3N05A

Crystal structure of nh3-dependent nad+ synthetase from streptomyces avermitilis
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
584
structure length
568
Chain Sequence
SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NH(3)-dependent NAD(+) synthetase
publication title Crystal Structure of Nh3-Dependent Nad+ Synthetase from Streptomyces Avermitilis
rcsb
source organism Streptomyces avermitilis
molecule tags Ligase
total genus 188
structure length 568
sequence length 584
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00795 CN_hydrolase Carbon-nitrogen hydrolase
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3n05A03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3n05A02
3.60.110.10 Alpha Beta 4-Layer Sandwich Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase Carbon-nitrogen hydrolase 3n05A01
1FO6A 2A84A 3HMQA 1NYLA 1UF5A 2WQ7A 4IZSA 1PG2A 1N1DA 2E11A 3C8ZA 2A4MA 1I6MA 1PFUA 1WY5A 1O0CA 4MWBA 1I6KA 1SURA 4R2LA 1IH8A 4I6GA 1UF7A 3AL0C 4EF6A 4Q16A 3KT0A 1T6XA 4JYZA 2CV1A 4IZTA 1M8GA 4H3SA 2CV2A 2A1UA 3FETA 4H5UA 2QUHA 4GU5A 5DB4A 1TFUA 1H3NA 4NAHA 2GM3A 4YMIA 4EFKA 2QTRA 3H9CA 3H99A 4MUFA 5KWVA 2X1LA 3UK2A 1GN8A 2CYCA 2YXNA 2IJGX 1U7DA 3CVWA 3FIUA 1U3DA 2DR2A 4WNYA 1EFVA 3SYTA 1RQGA 2DUMA 3KLCA 2YY5A 3VGJA 5HUHA 4PY2A 1DNPA 4ZCRA 3A04A 4GYNA 3X1JA 3LCJA 1VLHA 2QUJA 1J20A 3OP1A 5H8KA 1HYBA 1MAWA 1PFYA 4MUGA 2XRYA 1JILA 2RE8A 4TS1A 2CT8A 4KZFA 2A1UB 2CV0A 2VHHA 2J5BA 3MXTA 4CYGA 4GRIA 1NUSA 3CLUD 4ZT4A 5TS2A 1WXGA 4JFAA 3UC5A 2WB2A 1N2JA 1WXEA 1JHDA 1EE1A 4ZT3A 4EG1A 5LLTA 1KH1A 3D6UA 1LW7A 3NBAA 3GUZA 1N75A 3ZJUA 3IOEA 1F7UA 1M8PA 4LF0A 4EG3A 1EFVB 1VBMA 1M8JA 4HK4A 3TNJA 1K4KA 4A91A 2QJFA 3G6KA 4MULA 4ND6A 1QRUA 2NSYA 3IVXA 2JAXA 2A86A 4XFDA 1OBHA 2PFSA 2V0CA 1O95C 4AQ7A 1JIJA 3PRHA 1O0BA 2DYVA 3HFJA 1J1UA 3IUBA 3SZ3A 3DO8A 4RPIA 1O94D 3MMXA 3K9WA 4HJXA 3H05A 4WSOA 1M8FA 3JXEA 5BNZA 5HUJA 4KR7A 1WJGA 4MW1A 3INNA 2PXHA 4IZWA 1MC1A 1NZJA 5DASA 1KAMA 1N78A 1EFPA 2TS1A 3MLBA 3A05A 3N9IA 2JANA 1BS2A 2HMAA 3CVVA 4PBRA 3L93A 4BWVA 1PFVA 4ZT7A 1EMSA 3RJZA 1O97C 3HZRA 1WXIA 5DEOA 3FOCA 1EJ2A 1ILEA 4NX2A 4GYLA 1U7XA 5J5AA 5H8JA 4MAFA 4YP5A 1G8HA 4X0EA 1R6XA 2NZ2A 1O95D 2QTMA 4U8HA 5JQNA 2J07A 2QUKA 4CT0A 2AZXA 3TS1A 1EFPB 1KKUA 4EG7A 1KP3A 1KH3A 2A1TS 4IZUA 3P0HA 4UZEA 1H3FA 4EG8A 5AHWA 1NUUA 2QJTA 4OUDA 1COZA 4MQ6A 4MWDA 4CQNA 3CVUA 4MW7A 2ZUEA 3LE8A 2AG6A 4NDAA 2X1MA 1O97D 3U1VA 4G6ZA 3QTTA 2YWCA 3FI0A 4QRDA 4P2BA 3TQOA 4ZT2A 3N05A 1IHOA 3IVZA 2R5WA 5J59A 3F3MA 1NP7A 1KORA 3HV0A 3IH5A 4MW5A 2RD2A 4HG3A 1WQ3A 1N77A 3CLUC 3CR8A 1TYAE 3P0IA 3SZGA 3I05A 5KHAA 3RK1A 1NURA 4IZVA 4PBTA 3H9BA 1KQOA 1S4MA 3AKZA 1JMVA 1FYDA 1T9GS 4NZPA 2AKEA 4OUDB 3ZIUA 2WQ6A 2WSIA 5K0SA 3ZJTA 3K32A 3G5AA 3NV7A 3IVCA 2OQ2A 1XNJA 5IJXA 5FO1A 1KR2A 3ND6A 2HGZA 1MAUA 4DDKA 2DYUA 2QJOA 3FNRA 2VXOA 3H97A 2E2LA 1X8XA 3A2KA 5H8LA 3RBAA 2DLCX 1K4MA 2E18A 2J09A 1UF4A 3IMEA 1XNGA 2I1LA 4EG6A 1O94C 1G8GA 5H16A 1OWMA 2B7LA 3DV2A 3CA8A 2XRZA 4J76A 1OWLA 3FHJA 4MUKA 4MVXA 3UMVA 1O5TA 4ZT6A 1IQ0A 5KCMA 1QTQA 1GAXA 4MW4A 3GMIA 1J21A 1QJCA 2A7XA 1VBKA 2GGLA 2O5RA 1OD6A 2VHIA 1QNFA 1ZH6A 5HG0A 1MBZA 5H7XA 1MB2A 2QUIA 4E1AA 2JA2A 2CYAA 2E0IA 3CLTC 1QRSA 3TZEA 4MUNA 5F23A 3IODA 3Q4GA 4XFJA 2D54A 1JECA 3ZJVA 3D6VA 3NBKA 1QU2A 3E27A 3FH0A 1EXDA 5TEVA 4CDNA 4AS1A 5H8IA 3AG5A 1R6TA 1M1ZA 3KFLA 1F7VA 2D13A 1Q11A 2O8VA 1N2GA 3AFHA 4DDMA 4MVCA 1J1ZA 5EKDA 3IVGA 4KR9A 3COYA 3LOQA 1LI7A 2D5BA 3M5WA 3X1KA 1OWNA 1O6BA 4NATA 4MUEA 4QREA 1H3EA 4ARCA 3P8KA 4S1OA 3X1MA 4MW9A 3CLTD 1UFVA 3ELBA 2EJCA 4MW0A 4U63A 1G59A 2PIDA 2ZP1A 1B6TA 3ZXSA 1TQ8A 2J4DA 4HG5A 3FWKA 5LFAA 2H2AA 1K97A 3AIIA 1Q15A 2J08A 1QU3A 4MWEA 2DEUA 4JZYA 4K0RA 1PFWA 4L2IA 3BL5A 4F3RA 2CUZA 4EGAA 3FG9A 1V8FA 3CVXA 4NAUA 3PNBA 2IP1A 3RHSA 3SEQA 3ZUGA 4EG4A 1KP2A 3N8HA 1X6VA 3UY4A 1OWPA 4U7JA 4I6EA 4MUHA 4HJRA 4K03A 1EUQA 1KAQA 1CT9A 4KKVA 2GKSA 1N3LA 1N2HA 1WOYA 3KT6A 4G5FA 4DE5A 1GTSA 1YUNA 2PG3A 4MVYA 1XNHA 3DPIA 1K92A 2BTEA 4XSVA 4ZCSA 2DXIA 4L2IB 2A1TR 1I2DA 2VTBA 3ILVA 3PXUA 1M8KA 1ZUNA 2Z08A 4MWCA 1NUPA 3RK0A 3IDFA 3GLVA 4UZFA 2DETA 3SP1A 3IW3A 2E21A 1G8FA 4J75A 3HKXA 1F4LA 2PZ8A 3L92A 1ZJWA 2X3FA 4R0NA 1GLNA 1PG0A 3ZGZA 3KT3A 2DERA 1JGTA 1V47A 1WXHA 4ZCQA 2Z09A 5TEWA 4YP6A 1NUQA 1VBNA 3IMCA 3N2YA 1WXFA 2E89A 3IMGA 1M83A 4CYYA 2X0KA 1Q19A 4ZCTA 1YI8A 4PBSA 1JZQA 2DPLA 1J31A 1WQ4A 1MB9A 2VTBB 1QRTA 3OTWA 3VU8A 1IFXA 5J58A 4HGDA 1GPMA 4KPUA 3SEZA 4MW6A 4MLPA 3ZXIA 1I6LA 1T9GR 3IOBA 3SDBA 5FNZA 3CLSC 3QE4A 1JIIA 3Q10A 2QTNA 4ZT5A 1N2IA 1FFYA 1N2BA 2CFOA 4MVWA 1YULA 2V0GA 3PNYA 4DJAA 1YIAA 2GGKA 3UOWA 1T6ZA 2Z3VA 3ND7A 1WZ2A 4R2MA 2GOYA 4DNXA 1J09A 3TQIA 3DLAA 3KT8A 2PLQA 1F89A 4ND7A 2UXYA 5TGTA 3P52A 2CSXA 4JXXA 3COWA 1OBCA 3FDXA 1XJQA 3IOCA 2EL7A 1KQNA 5DK4A 3S3TA 1D2RA 2ZUFA 2W1VA 2IELA 4KPUB 4I6JA 3TZLA 1TYCA 2YWBA 2PZAA 1TEZA 3PNVA 3HL4A 1IQUA 3IUEA 1EUYA 1JIKA 3CLSD 1UF8A 2C5SA 1ERZA 4KR6A 2HZ7A 4OJMX 1JEDA 1O96A 1TYBE 2H29A 3ND5A 1GTRA 3MUEA 2OV4A 1H1TA 1N2EA 2PZBA 4G5YA 4QBTA 4EG5A 3CLRC 5K0TA 1KQPA 4CYFA 3RFFA 3VRHA 4DDHA 1QQTA 4FZJA 1GZUA 1IQRA 2CYBA 3Q12A 5FO0A 1U0BB 1WKBA 1U3CA 5LM3A 1F9AA 1JZSA 1NI5A 2A88A 1MOPA 4RUKA 4CDMA 4F4HA 1LI5A 3KI8A 4MUJA 1KH2A 1YUMA 1NUTA 3COZA 3AG6A 1N2OA 3ISJA 1T6YA 1A8HA 4JXZA 1J70A 1ULHA 4ARIA 1NSYA 3COVA 1O96B 1YIDA 4YP7A 4MUIA 1MRZA 1P7PA 5IHXA 1ZH0A 2G36A 3QTBA 1JEEA 1TYDE 3MLAA 3A4IA 4ZCPA 4DLPA 2BYTA 4Q93A 1R6UA 1Q77A 4HPWA 3CLRD 3FY4A 1MJHA 1IVSA 5JBNA 3G59A 3WUYA 3HGMA 4MW2A 3CVYA 1IRXA 1VL2A 3P0JA 2E2KA 1Y42X 4YBRA 1OWOA
chains in the Genus database with same CATH superfamily
4R68A 2VDWB 5DZSA 1T15A 3G0OA 4PUSA 4PZ0A 4JJ4A 4YR7A 4I2OA 3F5FA 1WTAA 2A5JA 4HWOA 1WZUA 2P2GA 3FETA 2H7CA 5DB4A 4MQBA 4CM8B 4Q03A 2Q2EA 1MDFA 5HJ7A 1SVMA 4Q3LA 3E82A 3LRXA 4YP1A 4PSKA 3C5VA 2O5EA 1YJAA 1Q7GA 1PT6A 3IQZA 4ZDWA 4A8PA 5TDHA 3DXFA 1FP1D 5JPIA 3HBMA 4K1XA 2YNMA 4A27A 1Z47A 2Q8PA 3KTOA 1XZLA 5BMVF 1KYXA 4PV7A 2JHFA 3ZJUA 3RRJA 1PV1A 1T95A 1YVDA 3WZ2A 3LPNA 1SMYF 2PFGA 2PNJA 2BEUA 1RRJA 1S2DA 2V0CA 4AQ7A 3SZ3A 1VL6A 2HOSA 4LXYA 3TZKA 4YXWA 3JXEA 5K7SA 2PLYA 3F71A 3ABQB 3SLKA 3ER6A 2K9NA 3GMDA 1ZLYA 4XYLA 1Q50A 1KKMA 5AFSA 4XLEA 3ECOA 3OPYI 3PYXA 1Q3TA 4QNNA 3W9BA 3HCRA 4LZNA 5KYUA 4MDYA 3C7TA 1X3ZB 1E6MA 3RS4A 2C98A 4NYMR 1TK3A 3EDRA 3OF3A 2OHXA 4J94A 2XOEA 4B7CA 4OOEA 1JBQA 1UCFA 1HF3A 3GA7A 4K6OA 2JH3A 3U4CA 4NEHB 5D5UB 3D6TB 3V8QA 4NQZA 4C76A 5L3SA 2ACVA 1DOAA 2FUG2 4HC4A 5I47A 4M98A 4AZVA 3OC0A 3HV0A 1ZRDA 3SFZA 3DOIA 1GZ5A 1HDDC 1W5BA 3I2KA 2VBZA 1Z2NX 1LE8B 4OHPA 2R68A 3O5AA 4D3DA 4LJ5A 1DBWA 4QJ3A 2X0DA 3ADKA 5KDLA 2MABA 3TRJA 1SU4A 5J1SB 3PZBA 3UHJA 4V39A 5JYEA 2ZRQA 3DQZA 5ICFA 3CR3C 1Y34E 2J3JA 1SAXA 2FEAA 4QTXA 2PA3A 1KK3A 1G8KA 4LWQA 2DQ4A 3B9BA 4Y18A 2BYVE 4Z2AA 3GV0A 2L17A 5DYGA 1N6HA 2W4QA 4YDQA 2RGDA 2YVLA 1NXXA 3DL2A 3KLNA 4CLOA 5HILA 1RLOA 3TNFA 1JMYA 1XDZA 4QDZA 1QU3A 1DFIA 2OUMA 1CUCA 5ALZA 3FCXA 4TYWA 4EF5A 5I7VA 3M4XA 4GS5A 4H7HA 3B3AA 2HCFA 5C3MA 3RHSA 4UVBA 3GTGJ 2MR6A 1X15A 3UY4A 4II2A 1PW7A 2OV2A 2XAQA 1CQIB 5HRCA 1M1NB 1LPBB 3BUSA 2NYAA 2P4WA 5M5XJ 2QZSA 3PDJA 2CW8A 1IBCA 4UKDA 3RF6A 1LX6A 1FTSA 4F7WA 2I55A 4R9RA 4WHMA 5JVGF 3GEPA 5I9MA 1F4LA 3ZHCA 4GLOA 4H18A 3WNZA 4OH7A 3N1UA 4ZZDA 3SZTA 4IR7A 1W4CA 3NS7A 3MWDB 4OHKA 3GCXA 3SS9X 3WAKA 2FD5A 3OIOA 1AKTA 1Q92A 2VAMA 2SKDA 1H93A 2Q6TA 3ZQUA 5ALRA 4GW3A 4DVGA 5DHFA 2ZSIA 3FPLA 4C4XA 1EHCA 2WZBA 2AD1A 3RVBA 4KR3A 3BJRA 1I1HA 2AWNA 1UC4B 3K2BA 4Q4LA 3VDNB 4E2XA 4I1RA 4GFBA 1HE5A 4UE3S 1K68A 1JTFA 1GO2A 2W42A 4UNOA 4PVDA 3RR2A 4KMMA 5JCJD 5KI6A 1YTLA 4JP1A 2H4WA 4RMIA 3V3KA 4DJ5X 1W7PB 2A6TA 3EPJA 4A3FJ 2CLMB 4KITB 1N1GA 4HPQA 4ZKDA 1J2YA 1RFGE 2HRBA 4YCBA 5KOJA 2BY2A 4G1EB 3OZ7A 1NC3A 3FXLA 1EVJA 3ZQJA 1F2TB 4WCFC 1JG3A 5F9FA 4UEOA 4ZGBA 1N8TA 4TMVA 1RLTA 1LTHR 1XTJA 5JXHA 1F5SA 4D5FA 3CJTA 2SCUB 2YHBA 4XRGA 4ZCPA 4DMRA 4QWQA 3EVTA 4ZO4A 4B5KA 4FR2A 4OXQA 2HHJA 3T8YA 4Y7NJ 2BFPA 3U0VA 2E1PA 2OKCA 2FUKA 1ZGHA 1XCBA 2JIOA 4KXNA 4MWBA 3TSWA 4MGKR 4M3FA 1BR4A 1EK0A 2A6PA 4Q16A 2JVKA 4V0NA 1DQSA 5C34B 2JI7A 3O3NB 4Z9XA 1FUKA 3TTUA 5KHDA 1HZZA 1Z0FA 2LIPA 2GB4A 5EJCA 1Q0QA 4BJ6A 3HVKA 3HS3A 3PC4A 4LOLA 2OCIA 2O4CA 1XO1A 2XRYA 4H9GA 3VPDA 5DCMB 2RHCA 5KTOA 2CFTA 1N2JA 1KPGA 2PVCA 4WXHA 1PDWA 1CXZA 3O21A 4H16A 3ETEA 4CM5A 3TGLA 3LA7A 3UGJA 3LT2A 3TAUA 2PSEA 3AEYA 5M2QA 2XF8A 2HQRA 3FZVA 2HL6A 1P7YA 3I4CA 1QWOA 1XVIA 4O25A 2WWTA 1Y5RA 5L3QB 4TWAA 2I80A 1FOEB 4RCZA 5GP9A 3JQFA 2HJ9A 2HWYA 4UVGA 3PJGA 1WXIA 2PPLA 3DKXA 4B4KA 2YUTA 3M6WA 3PGKA 5L3FA 1GFZA 5BSEA 4CE6A 4HSGA 4HB3A 2VH5R 5CDSA 2VDJA 3P7MA 1NDUA 2P4SA 3PQDA 1JI8A 4UU8A 1D3YA 1CZKA 1WE2A 3EW7A 4AVYA 4BB6A 2GI4A 5AHWA 2VYQA 4GP6A 3MT9A 1P0CA 4N3GA 4JNCA 1NVFA 2VVTA 3DE5X 1IHOA 1TVMA 2HMUA 2XNSA 3I05A 4OJKA 3SE7A 2DU8A 1VHLA 3KZIC 4NJMB 3EHEA 2VRNA 4BU1A 5C8YB 1HC7A 2GBIA 4RL6A 4DBZA 3GARA 2WKSA 1TF7A 2H92A 2I1LA 3K1AB 2ACKA 3TMAA 3WWOA 3Q0VA 2BOVA 3GFVA 3O95A 1KZGB 4RVOA 1JR3D 4OAOA 3EA4A 2O3JA 3CE6A 3GNLA 2J7KA 2H6CA 2XF2A 4HRYA 2HA0A 3D5LA 2OK7A 4A3CJ 4IDOA 5FF9A 1A76A 3WKDA 2W2KB 1JHZA 3F5QA 4RB0A 2CQQA 1R6VA 3ZMZA 1MGOA 2OGZA 5KNDD 2IVZA 4XPIB 3ENNA 4FZ3A 4GYJA 2CLKB 4LA4A 3NIWA 3EDQA 3OP4A 4TLMB 3WL8A 2FZ4A 3F3XA 4GECA 1FCJA 4RFLA 1I3QJ 1VCNA 1J0XO 1QMGA 3FKSD 3UJ7A 5F64A 5BR7A 1JFVA 4NF2A 4MIMA 3GFBA 3KSUA 1AIPA 1I5EA 4NCAA 2CXXA 3HDHA 1P0PA 1ST2A 4QYIA 2YR0A 4AMGA 1QLHA 3AG2H 2EZUA 1LS1A 4QPJC 1E63A 4UHTA 4MV5A 4L8YA 2MDTA 3JRIA 4ASNA 1UZLA 2BH2A 1EQUA 1P3Y1 4AYTA 3RS8A 5GTIC 1MLDA 2P6OA 3PDCA 2YN4A 3AJ8A 4K03A 5FFXA 1EVYA 1EDZA 5HNHA 2O9LA 2BFFB 4LOIA 1YF3A 3F9KA 1IPHA 1ZX1A 1QCZA 2IH2A 2WJAA 4W63A 1ZGWA 2PUEA 1T1JA 1WXHA 4JOMA 1OPCA 1NLMA 1ES9A 2OGTA 2EKLA 1BU8A 4MLPA 4HN9A 5JASA 4CYMA 2IUUA 3Q9NA 3UJ3X 3UHPA 3VKGA 13PKA 4R2MA 2ZBGA 3BTVA 1SOAA 5TGDA 2YXBA 3W04A 3KKZA 2GEUA 1WQ1R 5EP1A 2GH1A 1GA4A 3V8LA 5TQ0B 1G1AA 5CCBA 3UMGA 1BXGB 3BSYA 1AF4A 3ROKA 3H2IA 1O96A 1KWKA 1B6RA 1QLJA 1JNXX 5K8IA 5L6MB 1JW9B 3HIFA 1E92A 2XRLA 1SCAA 2WJ4A 4P31A 2O2JA 4GM1A 1KQFA 1YUMA 4TUYA 2VBXA 4Q3CA 5BVGB 3HLKA 4MCIA 3P9ZA 4ZA2A 4CG3A 2OR3A 5C8YF 4ZQFA 3AM4A 4MV0A 1A97A 4PHGA 1DCMA 2YJZA 2R6ZA 4JJGA 1R0YA 5CA1B 4W9NA 1V8OA 2FWBA 4ZMRA 3C8MA 1FJXA 1QYRA 1VI2A 1WJFA 5CFOA 1BIBA 1TEVA 1XCOA 4W97A 1Z28A 1EWKA 2ZWMA 2AOTA 2OFOA 4MGHA 4C88A 1BQ3A 2X4IA 4JR0A 1QO9A 4DG5A 3M9AA 4UMDA 1BBYA 1XELA 3H8VA 3NDBB 2FSIA 2DBYA 2DM6A 4ESVA 4BHTA 2AC2A 3C3XA 3BMOA 4WLNA 1RZRD 4P6VF 5JE8A 1PWXA 5EGSA 4MYHA 1EE1A 2KMUA 4ITRC 1ZQ3P 2DTRA 3IDSA 2GPSA 1QB8A 5ADHA 3EGVA 2ID6A 1K5DA 4PYKA 3PC8C 4OINF 1NTOA 1O9GA 5JZOA 2C99A 3D2BA 2VH1A 3TOZA 3U3OA 1DUIA 3N6RA 2EXXA 1I27A 2WYIA 2GYYA 1QZXA 5FYQA 5T5QA 2W5UA 3BAZA 4BU0A 4PHFA 2FHPA 2VEOA 2CLSA 1E1MA 3EF3A 3ORYA 1X70A 4L95C 1LVHA 4UQLA 1GTMA 1H0HA 2F8LA 4RO0A 3L0BA 1J0CA 1PFGA 3FWNA 5ALIA 4HF1A 2X9QA 4BN0A 3GN2A 4LVUA 1KKUA 1USSA 2XBUA 5KQLA 2X9VA 1W88A 1WXQA 2IPOA 4DR5B 4AULA 3T5PA 3VH2A 1MB4A 1SHUX 5ECYA 3AB3A 1GNPA 3ASUA 4QRDA 2X2OA 3TQHA 4FDLA 2R5WA 4IXDA 1R4MA 2GYVA 1DO8A 1HWYA 4DQ0A 1S72I 5KYWA 2WSSD 3DB1A 2VT3A 2P81A 1J0AA 5HE9A 1QS0B 3H0KA 1EH5A 4QBGB 1WP4A 3BD9A 2D1QA 3WDLA 1HDCA 5HR5A 2HWVA 2J09A 4FFNA 4GDMA 3T5XA 3GHYA 4XK4A 1K3FA 1FFSA 2JLXA 3OM8A 3A4NA 3LXUX 3TLEA 4IS2A 4IYRA 3F8CA 2VBCA 2I6SA 1E2QA 1FW6A 1JXSA 2LKDA 2PXXA 2YXDA 2H5IA 2C5AA 4CMGA 4ZYLA 2HRQA 3K35A 2IUFA 4F86A 1DRKA 2Q1UA 5FNVA 2NU7A 1JXQA 3LPAA 1EVQA 2LREA 1HKTA 3UJPA 2JFYA 3GP3A 1ZN7A 3KV1A 4DW8A 5CA1F 1CUUA 4RGRA 2VC1A 3QVVA 1O1YA 1M6WA 2FF7A 1ZK3A 5AKGA 1KF0A 3F3SA 1MX1A 3KYDA 4Q15A 2CVQA 1HBJA 3PO3J 2V98A 3GEGA 3VU9A 1R0BA 2NUBA 2OQGA 3CRRA 3FNIA 5KBYA 5LGUA 2VJCA 4PX5A 3DHYA 2GZWA 5CDYA 3PXUA 2NQ2C 1XIVA 4FHEA 4KSBA 1CX9B 4HDNB 3SP1A 4JI3B 3MTAA 5AWFC 1O89A 4DIOA 2A67A 2I7CA 1A9PA 2YY7A 2FMXA 3OTHA 3KXIA 1O3RA 2QJWA 5KYYB 3CKYA 3JVDA 4Q4JB 3J7YJ 3ERED 1RXVA 4XRMA 2PT7A 4FYMA 4J7UA 3DE0X 4NE9A 5FB2A 3EIUA 4HADA 4FX4A 3AYXB 3ZV5A 5TGTA 2HTFA 2ZU0C 1ZHFA 1MJGM 3QBEA 1RXYA 1NIPA 2RJ3A 4M9CA 1KFBB 4QTYA 1SN7A 3EQ9A 4OK5A 1JU4A 1Y56A 4HX4A 1U0HC 3MTEA 2XDYA 1TAUA 5D3ZA 4CIBA 3E22B 4RHUA 1E6LA 3HJEA 5ITZA 5AKKA 3HR8A 3HU2A 2CHGA 4N3BA 1T5OA 1UBHS 2ZYIA 4BASA 4E30A 3VR5D 2OV3A 1W5SA 4BNXA 2G07A 2FMFA 2EIHA 5DW3A 2BLLA 5CFQA 4NVRA 1KYQA 1QPGA 3MQFA 1U65A 2QWWA 3WNCA 5KYXB 2I2FA 1A1VA 2ILVA 2AFIB 4HXEB 1NONA 3LVQE 3RRFA 4XM0A 3GJ0A 3GRYA 3P5JA 3Q2KA 4FE7A 2JI6A 3KVRA 1NHAA 4M87A 2QMEA 3DVQX 3IC5A 5JNLA 4FDUA 2IZ7A 4TQGA 1H3NA 2YS7A 4AVZA 4QU8A 1RPTA 4QJ4A 3C2HA 1DJQA 3LWBA 3SYRA 2JGFA 1HXHA 1QCYA 4G0WA 2LSOA 4RESA 4R1OA 3AHCA 2EIKH 1VB5A 3I54A 4QYWA 3I53A 4P3PA 3Q7EA 2E2HJ 1QIIA 1L9XA 3QVMA 2LBFA 4YAOA 4F45A 3LSHA 5TMDA 2V7VA 3QU2A 4ENUA 1CULC 3LF2A 4HFMA 1LSSA 2RB5A 4NZNA 3Q11A 10MHA 3MBIA 2J5OA 1RR7A 3ZHQA 3P8ZA 4AD9A 4YCDA 4P32A 3GGDA 2V9VA 4R0MA 4OLBA 3QKRA 4JI1B 4KWCA 4UUVA 4JROA 1SXPA 4R69A 3NMUF 3DEKA 4JK3A 1TF2A 1YW9A 3SX0A 4ZREA 3HR7A 2G1KA 3G2KA 4R9NA 4YAIA 4IFIA 2VJDA 2FW0A 1RAAA 2ZIUB 3S27A 4EB0A 3KZ1E 3CNQS 1H1LA 5DYIA 1N2XA 1P0MA 4GLBA 1KK1A 2PS3A 1VFCA 3CG4A 2X15A 2QMQA 1NT4A 3B6JA 4YV1A 1E1QA 4NDAA 2ZJ5A 2VJNA 4BNJA 1OR8A 3WGQA 1PS9A 4B46A 1Z29A 2Q5LA 3K1NA 4FWIB 3BRQA 3RODA 3O1JC 1TLFA 6AT1A 3B78A 1ULSA 3SMQA 2OAGA 2AJLI 3K32A 2YIDA 2OESA 5EMNA 3EDMA 4JC8A 3HCDA 4AVPA 1OWLA 4KE9A 3QITA 4M21A 3JREA 2W6IA 4UTZA 3FOZA 2ZS7A 2KJCA 1QRSA 2VDKB 1LDKB 1GUZA 3AR9A 3RU3A 4XLPF 3HJBA 3H65A 2WZQA 4D02A 2OZVA 1JQAA 4B71A 5FR2A 3NX4A 5K5OA 1XK7A 4BS9A 2QKMB 2R4QA 2PNFA 5BYAA 4MS3B 3VAYA 3M07A 1OAAA 1JV2B 2GN6A 3I23A 5FLXK 1FBQA 3CRW1 2HF7A 3FHTA 2LR0A 3S2GA 1PR9A 2XKBA 3OEWA 5JLXA 4EL5A 1IBKB 2RAUA 3LZDA 3SMVA 1CUIA 5DHRA 2Z9CA 2FNAA 1P7CA 2KQUA 4A0SA 3F8TA 2WAQN 4URYR 5G0UA 2ZR0A 3VSAA 2XUJA 1KAQA 3UV3A 4DE5A 4EJWA 1E2HA 3OIWA 1YVPA 1L1RA 3TLAA 3RROA 1PYDA 2A9PA 4H1UA 1SC6A 4XIJA 4AJ1A 5C1OA 4NJOA 1OBOA 4D9FA 2G0TA 1DRUA 3O4FA 1NVKA 2X3FA 4BP1A 2V7PA 1V6CA 3S2IA 1MVLA 3SKXA 4IHAA 3G7UA 4ZV4A 2EFCB 2Q9AA 3QXJA 4BP3A 4LRTB 3WDMA 2CMHA 3CLSC 1T0FA 4IIGA 4OIRF 4KYWA 3DZKA 2W22A 4A36A 1SFKA 1RWQA 4ONEA 3RRZA 1A8IA 1WZ2A 2C7RA 1AZSC 3E58A 3PFCA 1GSHA 1CJBA 2WAXA 3CC4I 4CLXA 2C7QA 3BQNB 4PCUA 2AUMA 1W4LA 3R3VA 4A10A 1Q1GA 1VYHA 1WNFA 1YGPA 3E9RA 1DX4A 2I91A 1QV6A 4P4UA 3OBIA 1R9MA 1NQTA 3WMRA 2A0YA 2G4VA 2BPOA 3NHBA 3VSLA 4LDRA 1KJ9A 1LTKA 1J8QA 3NRVA 3T52A 1MH9A 3D4OA 1LF5A 3PPIA 3TSOA 4BEBA 4TTJA 4WE3A 4B2YA 4R79A 4FASD 4UMVA 2DSTA 3A4IA 4CG2A 2OFPA 3SC4A 2O7RA 4B40A 1UF5A 2PR7A 3LWDA 3A0UA 4TL8A 1IPEA 3BORA 2H1LA 1QQ6A 1D1SA 1QAMA 3HRIA 1U4SA 1MCZA 4JU9A 5CJPA 4NG5A 5L4SA 1Z4JA 1BKSB 4WXYB 3CLOA 5DCLA 2Q3BA 1W2WB 5A3JA 4WN9B 1G20E 1VTKA 3UMCA 3NVKI 3SZLA 4LCBA 3WNBA 2W70A 3ZDCA 3C8UA 4Y0AA 5K6AA 4B5LA 4HGPA 3WRWA 1FLNA 4LFBB 1OT5A 1N6RA 3CF6R 1X2NA 4XARA 3U49A 3CLUD 1NT2A 1CJCA 2HA4A 4EG1A 2AOWA 1L7XA 4GI7A 2QW8A 1S6YA 4BTEA 2CFCA 4DLLA 4EG3A 2EF0A 1KVRA 4YRRA 4S1PA 4NKRA 1S7EA 1O95C 3HFJA 3AVOA 3L07A 1H5UA 2GZ2A 2OKGA 1ZOIA 4JB2A 2GRUA 3K09A 3AEKA 4FGUA 2A9QA 3CY6A 3INTA 1VL5A 3W3ZB 3HSSA 2PTHA 3HZRA 3TG8A 3LK7A 4D4JA 4DSOA 5J1UA 3RBVA 1IN7A 3EJWA 1P6UA 4K6FA 3JQRA 3R8CA 3TNDA 5J1YA 2QX4A 1G98A 4LISA 5EIWA 4YFVA 2H1SA 4R7TA 2YHSA 3HY4A 2WIJA 2NRAC 4R9SA 2ZYGA 2QGNA 2VASA 5T4FA 4UDNA 3BTSA 2J3MA 2V96A 2G63A 3BS4A 3N05A 1LKZA 5JS6A 2LPMA 3CX4A 4HS4A 5AKZA 1GRVA 3HWWA 3L6CA 1EJ0A 2GCEA 2MC3A 1GZHB 2HN9A 2OECA 3K70B 4JL8A 3RW9A 5AW3A 1LSUA 4LDNA 1LB1B 5DXFA 4L8FA 2XRNA 3EOZA 3V55A 3RI3A 3PQ3A 3WQRA 3DBRA 4TRJA 2KSQA 2G3YA 3PUJA 1I2CA 5DP2A 2ZDGA 3DMHA 4RKRA 3TW7A 1GTL1 5ESXA 3WYDA 3MA0A 4QOEA 1JHYA 2QRUA 2DPMA 2D62A 4PZ9A 4FQ7A 3GAAA 2B8EA 2RJNA 4TYPA 4Z9FA 4OQYA 1FYEA 2WD9A 2X5JO 4RQBA 3K5PA 1KFCB 2WMNB 3QX8A 1WSWA 2PUDA 3D3KA 1FTTA 3WLRA 3U4AA 3S2SA 2QVZX 5JZVA 5D1HA 1G6KA 2DECA 3QSYA 3OH8A 4P0QB 3G2QA 1UPAA 1Y1RA 4ZDKA 4K0RA 5CM8B 3AHEA 2FY8A 4N7BA 4DJJA 5C8DA 3OYKA 2IP1A 1T5SA 3Q5EA 1ZH2A 3EXIB 5K3OA 1G60A 3T4PA 3STVA 3PWKA 1R5BA 4UVHA 5KYTA 4ENNA 1JDBC 2R7MA 2DMNA 4LCJA 2HVSA 1NF3A 1XUOA 3G23A 1IN4A 2BEVB 1VP3A 5LGNA 4CF6A 1CUVA 3VX4A 4ZH4F 4HWTA 4MWCA 1VRWA 1JAYA 5HDQA 3H42B 1DV2A 1UZMA 3UICA 3UNXA 1BDJA 1VQ6I 3CH4B 2BR4A 1E94E 3EUAA 4IXTA 4QIHA 3U5TA 5BN4A 3CX3A 2WHQA 2QI9C 2ZBKA 2P7VB 4OIQF 2BFCB 1E7QA 1W9MA 5JU6A 2FUEA 3L46A 4CKBA 1OI4A 5J3LA 1NRXA 3NT5A 3G8YA 1FYVA 1YYVA 4PYRA 1FP6A 3DHNA 4JVOA 1JSRA 4CQMD 4NC8A 3N2NA 3WP1B 3OEEA 4GI3A 1LJ8A 3MILA 4FTHA 2P2YA 1R71A 3S3TA 3GRKA 3FMOB 1E58A 1WZNA 2O1WA 2BCGY 3P2YA 5M5WJ 1HZZC 3X1YA 3TOCA 1TIKA 1D8TA 3IP8A 4Y2HA 5U9CA 1GPKA 3HDTA 2GZSA 2EZKA 3PGA1 2ISZA 3VU1A 5DGTA 4QFMA 1N1MA 2IU4A 3GVIA 1G2IA 2V74B 4M55A 3IVRA 3JRHA 3I4PA 2J6IA 1R5GA 4MHTA 1EK6A 2ORED 4AB1A 4XONA 1Z7WA 1VKJA 1ZL0A 3SC2A 5HOEA 3WR5A 3ROMA 1V8BA 1LXCA 3HXMA 4E4YA 4WZBA 1II0A 2B2CA 4RELA 1C0EA 1G5PA 2CDRA 4MW2A 3P0JA 3BF8A 1QHSA 4HFNA 1LQUA 1O8BA 4U2EA 4ZYDA 3OCYA 3BMCA 5K51A 4BHPA 4B87A 4AJPA 2HPHA 2JFOA 4OA5A 4UEJA 5EXXA 5C35A 4M9SA 4RXMA 2QXTA 5KVAA 4HBGA 5SY4A 4BLTA 4NZMA 5H59A 4PY2A 4YRZA 4M49A 2FV8A 4GGMX 2AMLA 3P9QA 3LL7A 2W7NA 1ML3A 1ECGA 1E3SA 2JHPA 3FXAA 5E3JA 2WF7A 3L41A 1IM8A 4QODA 4RD0A 2DAOA 1FS4A 1VCMA 4IJAA 2AHRA 2K7ZA 2Q9UA 1OXMA 3QVWA 2POCA 5TPZA 3IQWA 3F5DA 1U2SA 5DASA 5KVVA 4JBYA 4OB7A 2K3FA 2YV4A 2WKWA 4QDOA 4UU0A 1EJ2A 1GUBA 3M8KA 3FCEA 2KZGA 4K81B 1EUCB 1HO3A 2JH9A 4G5OA 2R7UA 3R9KA 1PZFA 2Q45A 3UH0A 3FROA 3A0HC 1U04A 2OFFA 3RPEA 4OHMA 5CVEA 4EMUA 1B6GA 2WJWA 2ZB4A 4HQKA 2R6R1 3F90A 4ZT2A 1TUBA 3ACBA 1IHUA 1BYUA 4I14A 1GSOA 3TP3A 1P29A 4R1HA 5JJKA 4HNRA 3PDWA 1S4MA 4XB6B 4QSHA 3TL2A 5FBLB 1ODFA 2JA6J 1OA1A 2H7VA 1H0KA 3ETJA 1ISFA 5KNCD 3MC1A 2BW3A 3Q8WA 1MGTA 3SPXA 2C7PA 5M5BA 5B66C 3FLAA 5EJ8A 4PYIA 3FBNB 4C3IJ 4JB8A 5KHOC 3L2RA 4HQFA 1T0HB 3KPHA 2V5AA 1XDBA 1KI3A 4D5EA 3HL2A 1L4BA 4Y6LA 2VZEA 4PGHA 4V0RA 1P2SA 3R5KA 2AD5A 1SXJA 1K86A 2UZ0A 2YSRA 4HXYA 4QUHA 1QPMA 1NBME 3BTJA 4BDSA 2X9DA 3JWPA 4BUJA 3KKKA 1M0SA 4RM3A 2UYCA 1XD8A 3NNSA 4BNWA 1PT8A 1TAHA 4PINA 4DPMA 3PNBA 1M54A 2FSGA 4HNQA 4KBGA 4HZUB 2C2OA 4FKBA 4Y6RA 3VTAA 2B0LA 4AJJA 5KREA 5C4IA 5CD1A 4MVYA 2OK8A 3DPIA 4KMRA 1DB3A 2XUQA 3LHDA 3H0GJ 1RI7A 3I32A 4RHFA 3HL0A 1Q1QA 1Z63A 4HGZA 4CM4B 4CCSA 2ZPUA 2WM3A 1XEFA 3WBJA 4BNVA 1Z0SA 1Z34A 1GQ2A 2LXNA 2Y4NA 3UB4A 4Q9HA 3WIVA 4PZLA 3WIEA 3WE2A 2XAUA 1SIOA 1RC1A 3GGPA 3BA1A 1DGQA 5EWJA 4A5SA 4LPKA 3W6OA 2K27A 1YC2A 4MGEA 4REQB 4ENKA 1M2NA 4WINA 2AR0A 4HN2A 4LGCA 1ZBQA 5TT1A 4JYKA 4YPOA 5DK4A 4IIEA 2V7WA 5JJCA 3DZJA 1QPZA 1JI0A 4AN0A 3ROTA 4BEWA 1S8FA 3RSNA 1J8FA 4NONA 5L51A 5K0LA 4N6OA 4AO6A 1U3VA 4JLWA 4UHCA 5C8VA 1C0PA 4JV5B 3AQ4A 3EAQA 3AM1A 3GGSA 2DA1A 4TLLB 3SHVA 3U48A 4LOKA 2FAXA 4R8MA 4ARAA 3P9SA 1JZSA 2Z8YA 3G71I 3P96A 4WOJA 4ZRMA 2IE0A 4RIHA 2RH5A 3IRQA 1MW8X 3COVA 4YP7A 3DDSA 3AILA 2HSEA 4P58A 5JD5A 5CLGA 1Y6IA 3IESA 1YVUA 2KKOA 4HW0A 1R4NA 3O1HB 3K96A 3RQSA 5CBKA 3ZQIA 3WMWA 1NYLA 4UHEA 5INTA 5IT0A 1A4RA 4BBAA 2ZAYA 3M49A 3O03A 1DAKA 3ERMA 5K0BA 3PUHA 3ZEIA 2FFRA 2PKWA 3CNNA 4J0IA 4M0DA 2N46A 1B6AA 4E4HA 3BIOA 1M1EB 2Q27A 4OXYA 5ED0A 4HLUA 2WC1A 4NJEA 3GY0A 4GYNA 2IEZA 2GPNA 3VKWA 2EZIA 3JD0A 2E5LB 3MN2A 4IICA 2P3OA 1DXYA 4HV6A 2VA9A 3A9UA 4FSXA 2P1RA 2WRZA 1HH4A 3H6HA 1MN6A 4ND6A 5EVCA 1LLCA 4IDPA 1BEEA 3EGCA 1C8LA 4OXXA 4MS4B 5FBKA 4HWKA 4KXQA 2QD3A 3DP7A 1IY1A 3DV0B 1W4AA 2CKDA 1E0JA 2R8OA 4BNKA 3CUQC 2BKVA 1BMTA 2LR8A 5ALVA 1ITZA 4KX5A 2WA1A 3RV3A 4AYWA 3BIXA 3HXTA 5F21A 1EH6A 2OXIA 2BFBA 3QNUA 2ZIWB 4YCCA 5H1YA 4KVZA 4PPFA 2H5LA 4H4EA 1K66A 3ELYA 1TK9A 1ISIA 3HMKA 1MF7A 4BTLA 4HDVA 1DZ3A 1DBPA 4KW7A 1VZ2A 2ZTSA 4IZUA 3WKEA 2EBFX 5IG2A 5DGDA 2FUNB 5FEUA 4H4DA 3DLTA 1MDMB 4DL9A 1CZRA 4XLTA 2PVSA 4IEFB 2PY6A 1O4WA 5JS1A 4TKUA 4JSTA 1S02A 3KKLA 2R3SA 4C7OA 3L4KA 1WXWA 1BN6A 1KQOA 1KEPA 3BPVA 1JMVA 2V9PA 5D3QA 2D4AA 1PEYA 3BJZA 3V2UA 5K8CA 3NWOA 3PEUA 4HYYA 3ZWPA 1DDIA 1NW7A 1G8GA 3FK6A 4J76A 5AHOA 1Q6ZA 2RJOA 3FTPA 4ZVLA 2O7OA 4DA4A 4LMPA 4MZDA 5F23A 3TGPA 3KOMA 1XEAA 5EGOA 2ATVA 4RZXA 4QNRA 3IBCA 2NVBA 2V7UA 1FYKA 2X0RA 2C7BA 4RHXA 5CXQA 1LI7A 2NO6A 1UBJS 4K9LA 5DGCA 3KZYA 1AGNA 1MC8A 2KIQA 2D5CA 5KTMA 2X14A 2BN4A 1LJ9A 4FGLA 1BEZA 3K31A 5CLFA 1GPWB 3JAKB 4WRRA 2J5RA 1T1GA 4V3BA 3EIFA 2JJQA 3NR2A 2Q0HA 1CFJA 3WHCA 4RCVA 4Q48A 3A6ZA 1TZJA 2CLOB 5KYVA 3I71A 4B3XA 3NDPA 5JWHA 4QYTA 3WK5A 4IUCS 1NIJA 4ZCSA 4MI1A 4B45A 2RC6A 1VJ0A 1O4VA 3IV5A 1UK8A 3VNBA 1DMSA 3RKYA 3MJFA 4PANA 3DT9A 3CCVI 1I0ZA 3MWMA 1U8EA 3H16A 5ICMA 3IAS2 3QPBA 2ZMEA 2GBYA 1VMEA 5I5GA 1N5JA 3FCUB 3THWA 2JCSA 3C3DA 1L8XA 2EX0A 1EFAA 4TYYA 1OPXA 4C0LA 1A5TA 3ZGYA 3G5MA 2V26A 2X0LA 2J9FB 3ZMVA 4CKZA 5E6UB 1QB7A 4LJ4A 4OYHA 3T9AA 5HLHA 2Y68A 2JQ7A 1EA5A 3QVJA 1WSAA 4XUDA 2BVNA 1XEXA 2B7CA 4TTAA 3DLAA 3SDSA 4F38A 5LZ9A 3BYZA 4XSXF 1JKPC 5D6FA 5D8KB 4CMIA 1LNSA 1P5RA 5IXJA 4YIKA 1T9DA 1ATZA 2C5SA 5LQMA 4JDPA 4XD2A 1II9A 3KSRA 4LVNA 2P6NA 1U3CA 2C9ZA 3KPUA 2EGUA 1NI5A 4Z9YA 3F98A 4EBFA 2HFHA 2BVLA 1LDEA 3U62A 3FN4A 3DKIA 1G17A 3ZBPA 4OIFA 4C7MA 1GVDA 1ZH8A 2VPZA 4NHJA 1HYEA 2QQ0A 2ZETA 1CQJA 1D0SA 3RWOA 3G4SI 2P30A 2E1MC 2XNDD 4MQLA 1EU1A 1QQBA 2XW6A 2HRDA 1APBA 5L45A 2E11A 2FBIA 4ECAA 1I6WA 3TLMA 4GKKB 2NNNA 2UVDA 3NBZC 2Y1CA 3MUNA 3R75A 2COMA 4JH0A 1V71A 3U4GA 2BM0A 1IEWA 3RCOA 2BDEA 5A3QA 2BY1A 4NAVA 3N2GA 3RTAA 3OQ1A 4CDGA 4G5QA 2XYPA 2QE6A 4PQYA 4AY5A 1XG5A 3COSA 5CCDA 2VNIA 1XKTA 4YMVA 2VSXA 1QTIA 2HH9A 3LUPA 4HPXB 3CCMI 4BO1A 3IOEA 2O03A 5LA6B 2EIMH 3MFQA 3G1MA 4AG6A 3U39A 4KR2A 1CZLA 1LU9A 3ZZMA 2JEOA 3GOHA 4INZA 4TKZA 4PJMA 2PUWA 4KODA 4HAVA 5EHXA 1G3IA 5ALHA 3J7ZI 2JATA 3NV9A 2WP0A 4L57A 4BWVA 5EIOA 4PRZA 1MMSA 3QPAA 4C4OA 3N2EA 2JLQA 3RJZA 4XKCA 3FM3A 4BY1J 4BX8A 1QZ3A 4BQQA 3FIJA 2EF1A 4I0WB 3Q3CA 1JIVA 4WW0A 1UPBA 5F2KA 3R24A 3NHWA 1F4PA 1KH3A 2F9MA 5JFTA 1JR6A 2O7VA 2ZR7A 1RFLA 2AXTC 2PZLA 3F8MA 2QE7A 4D82A 4P2BA 4LRYA 1MIOB 2GR9A 1FFXB 1YK1A 3HXQA 3WV5A 3Q9LA 3H4TA 3VYSB 4MMXB 1UBTS 3H11B 3ELDA 2GJSA 3DNFA 3RASA 4XA8A 3RAGA 4QO8A 2WSIA 3LMMA 1FFHA 3AP3A 5FLXA 3PHBE 5JQWA 2ZJFA 3W3AA 3ZP5A 1H6DA 4RTQA 5TIIA 3DNMA 2Q5JA 2ZT8A 2VXBA 1JFFB 1U6KA 4O5VA 1FTWA 5BW4A 3Q0WA 1ZH6A 3LYLA 3TEMA 4C4AA 4TRRA 4Z4QA 2XZPA 2HADA 3NYWA 1XNQB 5AXAA 1EXDA 3BQ9A 2PMUA 4BNGA 2GO7A 4TLCA 3JQEA 4KDRA 2PDAA 3WMEA 1F51E 4H0CA 3LCVB 4DR7B 1T08B 1FJ2A 3IH4A 3TB4A 3SF8B 3KIPA 2VDMB 3KNZA 1QHYA 4HDRB 3G8BA 1IHDA 5J2UB 5TXGA 3L6EA 4BNMA 2UUCB 5FHQA 3IQHX 2IOHA 3R60A 4D57A 1O57A 5B58C 1Z12A 3E6CC 4NYJR 3QPTA 5DTJA 4BLRA 5AOAA 5SY6A 1M34E 5CT5A 1OGJA 2HWKA 3E23A 2E4ZA 3BK1A 1DADA 4KZKA 4U2KA 7ABPA 3H6GA 3AKDA 2HEIA 2HWUA 3NWSA 2H1OA 1YUNA 2QSGX 2JGRA 2XGOA 5AESA 1UWCA 4A5OA 1GRCA 2HS5A 3MWFA 1R5HA 3SEFA 4CMHA 2EIXA 1TCVA 3O93A 2NZVG 2PUJA 4N9WA 4QL3A 1M6YA 1P8JA 2BMDA 1GTG1 5K0JA 5B3KA 3HBLA 2IP4A 1XZMA 2XMPA 5FWYB 3LUJA 2JL1A 1CUYA 5LA6F 2X9GA 3TXAA 3EFOA 1RHUA 3FUVA 1YL6A 1AV6A 4BY7J 3L6BA 2HU5A 5KVRA 2I34A 4MKHA 3QF4A 3DEUA 1LDYA 2XIGA 4JVLA 2Q8KA 1X38A 4UHKA 2ADUA 1LVAA 3MZYA 3DCNA 1H1DA 3RYRA 4MV6A 3NJRA 4ND7A 4HOYA 1L7QA 2W2LD 4KIJA 5GZ6A 4CR6A 3H9UA 1ISGA 2M8GX 1SD2A 4YRGA 1RAEA 1H89C 4Q3EA 1ONPA 4UARA 1XWFA 3DE4X 3ND5A 4DMUB 3G1TA 1AN0A 2BHSA 5LHGA 1Q21A 2GF2A 2M2IA 1JYFA 3I39X 2ZS9A 1ETKA 1UH5A 5LEJA 1NULA 3M5PA 4JLDA 2NUTA 5KJ1A 1P4SA 4HLQB 4Y6GB 3QKIA 5A7HA 1SIUA 2J6HA 5IEJA 3W79A 3I83A 1FDOA 3BG3A 2HA5A 4D99A 2B0CA 3QTBA 3R3ZA 4NH0A 1WETA 3I4NJ 1ZIDA 1VTNC 1JDNA 3RLFA 3PXEA 3ZD7A 2VYVA 1W1WA 3K09C 4C0HA 2G1UA 1WCV1 4MZXA 1QIKA 2H16A 3BG5A 2QUHA 1N8KA 2LVBA 5KOYA 4RTJA 4FX0A 4FDMA 2QPTA 1RWPA 2MA3A 3SYTA 4DKXA 4AMVA 1DNPA 4IWNA 4S1WA 1GGJA 4P38A 2WF5A 2G25A 4XJSA 3KQLA 1TUIA 3S81A 5BN1A 4G67A 4NMWA 1T34A 2B30A 4BB0A 1R6RA 1LRLA 2KMLA 2YS6A 5AJZA 3WLFA 1XLWA 1QVRA 2XSJC 4KBYA 3IGFA 2ZIXA 3IAEA 3S93A 4R1NA 5J2UF 4RAQA 4B3SB 4XQ0A 3SSNA 5EJ2A 4IQJA 2ZE5A 4KOAA 3H05A 4IKPA 1YFKA 1KAMA 2ZT5A 4V24A 2Q1WA 1G4DA 3ZWYA 2VJJA 2MSWA 1P0FA 2OHVA 5K0EA 3K0AB 4RPCA 3JVIA 4Z4HA 1V7PC 3O2QB 3PFNA 4GVPA 1ENZA 5BOSA 1F0PA 1K61A 2CL0X 1O6ZA 4IUYA 3P9KA 3RVSA 3E9MA 2C58A 5K20A 5T3YA 1S01A 4WXPA 4U2CA 2FCAA 1M6EX 4AKHA 3BXOA 4FU0A 1UMKA 2LZ0A 1AQNA 3PEWA 3GVHA 4LY0A 1E7RA 2HA2A 4Z1OA 3OYGA 4A6XA 4UATA 1CRPA 1X86B 2VQ6A 1CE8B 1GAWA 3N8KA 4PZJA 3BDAA 1XD7A 6ADHA 3IEMA 3E8SA 3WWZA 2FRHA 4RZIA 3M3DA 1R1DA 5JHFA 2BKUA 5BSUA 1XXLA 5DOZA 4M2LA 3A01B 5HQ3A 2OZUA 4D2IA 1MEJA 3K2EA 4GOXA 4AUMA 1HT2E 4PNEA 1K8RA 3DOUA 3PEYA 1TT7A 1LRKA 2AF4C 4KACA 3ZCUA 2GK7A 3W3CA 1GNVA 3LY8A 4UUPA 1GV2A 5AKIA 4N3CA 1KKLA 2VCYA 4LNHA 3CFYA 2BGGA 2YWHA 1YOVB 4N7MA 3H8JA 5ALXA 4FHGA 1C50A 4P5DA 1Q0HA 1QNTA 1XMXA 5KJEA 4XTCS 1JYSA 2EQAA 3FD8A 2CW7A 5HS6A 4M72A 3VFDA 4KRYA 4ND4A 3A02A 1VXOA 5L7WA 2BISA 2IHTA 3WTVC 1IU9A 5CK5A 2A6HF 3V8VA 2QSZA 2RI0A 1IUPA 4B4CA 1Y0NA 1HA8A 3E7PA 1CNFA 1A2KC 2YICA 3VJKA 1WMFA 2HYIC 3OPYA 4CEJA 1AXEA 5L3GA 2Z3ZA 2HLNA 1A4UA 3PJFA 1PUEE 4TXLA 4HRVA 2UYHA 2CQNA 4PG5A 2EWWA 1K92A 3A6PC 3U5ZB 3KDAA 2HU9A 1FLIA 1PZEA 2CUTA 4X9XA 2BR3A 1KIFA 3IV9A 4UUBA 2FR8A 2ZB2A 4QPQA 4K2EA 2WJIA 4M9UA 1X7ZB 3G85A 1PG0A 4UAGA 1OIVA 5TEWA 3IAHA 2Z09A 4AIHA 3O7MA 2QAGA 5GP1A 1QM5A 4PBSA 2AN4A 4JOCA 3MMNA 4KN6A 4KDFA 4M4SA 5HE8A 4FJ2A 4URXR 1VDZA 1FFYA 1JA1A 1DZIA 5IZCA 1L7OA 3G2BA 1OI2A 1T9KA 2OORC 3HKBB 4URFA 1NA5A 1E4EB 3LXRA 1ZK8A 3L49A 1NY5A 3OY2A 1I3CA 4XH9B 5K8LA 2QLFA 3WU2C 4BFSA 1IY9A 1JIKA 5DI3B 1KZ4A 4ZYAA 1V4RA 1OIXA 4KR6A 1YK0A 3UKOA 3HRSA 5T8KC 3MUEA 4BUZA 1JQ5A 1Y8CA 1BHQ1 5GAHJ 1DCFA 4QD3A 3RSLA 5JRZA 3LWNA 5EP4A 3WIBA 1WWKA 5FO0A 3IIIA 1YOBA 4B73A 2AOUA 1N6LA 4ZV9A 3QWFA 4JJEA 4MUIA 3NLLA 1L7PA 3HKCB 3VR6D 4YV0A 4G0UA 1NAIA 4KO3S 4ZOCA 1UXJA 3B02A 3OPQA 1UOQA 3VV2A 1CF7A 2FCRA 2EV9A 3T7SA 3D8UA 1RJ9A 4K9QA 2O2HA 4YBRA 3CVJA 4JNKA 3VZCA 1PUJA 4R6WA 3IE0A 2XLBA 2YOGA 2IPMA 3NYQA 1JEAA 2XGCA 1WPRA 2EJRA 1OC2A 2H2IA 4LE2A 2XXAB 4MUFA 3C3KA 4XIDA 2JLYA 3ABIA 5IUJC 2R48A 3VPCA 4YK7A 1K6YA 3NUGA 5ALTA 1UPCA 2YQ5A 2IYEA 2QLZA 2VRBA 4ENSA 4RHTA 4MVJD 3OZFA 2J3HA 4K9RA 3OP1A 1M2VA 2XUDA 4WZAA 4BHBA 1IHXA 5FUWA 2EFGA 4YJ2B 3ZIDA 4LF5B 3UC5A 1T8TA 2CWDA 1W36B 5IJAA 5K4HA 3EF0A 3AGPA 2JWTA 4DM7A 3G2NA 4XIGS 4I55B 4OLHA 5TT0A 3BWBA 3FTEA 2H0QA 2REQB 4DBVO 4GWKA 1FFCA 1KK0A 4XX0B 1RR8C 3RIHA 4CUJA 5TJJA 2CF5A 2WFAA 1EQ2A 4A2CA 1TWGJ 1IUKA 1WR8A 3JSPA 1I1OA 1ZIYA 4AM3A 3FOCA 5LGTA 4PSXA 3REQA 3DV9A 1EFLA 3HE3A 3PE6A 1XZFA 4ESJA 2QRLA 2IKSA 5SZJA 2ID7A 2M6KA 3P7NA 5LRSA 1A98A 4M8KA 4D4GA 1ORHA 2K9SA 4GX2A 1X7YB 1C4KA 2CMDA 3T06B 3MN1A 4MQ6A 3FWYA 4GR9A 1ZEJA 5K3DA 3JD3A 1O97D 4QVIA 1P5HA 1SXJC 1V43A 4V2UA 3IP7A 1MENA 4OXNA 4LYGA 3EPZA 4BNYA 1X80B 4HDCA 3H2JA 4N3AA 2I5UA 4RTOA 1E2PA 1KP9A 1NXVA 3JW4A 4BZXA 3FB1A 1IE3A 3PYLA 2N1BA 2E85A 2IZ1A 3ZJTA 5FYDA 4MTLA 2I3ZA 4TTSA 4UD2A 3ZTTA 4C06A 5KX5A 1F0KA 2B7LA 3D7KA 3C2QA 3BZUA 2V0NA 1RTKA 5CVUA 4BAYA 3PIOF 1LW6E 2L0KA 4DLKA 4F8JA 1IAVA 3RRXA 1SRQA 2MD5A 4LHYA 3SXPA 5DGXA 3AG5A 3CQ9A 4ZXFA 5M3FJ 2WPDD 2I6UA 2AXQA 2LOOA 3OTQA 4UMEA 4EQ6B 1HMYA 5GIPE 1GSIA 3ONEA 1U8TA 4YDHB 5FBQB 2XX3A 5F1YA 3DFIA 4YGXB 1PVDA 1Z5WA 2FQQA 3VSDA 3NFYA 1C3VA 4ZDOA 4E4RA 1U99A 1J6UA 2LKSA 1YI0A 3CJNA 1QGPA 4G1BA 1K4SA 1JUMA 1F5NA 4HLDA 1Q0TA 3E9ZA 2YINC 1I3KA 4YR9A 1N3LA 4L16A 2QTWB 3DEWA 1ONBA 4Q82A 4QRHA 3SFTA 3CEHA 4JQZA 3M8JA 1A7KA 2HK9A 5ERYA 3DC2A 2FLKA 4YJ2F 3V4LA 4X00A 2M0MA 1WL8A 3PFGA 5EHIA 4RVUA 3VNSA 4AZWA 3ZE9A 4XZ3A 4P8RA 1QQIA 1KSGA 1D6JA 5DRTA 1SCNE 4I55F 3GCGA 3RPUA 2PBIA 4EJSB 2HHAA 1XDGA 4WK6A 4ER3A 3F21A 2JGLA 2ZR8A 1FTZA 3LCCA 4GPTA 2JJ2A 1R7JA 4EJ2A 3V8EA 1EUZA 4CM1A 3BXFA 3ASYA 1F89A 2OHJA 2P2ZA 3MM4A 5CYOA 1QRDA 4DAOA 2YBDA 4OIPF 2GXUA 2Z8ZA 4JX4A 4BQSA 3PK0A 2V65A 2V03A 3C7JA 1FJHA 621PA 1QHHB 1I8TA 1J8DA 2X7XA 5K1YA 1UQTA 3R41A 1SIBE 3ST7A 4BYGA 2H1KA 1EMDA 1YRLA 3F6VA 3LM8A 1E77A 3QX3A 1KU3A 2I4OA 4K3UA 4DTIA 4W7HA 3AG1H 4MRVA 2WVGA 2I1WA 2II6A 1OZ0A 1XXHE 1NVUQ 2MMCA 5CVJA 2YJ5A 4DRZA 4GBMA 2O8NA 2R1VB 3EIQA 4ETIA 4BQOA 3BPSA 3KSMA 2X8BA 3I37X 5J5CA 2EK5A 2Q1XA 1ZINA 2EEZA 3E35A 4D45A 1LKXA 4CHUA 4CL2A 3IE1A 2Q62A 5LMZA 4FETA 1II8B 121PA 1HQYE 4S0ZA 4MV7A 3WBFA 1QFZA 1GKUB 3HLTA 5LUBA 4RU1A 5LMCA 1ETVA 4QRIA 4CTNA 4N5IX 1CRQA 2Y31A 1RXSA 4MK4A 1FNDA 1ZN8A 1UMBA 2B8WA 4OFZA 4LTNA 1N7GA 4CQLA 1EWYA 4ND8B 4NK5A 2XAHA 3L2UA 1LUAA 3ZBTA 4BFZA 3CJRA 3L0SA 4TV8B 4QYSA 3QFFA 4DMGA 3UHFA 2TRSB 3MWEB 4RZHA 5HIIA 4XSHA 3DEHA 1HEIA 4HJXA 3QUSA 2QHXA 3BMXA 3KJXA 3T9CA 5KTTA 1QDEA 3ROUA 2LG4A 5FKOA 3OJFA 5EINA 1PFVA 4EYKA 1AG9A 4LSZA 1EFDN 1Z08A 5KQMA 2XZLA 3HP7A 1KE2A 1OJLA 5FTJA 4ESOA 4RDXA 3AUAA 4KL8S 3VYWA 1H2AS 4IG4A 1P62B 1ESEA 3HOSA 1QJ4A 2DHCA 4LAFA 1HQDA 1G21B 4MR9B 4JEMA 3A4CA 3DKYA 3ZWBA 4LYJA 5ICSA 3RAEC 4DYQA 1SANA 1FU7A 4TXJA 5IYZA 1C5KA 1YFJA 3S2HJ 3S2FA 1GUFA 1Z83A 3WBBA 3LLVA 2RK4A 3JZMA 5LDGA 4MQEB 4DIFA 1X1SA 4BWFB 5J8FA 5K0SA 5EI5A 5DLDA 3HFRA 1EUDA 3A2KA 5LLDA 4MJLA 2O3QA 3AEXA 4ZAGA 4Q9AA 3CCLI 2C07A 1W44A 1TW2A 4IQ4A 1B72B 5G2OA 1NG6A 5FUVA 2I3DA 4XKJA 1C8VB 3BFKA 2CKMA 5CFRA 4HNUA 4JJZA 2WJVA 2HVQA 1RZUA 4TXHA 5H8IA 2G83A 2R97A 3TOSA 5LZ8A 3PGXA 3DGFC 3F9IA 4GXTA 5KVQA 2LC2A 2WD7A 5D4SA 4R71A 4OOFA 4FB4A 4R54A 5IOZA 3RT7A 1H3EA 3B5EA 2BH9A 5IAGA 2ERCA 3K8QA 4V0QA 2JCVA 2VQLA 2GJ8A 2BTQA 2ZYHA 4X8OA 2JT1A 2YNMC 1PL0A 1UBFA 4ZMBA 3LC1O 3LFUA 1TQ4A 4DQ2A 1ORDA 1SCKA 3FFTA 2E6KA 3SHOA 4WJLA 5JADA 1XQ9A 3A58B 4CM7A 3JASA 2PV0A 1S2MA 4BGDA 4HNAB 4QUAA 2O8BB 3KT6A 2ZJBA 2IPAB 2YDYA 3U1TA 3NHAA 3PHCA 3HDYA 1WGXA 5DGHA 4YJFB 1XD2B 3J81Z 1EWQA 1IOWA 2L0XA 3IA2A 1PO7A 1UIRA 3U44A 2R6AA 3E3OA 1NQOA 4MIKA 4KUMA 4A3SA 3ZE8A 1U8AA 2VQEB 4RM2A 5DEQA 4CTMA 2JKZA 1PP4A 1WW3A 4TV8F 2W4MA 4YT8A 2FQWA 3SYMA 1WVIA 3O0DA 1PJRA 2P0EA 1BW6A 2JLBA 5ECWA 3JCUC 3FZGA 3G2HA 1STOA 3SHTA 3R23A 4NARA 4G23A 2CSXA 2RI6A 3FDXA 3IOCA 3EZ2A 1JHHA 1SM4A 1T3HA 2P6MA 2ZRIA 3QQ5A 1ULUA 1OVMA 1UAAA 3MB8A 4PYMA 2GPYA 2XRFA 1RZVA 4ZZ3A 2WHEA 2GWRA 4EVIA 3OFSA 4JEIA 4DXDA 5EKSA 3MMYB 3WU1B 3WOHA 2XUZA 2FJPA 1IZ9A 5JCOA 4IRUB 1NR5A 3LKVA 1SC1A 4MUJA 3M5CA 1N2OA 1T10A 1NSTA 2AX4A 3T7TA 1ULYA 1ZW1A 3TLZA 2B6HA 2FFBA 5B3LA 4QXPA 3ZWAA 1EEXB 4PN7A 5L53A 1TIBA 2MW8A 1IH8A 2RG7A 3E6DA 5H2FC 1Z8NA 3V8BA 3MD9A 5EE0A 2P0AA 2J6CA 2J5XA 2QX9A 3C6MA 3GLIB 2Z2XA 3H3VK 2X1LA 1T0JB 2EQ5A 2NM0A 1D0YA 4R81A 2CHFA 2FSVA 3ZWXA 3IHTA 4EI8A 1HDEA 2R1TB 3AJAA 4F7ZA 1IUNA 5FOQA 1A9YA 4WFIA 5H9WA 4YPFA 2O1XA 2WB2A 4L8GA 1LA2A 2AJDA 2OXRA 2QLLA 2P79A 1Z9BA 1JHRA 2GWHA 3UIEA 2QRVB 3ZY3A 2V6MA 3VUEA 4RD2A 1E3JA 2JZCA 2Q28A 2XKKA 1MNQA 3F47A 4H0NA 2R8ZA 4NCBA 4KQJA 4FZRA 3OFND 3QKTA 3PDIB 4R1PA 4PBRA 2L01A 5ELMA 2I2CA 4DKJA 1Y7LA 1ZXLA 1UEXC 4PLHA 2NWQA 1IMOA 3N70A 4KR0A 1S7AA 1IC6A 1IZ7A 5ALUA 4LDQA 3CLKA 3M3PA 1NU6A 3ECAA 1EFPB 5FBZA 1M2JA 3KUCA 5CA0B 5M3BA 3T4EA 3HFSA 4TT3A 2JA1A 2ELKA 2FFJA 4DZZA 1PQWA 3THYA 1YB5A 5HMMA 1EG2A 1VJRA 3T8RA 3PX3A 2I4LA 1W59A 1OCCH 3KFXA 2X0FA 2OZPA 5K5QA 4EHBA 3FVTA 1D2NA 3OOWA 1ESZA 5IVDA 2RAEA 3ONWA 4IZVA 3EGXB 4OH1A 1LPNA 3EUHA 4D1QA 4BXOA 5LWHA 5EIBD 1Y3HA 1PJ4A 1OLXA 1UJ6A 3PNKA 4ZU1X 2TCTA 1G5RA 1L5WA 4GXQA 4ZYXA 1VGVA 3A36A 4F2GA 5DTEA 1G5FA 1D1QA 3BL6A 3U3MA 5DO9A 1RVDA 2E55A 1U2QA 2WJ3A 4NC6A 1CETA 3LX6A 2GUWA 3PQ4A 1XEWX 4EY7A 4YIIA 4PSCA 4BJ6C 1Z73A 3NRBA 3DVAB 1U1GA 4M1SA 4EZBA 2O0YA 4TN1A 4D4IA 4G3XA 4KSYA 4PXSA 2G7ZA 5IAEA 5JLWA 2XWPA 1E1RA 3DTIA 1EV7A 3ZLUA 3IR6A 4W1PA 4YAWA 2IT0A 5IEBA 1XNHA 4JBAA 2Y0EA 3JWIA 1Y98A 1ZUNA 3W5HA 1TA0A 1D1PA 2YV2A 5A2QA 3RWMB 4E5VA 3WL3A 1H8ED 1GZ7A 1S8OA 3JQFC 4N8SA 1E7SA 1OXVA 4P4SA 4BO9A 3P2EA 3EGDA 5CLLA 1LV7A 2GEDA 4KIUA 3P9YA 4HQRA 4MCJA 4EF4A 1PLKA 3AR2A 1OQAA 4LI3X 1GYQA 1OHHD 1RXEA 1OU0A 4V03A 1XVVA 5LD2B 3UUEA 1RHJA 5BV1A 2WPNA 5BQXA 3IA7A 5JAMA 1T1RA 5BV2P 1JDVA 2D1RA 3NC0C 2JCYA 4WDQA 2XC7A 2QL7A 1GL3A 5EZ6B 5EEHA 1HSJA 1Z0IA 3K9QO 3VDQA 4X63A 3C3MA 1T2DA 2N8GA 1Q7BA 2IOFK 1L5HA 1TKBA 5C44J 3ABMH 2I4MA 2AZTA 1D5YA 2I3GA 2VI5A 2CXSA 4P0TA 3MS7A 1LD3A 3DLIA 4JR1A 4YMGA 3DSRA 4L08A 2AE2A 4GUAA 1EFKA 1GPJA 1WVRA 3DDZX 3S3MA 1XTIA 5CA0F 4ADSG 5LQKA 3FBIB 5C51B 4EG5A 3TD2A 1FNBA 3E5MA 1FLDA 1DEOA 2Y1GA 4M9QA 4BP9A 4M0FA 3JQGA 3I5AA 1MD9A 4FYVA 3L7WA 1CUHA 5FJIA 5E9AA 1DKMA 4G0YA 3RCBA 2LW7A 4G0VA 3EXFB 1RP1A 5FL3A 4I3HA 4IX9A 1F43A 1ONNA 4WY8A 1AQLA 3VZQA 3SFIA 4ASUD 2PRZA 3SF0A 4M9XA 4OGLA 4MWOA 1S2IA 1SMKA 4M3NA 3DMYA 1ZD3A 3AVUA 2AKYA 4TVSA 1U6GA 2IEGA 2O2EA 2ODBA 4JT4A 1I3OA 2YY5A 3KD3A 3QKSB 1P4XA 1N5KA 2B20A 3W5VA 3GGCA 3GWZA 1ON1A 4EFLA 4QYMA 3BH6A 5J4YA 2Z1NA 1GTJ1 2G9RA 1KH1A 1X8LA 4CF7A 4LGYA 1T9AA 3QPLA 2RGAA 2WYOA 1SUCA 4IFBA 3KWJA 4RSHA 3VH3A 3JS5A 4Q6BA 2FF5A 1MTZA 3HZZA 2JAXA 2XYVA 4BAGA 5FLKA 2C9MA 2B5VA 4K5QA 4RVCA 4WNIA 2DPXA 4N65A 1K6MA 1FBSA 3QYJA 1HFJA 2L02A 5HP4A 2VONA 3AEQB 2J59A 2FEWB 4XMYA 2PN6A 1TPYA 3WYNA 4ZQBA 4KICA 4ZDLA 5IBCA 2AC4A 3VR3A 3MNFA 2FG6C 5KHLB 4FP9A 4DR4B 1KPHA 3TCKA 3WGUA 4BE9A 2HCJB 3UA4A 3EPPA 3ZK9A 4M53A 5TPWA 3E8MA 1TM4E 5FWXB 2B2XA 3CC7I 5LQNA 4P2GA 4AIJA 5ALWA 5JSHA 3HACA 1NRIA 4KXFB 1I6XA 1QZUA 3NDIA 3I5YA 2YKGA 1KRWA 1V9LA 3UANA 1FUEA 4DLBA 4TL9A 5FH9A 4XNFA 3N74A 4R7ZA 1NQ5A 4M86A 5EDNA 2VHJA 4KQEA 4BVJA 3SZUA 4AK9A 1Z25A 2M4GA 3ZDDA 1Z0ZA 1R0CA 3ASZA 4UXIA 1SC9A 1YA6A 2Y67A 4LZWA 5K99A 3T9BA 2GASA 4F6LA 1E3QA 4U8GA 2IA2A 3A6LA 3VVCA 4B17A 2E0IA 3OQBA 3QF7A 4HATA 4KJZA 5BMVA 4EHJA 4E5PA 4EYQA 4GP9A 4W9NC 1T3LA 5EMJA 2BJVA 1QO0D 4I8IA 3MT0A 1Y5IA 4B80A 3UTCA 1GU1A 2XV4S 4WTOA 3AY3A 1KHHA 2PEYA 2X0NA 1N9GB 2FE3A 4JQYA 2BGKA 3AFNA 3F3YA 1W73A 5LL6P 1Q14A 2HF2A 2VQDA 2XB5A 5CG1A 2XT9A 2PEZA 2XB2A 4PXAA 1SHLA 2Q9BA 1B0ZA 4HTFA 2J0SA 4U87A 1A7UA 1WCWA 1MSFC 1D4ZA 1L5NA 5IN5A 4IDHA 4DZTA 3A4TA 2HZTA 4U7JA 2EL9A 2QF7A 1L4EA 1SEPA 3LHKA 1WOYA 3QXSA 1GPNA 2HREA 1HURA 1U6JA 5C4MA 4EO9A 3S68A 3AVXA 3RYIB 3SBOA 3U3ZA 2MH9A 2Z95A 3QOFA 3ILVA 2OAP1 4JI6B 3GLVA 4JJKA 2O0HA 4IM7A 4N6NA 3PFKA 3CUEF 1V0JA 4RTNA 1D5VA 4WASA 3TFOA 5FEMA 3GWGA 1DWOA 1E59A 2X86A 1W0KD 5FBVB 1XHEA 4EW3A 1UMDA 1DOHA 1U5TA 4ZT5A 4HOBA 2QTAA 2IOQA 1DHRA 4G1VA 3W7VA 2H09A 1E2IA 2EFYA 1F6DA 4ZTUB 1PI3A 2Y05A 3IIJA 4DUGD 3CGGA 3T3OA 1GUDA 5BRNA 1ERZA 3H5TA 3DHWC 1BI0A 3BZWA 2DJ5A 1AKHB 4BNZA 2W0SA 2MIIA 2LKPA 2ZJOA 3CW2A 1P31A 1CDOA 4FJ1A 1UXHA 2FPWA 2C2BA 1TC1A 2B94A 3H13A 1LJUA 1NXSA 1XZ8A 1X3UA 1K4YA 1YW7A 2NU6B 3O47A 4TWJA 4CCAA 4NY1A 4I5IA 2VUTA 3WBKA 2XTNA 3B73A 1ST3A 2KIMA 3RC8A 5C3EJ 2VXDA 1BU5A 5IHXA 3A3NA 1E62A 1NK2P 2H1VA 1B6SA 5HX7A 1W5AA 4G24A 2HSDA 1NSFA 4CM8A 2XASA 3F6CA 1XN7A 2AUTA 2EKPA 1FRVA 4W1UA 3ENQA 3TIIA 3W2HA 1IMJA 1TECE 4TSFD 1AQ6A 4JY7A 5KYKA 3ML1A 1UJMA 1BX3A 1GCIA 4IKEA 1YAHA 4ARBA 3OCZA 1KJ8A 4ESBA 4DV1B 5KUTA 2CYCA 4NUBA 3W2WA 4KAAA 3KEQA 2Z98A 4NU0A 1VI0A 3I58A 1Z4QA 1NDQA 3TX2A 2WWGA 1YRYE 2V5UA 2BMAA 1S3IA 4LXUA 1C3JA 3TH5A 3MXTA 2NAFA 4WFQA 1R8XA 5BUCA 1FB5A 4XYBA 5H4HA 2RH4A 5BRAA 2AMVA 4HK4A 3G9XA 1U0GA 3AY6A 5B4UA 1CF9A 2FVYA 2Q49A 3DF7A 3BJMA 3Q15C 3DBLB 1W1WE 1OR7A 4REMA 2FPLA 1LRJA 3CEAA 5FD8A 3ICQB 2WZCA 1ECBA 1N6PA 4G5RA 2W6MA 3C3WA 3RVRA 5HMLA 3G0DA 3ZOZA 3D6HA 2Q6LA 2YMPA 4IOMA 3HJCA 5AOBA 3PP8A 4DNQA 2IIBA 4D96A 5EMHA 1F1JA 4MEAA 1V55H 3JQ8B 2C78A 3TS1A 3PNMA 3OC6A 4DMMA 2D74A 3IFSA 5BWMA 4OBXA 5FORA 1LE8A 2D59A 2JFFA 4BQAA 4D4KA 3F4BA 1BI2A 1SUAA 2BUCA 2PD6A 3LKBA 4FW8A 4HG3A 2OV7A 4OYRA 3HZOA 4II7A 3FBWA 4Y13A 2XA1A 4BYYA 1P1RA 3ZCSA 1QOZA 1QP4A 1LC0A 2AB0A 1T39A 3AHGA 2HSJA 4AJ2A 5H8LA 4X6LA 3E3AA 3P4UA 1JLRA 1P2BA 1R9NA 1EESA 2AQHA 4FK8A 1QH1B 4Q1BA 2H8RA 3B5JA 3E6BA 1USVA 2CNWA 5FDFA 4MI9A 2QUBA 3HVUA 1SFOJ 2QENA 4XGKA 1IBLB 2BFNA 5A4IS 4Z99A 3W6PA 3VFZA 2PMEA 4OKSA 4QGHA 2IBTA 4IIJB 1QGUB 2JFUA 1E61A 1FXUA 1CS0B 1CQIA 2D7CA 4HQLA 1SHJA 1H4QA 3F5MA 1C7JA 5JO9A 3RTCA 4ZVNA 4XASA 1PQYA 4TVBA 4BE0A 3HBFA 3G8DA 4O08A 5ADUS 2C4UA 1QSGA 4IGEA 2JLVA 4HJRA 1JEYB 5H3LA 1OXTA 1R3UA 1GVJA 1UR5A 3E5RA 1X4PA 5E3NA 2D1SA 3JPYA 3MWDA 1LLQA 4HAIA 2EBIA 2XPUA 1HNWB 4QT0A 2GD6A 2HWXA 3R7BA 1X3SA 4D3YA 3HCEA 3IW3A 4I4TB 2I9KA 4X1OA 2F5VA 1YDWA 4XIFA 1UDXA 2PANA 2QOEA 3G5LA 3K53A 4NYIR 1XALA 3TQCA 1ZZGA 1HG0A 3LOPA 4CYYA 3QLTA 1TDJA 2RC4A 3VU8A 1KDTA 4MHSA 1TD9A 1W7PA 4XSGA 2GD2A 2PLFA 1WO8A 1H6AA 3R3YA 1CIPA 1MC5A 1FIUA 1F2TA 4V0SA 4PTYA 4FCYA 4ZFNA 1VL1A 2QK4A 1DAHA 4B32A 1IUYA 5CK4A 3ROGA 2N47A 2PUHA 4KLAA 2SCUA 1XJWA 5AI6A 2CMGA 4QUKA 1DQRA 1J0RA 4CCLA 4RMNA 1XC5A 4NQRA 2M6SA 2DUWA 4D9EA 2Y0PA 5EJ4A 5IXSA 5L6LB 2HKIA 2I8AA 1TGYA 3CTPA 2GAAA 3B7WA 4HNGA 2ZRMA 5U4QA 2GTPA 2QL9A 3EHDA 1KMIY 9ATCA 2JHGA 2OZLB 1N1DA 4XFKA 4LK0F 3FBTA 1N57A 5F7ZA 4MQ4A 1UANA 4HFJA 1QVWA 4I66A 5FRMA 1SCIA 5DCMA 2H2DA 3Q7IA 2ZBPA 3DW3X 1TFUA 2OBPA 4BQEA 2Q6OA 1J8VA 5AD1A 4QQKA 3UH1A 2WF6A 3G2LA 2CNLA 2YDXA 3FCCA 5LKRA 2YMLA 5B6JA 3AOEA 4Z8YA 4JP2A 3PB3A 1JILA 2HDOA 1S5PA 3GNQA 2KHZA 4IIJF 1S7GA 1BOFA 4DFDA 3PJDA 3EDYA 3ZLVA 2Q7DA 4G1CA 2OYSA 5L3QA 1SULA 3DOJA 2EHDA 2Y1DA 5E3MA 2JIPA 1XL1A 1NM5A 1YZVA 1R10A 2M2EA 2E7XA 1QA6A 2C0PA 2QL5A 4GSKA 3K1ZA 2O1EA 1Y6GA 2HBRA 3WYBA 4HEHA 1OASA 1D04A 4XD7D 3U7RA 4I0AA 2NS8A 4ZOAA 1ZWLA 2P4HX 5DCWA 4DDVA 3FR7A 4L9VA 3BWDD 4YACA 1YDMA 4CYDA 3KEMA 1GR0A 5FL7A 1T0FC 4BXFA 4BMXA 4GCVA 1KMHB 2ZXHA 4IXMA 4GYLA 1T3TA 4TL6A 4XGIA 2NUAB 3VUFA 1XS9A 1Z7BA 1E5QA 4G0ZA 3LOCA 2IC5A 3PIIA 4UM7A 4HH3C 4I4TF 4NJMA 1SQ0A 1IM5A 5C8YA 2EFJA 1OFHA 4YRLA 4YYZA 4RDIA 4JA2A 1EP3B 1ZUHA 3GJ8A 3PC3A 2HAEA 3DFGA 3K1AA 2X8LA 4XDYA 1TYAE 4U39A 5DNAA 4H3HB 2H6EA 1NURA 2W2KA 2OXFA 4EELA 4PU0A 1OFGA 5HF8A 4XPIA 1XEWY 1B41A 1C7FA 2FDXA 3L05A 3L8GA 1VLZA 3TFWA 3JQAB 2X1EA 2UXNA 3FWEA 3FRHA 2Y9ZA 2QDXA 2QT9A 4QPCA 3KBOA 1QOQB 3DWLE 4HX5A 3L09A 2RN7A 4A9AA 3UJCA 4NDNE 2X5NA 3A4MA 4UNIA 1JHVA 4YP9A 4GYIA 2H4XA 4UBNA 4KVFA 1TQ6A 1S7OA 3JATB 2UV8A 1LFPA 2RHGB 2PN1A 3TZQA 4DILA 5A2QK 3AB7A 4ARCA 3ESCA 4ZJUA 2OP0A 5EC8A 4EPWA 1IXSB 4QAJA 5K6AC 1U9ZA 3WRVA 1DKPA 4EAQA 3IUPA 4I4NA 1FQJA 3GDGA 5FOXA 2ERXA 2G5GX 3IH2A 5LFAA 3V7CA 3VO1A 4FX5A 4PJ0C 1JS1X 2BFFA 1OA0A 3TSYA 1JDJA 3QYBA 1ZR4A 3E48A 4EHDA 3CVXA 5FKKA 1HRDA 4YWJA 4YH1A 2UVPB 5LBQA 3QVOA 4FXOA 4CVNA 5C0OE 2MINB 2RG1A 3ZDYB 3DEFA 2XGEA 2DPGA 4QTRA 2XYGA 3D6FA 3U09A 5EN4A 2P9QA 2GESA 2VAXA 2J3IA 3N2KB 3TTVA 2TSYB 3A8TA 3JARB 3IPLA 1W5CC 1AMOA 2P7IA 3N0RA 3IUNA 4JWKA 4NS1A 1AKRA 3I42A 3M6LA 1RJGA 2ADOA 1ZD1A 1Q7EA 5HTKA 5AVXA 4BAZA 3SDBA 4Q9IA 5DBHX 2QM0A 5TQ0A 1USWA 1O58A 1BXGA 1XCMA 4UXJA 1FW8A 3GT4A 4ZEVA 3ETCA 4BBPA 2VHEA 2QRKA 4U7WA 2N1MA 2FWMX 4JHXA 5AVVA 4IKFA 5AKXA 3LNCA 5JD6A 4FFMA 4WY5A 1P1KA 1ISRA 4KFUA 5HKAA 1RM3A 3HYNA 2PMKA 3TL6A 5BVGA 5E8JA 3OLYA 3ZD9A 1U8ZA 3VOSA 4C89A 4YCJA 3P32A 2Z2SB 3QWIA 1OLSB 1XFAA 1S6LA 3CLRC 3LRPA 1E9FA 3DZCA 4QGBA 1PQUA 2GLTA 2PMDA 4XRFA 4CKEB 5CA1A 1BQEA 3RE1A 2FE4A 2NU9B 5DLEA 3EF1A 2UXXA 2PTGA 4C08A 5IULC 2B4RO 1Z4IA 1CC1S 5DD8A 5KQRA 1ZW6A 2Q29A 5J63A 3T3EA 2NYXA 1ZVKA 1H0RA 1T4GA 1JUDA 2O3FA 2OPHA 2LDUA 1TM7E 5FV7A 3FMVA 4F3KA 4R8KA 1RWOA 1ZP6A 5KJ6A 3WYGA 3GAMA 3ZE2B 3F7MA 3P9CA 3CBGA 4MDHA 3LIIA 4ENTA 2IJGX 2GZMA 3ZWVA 1HT1E 4QXOA 4WD3A 2L9VA 1XN4A 2CUFA 3RVQA 2VPTA 2YYYA 1E2EA 3CCQI 5LN1A 1NFQA 2PKRA 3CXRA 2P6UA 1JQ3A 3SQMA 3UN1A 4AX4A 3GNTA 2R62A 1OFUX 1GRQA 1LNQA 4GMHA 4I99A 1DQZA 2IXDA 1JIJA 3IUBA 4I9GA 4TZKA 1RKVA 3OIYA 5DI9A 1FNMA 2AZMA 5KNLA 1WW8A 1D5CA 1XTKA 4AY4A 3U19A 1RE1A 3ZNPA 3FRJA 4MIOA 3I0ZA 3DPSA 3F22A 3QU5A 4GX5A 3GLGB 3DEAA 5IT9Z 2WAAA 3G2JA 2XB8A 2CVZA 2E1RA 3OECA 5T64A 4Q7JB 3R4VA 4RA2A 3BTUA 3BX1A 2H9YA 1SBHA 1XRRA 1QKJA 4IOLA 1PWZA 4NI5A 3ZW8A 4ZZIA 1QS0A 1XA3A 3DE2X 1J97A 4W8GA 2WILA 2HF9A 5BYBA 2OILA 3AFIA 2LP4Y 3CR8A 3QLJA 3Q1KA 5DDIP 4BNHA 1E3PA 4JI2B 1JZTA 2M1XA 1R8SA 1TVEA 1Y3IA 1O54A 4BO0A 1OFVA 1T9GS 4I1SA 2OMKA 4ZYGA 3G5AA 3OS2A 4DLTA 1Q57A 3HUTA 2WIGA 1NLUA 3FSEA 3ZNOA 4CYCB 1RPWA 2X3UA 1BC8C 1XL0A 3AINA 3SYKA 2HT6A 3V1KA 1ZCAA 1T9HA 4ZT6A 4KO2S 3T1VA 3OKCA 1NKSA 2ZBEA 2JAHA 3U13A 5HS8A 1QYIA 3BWXA 3U26A 4K88A 4PFKA 2ZVPX 3MTQA 3T3HA 3PPXA 2Y1EA 2GLOA 2PX4A 1ZA1A 4LCEA 3OO0A 4JLNA 4M0EA 5JXWA 4OHZA 1UKVY 3B3QA 3OUTA 5IT5A 3EQ8A 3V8RA 4DWOA 2COKA 3Q0IA 5HCUA 3ZDZB 1SC3A 4FI3F 5K7ZA 3ZHTA 2NNYA 1U80A 2YWJA 2H11A 4MWEA 3KZMA 5DLPA 1NFRA 3ON5A 3U4DA 3H7IA 4HDNA 2V1DA 2XADA 2ZI3A 3MMSA 3HWRA 4C7BA 1QLWA 2DFEA 2DBVO 2IOFA 4MP3A 4PZEA 3FIWA 2SKEA 1NW4A 3P5SA 2PUCA 4AY2A 5IC4A 5KYYA 1GUAA 4ZALA 3EWAA 2C7OA 4Q4JA 5JJLA 4EI9A 4UE6A 2PBZA 3CNBA 4OV6B 2IEIA 4NEGA 3HJUA 3ANLA 1Z67A 4CGYA 1G38A 5DHSA 5TVGA 2DOEA 3CF2A 4ZCQA 1O0SA 3OWOA 7MDHA 3LMKA 4EQQA 1AUXA 3SVLA 3L43A 3HJNA 4G0NA 5AVTA 1JZQA 2WMYA 4N3NA 4MW6A 3E3LA 5H20A 3JYOA 3W4IA 4Y6OA 4Z8XA 4L22A 5EPEA 5FPPA 3IUJA 4FOOA 4WACA 3I9V2 2W37A 3JZIA 3NKVA 3E22A 3SIPA 2DFHA 1QRRA 4ROSA 1OBCA 1PCXA 5KSOA 1VYTA 1JKOC 3IS3A 4B6RA 4IXWA 4YUZA 5D84A 5L3VA 3PGLA 2GHQA 2PO5A 3ELWA 5KYXA 4CLEA 1MMAA 3K9GA 2IP2A 2HJHA 2AFIA 2GN9A 2CLFB 3BZKA 5JTTA 4FNMA 1VMDA 2R6DA 3I9NA 1MQAA 3LQ2A 2P9BA 3CRQA 5DNDA 2RHHA 2P9TA 5F35A 2Q3EA 1ZITA 3WODF 4FQ5A 4I7HA 1V35A 1ZIOA 3IXLA 3N53A 4BQNA 3BXGA 3BGDA 1YQXA 3TN7A 3HVHA 4X1IB 2M0CA 5IDWA 1P77A 1DC6A 3B2EA 5F7XA 4IZSA 2DI3A 2PMHA 4HX8A 3VPAA 4X3PA 4G8XA 4IHQA 4K6HA 1P39A 2O57A 2PRIA 2XDWA 1P0IA 4N82A 3CC8A 2G5PA 2OLKA 1BD4A 3GPIA 5EGNA 3L9WA 4GC5A 4HYEA 3COPA 1F4KA 3SLGA 3HOUJ 3EVGA 5IWAB 4PZPA 4XLHA 2X4GA