3MZWB

Her2 extracelluar region with affinity matured 3-helix affibody zher2:342
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
53
structure length
53
Chain Sequence
NKEMRNAYWEIALLPNLNNQQKRAFIRSLYDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tyrosine kinase-type cell surface receptor HER2
publication title Structural basis for high-affinity HER2 receptor binding by an engineered protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 3mzwB00
2B87A 4IOIH 1MFTA 2LXCB 2M5AB 3S1KA 5K5GB 3MZWB 1U7JA 2B89A 1LP1B 2Q1KA 1JM0A 1X0TA 2OTKE 4NPDA 1EDLA 1BDDA 2B87B 4CPGA 2R44A 4HKZH 4BXLA 1ZXGA 4HB1A 2P58A 2KS1B 4NPEA 1EDJA 2JWDA 2UWJE 4GOFA 4KJMA 2WMMA 2QVAA 4ASWA 4GOEA 2RKLA 1S3JA 2LXBA 2QRXA 2HR3A 3FXDA 1SS1A 2SPZA 4WWIA 4NPFX 2I8DA 2K3RA 4ASVA 3FXEA 5DJTB 5EFWB 1JMBA 4GODA 1LT1A 1OVUA 5DJUB 5CBNA 1EDIA 4MN4C 1H0TA 4EYYQ 1OVVA 2KIKA 3MHVA 1ZW0A 2ZAEB 2M5AA 1U7MA 2B88A 2M0BA 2KZJA 1NVOA 4K35A 5C39A 1FC2C 4ZNCA 1H0TB 1DEEG 4ZMDA 5CBOA 3PH0A 1Y47A 2KZIA 2KI7B 2KUBA 1Q2NA 4K3AA 4HJGH 1BDCA 1EC5A 3ZDMA 3QWOC 1EDKA 1OVRA 2LR2A 1LP1A 4JBZA 3RGUA
chains in the Genus database with same CATH superfamily
2RH0A 1KILD 4GDOA 4YXWH 3MZWB 2WPRA 5GTIE 1GW4A 1URQD 2WSCJ 1QX8A 3BCCE 1J2JB 3CX5E 1AFOA 1BDDA 1FZFA 1NTMJ 3L75G 4BXLA 2IYPA 3T97B 2P58A 2E76C 2FXMA 1SQPG 2WMMA 2QVAA 5E79E 4GKGA 1L0NJ 3PP5A 1RF0A 3L73G 2R5DA 3CWBG 1N7SC 3RK2C 3H1JE 2QA4P 1NO4A 4NPFX 3HE5A 3G4SP 5AVUB 1OIPA 1OX3A 4D6TD 2KK7A 3L75D 1FZBA 1YTZT 2CPSA 4H0LB 5GTIH 3NTNA 1AQTA 3H1IJ 4WY4C 3HE5B 3PTZA 3A7OA 3CX5H 2HYNA 3HD7C 2C9NY 3L73D 1L4AA 1Q90D 1X9VA 1OW7A 2OQQA 3F89A 5E79H 1GK4A 1LTSC 1J1DC 4Y99B 4LGDE 2E43A 1QGKB 1L4AB 2KS1A 4IFFA 4JYBA 2ZVOB 4BRYB 1KZUB 3AEAC 2G3AA 2O1JA 3BVHA 1BDCA 3MP7B 1RE3C 1LP1A 2KNCB 1VF5B 3RGUA 1KILA 3AE1C 1QL1A 2YIUC 3B5NC 2QJPC 3CXHD 1NWQA 1URQA 2B89A 1LP1B 1NH4A 3RK3C 2NPSC 2J59M 1KC8Q 2OTKE 1XTGB 2FBWC 2Q9IA 4L74A 1QEXA 1URQB 1FZCA 4D6TE 3L75E 4M3LA 1BGYE 4JYCA 2ZYGA 2E75C 2Z5HA 1SS1A 4L73A 3L70G 3WUVA 3V4QA 1OW6A 2IFMA 2K3RA 3L73E 2WT7B 3M9HA 4AYCA 3S9OA 1SLQA 4PJ0E 2HODA 2KIKA 1OFCX 2ZXXA 3KDPB 1N2DC 2Q3EA 2OTJP 5AW1B 3M91A 2HODB 3L70D 5B5EE 1S5LX 1W2EA 3L71J 1HUCA 3CXHE 1LJ2A 3H1HG 4JF7A 2A45G 3CLQA 4HJGH 1FZGA 2FFDC 1NTKG 2LR2A 4TLFA 1CW5A 1OMIA 1LTBC 4PJ0H 3D6YA 3TGUE 3RBXA 2ITAA 2JO1A 3CMAP 2GA1A 1SQPK 3AE9C 4PV1C 2D2CC 5APQA 2B9BA 1YYCA 3IF4A 1TU3F 1P84D 3CCSP 1MV8A 4H13C 3H1HD 5B5EH 2Y0DA 1NTKD 1SQQE 2W83C 1T2KD 4KJMA 1SFCD 2BASA 2YKQA 3C9IA 4YPCA 3CMEP 1KB9I 3CXHH 1NU1J 3KQGA 1WT6A 2BCCJ 1S3JA 1VQ8P 3QH9A 3SFDC 4GIFA 1E79H 2N9BA 2V4HA 4DT0A 4HYTB 4I1LA 3L70E 4GODA 2FYNB 3TSIA 3L36A 2WZ7A 3H1KG 1HJ0A 3E1RA 1SQBG 2O01N 3CCMP 1N73A 2OTLP 3OW2O 2KLUA 4K35A 2QJKC 2RN0A 3VYIA 1PGOA 1JTHA 1M1KQ 3G71P 1N73B 1W5CE 1PL5A 2PFXA 2XU6A 3WUTA 5KKZC 4KT0J 2NZ2A 1EC5A 2QM8A 2WSEH 1P84E 3QWOC 1JTHB 3HE4B 1LTJB 2BEQD 1NTKE 5KLVG 1LNQA 2AXTE 2OGUA 1VQPP 2IDBA 2KB7P 1SFCA 3GF3A 2R3SA 4ASWA 1VPCA 2FYUJ 1L0LJ 5KLVD 4YTPC 4I6MC 3GHGC 5AVQB 2HR3A 1SFCB 1M1JC 2CK3H 1AQ5A 3GLMA 1HF9A 1SQVG 3WU2E 1JMBA 4H44D 1LT1A 3L72G 3M0DA 2ZYAA 2HFED 3A2AA 5KAIE 5KJ7C 1GU5A 4DZOA 1NAYA 1BE3G 1IFNA 1NTKK 2PGDA 4ZMDA 4R4MA 2O01H 4HH2A 1Y47A 3L72D 3CL3D 1HTLC 4R4LA 3VMYA 3OJAB 2WPQA 1NTZG 1FU1A 3WU2H 4OH8B 1FE6A 1MUUA 1FOSE 1Q81Q 2QEXP 1Q86Q 2VRSA 3R2PA 2AEMA 5KLVE 1PP9J 4U3FE 1K04A 2W27A 2YKOA 4OGQB 1Q82Q 1JY2O 1FOSF 1NTZD 3CCLP 1DH3A 1S4XA 3S4RA 4TT3H 3P8CD 2KSJA 1VL2A 1OXZA 3E7KA 2QM7A 2I8DA 2FXPA 1JY2P 3FXEA 1SQBK 3ABVC 1ZN5A 1W2BO 1RF0C 1DD3A 1SQXJ 3O6QA 1OVVA 1NTMG 1ZW0A 4H0LC 4H44B 5APWA 1PPJG 3E1IA 2WVRA 1L0NG 2Q3IA 3C1LA 2QSIA 1IO4A 1DD4A 5CJ4A 1DEEG 1JEKA 5AW7B 3L74E 3AECC 3H1LJ 2KLVA 4Y99C 5M1BA 4K3AA 5AW6B 1L4AC 5TJHA 3ZDMA 1EDKA 1KB9H 1AVOA 1PPJD 2PP6A 3H1IG 1NTZE 1L0ND 1UIIA 2XZRA 3FWLA 1OZHA 2A06G 3A0HE 1VF5C 4RJTA 1ZR4A 3H32B 3PLNA 3AE7C 3P8CE 3VP8A 2R44A 1GW3A 1T8ZA 3M9BA 3H1ID 3CCVP 1URQC 3CCJP 3CCEP 1JY3N 2QRXA 1SQVK 2A06D 4W7YA 2WQYC 1NOHA 1RQUA 3HTKA 1KYOD 1FS0E 2HPCA 4ASVA 1VQMP 1S72P 1QL2A 1WMKA 5AW5B 3A0HH 5AW2B 1EDIA 2K1AA 2Z5IA 3LW5H 1FDMA 5CHXA 4Y28J 3U59A 1IC2A 1HVVA 3SWYA 4EIJA 5APYA 1AVYA 1WRGA 3FWNA 1PPJE 1NTZK 1DX7A 3AE8C 1SQPD 3N7NA 1H88A 2ZT9D 2H89C 2YMKA 4PD4I 4KHXA 4OVNF 1NHLA 1VQOP 1NGMB 3CWBD 1GK6A 1P84I 1VQ7P 2A45I 3V6IA 3S1KA 3Q5PA 3H1IE 1KILE 5GTHE 5APXA 3Q5SA 1ZOYC 4WY4D 2A06E 2Q7CA 3L71G 1GDTA 1KYOE 1K05A 2KS1B 1EDJA 2K37A 4W80A 4GOFA 3CCUP 2N1TD 4IL6X 1JCDA 4QMAA 2AXCA 2RMZA 2LXBA 2W8ZA 3P8MC 1CI6A 1EQ7A 1KILB 5AW8B 1FBMA 1NTMK 2P7JA 3I55P 5EFWB 1IFIA 4D6TJ 1BGYJ 5GTHH 1NJIQ 3V2QA 1L0NK 4DJGA 1H0TA 2R5BA 3B5ND 1SQPE 1JUNA 2FYNC 1FZCB 1KYOH 2M5AA 3BRTB 1U7MA 2KZJA 2XKMA 1H0TB 1NU1G 3CWBE 2BCCG 3LIDA 4WB4A 1IK9A 5CCGC 2AEFA 4WVZA 1LT9A 2KZIA 3VP9A 2E75D 5KLIB 1N73C 5H2FE 1PIXA 1KFNA 2ZT9B 3V4WA 4JBZA 3TDKA 1LT9B 1YQ3C 2WPVB 1QLED 2B87A 4IOIH 1MFTA 2JWAA 2LXCB 3RL0C 4DCKA 2BCCD 1LTJC 5AVTB 4N3YB 1FDIA 3VTPC 4WY4A 4I7ZB 3CD6P 5AVZB 2Y0EA 5AVWB 2B87B 2W6JH 2WWWA 4WY4B 3AE6C 2N1TA 3TGUJ 1LTAC 1AJYA 1N8RQ 4PD4D 1RQVA 2V7QH 2Q5UA 1NYHA 5H2FH 2N1TB 1PGJA 1RE4A 1YJNP 5BU8B 2E74D 2Y9YA 1RE3A 2FKWB 1SFCC 1SQQJ 1OW8A 3B5NA 2IBZG 1S9KD 4O9BA 3N4XA 4ZKUA 2B88A 1X8YA 2WSEJ 1IFJA 2QJPB 3VN0A 2FYUG 1L0LG 3B8EB 3HUSA 3VMAA 1JO5A 2PAJA 3L37A 2BCCE 5AVRB 1VQ4P 3VMXA 3II6A 1ZLLA 2KUBA 3HUSB 2WSSH 2M3EA 2XDJA 2J5UA 3TK1A 2Q6QA 4PD4E 2H7HA 4JQ0D 2K88A 3AEEC 1HGVA 1KN7A 5AVVB 3H1KD 3H1HE 1SQBD 1H8AA 1BCCJ 1KQFB 1OWAA 4OGQC 2P1JA 3FGAD 3CI9A 4RKUJ 3GG2A 5APVA 2C9LY 3AE5C 2N9YB 2E5YA 4W7ZA 1PP9G 2E74B 4PD4H 2P67A 1NU1K 2O01J 2Y9ZA 3M06A 2JEEA 1P84H 3MUDA 4EI2A 2A45H 3ITKA 1LGHB 2HLOA 4H44C 2ZYDA 3EFFK 2JR8A 3V2RA 2AXTH 1CZQA 3W67A 3RBZA 1AA0A 2IFNA 2O1KA 3I56P 2OARA 1FDOA 1J1EB 3H1KE 1SQXG 1SQBE 1KQLA 1YJ9P 1PZQA 3KPEA 3W68A 1SQVD 2QJYB 3U1CA 1GL2D 1QVFO 3EQ2A 1FJPA 2JDIH 3KHUA 1GMJA 4NPDA 3MGNA 4CPGA 2WTYA 1IK7A 1NKZB 2WSFH 3L4FA 3H1LG 1KYOI 1SQXD 1BE3D 2HG5D 2ZXEB 5AVSB 2C0WA 4BWNA 5KAIH 4GT1A 1YQ4C 5AVYB 4U3FJ 2P2UA 2I1JA 2K9JA 1JB0J 1R8EA 3SSUA 1YITP 1K9MQ 1HBWA 2AEJA 2K9JB 3H1LD 2FYUK 1L0LK 3D71A 1JY2N 3C8VA 3M9QA 1FC2C 4AUWA 3JSVC 2OYHA 2IYOA 1SQVE 2YKPA 3AE4C 5BVZA 4EOTA 2OYHB 5CCHD 1PGPA 3L72E 2J58A 2WITA 2MJZA 4C7RA 2I1KA 1S5LE 3AEBC 1KMIZ 3O6QB 5KAFE 2GUVA 1JMMA 3L74J 1GL2A 1BE3E 1XTCC 4AQRD 3TF5A 5TISE 3AEDC 3CCRP 3A3YB 1EDLA 1K8AQ 1NTMD 3CPWO 1GL2B 3JCUE 1A02F 1KFMA 1LTGC 1USEA 4B86A 1ZRTD 2RKLA 3M0AA 3H1LE 3OA7A 2FY8A 2M8RA 3LW5J 1NKNA 1S5LH 3Q3DA 3MD0A 1FZAA 2SPZA 1RF1A 1MZ9A 1KV4A 3IN6A 5KAFH 1KILC 3V5BA 4IFMA 1L2PA 1KQGB 1RF1B 5TISH 1JY3O 3FX0A 2YXQB 1VF5D 3LIEA 3NMDA 1EZVG 4XE5B 3BCCJ 4XA4A 1VQ6P 2W6AA 3CC2P 3NXSA 2KYVA 1FZCC 1M57D 2IZ0A 2L5GB 2KSEA 1FZEA 1U57A 3HTKB 1ZV8A 3T97A 1MFZA 1SQXK 3MIWA 1JY3P 3H6PA 2OYIA 2HPCB 5CCHA 2O3JA 3AEGC 3WUUA 1NAFA 3H1JJ 4U7JA 1FAVA 4D6TG 2ZJSE 1BGYG 1EZVD 1NTME 3SFEC 2OYIB 2DW3A 5KLIC 5CJ0A 2ZT9C 2E76D 2YXRB 1L0NE 1LT9C 1ZRTE 4YXDC 1YJWP 1JM0A 3Q2YA 1T6AA 3PHLA 3AE2C 1N7SD 3RK2D 4I7ZC 2G8YA 1BGYD 3NFQA 2YO3A 1S2EA 2WSCH 4LC1A 1LWUA 2JP3A 4BRYA 1USDA 2ZFCA 3HD7D 2N1TC 2WPSA 1VQNP 2KNCA 1LWUB 1BSNA 2ZAEB 4LLHA 1RE4C 3TGUG 4L76A 1G2CA 1KQSO 1NVOA 1YBKA 2H88C 4ZNCA 4Z1MH 1EZVE 2IBZI 1ZP0C 3L71D 5CMZA 1R5LA 3L75J 1CI6B 2ZVNB 2GM4A 2IZ1A 1G2CB 2JKVA 1RHZB 1SQPJ 1SQQG 1IJDB 1N7LA 3RK3D 2NPSD 1CSBA 1Z56A 1M8OB 3L73J 3TGUD 3CWBJ 1VQLP 3HUSC 3GF7A 1Q7YQ 2M5AB 2WT7A 3A5TA 2Q1KA 3KYQA 1X0TA 2V7QJ 2E76B 1IFDA 1N7SA 3IR9A 3D70A 1GZLA 1SQQD 4HKZH 2K9YA 4RESB 4NPEA 2C0XA 1VQ9P 1IFPA 3GW6A 4GOEA 1NU1D 1N7SB 2E5TA 3RK2B 5CCGD 1S1CX 1M56D 3Q1MA 3FXDA 1GU4A 5B66E 4OWFA 2BEZF 4N78D 3CC4P 3HD7A 5APTA 1JCCA 3L71E 2NRGA 3VOPA 5DJUB 3HD7B 2FYZA 3HRNA 4XFJA 3RL0D 3MHVA 1YI2P 2E74C 5L8RJ 3PRJA 1BCCG 1J1DB 3VMZA 3RK3E 1T2KC 4JPZB 5AW0B 4L75A 4ZKPA 3SWKA 3TNUA 3V2PA 5B66H 1SVFA 3I5CA 1Q2NA 2NPSA 3MUDC 4PV1D 1Y8AA 2D2CD 2LKMA 1OVRA 2YIUB 3P32A 1BCCD 3B5NB 4IFDK 3P7KA 4H13D 3TNUB 3L70J 3RK3B 2NPSB 1N86A 3M0DC 1J1EC 5AVXB 1NU1E 2L91A 1RH5B 3K5BA 1H89A 4UB8E 3U1AA 1JOCA 1T3UA 1X22A 2XNDH 5KTBA 2IBZD 2QJYC 4C7NA 4N78E 4HB1A 3B4SA 1GD2E 2IX7C 2E75B 2FYUD 3EFGA 5CCGA 1L0LD 1PV3A 4C7NB 3IAOA 1SP4A 5APSA 2XNXA 4WWIA 1R5SA 3H1HJ 1KTMA 1QVGO 1MKMA 3G6EP 1NTKJ 3D6ZA 3HE4A 4UB8H 1LTJA 3TYYA 4EYYQ 5AW3B 5APUA 1S9KE 1HWTC 1D7MA 2M0BA 2FFDA 3RL0g 3RL0B 3A0BE 5C39A 1SQQK 3AE3C 1BCCE 2MKVA 1DIPA 2E42A 2R3CA 4U3FG 2OYOA 3L35A 2FXOA 4OGQD 3BATA 2FFDB 3SWFA 3PH0A 3Q5RA 3OAKA 2KI7B 2PRRA 3GMAA 1K73Q 2IBZE 3CX5I 2OYHC 4UB6E 2WSFJ 4PV1B 2D2CB 4DOJA 1DEBA 1X79B 1M90Q 2Y0CA 4H13B 2FYUE 4WBAA 1L0LE 1PP9D 4U3FD 3G9RA 1Y9BA 3A0BH 2GUSA 1ZXGA 3H1KJ 1SQBJ 2JWDA 4C46A 1ZR2A 3H25A 1G1JA 2POHA 1GL2C 3CC7P 2KXPB 3IFMA 2YMYA 1VQ5P 1ZMEC 5KJ7D 4UB6H 1KB9D 4EDFA 4IL6E 3L74G 2QIWA 3KZIE 3JC22 1GTWA 1BSHA 5AW9B 4MN4C 5KLVJ 2JJLA 1M7LA 1HJBA 2QJKB 1RF1C 1IFMA 3BASA 3PJSK 1YIJP 1VQKP 1PFIA 2KOGA 3L74D 5KKZB 3AEFC 5CBOA 1T3JA 2YO2A 1EZVI 3CCQP 1PP9E 4IL6H 2P10A 4I2LC 1G1IA 3KZIH 3USSA 5AW4B 1IZNB 1KD1Q 5K5GB 3BCCG 2OYIC 1U7JA 3G3ZA 3O8ZA 1SQVJ 5CCHC 3GHGA 3L72J 2YNYA 1EXJA 1M1JA 3MTUE 3BRVB 1KORA 3R4YA 1A02J 1KB9E 2UWJE 2W6BA 2KP8A 3GHGB 1UIXA 2H43A 1LTIC 1M1JB 1BE3J 3H1JG 4A7PA 3V2NA 1SQXE 1YHQP 1VDFA 1FJKA 3BCCD 1YTZI 3CX5D 5KJ7A 2QE7H 2W90A 2IPPA 4H0LD 3EWKA 4RO0A 5DJTB 1NTZJ 2H8PD 2M3BA 1HH0A 1OVUA 5CBNA 1AV1A 1RY3A 2XV5A 5KLVK 2R32A 3H1JD 1LWUC 3CXHI 3H32A 1L4AD 3UIAA 1LTTC 3WMM0 3F5HA 2CPBA 3B71A 1PGQA 5BU5A 1EXIA 1JNMA 1E5WA 3JCUH 3KXDA 4N6JA 1HGZA 2QG4A 2Z4EA
chains in the Genus database with same CATH topology
2B87A 4IOIH 1MFTA 2LXCB 2M5AB 3S1KA 5K5GB 3MZWB 1U7JA 2B89A 1LP1B 2Q1KA 1JM0A 1X0TA 2OTKE 4NPDA 1EDLA 1BDDA 2B87B 4CPGA 2R44A 4HKZH 4BXLA 1ZXGA 4HB1A 2P58A 2KS1B 4NPEA 1EDJA 2JWDA 2UWJE 4GOFA 4KJMA 2WMMA 2QVAA 4ASWA 4GOEA 2RKLA 1S3JA 2LXBA 2QRXA 2HR3A 3FXDA 1SS1A 2SPZA 4WWIA 4NPFX 2I8DA 2K3RA 4ASVA 3FXEA 5DJTB 5EFWB 1JMBA 4GODA 1LT1A 1OVUA 5DJUB 5CBNA 1EDIA 4MN4C 1H0TA 4EYYQ 1OVVA 2KIKA 3MHVA 1ZW0A 2ZAEB 2M5AA 1U7MA 2B88A 2M0BA 2KZJA 1NVOA 4K35A 5C39A 1FC2C 4ZNCA 1H0TB 1DEEG 4ZMDA 5CBOA 3PH0A 1Y47A 2KZIA 2KI7B 2KUBA 1Q2NA 4K3AA 4HJGH 1BDCA 1EC5A 3ZDMA 3QWOC 1EDKA 1OVRA 2LR2A 1LP1A 4JBZA 3RGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B87 A;  4IOI H;  1MFT A;  2LXC B;  2M5A B;  3S1K A;  5K5G B;  3MZW B;  1U7J A;  2B89 A;  1LP1 B;  2Q1K A;  1JM0 A;  1X0T A;  2OTK E;  4NPD A;  1EDL A;  1BDD A;  2B87 B;  4CPG A;  2R44 A;  4HKZ H;  4BXL A;  1ZXG A;  4HB1 A;  2P58 A;  2KS1 B;  4NPE A;  1EDJ A;  2JWD A;  2UWJ E;  4GOF A;  4KJM A;  2WMM A;  2QVA A;  4ASW A;  4GOE A;  2RKL A;  1S3J A;  2LXB A;  2QRX A;  2HR3 A;  3FXD A;  1SS1 A;  2SPZ A;  4WWI A;  4NPF X;  2I8D A;  2K3R A;  4ASV A;  3FXE A;  5DJT B;  5EFW B;  1JMB A;  4GOD A;  1LT1 A;  1OVU A;  5DJU B;  5CBN A;  1EDI A;  4MN4 C;  1H0T A;  4EYY Q;  1OVV A;  2KIK A;  3MHV A;  1ZW0 A;  2ZAE B;  2M5A A;  1U7M A;  2B88 A;  2M0B A;  2KZJ A;  1NVO A;  4K35 A;  5C39 A;  1FC2 C;  4ZNC A;  1H0T B;  1DEE G;  4ZMD A;  5CBO A;  3PH0 A;  1Y47 A;  2KZI A;  2KI7 B;  2KUB A;  1Q2N A;  4K3A A;  4HJG H;  1BDC A;  1EC5 A;  3ZDM A;  3QWO C;  1EDK A;  1OVR A;  2LR2 A;  1LP1 A;  4JBZ A;  3RGU A; 
#chains in the Genus database with same CATH topology
 2RH0 A;  1KIL D;  4GDO A;  4YXW H;  3MZW B;  2WPR A;  5GTI E;  1GW4 A;  1URQ D;  2WSC J;  1QX8 A;  3BCC E;  1J2J B;  3CX5 E;  1AFO A;  1BDD A;  1FZF A;  1NTM J;  3L75 G;  4BXL A;  2IYP A;  3T97 B;  2P58 A;  2E76 C;  2FXM A;  1SQP G;  2WMM A;  2QVA A;  5E79 E;  4GKG A;  1L0N J;  3PP5 A;  1RF0 A;  3L73 G;  2R5D A;  3CWB G;  1N7S C;  3RK2 C;  3H1J E;  2QA4 P;  1NO4 A;  4NPF X;  3HE5 A;  3G4S P;  5AVU B;  1OIP A;  1OX3 A;  4D6T D;  2KK7 A;  3L75 D;  1FZB A;  1YTZ T;  2CPS A;  4H0L B;  5GTI H;  3NTN A;  1AQT A;  3H1I J;  4WY4 C;  3HE5 B;  3PTZ A;  3A7O A;  3CX5 H;  2HYN A;  3HD7 C;  2C9N Y;  3L73 D;  1L4A A;  1Q90 D;  1X9V A;  1OW7 A;  2OQQ A;  3F89 A;  5E79 H;  1GK4 A;  1LTS C;  1J1D C;  4Y99 B;  4LGD E;  2E43 A;  1QGK B;  1L4A B;  2KS1 A;  4IFF A;  4JYB A;  2ZVO B;  4BRY B;  1KZU B;  3AEA C;  2G3A A;  2O1J A;  3BVH A;  1BDC A;  3MP7 B;  1RE3 C;  1LP1 A;  2KNC B;  1VF5 B;  3RGU A;  1KIL A;  3AE1 C;  1QL1 A;  2YIU C;  3B5N C;  2QJP C;  3CXH D;  1NWQ A;  1URQ A;  2B89 A;  1LP1 B;  1NH4 A;  3RK3 C;  2NPS C;  2J59 M;  1KC8 Q;  2OTK E;  1XTG B;  2FBW C;  2Q9I A;  4L74 A;  1QEX A;  1URQ B;  1FZC A;  4D6T E;  3L75 E;  4M3L A;  1BGY E;  4JYC A;  2ZYG A;  2E75 C;  2Z5H A;  1SS1 A;  4L73 A;  3L70 G;  3WUV A;  3V4Q A;  1OW6 A;  2IFM A;  2K3R A;  3L73 E;  2WT7 B;  3M9H A;  4AYC A;  3S9O A;  1SLQ A;  4PJ0 E;  2HOD A;  2KIK A;  1OFC X;  2ZXX A;  3KDP B;  1N2D C;  2Q3E A;  2OTJ P;  5AW1 B;  3M91 A;  2HOD B;  3L70 D;  5B5E E;  1S5L X;  1W2E A;  3L71 J;  1HUC A;  3CXH E;  1LJ2 A;  3H1H G;  4JF7 A;  2A45 G;  3CLQ A;  4HJG H;  1FZG A;  2FFD C;  1NTK G;  2LR2 A;  4TLF A;  1CW5 A;  1OMI A;  1LTB C;  4PJ0 H;  3D6Y A;  3TGU E;  3RBX A;  2ITA A;  2JO1 A;  3CMA P;  2GA1 A;  1SQP K;  3AE9 C;  4PV1 C;  2D2C C;  5APQ A;  2B9B A;  1YYC A;  3IF4 A;  1TU3 F;  1P84 D;  3CCS P;  1MV8 A;  4H13 C;  3H1H D;  5B5E H;  2Y0D A;  1NTK D;  1SQQ E;  2W83 C;  1T2K D;  4KJM A;  1SFC D;  2BAS A;  2YKQ A;  3C9I A;  4YPC A;  3CME P;  1KB9 I;  3CXH H;  1NU1 J;  3KQG A;  1WT6 A;  2BCC J;  1S3J A;  1VQ8 P;  3QH9 A;  3SFD C;  4GIF A;  1E79 H;  2N9B A;  2V4H A;  4DT0 A;  4HYT B;  4I1L A;  3L70 E;  4GOD A;  2FYN B;  3TSI A;  3L36 A;  2WZ7 A;  3H1K G;  1HJ0 A;  3E1R A;  1SQB G;  2O01 N;  3CCM P;  1N73 A;  2OTL P;  3OW2 O;  2KLU A;  4K35 A;  2QJK C;  2RN0 A;  3VYI A;  1PGO A;  1JTH A;  1M1K Q;  3G71 P;  1N73 B;  1W5C E;  1PL5 A;  2PFX A;  2XU6 A;  3WUT A;  5KKZ C;  4KT0 J;  2NZ2 A;  1EC5 A;  2QM8 A;  2WSE H;  1P84 E;  3QWO C;  1JTH B;  3HE4 B;  1LTJ B;  2BEQ D;  1NTK E;  5KLV G;  1LNQ A;  2AXT E;  2OGU A;  1VQP P;  2IDB A;  2KB7 P;  1SFC A;  3GF3 A;  2R3S A;  4ASW A;  1VPC A;  2FYU J;  1L0L J;  5KLV D;  4YTP C;  4I6M C;  3GHG C;  5AVQ B;  2HR3 A;  1SFC B;  1M1J C;  2CK3 H;  1AQ5 A;  3GLM A;  1HF9 A;  1SQV G;  3WU2 E;  1JMB A;  4H44 D;  1LT1 A;  3L72 G;  3M0D A;  2ZYA A;  2HFE D;  3A2A A;  5KAI E;  5KJ7 C;  1GU5 A;  4DZO A;  1NAY A;  1BE3 G;  1IFN A;  1NTK K;  2PGD A;  4ZMD A;  4R4M A;  2O01 H;  4HH2 A;  1Y47 A;  3L72 D;  3CL3 D;  1HTL C;  4R4L A;  3VMY A;  3OJA B;  2WPQ A;  1NTZ G;  1FU1 A;  3WU2 H;  4OH8 B;  1FE6 A;  1MUU A;  1FOS E;  1Q81 Q;  2QEX P;  1Q86 Q;  2VRS A;  3R2P A;  2AEM A;  5KLV E;  1PP9 J;  4U3F E;  1K04 A;  2W27 A;  2YKO A;  4OGQ B;  1Q82 Q;  1JY2 O;  1FOS F;  1NTZ D;  3CCL P;  1DH3 A;  1S4X A;  3S4R A;  4TT3 H;  3P8C D;  2KSJ A;  1VL2 A;  1OXZ A;  3E7K A;  2QM7 A;  2I8D A;  2FXP A;  1JY2 P;  3FXE A;  1SQB K;  3ABV C;  1ZN5 A;  1W2B O;  1RF0 C;  1DD3 A;  1SQX J;  3O6Q A;  1OVV A;  1NTM G;  1ZW0 A;  4H0L C;  4H44 B;  5APW A;  1PPJ G;  3E1I A;  2WVR A;  1L0N G;  2Q3I A;  3C1L A;  2QSI A;  1IO4 A;  1DD4 A;  5CJ4 A;  1DEE G;  1JEK A;  5AW7 B;  3L74 E;  3AEC C;  3H1L J;  2KLV A;  4Y99 C;  5M1B A;  4K3A A;  5AW6 B;  1L4A C;  5TJH A;  3ZDM A;  1EDK A;  1KB9 H;  1AVO A;  1PPJ D;  2PP6 A;  3H1I G;  1NTZ E;  1L0N D;  1UII A;  2XZR A;  3FWL A;  1OZH A;  2A06 G;  3A0H E;  1VF5 C;  4RJT A;  1ZR4 A;  3H32 B;  3PLN A;  3AE7 C;  3P8C E;  3VP8 A;  2R44 A;  1GW3 A;  1T8Z A;  3M9B A;  3H1I D;  3CCV P;  1URQ C;  3CCJ P;  3CCE P;  1JY3 N;  2QRX A;  1SQV K;  2A06 D;  4W7Y A;  2WQY C;  1NOH A;  1RQU A;  3HTK A;  1KYO D;  1FS0 E;  2HPC A;  4ASV A;  1VQM P;  1S72 P;  1QL2 A;  1WMK A;  5AW5 B;  3A0H H;  5AW2 B;  1EDI A;  2K1A A;  2Z5I A;  3LW5 H;  1FDM A;  5CHX A;  4Y28 J;  3U59 A;  1IC2 A;  1HVV A;  3SWY A;  4EIJ A;  5APY A;  1AVY A;  1WRG A;  3FWN A;  1PPJ E;  1NTZ K;  1DX7 A;  3AE8 C;  1SQP D;  3N7N A;  1H88 A;  2ZT9 D;  2H89 C;  2YMK A;  4PD4 I;  4KHX A;  4OVN F;  1NHL A;  1VQO P;  1NGM B;  3CWB D;  1GK6 A;  1P84 I;  1VQ7 P;  2A45 I;  3V6I A;  3S1K A;  3Q5P A;  3H1I E;  1KIL E;  5GTH E;  5APX A;  3Q5S A;  1ZOY C;  4WY4 D;  2A06 E;  2Q7C A;  3L71 G;  1GDT A;  1KYO E;  1K05 A;  2KS1 B;  1EDJ A;  2K37 A;  4W80 A;  4GOF A;  3CCU P;  2N1T D;  4IL6 X;  1JCD A;  4QMA A;  2AXC A;  2RMZ A;  2LXB A;  2W8Z A;  3P8M C;  1CI6 A;  1EQ7 A;  1KIL B;  5AW8 B;  1FBM A;  1NTM K;  2P7J A;  3I55 P;  5EFW B;  1IFI A;  4D6T J;  1BGY J;  5GTH H;  1NJI Q;  3V2Q A;  1L0N K;  4DJG A;  1H0T A;  2R5B A;  3B5N D;  1SQP E;  1JUN A;  2FYN C;  1FZC B;  1KYO H;  2M5A A;  3BRT B;  1U7M A;  2KZJ A;  2XKM A;  1H0T B;  1NU1 G;  3CWB E;  2BCC G;  3LID A;  4WB4 A;  1IK9 A;  5CCG C;  2AEF A;  4WVZ A;  1LT9 A;  2KZI A;  3VP9 A;  2E75 D;  5KLI B;  1N73 C;  5H2F E;  1PIX A;  1KFN A;  2ZT9 B;  3V4W A;  4JBZ A;  3TDK A;  1LT9 B;  1YQ3 C;  2WPV B;  1QLE D;  2B87 A;  4IOI H;  1MFT A;  2JWA A;  2LXC B;  3RL0 C;  4DCK A;  2BCC D;  1LTJ C;  5AVT B;  4N3Y B;  1FDI A;  3VTP C;  4WY4 A;  4I7Z B;  3CD6 P;  5AVZ B;  2Y0E A;  5AVW B;  2B87 B;  2W6J H;  2WWW A;  4WY4 B;  3AE6 C;  2N1T A;  3TGU J;  1LTA C;  1AJY A;  1N8R Q;  4PD4 D;  1RQV A;  2V7Q H;  2Q5U A;  1NYH A;  5H2F H;  2N1T B;  1PGJ A;  1RE4 A;  1YJN P;  5BU8 B;  2E74 D;  2Y9Y A;  1RE3 A;  2FKW B;  1SFC C;  1SQQ J;  1OW8 A;  3B5N A;  2IBZ G;  1S9K D;  4O9B A;  3N4X A;  4ZKU A;  2B88 A;  1X8Y A;  2WSE J;  1IFJ A;  2QJP B;  3VN0 A;  2FYU G;  1L0L G;  3B8E B;  3HUS A;  3VMA A;  1JO5 A;  2PAJ A;  3L37 A;  2BCC E;  5AVR B;  1VQ4 P;  3VMX A;  3II6 A;  1ZLL A;  2KUB A;  3HUS B;  2WSS H;  2M3E A;  2XDJ A;  2J5U A;  3TK1 A;  2Q6Q A;  4PD4 E;  2H7H A;  4JQ0 D;  2K88 A;  3AEE C;  1HGV A;  1KN7 A;  5AVV B;  3H1K D;  3H1H E;  1SQB D;  1H8A A;  1BCC J;  1KQF B;  1OWA A;  4OGQ C;  2P1J A;  3FGA D;  3CI9 A;  4RKU J;  3GG2 A;  5APV A;  2C9L Y;  3AE5 C;  2N9Y B;  2E5Y A;  4W7Z A;  1PP9 G;  2E74 B;  4PD4 H;  2P67 A;  1NU1 K;  2O01 J;  2Y9Z A;  3M06 A;  2JEE A;  1P84 H;  3MUD A;  4EI2 A;  2A45 H;  3ITK A;  1LGH B;  2HLO A;  4H44 C;  2ZYD A;  3EFF K;  2JR8 A;  3V2R A;  2AXT H;  1CZQ A;  3W67 A;  3RBZ A;  1AA0 A;  2IFN A;  2O1K A;  3I56 P;  2OAR A;  1FDO A;  1J1E B;  3H1K E;  1SQX G;  1SQB E;  1KQL A;  1YJ9 P;  1PZQ A;  3KPE A;  3W68 A;  1SQV D;  2QJY B;  3U1C A;  1GL2 D;  1QVF O;  3EQ2 A;  1FJP A;  2JDI H;  3KHU A;  1GMJ A;  4NPD A;  3MGN A;  4CPG A;  2WTY A;  1IK7 A;  1NKZ B;  2WSF H;  3L4F A;  3H1L G;  1KYO I;  1SQX D;  1BE3 D;  2HG5 D;  2ZXE B;  5AVS B;  2C0W A;  4BWN A;  5KAI H;  4GT1 A;  1YQ4 C;  5AVY B;  4U3F J;  2P2U A;  2I1J A;  2K9J A;  1JB0 J;  1R8E A;  3SSU A;  1YIT P;  1K9M Q;  1HBW A;  2AEJ A;  2K9J B;  3H1L D;  2FYU K;  1L0L K;  3D71 A;  1JY2 N;  3C8V A;  3M9Q A;  1FC2 C;  4AUW A;  3JSV C;  2OYH A;  2IYO A;  1SQV E;  2YKP A;  3AE4 C;  5BVZ A;  4EOT A;  2OYH B;  5CCH D;  1PGP A;  3L72 E;  2J58 A;  2WIT A;  2MJZ A;  4C7R A;  2I1K A;  1S5L E;  3AEB C;  1KMI Z;  3O6Q B;  5KAF E;  2GUV A;  1JMM A;  3L74 J;  1GL2 A;  1BE3 E;  1XTC C;  4AQR D;  3TF5 A;  5TIS E;  3AED C;  3CCR P;  3A3Y B;  1EDL A;  1K8A Q;  1NTM D;  3CPW O;  1GL2 B;  3JCU E;  1A02 F;  1KFM A;  1LTG C;  1USE A;  4B86 A;  1ZRT D;  2RKL A;  3M0A A;  3H1L E;  3OA7 A;  2FY8 A;  2M8R A;  3LW5 J;  1NKN A;  1S5L H;  3Q3D A;  3MD0 A;  1FZA A;  2SPZ A;  1RF1 A;  1MZ9 A;  1KV4 A;  3IN6 A;  5KAF H;  1KIL C;  3V5B A;  4IFM A;  1L2P A;  1KQG B;  1RF1 B;  5TIS H;  1JY3 O;  3FX0 A;  2YXQ B;  1VF5 D;  3LIE A;  3NMD A;  1EZV G;  4XE5 B;  3BCC J;  4XA4 A;  1VQ6 P;  2W6A A;  3CC2 P;  3NXS A;  2KYV A;  1FZC C;  1M57 D;  2IZ0 A;  2L5G B;  2KSE A;  1FZE A;  1U57 A;  3HTK B;  1ZV8 A;  3T97 A;  1MFZ A;  1SQX K;  3MIW A;  1JY3 P;  3H6P A;  2OYI A;  2HPC B;  5CCH A;  2O3J A;  3AEG C;  3WUU A;  1NAF A;  3H1J J;  4U7J A;  1FAV A;  4D6T G;  2ZJS E;  1BGY G;  1EZV D;  1NTM E;  3SFE C;  2OYI B;  2DW3 A;  5KLI C;  5CJ0 A;  2ZT9 C;  2E76 D;  2YXR B;  1L0N E;  1LT9 C;  1ZRT E;  4YXD C;  1YJW P;  1JM0 A;  3Q2Y A;  1T6A A;  3PHL A;  3AE2 C;  1N7S D;  3RK2 D;  4I7Z C;  2G8Y A;  1BGY D;  3NFQ A;  2YO3 A;  1S2E A;  2WSC H;  4LC1 A;  1LWU A;  2JP3 A;  4BRY A;  1USD A;  2ZFC A;  3HD7 D;  2N1T C;  2WPS A;  1VQN P;  2KNC A;  1LWU B;  1BSN A;  2ZAE B;  4LLH A;  1RE4 C;  3TGU G;  4L76 A;  1G2C A;  1KQS O;  1NVO A;  1YBK A;  2H88 C;  4ZNC A;  4Z1M H;  1EZV E;  2IBZ I;  1ZP0 C;  3L71 D;  5CMZ A;  1R5L A;  3L75 J;  1CI6 B;  2ZVN B;  2GM4 A;  2IZ1 A;  1G2C B;  2JKV A;  1RHZ B;  1SQP J;  1SQQ G;  1IJD B;  1N7L A;  3RK3 D;  2NPS D;  1CSB A;  1Z56 A;  1M8O B;  3L73 J;  3TGU D;  3CWB J;  1VQL P;  3HUS C;  3GF7 A;  1Q7Y Q;  2M5A B;  2WT7 A;  3A5T A;  2Q1K A;  3KYQ A;  1X0T A;  2V7Q J;  2E76 B;  1IFD A;  1N7S A;  3IR9 A;  3D70 A;  1GZL A;  1SQQ D;  4HKZ H;  2K9Y A;  4RES B;  4NPE A;  2C0X A;  1VQ9 P;  1IFP A;  3GW6 A;  4GOE A;  1NU1 D;  1N7S B;  2E5T A;  3RK2 B;  5CCG D;  1S1C X;  1M56 D;  3Q1M A;  3FXD A;  1GU4 A;  5B66 E;  4OWF A;  2BEZ F;  4N78 D;  3CC4 P;  3HD7 A;  5APT A;  1JCC A;  3L71 E;  2NRG A;  3VOP A;  5DJU B;  3HD7 B;  2FYZ A;  3HRN A;  4XFJ A;  3RL0 D;  3MHV A;  1YI2 P;  2E74 C;  5L8R J;  3PRJ A;  1BCC G;  1J1D B;  3VMZ A;  3RK3 E;  1T2K C;  4JPZ B;  5AW0 B;  4L75 A;  4ZKP A;  3SWK A;  3TNU A;  3V2P A;  5B66 H;  1SVF A;  3I5C A;  1Q2N A;  2NPS A;  3MUD C;  4PV1 D;  1Y8A A;  2D2C D;  2LKM A;  1OVR A;  2YIU B;  3P32 A;  1BCC D;  3B5N B;  4IFD K;  3P7K A;  4H13 D;  3TNU B;  3L70 J;  3RK3 B;  2NPS B;  1N86 A;  3M0D C;  1J1E C;  5AVX B;  1NU1 E;  2L91 A;  1RH5 B;  3K5B A;  1H89 A;  4UB8 E;  3U1A A;  1JOC A;  1T3U A;  1X22 A;  2XND H;  5KTB A;  2IBZ D;  2QJY C;  4C7N A;  4N78 E;  4HB1 A;  3B4S A;  1GD2 E;  2IX7 C;  2E75 B;  2FYU D;  3EFG A;  5CCG A;  1L0L D;  1PV3 A;  4C7N B;  3IAO A;  1SP4 A;  5APS A;  2XNX A;  4WWI A;  1R5S A;  3H1H J;  1KTM A;  1QVG O;  1MKM A;  3G6E P;  1NTK J;  3D6Z A;  3HE4 A;  4UB8 H;  1LTJ A;  3TYY A;  4EYY Q;  5AW3 B;  5APU A;  1S9K E;  1HWT C;  1D7M A;  2M0B A;  2FFD A;  3RL0 g;  3RL0 B;  3A0B E;  5C39 A;  1SQQ K;  3AE3 C;  1BCC E;  2MKV A;  1DIP A;  2E42 A;  2R3C A;  4U3F G;  2OYO A;  3L35 A;  2FXO A;  4OGQ D;  3BAT A;  2FFD B;  3SWF A;  3PH0 A;  3Q5R A;  3OAK A;  2KI7 B;  2PRR A;  3GMA A;  1K73 Q;  2IBZ E;  3CX5 I;  2OYH C;  4UB6 E;  2WSF J;  4PV1 B;  2D2C B;  4DOJ A;  1DEB A;  1X79 B;  1M90 Q;  2Y0C A;  4H13 B;  2FYU E;  4WBA A;  1L0L E;  1PP9 D;  4U3F D;  3G9R A;  1Y9B A;  3A0B H;  2GUS A;  1ZXG A;  3H1K J;  1SQB J;  2JWD A;  4C46 A;  1ZR2 A;  3H25 A;  1G1J A;  2POH A;  1GL2 C;  3CC7 P;  2KXP B;  3IFM A;  2YMY A;  1VQ5 P;  1ZME C;  5KJ7 D;  4UB6 H;  1KB9 D;  4EDF A;  4IL6 E;  3L74 G;  2QIW A;  3KZI E;  3JC2 2;  1GTW A;  1BSH A;  5AW9 B;  4MN4 C;  5KLV J;  2JJL A;  1M7L A;  1HJB A;  2QJK B;  1RF1 C;  1IFM A;  3BAS A;  3PJS K;  1YIJ P;  1VQK P;  1PFI A;  2KOG A;  3L74 D;  5KKZ B;  3AEF C;  5CBO A;  1T3J A;  2YO2 A;  1EZV I;  3CCQ P;  1PP9 E;  4IL6 H;  2P10 A;  4I2L C;  1G1I A;  3KZI H;  3USS A;  5AW4 B;  1IZN B;  1KD1 Q;  5K5G B;  3BCC G;  2OYI C;  1U7J A;  3G3Z A;  3O8Z A;  1SQV J;  5CCH C;  3GHG A;  3L72 J;  2YNY A;  1EXJ A;  1M1J A;  3MTU E;  3BRV B;  1KOR A;  3R4Y A;  1A02 J;  1KB9 E;  2UWJ E;  2W6B A;  2KP8 A;  3GHG B;  1UIX A;  2H43 A;  1LTI C;  1M1J B;  1BE3 J;  3H1J G;  4A7P A;  3V2N A;  1SQX E;  1YHQ P;  1VDF A;  1FJK A;  3BCC D;  1YTZ I;  3CX5 D;  5KJ7 A;  2QE7 H;  2W90 A;  2IPP A;  4H0L D;  3EWK A;  4RO0 A;  5DJT B;  1NTZ J;  2H8P D;  2M3B A;  1HH0 A;  1OVU A;  5CBN A;  1AV1 A;  1RY3 A;  2XV5 A;  5KLV K;  2R32 A;  3H1J D;  1LWU C;  3CXH I;  3H32 A;  1L4A D;  3UIA A;  1LTT C;  3WMM 0;  3F5H A;  2CPB A;  3B71 A;  1PGQ A;  5BU5 A;  1EXI A;  1JNM A;  1E5W A;  3JCU H;  3KXD A;  4N6J A;  1HGZ A;  2QG4 A;  2Z4E A; 
#chains in the Genus database with same CATH homology
 2B87 A;  4IOI H;  1MFT A;  2LXC B;  2M5A B;  3S1K A;  5K5G B;  3MZW B;  1U7J A;  2B89 A;  1LP1 B;  2Q1K A;  1JM0 A;  1X0T A;  2OTK E;  4NPD A;  1EDL A;  1BDD A;  2B87 B;  4CPG A;  2R44 A;  4HKZ H;  4BXL A;  1ZXG A;  4HB1 A;  2P58 A;  2KS1 B;  4NPE A;  1EDJ A;  2JWD A;  2UWJ E;  4GOF A;  4KJM A;  2WMM A;  2QVA A;  4ASW A;  4GOE A;  2RKL A;  1S3J A;  2LXB A;  2QRX A;  2HR3 A;  3FXD A;  1SS1 A;  2SPZ A;  4WWI A;  4NPF X;  2I8D A;  2K3R A;  4ASV A;  3FXE A;  5DJT B;  5EFW B;  1JMB A;  4GOD A;  1LT1 A;  1OVU A;  5DJU B;  5CBN A;  1EDI A;  4MN4 C;  1H0T A;  4EYY Q;  1OVV A;  2KIK A;  3MHV A;  1ZW0 A;  2ZAE B;  2M5A A;  1U7M A;  2B88 A;  2M0B A;  2KZJ A;  1NVO A;  4K35 A;  5C39 A;  1FC2 C;  4ZNC A;  1H0T B;  1DEE G;  4ZMD A;  5CBO A;  3PH0 A;  1Y47 A;  2KZI A;  2KI7 B;  2KUB A;  1Q2N A;  4K3A A;  4HJG H;  1BDC A;  1EC5 A;  3ZDM A;  3QWO C;  1EDK A;  1OVR A;  2LR2 A;  1LP1 A;  4JBZ A;  3RGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...