EEIA 2UUBB 1Z4KA 1ONNA 5LU9A 3B2QA 2ODAA 3FPLA 3KVYA 4ZVUA 3Q7QA 4D2IA 4K3VA 4EX7A 1GSAA 4JLVA 1H2FA 1PF7E 3SPXA 3W8EA 1D0VA 1PJBA 2VJAA 3LUPA 5LP6A 4KLRA 2H4YA 4ER3A 4X7BA 1E1RA 1XI2A 3HR7A 3E15A 5DYTA 4H1WA 3LQRA 2JAWA 5FBHA 2DKFA 4BTEA 4FYVA 3WNCA 1PUJA 3GCWA 2ZR0A 4DMCA 4NNPA 4HNTA 3VRHA 3ZVRA 4EK9A 5EQFA 3ILXA 1Q74A 3UWSA 5AUOB 1Z82A 3IE0A 3RSSA 4Z49A 1LNQA 3FJOA 2FY8A 1EUZA 1M2HA 2AF3C 4KI0A 3CWQA 3LBIA 1F0PA 4RKFA 4P3KA 4EPTA 3DBRA 3NAZA 1IHDA 1YS2X 3HWX1 4IQGA 4M46A 1ZRMA 3IIEA 1LV7A 3C7CB 1DTWA 4M0LA 2YWEA 4NY1A 3IT3A 3N8GA 3T38A 1LC0A 1M2EA 1TJYA 1VE1A 3D02A 1CT9A 3FZEA 1C4WA 3L8GA 2OY0A 4HRYA 4QYTA 5FFNA 3TOVA 4CIWA 3OPYB 4D9MA 2GCOA 3JD1A 3AESB 3WICA 1EX7A 1G9SA 3G0IA 1DG9A 3F7TA 4LTMA 4FYJA 4NOLA 5IKOA 1XCPA 2GPWA 4OA5A 2FPIA 4EEZA 1FVOA 1YVPA 3PDWA 4LYJA 5D86A 1ZU5A 1FSSA 4LKRA 4ZOEA 2XKAA 4O5OA 3D3WB 3ZHBA 4DC9A 5I48A 2GD0A 4Y1RB 5AK0A 2HK8A 1HKHA 3O4JA 1KSHA 5H0IA 3D2LA 2ZBEA 3IMKA 4TGLA 4BE7B 2IHJA 5ECGC 4AZSA 4FPXA 4O33A 1QZ3A 1E8NA 1U0LA 4G4SP 5FO0A 4BP9A 3DZJA 1IEQA 1VJRA 1ODIA 4MMZB 1DDGA 1VKOA 3O8OB 1MZVA 1NXTA 2JI6A 2VQDA 3FI9A 1G3UA 4O2LA 4C7JA 2P9YA 1E89A 3LVBA 3ZIUA 4OLBA 3O0DA 1KOGA 2XVYA 3HABA 1U8CB 4I9NA 4JL5A 1HYGA 4ZGWA 3IODA 1SCQA 3HXTA 1IUNA 3KWMA 3D0RA 3EVGA 3NT4A 1SB8A 1VL0A 4BNGA 4DR3B 4B84A 5IG2A 1NU8A 4QQ8A 1WAMA 1XRQA 2C57A 2D5BA 3LLUA 3GT4A 4L8LA 4BDSA 3K5PA 3OF5A 4WBXC 2AN4A 1ODFA 3K6SB 3H17A 5AKEA 4B4KA 4YRBA 1E4OA 1ZN2A 2CKMA 3VVMA 1UKEA 2D0IA 2OXCA 4EUHA 2P68A 2XXAB 1CUZA 4D9NA 3SEZA 3ZH2A 5GV8A 4CEJB 1SHKA 1E18A 2V9CA 2WQ7A 1CTQA 5PNTA 1XC7A 3THSA 1Z5GA 1QHIA 2QZZA 3FWHA 1EP2B 1XELA 3QEMB 2NU9B 4I55A 1T8UA 2D5IA 1OHHD 5AKJA 4HL6A 1Z2DA 1H9CA 3FR8A 4F8EA 3MGKA 3I05A 3RIEA 2XZPA 1TK9A 4MVJH 3N6VA 3L6CA 3FFBA 4OLJA 4TXHA 3EIFA 1H3NA 3NUZA 4R9VA 4Q1AA 2WV7A 3HCRA 4ZCLA 3T52A 4XLTA 3NHZA 1E98A 4PSUA 1XMQB 2VHVA 3HBLA 5A05A 2BHTA 3Q3VA 3KKLA 1QFZA 4UNIA 1V7CA 4C4PA 2B83A 4JZKA 3BXFA 3M33A 3IOYA 4NQRA 2OBYA 2YCBA 5G1PA 2XBMA 2J9FB 1OD6A 1REQB 2JGIA 3SVLA 2RAVA 5FR2A 4RIHA 4REQB 6YASA 1UKBA 3IUPA 5BVGA 1ZKDA 5JV5A 1WBBA 5LIRA 1GCAA 4U4AA 4DPKA 1E2JA 2X1HA 1SVIA 4N3BA 3DP9A 3VR5D 4YV7A 1VI5A 1EFPA 4BVEA 1VSVA 1XAIA 2A7XA 3CLRD 2Q1YA 4NBKA 5EIAA 1K2VN 4JFAA 3ZHTA 4G1MB 4HWTA 4RUKA 2G40A 1KRHA 4M37A 4XPZA 1KI6A 3QLUC 5CVVA 3E5RA 3OJCA 3CSSA 4DXHA 3TBFA 1DBIA 3EEQA 3V4OA 1RMQA 4DUZB 2ABWA 4X66B 2WUDA 4DJ5X 3WFIA 1G38A 4DB2A 2D1RA 2OFFA 1ZH8A 3BGWA 1H1LA 1U2GA 4RH0A 3AH8A 4OHVA 4B3IA 2J48A 2LWIA 5B3JA 2AC2A 5TEWA 1F9EA 5D3ZA 2J0VA 2BMDA 3H11B 1IWOA 1OXTA 4LOIA 3UWOA 3AY0A 4IF4A 2E0IA 2AZXA 3THRA 3ROZA 2JK0A 3GA0A 3NVKI 2QW8A 4KVAA 3HC7A 4O2AB 3ZV7A 2C2XA 5EMLA 1CW2B 5B4TA 1C50A 4ND1A 4RE6A 3RYIB 2HRCA 2WEKA 4EZBA 3V2HA 2JL1A 2GAOA 3A3PA 4YRZA 5AM2A 5AI9A 1C5KA 3GVHA 3S1AA 1XWFA 4FUQA 4IGIA 3BH7A 4JP2A 3WGQA 4BMZA 4ZJYA 5D01A 3BB4A 4GMXA 3FWZA 2BGLA 2WK1A 3C6YA 5H3HA 5H7XA 4M9UA 4DIKA 1SFRA 3BSYA 2J4CA 2D00A 2JFFA 4Y2YA 3T34A 3TRIA 4CKYA 4ZEVA 5BURA 3A3KA 3DTVB 1YJXA 2X8WA 2RG7A 3NZEA 1HL7A 5M3BA 5L40A 2P1ZA 2Q5HA 2GA9A 4BX8A 1CUHA 3BVPA 3OSUA 4YVFA 3H1GA 4Q1FA 4FILA 2CZQA 3N74A 4MMYB 4F6CA 3OFKA 4NX2A 3BQ9A 1EFVA 1K5HA 2I3AA 2QENA 3IXQA 4YT2A 2GJSA 1OGJA 4LTDA 4O2AF 2VDPB 2XTJA 5AUQA 3U6KA 4QYMA 1JQAA 5AM4A 2OECA 1LDNA 3I32A 4UE6A 3ZTWA 3QUSA 4G1UC 4TTAA 1C0KA 3JVVA 2PMCA 2HB6A 2VDRB 2RAFA 4JVOA 3QRWA 2ZUSA 3K3PA 2QF7A 5JJIA 5JXWA 2RK3A 5CVJA 1YC5A 3GFFA 2VF5X 3M0EA 1HE8B 3Q40A 4QYIA 4ZVTA 3X44A 4AZ3B 4J3JA 1I4OA 5DHSA 1Y5NA 1BROA 2D5AA 3KKPA 1RXUA 1VHWA 1WEHA 2XT0A 3T35A 4ZU6X 3UT5A 4KQ6A 2KX7A 1UPUA 2QE7A 3HP1A 4O3MA 4URUR 3EASA 3ETGA 1FFXB 2VJDA 3OIWA 4BL5A 3DHYA 4QPCA 2HREA 4FGUA 4Y1GA 4JP1A 1TL7C 2PKQO 2B21A 2P3LA 4ZDKA 1E79A 3DEFA 4KV9A 3MD9A 2A1UA 3W6ZA 2PGDA 3F2IA 4DMRA 5FH9A 3I5AA 1N32B 3CJTA 3M9XA 3CJRA 3P8ZA 4FQ7A 5I5EA 4PRZA 4K9KA 5DT9A 1NASA 1D4AA 1KK2A 4URWR 3B51X 5DTIA 5DRTA 2IX9A 2OR3A 4KXNA 1VJGA 4KQEA 3PJRA 2GZMA 3C8UA 3NIDB 4JP3A 4UHFA 1QYXA 2PKEA 5K8TA 2GEDA 4U7TB 4XOIA 1WHTA 2WU4A 1EK6A 3FNBA 3EG5A 3QPAA 4X45A 3C3JA 5TMEA 3SXJA 3TKYA 5JCPA 2Q62A 3DR3A 3SFVA 3HI4A 4LQ4A 2AQIA 2MSEB 2BT4A 2P67A 1QR6A 1UMCA 2HSWA 3F46A 2XQGA 1THMA 5JAQA 1CFZA 2BUAA 3QBVA 1TEXA 3COPA 2BGKA 1QH1A 3WMEA 4UUNA 1PD1A 1KFBB 4BRUA 2R7NA 5EZQA 4MP6A 1KJQA 1FE8A 5G0VA 4YUVA 4EITA 1J4AA 2BM9A 3FETA 3EEBA 3IAUA 3RU3A 1KO7A 3WSVA 1JLRA 5DHAA 3T3PB 4FS3A 2CN1A 3FB1A 4E0BA 2RGUA 2PSSA 1FXSA 1VB3A 3K70D 2IY7A 1HY3A 4MUMA 4UHJA 5FTNA 4Z7NB 1UL1X 1C80A 2I6SA 3GEBA 1AHNA 1MC4A 4I4CA 1KEZA 1OW3B 2WZQA 4FWTA 2B7LA 2FQ1A 3RT9A 4M1KA 1CY0A 1P77A 3B1WA 2E4VA 2VSFA 3IALA 4JB2A 4NZYA 2FN3A 3PTAA 1RLJA 1KYVA 4WJLA 4CIBA 1MOPA 2BEUA 2O4CA 4XIFA 4BNVA 4C2AA 3T7RA 4J2OA 2WDZA 4CR8A 4YT8A 2VZ9A 3VJRA 4RQTA 5U4XA 4LW8A 1R8JA 2WFMA 5ES4B 1KBQA 2DPXA 4BY9E 2NAPA 1NQVA 2XMQA 4FFOA 1DC4A 4AX4A 4UTRA 3GP8A 4MR9A 2W6QA 3IKJA 1ZI6A 1L1EA 3A1DA 4YGXB 1NUQA 1S3GA 2LUOA 3JASB 5KDLA 3C24A 3FTEA 2IUEA 3G49A 3VNBA 3WGVA 5IFKA 1GILA 5J4HA 3WL6A 1TCBA 3DXXA 3HCAA 2GHQA 1QLWA 1X7WA 3DBRB 4XWKA 4CETA 1T0UA 1H1TA 4M6WA 4RMJA 2ZT6A 3I2GA 2PBRA 2VRWA 1DTWB 3RIMA 1YDMA 1Y8QB 3AFIA 4DEVA 4XGQA 1X15A 4IIHA 4G65A 2QI9F 2QVCA 3G9UA 5F64A 1PIWA 3AXSA 2BSAA 2R68A 4D3ZA 5B5SA 2DR0A 4P32A 3AOEC 5EXEA 3NOVA 1U2RA 1QPBA 1ZITA 1MA0A 1X0XA 5IW8A 1L8QA 2B6NA 4Y2QA 4B3SB 4Z3DA 3L7IA 2FPIB 4H9GA 5TC4A 4AURA 2IY9A 1VIYA 3ER9A 1Z2NX 2FFBA 4PF1A 2Q21A 4IFIA 3MS2A 3THXA 3QGMA 5F9FA 2Y9MB 3CLTD 3VHXA 4BLUA 4TYYA 4YRDA 3JZDA 1SQ6A 3LL7A 3M4JA 3AI7A 4IMIB 4MKHA 4N01A 4RWZA 3ROFA 1UPBA 5JMPA 2QTMA 5K0SA 4GC5A 4ARUA 4K9SA 4Q3CA 1XDUA 4L8FA 2YS6A 4UZSA 1T9DA 1B23P 2ZSIA 2HRBA 3CPJB 1BEEA 1G8YA 4KW7A 3VYSB 2PBFA 4EY3A 1H22A 4JBGA 4IXTA 1XMXA 3A37A 4AB1A 2FP4A 3KQYA 1XEFA 3E9YA 1I24A 4BN4A 4CIXA 2AYZA 5TJ9A 5K0FA 2G1UA 4GG1A 1NPYA 2QVXX 5B2FA 5C2JB 1KJNA 2XVAA 3A9UA 3IQHX 4RFSA 4RENA 2ISCA 2B36A 1QIEA 1YZQA 5CK4A 1G5RA 3QMPA 3RHZA 3ZUPA 2IPNA 4EUKA 1BQ4A 4D42A 1X8XA 3QKWA 3HDHA 3FNRA 3ZJ5A 4W9MC 2R44A 5SV2A 4CKWA 3RD5A 3HZZA 4N5MA 1G8KA 4G84A 3S7TA 3RM3A 3ADPA 4KNYA 3MSXA 3SJBA 5CCBA 1T3SA 1SWVA 4KQMA 1TYZA 1SB9A 2B8JA 3L8YA 2GVZC 3D3KA 3CISA 1S9HA 4J91A 4JBXA 4QTXA 3T1VA 1Q0TA 2IEDA 4LRUA 2FLVA 2PG3A 1P7YA 1RBYA 3IVAA 4KR3A 4TPKA 1FB5A 4U00A 5LZ4A 3FTFA 1UKZA 2VYNA 2Z57A 4I55B 3U61B 2AUNA 1L5GB 3AF6A 1T1GA 1UZNA 1JAIA 1I7LA 4AJIA 2C4TA 3NBMA 3PGJA 1HNZB 1VCHA 3VR3D 3LYHA 1JFRA 3CU5A 4R2WA 2HU2A 3MUNA 4KFTA 3TVTA 4G89A 4Z5XA 4DJJA 2QNRA 2VP6A 1F4LA 1R6BX 3JRNA 3SQDA 3WA7A 4Q3AA 1DQYA 3R6TA 2DQSA 1XQWA 1P62B 2WIAA 2OB2A 4EZEA 3RAFC 2BR3A 2PJZA 1OUMA 2C7RA 3AGPA 2F17A 1JHYA 3EZFA 4KR9A 3NHBA 1XN1A 2F6RA 3EXHA 3WV5A 1PS0A 2JA2A 5K45A 2VP2A 2QN9A 2XHZA 5IRCD 4IJMA 3HRKA 3NBQA 3TZKA 5BVGB 3CBQA 1C14A 1Q84A 4FI3F 1Z5WA 4M0PA 1IUKA 1PJ4A 4I55F 3RRYA 5JFOA 1R50A 3FCUB 5DBFA 1KAQA 3L49A 4QVIA 4MVJP 3CKKA 2CVOA 3PQ5A 1J2YA 1UEJA 4Q93A 4S0XA 1PKEA 5AHXA 1D1TA 2W22A 5U4QA 1KE2A 4RZ2A 1KI6B 1XNGA 4OXQA 4C5CA 5DNCA 5F3RA 2ESRA 4FFMA 2GWRA 621PA 5JAZA 3QVKA 4I5GA 2CXXA 3VC3A 3VR6D 2ZIXA 3NDIA 1G8HA 1WV0A 3WGLA 4HLUC 3RJMA 1UBFA 2AR7A 2R8ZA 3BXPA 2C99A 1YNOA 5AKLA 4L4UA 1HFJA 1WCIA 2F55A 5JZBA 3JYHA 4CMEA 1J2JA 2XKKA 5DE3A 5ALHA 3IELA 1O0CA 1KY4A 2Y66A 1IK6A 5SY4A 4Z7OB 2B8TA 4MK4A 3EJWA 3VSAA 1JAHA 3JQAA 4YROA 4H18A 2ZIFA 3SR0A 4PCVA 4BMYA 1KQPA 5GJBA 1EA5A 2ACWA 2HA4A 4GYWA 2FF5A 2I9KA 4Z53A 3L6DA 3LZCA 3U62A 5HQJA 4DR1B 4A0QA 2YTZA 4UBOA 2B5VA 1J8YF 1GPWB 3ON5A 4DQDA 1T29A 4EUNA 1NV8A 1L8AA 1SC3A 4XW2A 2IOYA 1TU4A 5ENDA 3KCQA 4MLPA 4BN5A 4KAXA 3MGBA 5EQDA 1G2QA 1U9YA 3RVLA 2HTFA 1JFSA 2F1JA 3RWMB 1EJBA 1Z62A 2RGCA 4XJTA 2A94A 3GUHA 3OZTA 2GRJA 3QENA 4I3FA 3W0LB 3KV3O 2BLNA 3HCNA 1JBQA 4UHEA 2WVAA 1IBLB 4F3RA 2LTAA 3MMPA 3BGVA 1I94B 2BDUA 3VAZA 1EWKA 4O8CA 4UASA 1Z4NA 1EFVB 4ZT6A 4F91B 4YAIA 4IO1A 4QC2A 4Z4EA 1ZM3A 3PV0A 4RO0A 1PCXA 4OUDA 1BEUB 4YT4A 2QDXA 5BOSA 3NDJA 4FX5A 5PGMA 1MENA 2AG1A 3T0GA 4H3VA 3QWFA 5DTJA 1YJQA 3HJFA 1Z06A 5FUWA 1V6SA 1NRIA 1A82A 3ZGXA 1A98A 3J80A 3H9EO 1DPGA 1G5TA 1AKVA 3KEQA 3NUGA 3UHPA 5U1PA 3FHLA 4P83A 2Q3MA 5J5AA 4RHYA 1B6RA 1CUFA 2A88A 4HGPA 3RVQA 4BVGA 4NCNA 3I1FA 3ZWMA 1MO3A 3FGOA 5GIPE 3RNOA 4LE2A 5JCXA 1Z17A 4Z8XA 4E94A 2EJVA 1MLDA 4PLYA 3AR6A 2OZKA 1IQRA 2I3ZA 1OT3A 1YNSA 3I9MA 1V4VA 5H70A 1Q1AA 3TMYA 3W9SA 1GZ7A 3VNRA 3ZWOA 1GYQA 2A1UB 2PWAA 2XB9A 3H8SA 3Q5EA 2I4RA 2RHOA 3QW2A 4NZZA 3AO0B 3CZ9A 3W90A 3O3CA 1AO0A 1WNTA 3HRIA 4TM8A 2C5GA 2H2GA 3CRNA 3NPMA 3H5VA 2V58A 3FKSD 3I9OA 1FJ2A 4HX5A 3U3KA 3VU9A 1SURA 2ES4A 3TCKA 1W36C 2I1LA 1T5HX 2BTQA 3IEIA 4F38A 5KS2A 1NTOA 2WU8A 2BGMA 3G9TA 3NR2A 3P27A 4QBIA 1N2CA 4QAQA 4ZK6A 2JJ8A 3G5LA 1PJZA 4GYJA 5KJ6A 3QHPA 3ML1A 3G6KA 2ADFA 2NQ2C 4TWZA 1CR1A 2PX6A 6ABPA 4E5VA 4XX0A 1ML4A 3KT8A 2PT6A 1T9GR 2I2BA 1QH1B 4RFVA 3VDRA 2OD7A 1EFCA 2EHDA 3JZIA 4MYSA 2C7PA 2O2ZA 4R2JA 4UJ5A 4E21A 4JI0B 4DLAA 4XFJA 4R3NA 2XYQA 4DNFA 2Z3VA 3WQBA 2WU0A 4U0KA 2CV1A 3TEFA 1CP2A 1ML3A 2OAGA 4M0DA 3KYIB 2PKRA 4J0FA 3WWPA 4QYXA 1RWMA 5AIBA 5CA0A 3R0QA 1HZZA 3ETCA 1TZCA 4I9UA 3JTEA 3GD5A 2DZDA 1WXXA 2QMYA 3WLHA 1BKYA 5KTSA 1ENYA 3HK2A 3X2FA 5IUNC 1F2UA 3TRKA 3W9BA 3PITA 4FR0A 5JYDA 2BEUB 3PHHA 4GX5A 1F0KA 3VGPA 2OQRA 2PQ6A 4P7FA 4CLXA 4F5EA 4LXUA 3C43A 1IBKB 1GGNA 4KO1S 4I50B 4G0OA 3H3FA 4V24A 1P4HA 1P5JA 2Q49A 1UBLS 3A6ZA 2C77A 3EXFA 4QRHA 5HUQA 5J4YA 1QTQA 3DMGA 4MR9B 5DCWA 3S8MA 1C9JA 3DOJA 4QSMA 5TQVA 2Q7OE 2VQ3A 2GK3A 2IA5A 3PFGA 4IMRA 4XQEA 1W5EA 3F4KA 5FQNA 1GPLA 1I6LA 3L1JA 1X7WB 1U2EA 3IAM6 2XRMA 4DR7B 1SQSA 3CB2A 4M54A 1NW9B 1QFMA 4TKVB 3K09A 1DEAA 2V0GA 4E88A 2OXEA 3DWFA 3Q9NA 3HA2A 4HXEB 2WJGA 2YYZA 4F7WA 4XYMA 4RMGA 3LSTA 2Y1XA 3CINA 1QQAA 3MOGA 3F4LA 1DLIA 3EFBA 4PG5A 1OKKD 2A9PA 5HZHA 1QUEA 1VLJA 3BG5A 5ICFA 1NBOA 4EI9A 4BKPA 1N3LA 2GBLA 5DM60 5KIAA 2PANA 3R3UA 4QOSA 2F8LA 2C95A 1IK4A 2W6CX 2SCUB 2XODA 3QWAA 4I50F 2MSDB 4JP5A 3WMFA 5IKEA 2HWWA 2I6FA 3TTUA 3K4QA 2XOXA 3GEPA 3KQPA 3MOSA 2ZJ5A 2OENG 4CEIA 1NNEA 4RQBA 2D3WA 2ZULA 4DV2B 2WKRA 3FPAA 4LXHA 3IRUA 4CM8A 1OX4A 3AUJB 4QGHA 4DARA 4FEGA 1GLGA 4JI8B 4OREX 2PK3A 1XNQB 3AL0C 2UU9B 1X7ZA 4BIMA 4A15A 1THTA 4KWEA 1QH9A 3HPRA 4WK6A 5HOQA 5HKBA 3V00A 3GEDA 1N25A 1VSUA 3N75A 4QSHA 3AIIA 4ITUA 3VDNB 2FP4B 1IXRC 3NOQA 4Z1OA 1MV5A 5AJXA 5GPBA 1RYHA 1M1UA 2FSVA 3B5JA 4ZI7F 1IEVA 5HM6A 3LUCA 3V46A 3PD0A 1DAIA 1YZHA 3KYDB 4DMKA 1RXIA 1U5BB 5C7YA 4BBAA 4QUGA 5GZ6A 4DLSA 3L0ZA 4Z4GA 1TAQA 1NUTA 2DGDA 1YI1A 3OCVA 1LLUA 3ADCA 5C5IA 3BE6A 1Q0QA 2BJVA 3GN2A 4N0EA 2AJBA 4QELA 1IG3A 3FUUA 3A04A 5B7QA 5KTKA 2W8ZA 4LBVA 1GAEO 1QXSA 3R7AA 4W5QA 4Q01A 4LY9A 1DMRA 1E20A 1TAGA 4GO1A 4MH0R 1WPGA 1XTUA 1X77A 2O52A 2P2LA 1C29B 3KT6A 3UWPA 1CZLA 1R8YA 3FDJA 3IUJA 2DPMA 1GDHA 4EF4A 2C5EA 5LIPA 1CDOA 3SC4A 5M34A 4B0PA 3F97A 5LOVA 2BZSA 1F6WA 1KAMA 3BREA 1KYTA 2HAEA 2IUYA 4TUYA 1CS0A 3UJNA 2IEZA 3I01A 1DUVG 4L28A 4M89A 3TZ6A 3TPZA 5JTTA 1OHHA 3JATB 2WABA 2WP0A 3ETJA 3NHYA 3O4IA 4KO4S 2VHCA 3O2JA 3GA5A 1SUBA 3EZ6A 3RWBA 1Y48E 1B3BA 3IHWA 1XPOA 1H8ED 2VDKB 1KEEB 3OUTA 4Q5IA 3U7FB 1P6XA 1GGEA 5CDSA 3QU2A 2JDID 3QLVC 3DSRA 1FNSA 3WRYA 4J9VA 2NXCA 1ZNQO 1TUBA 5CT8A 2YWRA 5CTJA 1CJSA 3G0BA 2FCAA 2ZTUA 4ZQHA 1RABA 3ADKA 3N53A 3MWKA 3SYNA 1BHSA 1Q0HA 4OQLA 2X58A 4YRJA 3EXHB 1KVRA 3KZ1E 4AUMA 5K3BA 4C4RA 3ASZA 5D1NA 2ERYA 4WZ6A 5ENZA 5D8DA 2AF4C 1E3MA 4IUDS 2DMRA 2IRWA 1YI0A 3GXOA 4MPRA 1ZIDA 3TGLA 3I76A 4N6OA 3ZK8A 1CF2O 1OOEA 1GZ5A 1UQRA 1USWA 3WMRA 4D3FA 1F20A 4B4DA 5IT4A 1BYIA 1C1HA 1I7PA 2LP4Y 4HAZA 3UUWA 4AF8A 1U0JA 2V9PA 1TZKA 2XWJI 4IDPA 3U4DA 1Z3IX 2A0UA 3VR5A 2HW8A 5F2NA 5FI5A 2IOFA 4YAJA 1EYZA 2ZIXB 4F8JA 4X1IA 1H8HD 1RHKA 2H6EA 2PT9A 3HFGA 5BN5A 3PYXA 1C8KA 1RCTE 3HB1A 2O1XA 1T9CA 4TWBA 5KJCA 1WCIB 2FJUA 3R3YA 1CEXA 4LC9A 5FPSA 1BJTA 2PGNA 3KOOA 2BTEA 3REQB 4M22A 2MR6A 3KHKA 3SF0A 2XBUA 2XPCA 5A2QA 1Q1QA 1FS5A 5JMWA 3K8YA 4YCJA 3TBHA 1RRCA 1PNTA 5G0UA 1AXRA 4FE4A 3V1TC 3Q2KA 1CCWA 1XK7A 3W5VA 3ZLVA 1SK8A 4DDVA 2YDXA 2RKOA 1EWTA 1QWOA 1KFKB 3O84A 3OKCA 2D59A 4FGLA 4XRRA 1E1YA 4ALMA 4Z54A 5HJEA 1SRRA 2C4UA 1C9MA 4WEOA 1ORTA 3EVFA 1W1UA 3NI2A 2I54A 2V96A 4RHEA 2FPPA 1KAHA 2X0FA 4HXGA 3IOCA 1CPYA 3ZE7A 1I4EB 1JPJA 2XVZA 3KJNA 1HNWB 4NYJR 4AP6A 2DJ5A 2WSYB 2WDPA 3I1IA 4UNQA 1AKUA 2IU0A 4B9EA 1V5GA 2OK7A 3IAM1 1UFRA 4B34A 1N9ZA 1CLEA 3DCYA 1E3WA 4XPIA 1YZGA 5J4LA 3GMIA 2YRWA 3BC1A 1XJ0A 3HL0A 4FJ1A 2FPKA 2ECQA 2NTJA 4TMTA 3BXOA 2UZ4A 4I1SA 3GUZA 3BXHA 1YRBA 4TTIA 1IY9A 2QM8A 2AI2A 2QRUA 3N6XA 4R6WA 4R8MA 3S5UA 5JR3A 3I4LA 4IH4A 1DMSA 4G24A 4G81A 1KVQA 1Q7EA 4GRIA 5ITZB 1VZ3A 4OUDB 3ZU3A 4QODA 2FLWA 3RVNA 2IHNA 2HQOA 1E6LA 2HNKA 4CT0A 4M76B 3G0HA 1Z28A 2FDRA 2FPGA 1OLUA 1XF9A 3LP8A 1AKEA 3DEJA 4UDOA 4Y2RA 2IYXA 4CM1A 1PX0A 5T8KA 3LHKA 4ZICA 4MKGA 1GZHB 1RZRA 1TM3E 1Y4DE 2HQ1A 3SZUA 1NA5A 3OC6A 1X92A 3AZPA 2W70A 1Z4QA 1SUSA 2IQIA 3DKPA 4A1OA 4B2YA 3H5TA 3BBPA 5IF9A 1Q12A 3CNHA 3ZLTA 1Z07A 4S05A 3NM6B 4WNIA 1PD0A 3RBZA 2Q1UA 3JWEA 4HUJA 2LIPA 3OLCX 2WHPB 2I7VA 3LLVA 1T1JA 1NX9A 1F1JA 2PUTA 3WWYA 2EZ9A 4DS3A 4I3GA 2QVYX 1GQOA 1X80A 4KQIA 3ZLBA 1M8PA 4GI3A 4GNKA 2B4QA 4BX2A 4CHGA 3FSEA 4N0QA 3M5DA 1R9GA 1OREA 2O2EA 1DARA 3WR5A 1L4NA 4X61A 1EPUA 2FFHA 1LBQA 2PMKA 4QKQA 5JRJA 1NIJA 5IULC 1R10A 5FR1A 1ANKA 4RTJA 1YA8A 3IKTA 4BFXA 1YQUA 4BIIA 4NARA 1ONOA 4G01B 4WLOA 2ZIEA 1NXPA 3BRWA 2WM8A 2BTQB 4M83A 3ZGZA 3UAVA 9LDBA 4KXFB 4KPGA 3AUXA 4Q4JA 1N2CB 1XZFA 5AHKA 1JLSA 4ETWA 4Q1DA 4Y2TA 3CH5A 3IPCA 1OYOA 5BO5A 4QXQA 5C34B 1SVUA 4CL8A 1YQDA 4S1TA 4WESA 4C2UA 4XX0B 4F4HA 1H6BA 2BKAA 2FSPA 4XOUA 3I0MA 4GOLD 1G8MA 3I8SA 4J0CA 4TWJA 2QRNA 3TSWA 3ANNA 3W3ZB 5DHQA 1AKYA 2FTKE 2FX3A 1PV1A 4O0LA 4X24A 1YQEA 2LDBA 2VNSA 3TMAA 4TT3D 2JGDA 5CYFA 1F12A 2G0TA 3E7XA 3MJVA 1Z6GA 5L3RA 3K6KA 1EJ0A 4QHYA 5CBKA 4OXNA 5JZVA 5F1KA 4B6RA 4W6ZA 1VHLA 2UXCB 2ZB4A 5FD8A 1AG9A 2NVWA 2YOHA 3AY3A 4ETNA 4E5NA 1HT1E 5IT5A 4HTFB 2C2KA 4PLGA 3L9WA 4GPIB 2PQMA 3HRHA 1F2UB 2CCKA 1OWOA 2Y0CA 4IICA 4CIVA 4AJ9A 2JKZA 1HMPA 3E2MA 3UQZA 4JJZA 4ESEA 4E7OA 1JDTA 3F9IA 3G85A 3L1HA 4IZOA 1GNPA 1OLSB 4RS4A 4WOBA 3D5EA 2F9FA 1BXKA 2ZYSA 3L8ZA 4HJRA 5CX1A 3PQCA 3GVCA 5E4YA 5E0KB 5L3SA 4DJEC 1NYRA 3GUYA 3VR0A 5L3QB 2FB9A 1ARZA 2QLMA 3RANA 2J09A 3NNDA 2IH4A 5LFAA 4ZGBA 2BAGA 4KRFA 3QEAZ 3BA6A 4LJ6A 3AR4A 4HD8A 4IYRA 1FU7A 3T8YA 5JYCA 3A14A 2J85A 3VJKA 5DNYB 4C2TA 4IKPA 1X3LA 5AQ1A 1SNYA 1ZXXA 1LSOA 4HH1A 3ZIDA 3W5AA 1PU2A 2QRLA 5BYKA 4OF4A 2RH9B 1I10A 3WGKA 4LBWA 1C3VA 2GAJA 4X95A 4CE6A 4WCFA 4QFCA 5CLIA 3VH2A 5DM70 2GESA 3SKYA 4B6FA 4CV1A 1XZLA 3DVLA 4RSMA 1BX3A 5JE8A 1UXHA 3Q5DA 1CIVA 5AQEA 4DIMA 1Z13A 2QL7A 4WK2B 1TTQB 5CNJA 4EPYA 4LJ4A 3JRWA 1SIWA 4AW9A 3L9XA 3JWGA 4PZLA 1R9MA 2B34A 4D0NA 4ZYVA 2ZI4A 4GOKA 1X1EA 4C3ZA 3OICA 4TLDA 5DEOA 1Z0KA 3QKSA 2XRYA 4CEIB 5LDGA 1BRTA 2BF4A 1JXAA 3LKZA 1BVRA 1JX6A 3NBXX 4UVIA 2XD4A 3ZS9A 4MS4B 4EG8A 1X7ZB 1UFOA 5HF6A 2DPLA 3KELA 5TSDA 2EX4A 3SN6A 3QU4A 1QYDA 3AL3A 3KB6A 3FD8A 3MT0A 1ENPA 3G02A 4MGZR 4P2BA 3AR9A 4PO1A 5AVVA 4TROA 3F96A 1Z63A 1F3LA 1BS2A 1QO7A 2QU8A 3KZNA 3SC3A 3LX4A 2F00A 5B1YA 5I4CA 1EUYA 1CX9B 4KNVA 5AKXA 1GUZA 1U1GA 3CRW1 3KD2A 3IP6A 4NBUA 3NEYA 1RD4A 2IXGA 4CU2A 4LRXA 2XUDA 4BFWA 5CG1A 2Q6KA 3I0NA 1Q95A 1E9EA 2R2GA 3HCFA 1U02A 4P8RA 3MFQA 3WLQA 2HWYA 1J06A 1DWQA 4IIGA 4BO7A 4NXNB 4WY8A 2LVBA 1ACMA 3CMCO 1V3TA 4N7BA 4IIFA 3AB7A 4U2EA 1HOXA 5KNBD 3Q4GA 4M88A 3FSGD 4MEJA 4W9NA 4HVLA 4UPEA 5FOTA 2HLHA 2PU7A 2GILA 5JLAA 3VTFA 1PEAA 3HQ4O 1UOEA 5EYPB 2OHHA 3WRXC 5LOVB 4L0MA 2RAUA 5JS6A 1N5LA 4XM1A 1Z35A 4TUYB 4EVRA 1CS0B 2XNSA 1V1MA 3EUAA 3MTDA 4MIEA 5GONA 3AM3A 4LXXA 1E4EA 1NVGA 1Y3CE 4JUIA 4PS0A 2OCDA 3KYBA 2JVJA 1STOA 3HCEA 3UJ3X 1NMXA 1R66A 2VDVE 2GAIA 1JLLA 2SECE 3DDCA 2GPAA 1JAXA 1ORDA 3ECSA 2F8SA 3LPDA 2OV1A 1MB9A 3O1LA 2O57A 4ZDIA 1IN5A 4CLRA 3HNOA 1TUBB 1L4KA 2VAPA 2A8YA 3BILA 3LUGA 5ETJA 1ZN8A 2A2ZA 2G06A 3N2ZB 4JQOA 3UK2A 4LI0A 5AESA 2XA2A 2LGJA 3Q6NA 4RGQA 3WXBA 2VPTA 1S9DA 3ACBA 4IW3B 4JLPA 4YHHB 2G76A 2YJNA 2QORA 3CZPA 1QYVA 5LOVF 4N5HX 2D8AA 2Q0QA 1NVTA 3NNSA 1PWZA 1UPCA 2JGFA 4NVRA 3A7DA 2MR5A 1QG4A 2DWQA 3DL7A 4TUYF 3RS4A 1LTKA 4Q3NA 2JI8A 2YIMA 2RGNC 4CKCA 3JAMA 1DV1A 1GGHA 1N2HA 4RACA 3CE9A 1GWNA 3B6EA 3LRTA 4TYWA 2YY6A 5BN5B 2GJ9A 5LC1A 3EF1A 2FSIA 3UK7A 3A26A 3E9QA 3CUEF 5E0OA 1YR6A 1J9ZA 2C2ZA 4M1ZA 5ALOA 4EEXA 2J7PA 4A0FA 1U7ZA 3O93A 2PLFA 4MR7B 1OX6A 4DV3B 2D4HA 3N05A 3KOYA 4ARBA 5GJCA 3L7AA 4YUAA 3S1SA 4N7MA 1GDTA 1OR8A 3GDHA 3GLIE 5EXDA 1DBVO 2C9BA 4KI7A 1JVBA 5SZHB 3WBBA 1ACLA 5BWNA 4EHIA 2V03A 3NTXA 4NS1A 4FOTA 4ADSG 1ODLA 1ZL0A 3TLJA 1E2IA 4C0HA 2PMFA 3H19A 1XMIA 2QUIA 1OB2A 4UMVA 4CKBA 3GAAA 3MAGA 3C3EA 3V1UA 2OO5A 2QD4A 2O2GA 2XHEA 2FPPB 2R8EA 3VV3A 2AEFA 4DILA 4QNNA 1U1CA 2BRUC 3AYXB 2A84A 3HDTA 5GZ3A 4TMXA 3LGSA 1VHDA 4WN9A 2C4MA 3WXMA 1ZMRA 4BLPA 1AGYA 4ED9A 1G63A 2Q9UA 1DJNA 1XD8A 2XEXA 1Y89A 3LM8A 3OMXA 4XPIB 5H68A 2ID9A 4LWOA 4AYTA 2A5DA 1CZHA 1Z7BA 3A25A 2PUGA 4MCHA 4TKZA 1LTHR 3FYHA 2VJBA 2BDTA 3TI9A 4YWJA 3CB4A 4DDTA 4XGKA 4K9QA 3X2EA 3FGZA 3OLWA 2D5LA 3DEIA 1DAEA 1HRDA 1DKQA 3LKBA 1M5RA 4HGQA 1ZD8A 1ZK1A 1TW3A 2NV0A 2FPGB 1OLUB 2P6UA 3V2GA 4OAQA 2QYOA 4DLPA 4OO3A 4MDFA 2I0FA 3ZNQA 2ODEA 4KO3S 4P3NA 2NX2A 3NG1A 4V38A 4TKUB 3WJ7A 3EZ7A 4U1RA 4RH3A 4EOGA 2XB2A 2R9VA 4A1FA 1A5ZA 3ZDXB 4M0CA 5DYWA 1WXHA 3M6VA 4B79A 3NKLA 4D9BA 1BMDA 3BMOB 4LHXA 3SIRA 3ZZMA 2WU3A 3OF2A 3BUSA 4BO1A 1IM5A 3D6TB 4JSYA 4OQXA 4UCXA 5FKJA 2J0QA 1DJPA 3LZ6A 4NULA 2ZI5A 1Z56C 2RH4A 4EMBA 1SHLA 3FNHA 4TOIA 2NYRA 1U8UA 1D6JA 1X74A 2FOXA 4KIFA 3BK2A 3P9YA 4Q9IA 4CFZA 1KA9H 1FW8A 4WKGA 3PPIA 4C05A 1X80B 1N5MA 4V3BA 1WMDA 1VI6A 3HA5A 3H2ZA 4JLMA 5LU8A 1ECPA 4GBMA 2NSYA 4RPLA 4ZZIA 4QICA 3TUIC 1F8GA 1YRLA 4K2HA 1QG6A 3AU9A 5K51A 3ZHOA 1VPLA 3CT4A 3FMOB 4IFBA 2HJRA 1J24A 2Z4SA 4O0MA 4CW7A 1RC1A 4RANA 3PE4A 2HSEA 4AZTA 5LVAA 1ZHOA 1E0KA 2GD2A 4O2BA 1ZM4A 2XUJA 1PGQA 3JZMA 4TXMA 3GEHA 3FKSA 4KUEA 4KIGA 4LDPA 2P11A 4UD2A 3S4YA 4PG7A 1U4NA 4Q1BA 4RLQA 4HGOA 1LJUA 3CIFA 4WINA 1VLVA 1FF9A 3GCDA 3BHJA 1L7PA 3AJAA 2CGEA 1L5YA 1D1QA 1DQZA 1H9BA 3NWPA 1E32A 2VWHA 3K53A 1ZUNA 3H99A 2ZJ7A 1SQFA 3MWFA 2P2CA 1GTVA 4PZZA 4RMHA 3SBDA 1UK7A 4CYMA 2YR0A 4MICA 2C9ZA 3UOWA 4URXR 3A6GA 4KEAA 4A27A 2YYSA 4MUAA 4G56A 3PA6A 2BEKA 4J0HA 4ZEOA 1B8PA 3JQDA 1NBME 2JGDB 1UEIA 2PSFA 2QL9A 3FAKA 1DJQA 1ULUA 2SKCA 2V4UA 4OSOA 1EU1A 4I8IA 1FP4B 5K1ZA 3H2KA 4URFA 1HKUA 4BZWA 4HAUA 4XIJA 4BFVA 2Q3EA 5AUNB 4A7PA 1W46A 2IHTA 2O5VA 2PLAA 1X7YB 3LOUA 1NVVR 2HC9A 1K4KA 4Q4HA 4AL4A 4F9GA 1WW8A 1OFIA 2IT1A 5JH7A 2ZAIA 1X2EA 1KBZA 2XSZD 4XGNA 3D54D 4G0UA 1T4DA 2L82A 2PIAA 3UXMA 5CX1B 5BOVA 1SXJA 4NG4A 5L3SB 2B1QA 2IHKA 3OETA 1V4NA 3VTAA 3RHSA 4CGZA 1H6CA 3EQ6A 1PTJC 4BMPB 4AY3A 3LT2A 5HEKA 2H4WA 3SXUA 4NU5A 2ZTLA 1TEZA 3P2MA 1EXDA 3GNLA 3KC2A 3S2EA 3GRUA 1XR3A 2QP9X 4QJBA 2HHCA 4QBFA 2O5CA 1NYTA 3N3BC 3TLGA 3R9WA 3AJ8A 1JKIA 3T7TA 1GTZA 3PI6A 1WB5A 1P1RA 3ME5A 4UDXX 1KEWA 2HKIA 4BAUA 1EK5A 4N7JA 5AJUA 3X1MA 1HORA 4DCSA 1NQTA 3OH8A 3PFNA 4P80A 1KO4A 5KTYA 1M3SA 2ZOSA 2VHJA 3N87A 3ZU5A 3OLZA 1WVGA 1YCFA 3UT0A 2FZEA 4NEHB 3FCYA 5EKDA 4Z0PA 3AR3A 5IZCA 3EWAA 2OCAA 3ZZ1A 1YZLA 5HGXA 1E1CA 1BXRA 2PU5A 1L4LA 2Z4TA 5AJZA 1DWUA 5F12A 2WP8J 4L08A 1JNYA 2NTYC 2WSSD 4IUCS 1SZCA 4W99A 2QD5A 1Z29A 3Q5GA 3DV9A 4JEIA 2FMUA 5CYPA 1ZM2A 2YUIA 4H6WA 5F21A 3ZHXA 1JWBB 4ESOA 1MR3F 4Z9XA 1QNLA 2NGRA 1Y6FA 5EPOA 1XV5A 4DG5A 2QW0X 1SY7A 3BMQA 2FVYA 2CJPA 5I9NA 1EP1B 4RD2A 3WYAA 3FVQA 1E6UA 1GNQA 2PZ8A 2MHCA 3NXSA 4RZQA 4CUZA 3TO5A 2EWVA 5LZ5A 3TLZA 3OPXA 1JBEA 1FOEB 4DA0A 1M8FA 3OCXA 4NSNA 3FSJX 3ILSA 2ZBQA 1EFLA 5J43A 3IYLW 5P8WA 4WKCA 3MRVA 4Y67A 2QK4A 4HVTA 5HJ2A 5J3JA 2QR3A 3PUWA 1N75A 2GBGA 5KX5F 3ID6C 5JS2A 3DAYA 1VDMA 1FYXA 2OG1A 3OZWA 3VBCA 4ZT7A 2NO1A 2LR0A 1XXHA 4Q3BA 2W2TA 1L5MA 1IOVA 1DBSA 3D7MA 4HDKB 4M8NE 4X6YA 3DLTA 4XFKA 5CEEA 1U7HA 1OJLA 4ZQBA 3TTXA 1KERA 1YE8A 2C7OA 4B7CA 3FG9A 2GF9A 5LKRA 3PUHA 1DDOA 2A0FA 4YBRA 2FFQA 2XMDA 3FJ1A 4MI1A 3EEFA 4S0ZA 4FT4A 3TE6A 5AMXA 3BEOA 5IUKC 2AG0A 2HA5A 3HBMA 4N6NA 1Q15A 4J1TC 1N2SA 3DT9A 2CJXA 2OUIA 3ICVA 4IYJA 4BNTA 4BNXA 4EHDA 3R3WA 5GZ1A 1T25A 1TIBA 1UBMS 3AQIA 5CX4A 3SNHA 4WCVA 1EE2A 2CEKA 1F4VA 4B46A 3QE3A 4AKGA 4PY2A 1ZBQA 4LV6A 1GEEA 3TLKA 1O6GA 4RD6A 221PA 3CLKA 3JX9A 3M1YA 4UAVA 5GONB 1K8QA 3FOCA 2HJWA 1E4EB 4OLHA 4Q3LA 3F1LA 5IM5A 3T3IA 2WJYA 1T6BY 1T10A 1TYCA 1MJGA 1NSYA 3D6FA 2PL1A 2QLFA 3HBFA 3LBHA 4UOZA 1JLLB 1NP3A 1OLXB 3DS8A 2O3RA 3T12A 5A3RA 4F21A 5I7OA 3JRXA 1CY4A 1JFFB 4NH0A 1USKA 3VR4H 2VHUA 4CLRB 1YA6A 1Z33A 3IL2A 3DD5A 3PX2A 4QUIA 1S1CA 1JZQA 1A4UA 1F14A 1F8FA 2JDIA 4NECA 4BO4A 5J2TB 3A31A 4IPTA 4F4FA 2Q5JA 4W5TA 2X1VA 3U60B 4ILEA 3LOPA 5CXQA 1N3YA 4BPBA 2JIDA 1JJ7A 2GARA 2ZU6A 4YMUA 1TMGE 2H0AA 3V97A 4ZMBA 1PK8A 3R75A 2HYIC 4JLOA 4MW2A 5C53B 4OXIA 1CJCA 3AEXA 5CB4B 1I6WA 4CKCB 2DHEA 3TG8A 2QEQA 2I67A 2ZJ2A 3L0DA 4G5GA 2HDNB 4ESHA 3AM4A 2JGRA 5I47A 5JXHA 4RZ3A 1S1MA 3AEQA 1FX0A 2J87A 1NBWB 3O95A 5HX7A 5EHNA 2BM1A 2VJNA 1A5TA 3IP7A 2EFCB 2EJWA 5BVHB 3A36A 3KLNA 1X7DA 3LVQE 4ALNA 4DRYA 1EVKA 1LW7A 1W7AA 4U39A 1H8HA 2Z98A 3T3OA 4WQMA 4D56A 1EE1A 3GNQA 3WIEA 1UMKA 2BP7A 1P7VA 3IUYA 4LJLA 5EZSA 3WLJA 1NQAO 5J2TF 2WT9A 1EIZA 5AJWA 2GETA 4Y6LA 4RJIA 2E7ZA 3W79A 2CDAA 4YECA 3FI0A 5IJ0A 1YZKA 1FYEA 4IRMA 1Y5LA 4F1KA 2HCBA 1ZIXA 3IP8A 4PBTA 1IRIA 3WOVA 2Z1MA 4DA9A 3BDVA 1RKXA 4KZKA 4TTQA 4PNPA 1C7FA 1GXSA 2B3DA 3DHEA 4MLDA 1HOTA 1BXZA 1TGYA 1LJLA 2EXXA 4ALIA 1E2PA 4GX1A 5CB4F 1CRWG 3BE5A 4TSKA 2FDCA 3NVMB 1J20A 4OMUA 4XKJA 2QLNA 4ZVRA 5LBIA 4TV8B 2Q1TA 4FDTA 4J7CA 3T3EA 4LIPD 3Q0IA 4WN9B 2C98A 1G8PA 2GNOA 3B70A 3KJQA 3PNOA 1DIOB 1FXWA 1YGYA 5D2CA 5LJIA 1AMUA 3ZVMA 3I3OA 1SHTX 1QM5A 3WYNA 2HA3A 3CO0S 5AW8A 5G1OA 1IH8A 3WK5A 1U28C 3H42B 1PWHA 1XJQA 3PFBA 1YJCA 4JC5A 3JYNA 3C3YA 3EDYA 3VH4A 1U9IC 4U63A 2KLHA 3X1ZA 2XY4A 2HA7A 1D2AA 1N0IA 3GIDA 3PIDA 3CY6A 1SKYB 5B58T 1JT9A 4BQIA 5KMGA 1VKHA 1BE0A 2FOLA 4LJ8A 4FSHA 4WGGA 5T41A 3GJYA 3T95A 4QUJA 1HE5A 1G3QA 2Y6UA 1N5DA 5AI5A 3V3KA 3V8MA 4DLNA 5G40A 8GPBA 2R6AA 2FW0A 3SM3A 3EXAA 4OV6B 4TV8F 4BNYA 4PPGA 1J2UA 1HE3A 2H8KA 3REGA 4L5JA 4RVGA 5TRTA 3ZXUB 3K5HA 1XNHA 3KTOA 3E9MA 5LP1A 5CVUA 1B15A 1QG0A 2V54A 4N40A 4PLTA 2BI7A 2FFJA 2WTEA 2PUCA 3UPUA 2LCIA 3KD3A 3EA0A 1R00A 4LYGA 4JJ8A 4UNNA 4C88A 5F5LA 1Q1NA 4N7RA 4UPDA 4GE3A 4XD7D 1BMTA 5KYWA 2EEPA 3RKUA 5FPQA 1S3IA 3I62A 4IBOA 3QU5A 3IB3A 1OWNA 4JJ4A 3ICOA 3O31A 3HEMA 5CNKA 1E2KA 2PPLA 5A9TA 3LQKA 4JGGA 3R8FA 1MORA 5ALYA 1DC3A 3UAGA 3KKOA 5H83A 4O2BB 3FIJA 3W78A 1UCFA 1E2LA 3IQWA 3VV2A 2KYRA 1B16A 4N9QA 3IESA 3Q9LA 5THQA 1JJBA 1WPRA 4QT4A 1AB5A 1IY2A 1JF8A 2X6TA 4MV6A 3VC2A 1MU0A 1ZUNB 4HB4A 4YAWA 5DM2A 1RWPA 5K05A 2J3DA 1WY5A 5IN5A 2BGIA 1SC6A 4HWSA 5K6TA 3CE6A 3VPCA 2CYBA 1R0XA 4B33A 5CB8A 2GYWA 3CPHA 4MI3A 4OFWA 4LJ7A 1CDDA 4BVLA 1W36D 3JQCA 2GTHA 1EIWA 2H3EA 2Q3HA 1WY7A 4FYYA 1P8AA 3I53A 4FZ3A 4QHSA 3KL2A 2WFZA 4ENVA 5TR9A 3KAKA 1LGYA 4CIYA 3A9CA 2QQ5A 3COYA 4PQGA 4WPGA 2FR8A 3TX2A 3PIIA 4O2BF 3KQWA 1XDWA 4Q4HB 4OI4A 3RO7A 2O0JA 3DTNA 4H59A 4V03A 3T7SA 4NCHA 2ZJZA 3KPYA 1G8JA 1QYCA 2JEYA 4JNKA 5JH7B 2P9EA 3QBEA 3BFVA 2Z5LA 3WX0A 1Q0ZA 3DMRA 2O2YA 1NDHA 1T6NA 2E85A 1SXJB 1XZJA 1JHAA 1DBRA 3ADOA 4OEHA 4P81A 4GBGA 1IMJA 2EX0A 3ZBQA 5KC8A 3TUZC 3NCTA 4MVWA 1UXGA 1M2WA 5AFSA 1NF9A 4NAHA 5EMKA 3WLOA 3PXBA 1GR1A 1NN3A 4K9DA 4MYHA 3SDBA 1SN7A 1CUIA 1GLVA 4HFMA 3GY0A 4R8SA 1NZDA 2FMKA 2ZWAA 4GPZA 3CUSA 4DMGA 1WD5A 2UZ1A 1QTRA 3MTIA 4RDCA 4U3JA 4MWCA 3NHAA 5K0BA 1O6ZA 3L41A 4JI5B 1S2LA 2J6IA 3HEBA 2CD9A 2WE8A 1MB4A 3L2OB 4FHEA 3KPWA 4OYHA 2NU7A 3V8QA 3F98A 1YUMA 1IFXA 3WWEA 5IC4A 1NVKA 1XZCA 2VP4A 3TXYA 3SZLA 5JH7F 1QGUA 1T9AA 2W2LD 4E5KA 2FXIA 4B76A 3C8DA 3NOOA 3Q98A 3RLIA 3FRIA 4AMBA 4DLRA 5TGZA 3ZV3A 3AR7A 2OD9A 1E1CB 1QH0A 4P5DA 4FOSA 4H4EA 1K3FA 4MJ7A 4X85A 4X8HA 1I9CA 2WD7A 5TPZD 1DDIA 1UWLA 1Q3TA 3P97A 2ODBA 5CXXA 1WG8A 1V5EA 3CEMA 1R8QA 2P27A 3B82A 1WUIS 2XUHA 2H3HA 4IDOA 3W34A 4AYXA 1J97A 4QGFA 2D1QA 1NM5C 1XA4A 1LF0A 4IKEA 3W5BA 4TSRA 1EFRA 1E9SA 2HWXA 4HNHA 3USCS 3WLTA 2FK7A 2VP3A 4KKVA 2B4KA 4ZV7A 1V48A 3D7NA 5EJEA 3BMQB 5K4HA 3WGOA 3MJCA 1KSJA 3FPGA 4FC7A 4ID3A 3JXEA 2F64A 3AR2A 5DNWA 2F90A 3KG2A 1MQ8B 1A8QA 2DUNA 1H5NA 1U6JA 2JJ2D 3T06B 2FKAA 3I72A 4EYKA 1E5DA 2W98A 3L7YA 2V7GA 4GZLA 3TVYA 1D2MA 2R84A 2C5HA 2H1RA 4EA6A 1T2NA 3DLBA 1WS6A 3WK9A 1YAJA 1QP7A 4PM4A 3O8RA 2X3UA 2ZTSA 1JEYA 1IIRA 2DUUA 1XXHB 1UM8A 2ZGVA 1Y1SA 2AA3A 4FZVA 5DM4A 4F04A 5TARA 3AEKA 2Q1XA 3NYWA 4FMDF 2M6LA 1RQXA 2NLOA 1ZK2A 3STTA 4OB8A 2JF0A 1T15A 1AVTA 1XTZA 1M8JA 4EAAA 3C97A 4PNZA 3PGA1 1EAMA 3LGXA 1RNLA 2Y1DA 2FWJA 3KFLA 1C7RA 1EDOA 4FOOA 4ARZB 4KPEC 4HJXA 5KNBA 3KVNA 1EQAA 3MWEA 4G5HA 1WRBA 5AYVA 4A5OA 4BVFA 3SLRA 4CV2A 4ASUD 4CMGA 3KVOA 3BTOA 1DHTA 4A16A 2P6OA 2NG1A 5IPFA 1TECE 2UAGA 4GWLA 1ZAYA 5KHOC 2F48A 1XQ6A 4CMIA 5TY0A 4S04A 1YQGA 1ZK4A 5F2EA 3CZQA 3KQSA 3RE1A 2KJQA 2BGNA 3GGGA 3N2LA 3UMMA 2P4QA 4BNJA 1QPZA 2GHIA 1D04A 3OI7A 4IQ8A 4DZTA 1UDCA 4EJFA 5F51A 2EZ8A 1IC6A 5DTRA 4CDMA 4D9KA 2ONKA 4TVKA 1Z83A 1P60A 1WQ4A 3ENZA 3GFVA 4YUXA 5H5JA 2PUAA 3NHJA 4BWVA 1OC4A 3F7OA 3QG1A 5B7NA 3N8NA 1U5AA 3O4RA 4MRMA 5DOZA 4CF3A 4OBWA 2JJQA 1NR7A 2JLCA 5KWEA 4TSFA 3AF5A 1KC3A 1NJSA 1VFPA 2D1TA 3KTDA 3OCZA 3DMTC 5EP2A 4C22A 4CNBA 4DIBA 1G4HA 5C35A 2RI6A 4I1RA 5KHLB 3LPAA 3RSGA 3AFGA 4JR0A 5EXXA 2GFIA 1NKSA 2P9JA 5BQPA 4PTLA 3ELUA 3L1UA 1L4YA 4PVDA 3D2AA 3C85A 1B0ZA 1P1BA 1Z37A 2K7ZA 2WPDA 3Q3EA 2E87A 1AT1A 4OAOA 3EVTA 3KJHA 4BBPA 4GXRA 3JQ9C 2ZK7A 3EXEA 3NHUA 4OYYA 4RGVA 5HRCA 3RNLA 2I4TA 3K0SA 4WLVA 3OCYA 1NZJA 1FX0B 3A6HA 3CNOA 3GRRA 2IPOA 1Q0UA 1WPXA 1XJCA 3GQBB 1Q91A 3SYRA 5FTMA 5L6MB 2HQBA 1QU3A 2VF8A 1XLUA 3VAYA 4LDNA 5LBUA 4E12A 4OAPA 3FNEA 4ZVMA 5SZKB 3FMIA 3JYPA 3RI3A 4L3WA 1P17A 1VB5A 3J81A 4BZPA 1IONA 4E07A 3E61A 1CG6A 3UUGA 2WIFA 3LHDA 1TVEA 4JAVC 4QGAA 3R7WA 5L45A 1BMFA 3ZXIA 1LPBB 1GXSB 3PL1A 4LS3A 3QLUA 1RP1A 3VKUA 4IJ5A 2ALJA 3ZDAA 3UFXA 1I4LD 2EF1A 4F2PA 1A9YA 3CUYA 3D6UA 5FL7D 1J2RA 1KIMA 2APJA 3W5HA 3LXUX 5AI6A 5B2ZA 3LHFA 1CRLA 2WPNA 2ZSHA 4MUIA 2NZJA 2Y27A 3WZ2A 2IF0A 3MMSA 4EG5A 4YMHA 1KNQA 1IY8A 3KR1A 1DKMA 3PUIA 1K8YB 1DUIA 2IH5A 3EY9A 3UMJA 5D00A 1UJ2A 4MAFA 1Z75A 4B3XA 3KQLA 4DQVA 5FYQA 4UNSA 4L50A 1GA4A 3UHAA 5IABA 4UUQA 3ZXXA 4D25A 3BB3A 2OP0A 1NJGA 1IU9A 2YZNA 3F5MA 5KMGB 5ELLA 4QARA 4P2GA 1ODTC 3A32A 2R4QA 2BFEA 4Y6PA 3NX4A 5DTQA 4CI0B 5KWJA 1ISRA 1DXHA 1Z6TA 1DCMA 5CBPB 1MOSA 1Y4UA 5GAJA 3DE3X 4BJHB 5G3YA 4WTOA 3D4BA 2ZI3A 1FTNA 4URVR 4HZUA 4OA8A 1DJLA 4B3FX 1PJ3A 3CGGA 3U80A 2YV1A 1KYZA 5ERXA 5EUQB 3DAGA 2PE5A 3DZFA 3QV2A 1TYEB 4H7IA 5ALQA 1U9CA 2O48X 1Y4SA 3L77A 4FDAA 4PU0A 2B94A 5SYAA 3UAZA 5FWDA 1U0GA 2F8TA 1WZ2A 3MRXA 1O1YA 3OIDA 1EG7A 4C43A 5JS7A 1T3ZA 5TF4A 1JJAA 2IC5A 4Y8VA 3QSYA 1TTHA 3GZNA 1CVIA 3VNUA 4WA7A 1N6PA 2GM5A 3DZKA 4M9QA 3ZHQA 1GCIA 3M6WA 2ZYVX 1UKCA 2VH2A 4DA8A 2ZYTX 2IH2A 3B85A 4FLEA 4A73A 4IDEA 4BO8A 3TQOA 4NYJQ 3H04A 2ZRPA 5I9IA 2ZUWA 1U3GA 1WB6A 2BL4A 1RI4A 3K1TA 3ZWAA 1Z2CA 2HY7A 4XUDA 3E18A 3U26A 4KWIA 3T94A 2ZJBA 1U0NA 2QN2A 4BO3A 3A6DA 3F5FA 4EGJA 3CRMA 4FT2A 1ZGCA 3B9RA 1W8DA 1N6NA 3C2QA 5AHOA 5BN1A 1A2QA 3EZLA 1A1SA 2BFFB 3ZVNA 1VBNA 3HVUA 1FEZA 1X1AA 2ZRLA 4TS3A 4CLOA 4EA8A 4JU8A 3S55A 3MMZA 4LY3A 5HRUA 2IP4A 4KPFC 2YFQA 1AGRA 4CL2A 2AI3A 2J9ZB 2XE6A 3FPCA 1ZIOA 3W7AA 2GBCA 3GVXA 5B12A 3SQWA 5DYIA 1VBMA 5CIYA 3B7PA 5GGYA 4DCCA 4WKNA 2BVNA 5EP4A 3ZHUA 3QE4A 1CY1A 5IXSA 1U2DA 5KNCD 4CHTA 1D2EA 1XGKA 2GXQA 1QUFA 1VHTA 1E4VA 1C8VB 4TRMA 2PGJA 1JIQA 2AKAB 4XYBA 5JUWA 5AVUA 1SD5A 4HR7A 4HXFB 5F2OA 4KRGA 4B71A 3BJEA 2CE2X 3IAXA 2ZJ4A 4R69A 3KSUA 4M60A 1R6TA 4FGJA 4E7PA 5ECDA 4M7OA 3DTTA 4X20A 4IJ6A 3RYFB 3LDGA 4D4HA 1MABB 2EJTA 3AUYA 2JFXA 4AZWA 4QLAA 1XKTA 3T3MB 3VTKA 1W75A 3H65A 4LVOA 1Y1PA 3UG7A 3E23A 1S6YA 1RLMA 4UCQA 1OU4A 4F4JA 2VL7A 2WMYA 3RVOA 4K6KA 2ZR8A 3VPGA 1TE2A 2PCLA 2G6BA 3KJGA 2WTMA 3GRYA 2J8ZA 3H9JA 2R3SA 2J31A 2ZLBA 3W2FA 1VKNA 3S2FA 4GX2A 3CX3A 2CNKA 3AKEA 2IDJA 3OLVA 5CW2A 4U3JB 3EE6A 1CV2A 1RHRA 3NIGB 3R9XA 2PVPA 2C4WA 1L5LA 3SZRA 3PF9A 3N3AC 2CV2A 2AR9A 1R6XA 1UWCA 1ZFNA 1QIJA 3LPNA 3WGTA 1OAOC 4H31A 4Z51A 1QGUB 3BD8A 2OXRA 2YL2A 1RLUA 4YRFA 4HMPA 3AVVA 3WIOA 2KI5A 4H4DA 5LQDA 1RYFA 1QC5A 2YCLA 4IJUA 3UJHA 2QAJA 10MHA 3S8EA 3EPPA 1V39A 1YR7A 3ZGNA 2WD7B 4JQSA 3K0FA 1XU9A 4RW0A 5LXTB 2E3JA 1Q6YA 3IAS6 1BOFA 4ZA2A 2NT4A 1XA3A 2WWGA 1LBSA 2JCYA 2QI9C 4CM3A 3NO4A 4HWRA 4PXSA 5AOBA 4NONA 2OESA 3NVAA 3E6AA 3K2BA 3W3AA 5MFZA 2XTNA 1YZNA 4OJQA 3DVAB 3HSSA 3PHJA 5FNZA 1RLIA 4UHKA 2I2XB 1UJNA 2ATIA 4FHZA 3QNWA 2CNNA 5IEBA 3U09A 1LK5A 4BZQA 2XV1A 4NNJA 2HHAA 2VSXA 4YMWA 5EL0A 5EMJA 2YOFA 3L7BA 4E08A 2I55A 4MLCA 3GGJA 3RU2A 1WZNA 7AT1A 1U1IA 5B1SA 3DMPA 3AOEA 1G7SA 1U7TA 1OXKB 3NJRA 4EY6A 2RKBA 4V0KA 1IPFA 4MKFA 4UUAA 2B99A 5LPNA 4KV7A 4U7WA 5C3UA 3FKJA 1GGJA 1WX1A 2JIZA 3RC3A 1THZA 1W4ZA 2C8JA 4FSDA 4N0DA 3SKXA 3UC5A 1JEYB 2FMFA 3UMBA 5LXTF 1VSTA 2QL5A 3RTAA 3OZVA 3AEKB 4L2IA 1SHJA 2KLBA 4QWWA 2CV0A 4XLLA 3ZDCA 4QBTA 1BDJA 2O3JA 3G8BA 3GELA 1JYFA 4Q7LA 5P21A 4CQMD 1II8A 1XQ9A 2OYSA 3CPSA 4KXQA 4FGSA 1HE1C 4KWTA 3WJAA 3EZ9A 3MWEB 3VNVA 1UJ5A 3L46A 1K4MA 2G4VA 1CQWA 1XCOA 2AOWA 4DV7B 4IFEA 2GHTA 2OOSA 3QA3E 3F9CA 5IYZA 5K8CA 4FFPA 2ZW9A 4FNOA 5FADA 4CMIB 2IYNA 3GROA 5EHQA 1JQEA 3PCXA 5FYDA 2XYRA 1NRXA 1W5TA 2O8VA 1EK2A 3BSFA 3FYDA 3OP4A 4MVJI 4NMXB 4RULA 3EZXA 5DXAA 2GYVA 1FLAA 3QU9A 4Y1EA 3BZBA 3S70A 1QIKA 3P9XA 4Q05A 2HL6A 4YC7A 1D9ZA 4PIVA 4AF7A 4BFZA 1QGYA 4BB6A 3OE7D 3OE5A 1VXRA 2FHSA 5G1NA 4RTKA 3GPBA 1KJJA 2CHEA 1NQWA 2HDWA 1U4SA 5A5FA 3RROA 4N3CA 1VLLA 4E32A 1PJQA 3UTCA 1DT3A 3CW9A 1ZZEA 2CUTA 1KXJA 5K4AA 1UWVA 4LV8B 1L7NA 2FPLA 4X94A 3GUUA 4K6GA 3L6UA 1ZSNA 3OHPA 4PYNA 2QHXA 3URKA 4RVSA 3O3OB 1UZUA 2X0RA 5AICA 3WWDA 2VTEA 3MGCA 3QK7A 4LXIA 3H1BA 2VDOB 2J3LA 3H0EA 2BKUA 2B35A 3TQHA 3E9NA 1EZ4A 1AURA 4YO8A 5G02A 4XUCA 1OH7A 3JQ7A 3VUFA 2Q8PA 1GSHA 5D84A 4OXRA 4QWMA 3HU5A 2IYTA 1TM7E 2PR7A 1H2WA 2NSLA 3M82A 4FI3C 3TIVA 4M9RA 3ZWCA 1I1HA 2YC2C 5G3ZA 1EVQA 2VZLA 2I34A 6Q21A 4FDMA 2XCTB 2W4MA 3FHOA 3NHRA 4RVOA 4XRGA 4Q4LA 1XRLA 2AFIA 4ODIA 3MWYW 1A69A 2JCBA 1WU8A 3RRXA 1GU0A 3H1AA 3K9CA 2Q45A 3WL3A 2NNWB 3I6QA 4G3XA 5DF1A 2ZE5A 3BFJA 1RJEA 4FD3A 4RZSA 2YFKA 2P40A 4FCCA 4G4SO 3EMVA 4NJOA 1M1NA 3LY5A 4EHFA 4EYEA 1I5EA 1OPRA 2JIOA 3DGEC 2P4SA 4JDUA 1P2UA 4CG0A 1NUHA 2ZUDA 4QLBA 3OPQA 4B3TB 1Y3IA 3UFXB 4W5NA 2CNDA 4K6HA 4GR4A 6NULA 1TIPA 3C5HA 5A4IS 3FY4A 4R1OA 2EBUA 4HLUA 4BOYA 2QTGA 3RODA 1YU6A 2MWMA 3K0AA 1CQJA 3OQHA 4RK4A 1FFEA 1G42A 2EFEB 4G4JA 1I8TA 2E49A 2VK1A 2XADA 4MWOA 5D1HA 5C7LO 4H16A 4ZVOA 4B7ZA 5HGJA 2GZSA 4DEYA 2B2CA 2MIIA 1A27A 4PX5A 5DN6A 2R96A 3HACA 3R74A 2X4GA 4X5OA 3KIPA 2GLXA 4M8SA 3VVCA 2BEWA 1Y7LA 2Y77A 3CLHA 2BFEB 1P73A 4JB3A 4YMSA 5TGDA 4R1SA 2GN6A 3QFSA 5LDDC 5DLPA 4P3OA 1U2GC 1WJGA 3I64A 4RHUA 2BMFA 4LHWA 4NL4H 4WXEA 3LFTA 3PVSA 1TO2E 1NPDA 2VSOA 3GJQA 1BWRA 1W87A 3DZCA 1G5IA 3IVMA 4BJ5A 5IAAA 2HFJA 2YXNA 2ILVA 1E7QA 3NTVA 4KSBA 3LP5A 1L9XA 3JQQA 5DGTA 3KHUA 3KNZA 4L6CA 2ZJYA 5BQ5A 1WLYA 1MDFA 4U7JA 2DKNA 2QMOA 2X2PA 2C1XA 4HH0A 4RDHA 3Q7SA 2OPHA 2HSJA 4NV1A 1P61B 3FZGA 3OZAA 4XI9A 3E7PA 3RSHA 4TQGA 4TXJA 5DTEA 4WNCA 1ND5A 4OG2A 3FLEA 3RYCA 1NQOA 5EVJA 4LF7B 1PR6A 3WB9A 4J6FA 1E2FA 5DHPA 3ZY3A 3A6KA 2LKDA 1UC4B 1KDOA 4K8RB 4Z4IA 4FTWA 4PQYA 2IDZA 1ZMTA 2O54A 3VKFA 1DE0A 5AVKA 1LQTA 3CO5A 3HE3A 3QPWA 4QTTB 1JXMA 1RW4A 4UEOA 1B8OA 2QB5A 1N57A 4MX8A 4WNAA 3RSCA 5K7SA 4PN7A 1J00A 2ZT5A 4MHSA 4DSUA 2O3TA 1MQ9A 4PC1A 1H23A 3RKSA 3C15C 4I0WB 2INGX 2ZSUA 4NQZA 2I1VB 1O4VA 4OHPA 2X1MA 3T5CA 4QHTA 2V7QD 2GJ4A 2O2HA 2RBKA 3TK1A 4BE9A 1DEHA 4E31A 2PDAA 3K1AA 1SD1A 3MTJA 3ZV6A 4I6GA 3F5SA 1RRGA 1UM9B 4N18A 1LB1B 1S8AA 4DSAA 1EJ2A 4JV5B 4WASA 2HBYA 4MGIR 4EPRA 5ED0A 3VAAA 2VCYA 1JJVA 2FVXA 3LT4A 4ZAWA 3PVZA 1A04A 4OTZA 2GT1A 4DGSA 3K7EA 4ZYUA 2YIJA 3HU1A 1E6MA 4PR3A 5BN4B 5FOSA 2RH5A 3LUBA 1ISGA 2BD0A 3R5FA 4KE7A 3AJRA 3DVSX 1O5TA 3ZY4A 1FP2A 4S1PA 3IVCA 5GADl 5ALWA 4J94A 1KBOA 1PZGA 3D8HA 3D8UA 4ZHQB