3N05A

Crystal structure of nh3-dependent nad+ synthetase from streptomyces avermitilis
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
584
structure length
568
Chain Sequence
SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Nh3-Dependent Nad+ Synthetase from Streptomyces Avermitilis
rcsb
source organism Streptomyces avermitilis
molecule tags Ligase
molecule keywords NH(3)-dependent NAD(+) synthetase
total genus 188
structure length 568
sequence length 584
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00795 CN_hydrolase Carbon-nitrogen hydrolase
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3n05A03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3n05A02
3.60.110.10 Alpha Beta 4-Layer Sandwich Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase Carbon-nitrogen hydrolase 3n05A01
3KI8A 1EFPA 2RD2A 1T9GR 1WXGA 3P8KA 2X1MA 1V8FA 1Q15A 4R0NA 3LOQA 1YUNA 3PNBA 4MW6A 2PIDA 3X1MA 3WUYA 1KORA 1S4MA 2A4MA 3N2YA 3TZLA 5AHWA 4EG4A 3TS1A 3NBKA 4K03A 3CVXA 4HJXA 5H7XA 2CV1A 2AKEA 2YWCA 3KT6A 2GGLA 3H97A 5IHXA 3ZJVA 1QRTA 4ARIA 4KZFA 1T9GS 1MBZA 3ZGZA 1K97A 4R2MA 3G5AA 5LM3A 3MLAA 2VHIA 3KT0A 3KFLA 4DDKA 1HYBA 4MVCA 2CUZA 4L2IB 1N2IA 1TFUA 1G8HA 1LI7A 1KH2A 1IQ0A 3ND6A 4RUKA 4ZT6A 2A7XA 4EG1A 1O96B 3PRHA 2E2LA 2Z3VA 1PFYA 2QTMA 1GTRA 2A84A 1MB2A 4DLPA 2EL7A 4G5YA 3TQIA 1J31A 3X1JA 1JHDA 4H3SA 2J08A 3ND7A 3CVYA 1KH1A 1P7PA 3M5WA 3MXTA 4JXXA 3HGMA 3H05A 1EUYA 1I6MA 3MUEA 2QUJA 4EF6A 4CYGA 1Q77A 1CT9A 1NI5A 3COVA 4ND7A 1OBHA 1GLNA 1O94D 4UZFA 5TEVA 1OWMA 4ZCPA 3IOBA 3CR8A 1I2DA 2DLCX 1OWPA 1UF7A 1QU3A 4I6JA 2DEUA 4PBTA 2QUIA 2DERA 1KKUA 4MVYA 4MW4A 2J5BA 2QTNA 4MUIA 4ZCTA 3G6KA 3HV0A 4XFJA 4AS1A 1EFVB 3Q12A 3QTTA 5KHAA 3H9BA 5FNZA 5DK4A 1VL2A 2RE8A 4MUEA 4PY2A 3DPIA 4A91A 5FO1A 1NUPA 3CLRC 4MAFA 3ND5A 3RFFA 1O97C 1NZJA 3SEQA 1EJ2A 5JQNA 2R5WA 3QTBA 2ZUFA 2PFSA 1WXFA 3VRHA 1N2GA 4ZT2A 2GM3A 1A8HA 4CYYA 1I6KA 1UF8A 3E27A 1JEDA 3P52A 1X8XA 4CYFA 3ZUGA 1KQNA 1EFPB 4IZUA 3SDBA 1PFUA 4KR9A 2E21A 3IUBA 1EE1A 2YWBA 1GTSA 5KCMA 2OQ2A 2CV0A 2D5BA 1F9AA 1JEEA 5H16A 3RK1A 2V0GA 3D6VA 2HZ7A 2YY5A 2BTEA 4EG6A 3AL0C 3PNVA 4X0EA 1UFVA 2A1TR 3AFHA 1FYDA 2HGZA 1T6ZA 3IH5A 4MWDA 2CYCA 3N05A 4EG8A 3K32A 3LCJA 4ZT4A 1M8KA 5J59A 3TZEA 1BS2A 4KR7A 2PLQA 2UXYA 1U7DA 3FIUA 1XNHA 2I1LA 1GZUA 4NAUA 5DEOA 4OUDA 3A05A 1Q19A 4NZPA 1TEZA 4YP5A 2QUHA 4MWEA 4YP7A 4HG3A 1MOPA 4MWCA 1OBCA 5H8KA 1EUQA 2G36A 4MW5A 1XJQA 3HMQA 1R6XA 3CLUD 2E11A 5LLTA 1J09A 2PZBA 4WNYA 2PXHA 1TYCA 5HUHA 1M8PA 5DASA 1O97D 3IVXA 4DJAA 3PXUA 1G59A 2E0IA 4CT0A 1UF4A 1MAWA 1V47A 1N2HA 2YXNA 3DV2A 1M8GA 4HPWA 4Q93A 3SZ3A 1FFYA 1N78A 4S1OA 2ZP1A 4WSOA 2AG6A 1JMVA 1YIAA 3P0JA 3DLAA 1O0CA 2D13A 1NSYA 1YI8A 4U8HA 2H29A 3C8ZA 3CLSC 3TNJA 2DYUA 5EKDA 4U7JA 1N2OA 2VTBA 4CDMA 4UZEA 2QTRA 1O94C 3P0IA 3I05A 1WZ2A 2A1TS 3Q4GA 4NAHA 4ARCA 3Q10A 3IVGA 3FNRA 1QRSA 2QJFA 2XRYA 4J75A 4F4HA 2GOYA 4QBTA 2DETA 1FO6A 4EG5A 1U3CA 1O5TA 1ULHA 2IELA 3ISJA 3NV7A 3K9WA 4XSVA 1XNJA 1EMSA 2XRZA 1TYAE 3BL5A 1N3LA 3PNYA 1F4LA 3AG5A 2A1UA 4MUFA 2PG3A 4GU5A 4EFKA 1KAMA 3IVZA 1ZH6A 4Q16A 3D6UA 1NURA 1JIIA 3AIIA 1WKBA 1WXEA 4OJMX 4K0RA 2Z08A 2E2KA 1G8GA 4DDHA 4G5FA 2QJTA 3U1VA 1QQTA 1WOYA 5TEWA 1G8FA 4JYZA 3F3MA 3KT3A 3SEZA 1MB9A 1TYDE 4MW2A 3UY4A 5K0SA 3VU8A 3UC5A 1T6YA 3SZGA 5JBNA 5TGTA 1JIJA 1MRZA 4JXZA 3UOWA 2X0KA 4MW7A 1F89A 2HMAA 2J09A 4YBRA 3FDXA 1JILA 1J21A 2CYBA 2WQ6A 4HJRA 1VBNA 1H3FA 1QNFA 3FHJA 4NX2A 4H5UA 3GMIA 3L92A 5DB4A 3SP1A 4KPUB 2A86A 1JGTA 1XNGA 3ILVA 1KR2A 3ELBA 3JXEA 3RJZA 3ZXIA 1ZJWA 1K4KA 4ZT5A 1IFXA 2A1UB 4KKVA 1J1ZA 2IP1A 2GGKA 2J07A 4ZCQA 2DPLA 2CYAA 4RPIA 1JIKA 3RK0A 4P2BA 2CFOA 1NUUA 1LW7A 3HZRA 3ZXSA 1MC1A 1YUMA 4MVXA 3AKZA 5F23A 4MUNA 3G59A 1T6XA 1X6VA 3DO8A 4NDAA 1QTQA 2PZ8A 2WB2A 3CLSD 3IODA 4JFAA 3INNA 4I6EA 1JECA 1N2JA 4JZYA 1N2EA 1IHOA 2WSIA 4ND6A 2DYVA 3RHSA 3CVUA 1N77A 2PZAA 1IVSA 3OTWA 1K4MA 1Y42X 3CLTD 3X1KA 1QRUA 3ZJUA 1TYBE 1ZH0A 2V0CA 2JAXA 4U63A 1R6UA 4KPUA 1O0BA 4ZT3A 1KP2A 1M83A 1F7VA 3CLUC 3IW3A 1H3NA 1OWOA 5FO0A 5LFAA 4CQNA 3TQOA 2CSXA 1KQPA 1N75A 3MMXA 1OD6A 2EJCA 2NSYA 1J70A 4R2LA 1NP7A 2VHHA 3A04A 2J4DA 3IDFA 5BNZA 3A2KA 1DNPA 2E89A 1WXHA 5H8LA 1MAUA 1I6LA 4F3RA 4OUDB 2X3FA 4GRIA 1N2BA 1IRXA 1OWLA 3KT8A 3CVVA 4GYLA 2O8VA 4MUGA 3GUZA 1SURA 2VXOA 4MUKA 5J5AA 4HK4A 4MQ6A 1O95D 1WY5A 3HKXA 1YULA 1WQ3A 5HG0A 4MUJA 1UF5A 1NUTA 5H8IA 1GN8A 4MLPA 4MULA 4PBRA 2GKSA 4AQ7A 2DUMA 3N8HA 4NATA 3UK2A 4HGDA 3IUEA 2JANA 2AZXA 1J20A 1KQOA 4KR6A 1KP3A 2C5SA 3FOCA 1QU2A 4IZVA 4EG7A 1F7UA 1H1TA 3COWA 3CVWA 1H3EA 4BWVA 5KWVA 3A4IA 3OP1A 4ZT7A 4J76A 3ZJTA 3NBAA 4E1AA 1GAXA 3SYTA 4LF0A 2NZ2A 2Z09A 4MWBA 2QJOA 3COYA 4ZCRA 1WJGA 2VTBB 2QUKA 3FH0A 3CLTC 4G6ZA 4TS1A 4XFDA 3ZIUA 3CA8A 3FWKA 1PG2A 3IOEA 2CT8A 2CV2A 1COZA 1VLHA 4IZWA 3H99A 1ZUNA 1LI5A 4I6GA 1M8FA 4ZCSA 4MW9A 3HL4A 2E18A 3QE4A 4PBSA 2W1VA 1JZSA 1K92A 1N1DA 3COZA 4QREA 1ILEA 3IVCA 1MJHA 3IMGA 3N9IA 3VGJA 1M8JA 3H9CA 4EG3A 4EGAA 5HUJA 1U0BB 1O6BA 4GYNA 3CLRD 3L93A 4FZJA 1NUSA 1PFWA 3MLBA 1EFVA 3AG6A 4CDNA 1IH8A 2ZUEA 2WQ7A 1QJCA 1Q11A 3IMEA 1NYLA 1B6TA 4DE5A 1OWNA 3FY4A 5K0TA 1WXIA 2A88A 2B7LA 1O95C 1ERZA 5IJXA 4IZSA 4DNXA 1TQ8A 1YIDA 1EXDA 1D2RA 1KH3A 5J58A 2TS1A 2JA2A 4MUHA 1U7XA 1IQRA 2D54A 1U3DA 3S3TA 2DXIA 1R6TA 3RBAA 1VBKA 3FI0A 1JZQA 1M1ZA 3HFJA 1PG0A 2X1LA 1KAQA 2H2AA 3P0HA 2DR2A 1J1UA 3KLCA 4HG5A 2O5RA 3GLVA 4YP6A 2IJGX 4MW0A 4MW1A 1PFVA 1GPMA 1VBMA 1IQUA 3FETA 3LE8A 4DDMA 1O96A 4QRDA 3FG9A 4MVWA 4YMIA 3UMVA 1NUQA 5TS2A 1WQ4A 4IZTA 3IMCA 3IOCA 2BYTA 4L2IA 1RQGA 2OV4A 5H8JA
chains in the Genus database with same CATH superfamily
2YYSA 1U9ZA 1JDBC 2LREA 4ND1A 3FUUA 5E1DA 1U4OA 2JFFA 1LSOA 1VECA 3G7NA 2YWHA 4A3LJ 4ZOQI 3E3MA 1AKEA 3HWSA 1QQ7A 2P77A 3EFOB 3FSEA 3IR6A 3FVWA 1JIUA 2AK3A 5EZYB 3RYIA 4E14A 2R8OA 3DTKA 1QCZA 1SC3A 2RGAA 2JJ2D 4XM2A 4UM5A 4PO3X 3OR1C 3N2YA 4CF6A 1E2XA 3HEMA 3OZDA 4Q3DA 3IBFA 3TZLA 2C4NA 4B2LA 4BNYA 4UNOA 3CQ9A 3ELUA 5BRAA 2F3PA 2R96A 2CQQA 5AHWA 3KEGA 3VPXA 3U7QB 2E55A 3C98A 3KXPA 4EPYA 4YAKA 1W6UA 3H97A 2VF8A 1CLEA 4ZO7A 4AF7A 2BGCA 2VVTA 3FK6A 5BN5A 5MN5A 1E6UA 1K97A 4FBLA 3PTZA 2E4UA 1X1QA 2QNBA 2V98A 1JFRA 1QHHA 4KXQA 1BFDA 4LF4B 1Q0ZA 3IT3A 5AUOB 5ILSA 3U4QB 4X1KA 2DFLA 1T34A 4MVCA 3KZIC 3DJYA 1KEWA 3EISA 2HN9A 1EFAA 1Z45A 4QUDA 2X9LA 4TQUS 3SIXA 2PBFA 4M8SA 4PYOA 3TLCA 5B55A 4XB2A 2PU5A 3HKDB 1A8SA 5HS6A 3IVRA 1OCTC 1U3FA 1PFYA 1EX1A 3OJEA 5C4GB 4QTTB 4LRXA 3ILYA 1ZK3A 2W43A 5CH3A 4PGFA 3UATA 2WD9A 1NOKA 2KRHA 1PGNA 3CVOA 3KYCA 4LGVA 3H84A 5D86A 3VR3A 3WNVA 2E5WA 2B69A 2NQTA 2CE7A 3LCCA 2J5RA 2X77A 1W75A 1B0UA 3QG1A 4DT1B 5DP1A 4I99A 2VUUA 4QECA 5DNAA 3DFMA 5SYAA 3SGLA 2NO6A 4H3SA 3J7TA 3TUIC 4TKUB 4BNKA 2X6YA 3WIEA 3LY9A 4RNDB 1P2FA 4CDRA 4BJ6C 1GYRA 1MH9A 4HMQA 4DNQA 5FWYA 1CUAA 4V0OA 3BJMA 2X5XA 3TNDA 1J2UA 5D5PA 3Q0VA 4M0CA 1DB3A 2IWRA 3UM9A 5LN1A 2B94A 5ILUA 1NDUA 2IEBA 2IXTA 2ID3A 4LRQA 4O2BB 4CYGA 1RXCA 1YZKA 1FVXA 3O8QA 3ZHVA 1VKZA 4RKQA 3KYIB 1JUPA 1KYWA 1OBOA 1TGYA 2VNIA 4ANJA 3BTIA 2PVCA 3V2GA 4AB1A 1PF7E 3FUWA 4C0AC 1SFEA 3LDGA 4TLBA 1D5WA 1G6KA 2DKNA 1PT8A 1FQKA 2ZBVA 2E37A 3N53A 2DHDA 4KPFC 1DKQA 2R1TA 4UDOA 3DDCA 2DHRA 3ZU4A 3OS2A 3N4MA 1P91A 1Z26A 4FDVA 2FMTA 5M5WJ 1VMEA 2LDUA 1BDJA 1KPIA 3P45A 3C41J 1W7PB 1XSDA 3G6KA 5FTJA 3L07A 2X2OA 3WL4A 1CEXA 1MDMB 1KMCA 4CF5A 1U0NA 4NCXA 4OF4A 3DZJA 2F4OB 5EUCA 5AM4A 3UW3A 5EJFA 4EP1A 1LF0A 4QFBA 4DMHA 2HPVA 1FFDA 2P0AA 1KXJA 5F2KA 3VOSA 3ZOKA 5KYWB 5BW8A 2YWRA 5JJCA 1ORVA 4WK4B 1GGKA 4J1TA 1S9HA 5DBEX 3BGDA 2AO9A 3D4IA 4PG4A 3AESB 2VCHA 4EKNB 2DFNA 3ND5A 3ZQHA 2KISA 1TK9A 3E7FA 4JQZA 5ES4B 1HR0B 4P9NA 5BRJA 3OZBA 4I46A 2GRJA 4Z8XA 2ZJZA 2KLHA 2WJZB 3KXKA 3D2AA 3K4QA 1P1RA 1WXFA 4PJ0C 2AFHA 4BV9A 1T0FC 1J2RA 2RGWA 4HQLA 3BOSA 3O1HB 4L50A 3SEAA 1L7MA 2QX9A 2C8JA 1HDYA 2B83A 4H60A 3UJ6A 4EK9A 2RGVA 1GNPA 1VJ5A 3MCVA 3O92A 5CCEA 2AE1A 3QU6A 4Q66C 5ICCA 4ESJA 3NJRA 1JEDA 2W42A 1TCUA 2JN6A 3H9UA 2BYVE 3QFRA 4OLHA 3FK7A 3ZEIA 3ZHCA 5JADA 1EFPB 1I2BA 2DTZA 1PSZA 1J7KA 1U9OA 1IY2A 1ZOIA 4WZ6A 3TLAA 3MCAA 4G0MA 3O4VA 3S2EA 3UICA 3HHEA 2GZHA 1VRCA 2XB8A 1VKHA 1SD7A 2K86A 4D0GA 1EE1A 2FG6C 3AJ9A 4Z7QB 3F8CA 3T1BA 1PWZA 4IS2A 1FFGA 1XMIA 1YQGA 1E3TA 2JK0A 2NV2B 3BGWA 3L8FA 4G0NA 3GFFA 3LIIA 5T4EA 2P6OA 4IDAA 4RA9A 3ZBUA 5LB4A 5HBGA 4BLTA 3SHTA 2F1OA 1LBTA 1NAHA 1ZL0A 2JAWA 3LF2A 4PFJA 4RGYA 2AI2A 4WK0B 2EDAA 1L5MA 1DU4A 1U3WA 4QYWA 4H1VA 3H4TA 3THSA 2OE2A 3AEQB 3TZEA 1NLZA 5DBFA 3LHKA 3LY7A 3EUEA 1U31A 1X0XA 1EVLA 3GUYA 3EVEA 5LLSA 4TYQA 1ZGZA 4RHEA 3H1CA 2IEAA 4MCAA 3F8NA 2J59A 1MRNA 5FI0B 5ULLA 2C0QA 2Z56A 4AYBA 2PSEA 3IAS1 1KQ9A 3WJ7A 5JNVA 5JWOA 3TRJA 1U0SY 5DH9A 3E5QA 5FKKA 5A3RA 5KVVA 4E1BA 3FKJA 1AQNA 1GYPA 4DPKA 1WZNA 2BIFA 3D3NA 1F48A 1SHJA 2G36A 3GBGA 2I7VA 2WICA 1SU7A 3D8RA 5F4ZA 4DW6A 1KEPA 3W7VA 2FPKA 5D1NA 1ZNQO 3NFRA 1CY7A 1E3WA 2WU8A 4L9SA 4B4KA 4JYAB 4YR7A 4FT8A 3KELA 4DIQA 4C5BA 4O5OA 3VO2A 4C0HA 1EJ9A 5YASA 3ZW9A 2I2CA 3EXHC 3BJIC 4Z86A 1HDGO 1GITA 2XZLA 2OFFA 1S7AA 1L1FA 2R6R1 3K72B 4Q4AA 5L3RA 3WGHA 1EYZA 1RRPA 4D9EA 1ZMTA 4NG5A 1CR1A 1MD0A 2YHAA 3MCWA 1E2QA 4EL0A 4CQMB 4CT0A 3OCZA 2QL9A 4YREA 1R6DA 3DV2A 4HPWA 3BR0A 3SZ3A 2E4ZA 3ESBA 1I2AA 1VKOA 4EJ0A 5KU7A 4G4IA 2I3GA 2NM0A 1XTSA 2BTQA 3KB1A 3OEED 4DSTA 5CNIA 3ZDDA 2C2GA 1FUIA 3PHJA 3GIWA 2ZS9A 3PFWO 4MPRA 4U8HA 4D0LB 5LP1A 1NR1A 3MTQA 4RVSA 1QQIA 4DLUA 5EYPB 3L7CA 5EKDA 3DH0A 1H9CA 1MJNA 4IQ8A 2HAEA 1RKQA 1KYVA 2VNHA 4TSRA 2VTBA 4CMGA 4MCIA 2QTRA 2EEPA 2QKYA 2R6AA 1M3SA 3RADC 1FP2A 2BBSA 2VQLA 1YS7A 4IKEA 4U2BA 1A8IA 4FE7A 4RENA 1PR1A 1QUEA 4YRMA 3BK7A 2BDUA 1LB2A 3G8AA 1U04A 3JD4A 4IX9A 1X2NA 5AXBA 2QVCA 3G8DA 4GZ5A 3WZLA 2EFQA 4BQIA 3EW7A 4K9MA 1SXIA 1WNTA 3KSUA 5H7XA 3IX7A 3PFBA 3VU1A 1PT7A 1Q2UA 4OQLA 4URYR 5EA2A 1Y37A 4IJ5A 3BK1A 2CW0F 1OTYA 2FEXA 3BRWA 4HUJA 4U4AA 5ER6A 4NU0A 4I5GA 2PT6A 1CRZA 2V8BA 2X3YA 3GAMA 3JD2A 3MBKA 2RC4A 3LQ4A 3PCXA 4X24A 3GHHA 1H66A 1QWSA 2GTIA 4OB7A 4CEJB 1R16A 3H7AA 3DDWA 4WN3A 3MYRA 4HZGA 1DTSA 1WCV1 1IOZA 3CJQA 1DRKA 3DAYA 3MOSA 4AZ0B 1C1XA 5B58C 4OQZA 1F7UA 3RARA 3QSGA 1ZVMA 4YJGA 4LE2A 2ECBA 2R7OA 1XALA 2JGDA 4P7KA 4QAQA 1QYDA 4ETIA 1CIPA 3GZNA 1BDHA 2E4XA 3EEOA 3FXLA 3PITA 3T99A 2NU7B 3ICPA 1FRNA 4KIJA 3HPGA 5D87A 2QMEA 3A32A 3T1VA 3U81A 3OOHA 3V6MA 5KVAA 2K7FA 3C6KA 1VZ2A 3L7WA 3TMOA 2EFCB 1IJFA 1DXYA 5AKYA 3SQXA 3P2EA 4U3JB 1HSZA 1MRZA 3G7SA 3ORHA 2IXFA 2VT7A 1T3ZA 5HZGA 3DM5A 4J7UA 5FJ8J 4WCDA 4M37A 3FFWA 3HU5A 1SD6A 2CYBA 3L1IA 3MMZA 5C1DA 5FF9A 1EH5A 1VBNA 2FJ0A 3KEMA 4MS4B 5CJ9A 1K0UA 4OQDA 4CFZA 4KVZA 4R7ZA 4REQA 4WTOA 3ZJTA 1YH3A 5JXWA 3CFYA 4HDRA 2R6FA 4B6RA 5H4HA 4R51A 1USKA 1P29A 2ZB4A 3BRSA 1G8AA 2E3JA 3ACCA 4DC1A 1HQYE 1OQAA 4UU8A 3RJZA 1H1LA 3V7CA 2J6HA 3VPAA 4UEKA 4B73A 1JJVA 3R77A 4M3NA 5BR4A 4C2BA 4CN9A 1E94E 1EWYA 4I99C 3OL3A 4JX4A 1EXMA 2ATEA 2D1RA 3WHCA 4O2AF 1RWBA 4M7OA 5TX7A 4AM8A 1UKZA 2FMUA 3IEKA 2H00A 3EUAA 1TQIA 4ZC3A 2A14A 3I71A 2AI3A 2GHTA 3BFKA 3DP7A 3CZ5A 4DCCA 2MSLA 2RHRA 3G2IA 4NRDA 4RADA 4GEKA 1VJDA 3DGFC 5E8JA 1ZGJA 1FFXB 3R3WA 5CFQA 4LXXA 4OHVA 4RPIA 2OUIA 4M71A 1RRVA 1IHXA 1TC3C 1C30B 3CZAA 4HVAA 4DOZA 1ZUHA 3A6DA 4JC8A 4YI5A 2W6QA 4QDKA 3HO6A 3LO5A 2RI6A 4B75A 1QFJA 5LZ9A 3BKXA 3MYYA 1U0TA 5E8RA 1G4AE 2C3PA 1XRSB 3H04A 2R00C 3QMPA 4OHFA 1YVEI 3A7EA 4GXTA 1PGOA 2WEKA 4YUAA 1QTQA 3BWGA 1H23A 2Z6UA 1RWMA 4FWTA 4FK8A 5MN6A 3T8TA 1ORHA 4G5OA 4LWQA 1ZJZA 3BE8A 4BNZA 3V8JA 4DIBA 1IBMB 3VH1A 3TTSA 1ZNZA 3VYWA 1SC4A 1YLFA 2Z1MA 2C9BA 5K3DA 1N3BA 1TW2A 1AHHA 1ODJA 1UMDA 2HMTA 1EUCB 2JRLA 2Q6IA 3LDFA 4GM1A 4K9KA 1YVPA 2BTQB 3WO0A 1ZDMA 1N77A 4RV9A 1LTKA 3MJVA 2ZYVX 1SBCA 1QVZA 3MFYA 1Y42X 3OTQA 3VVCA 1ONBA 2YW2A 4CO8A 3HRHA 1JSLA 1HE1C 2D1HA 1NE2A 2FWBA 3MBOA 3FYHA 3R41A 2MW8A 3DTTA 4J9UE 4TL7A 3T38A 3K0AB 3VPCA 4JJIA 3HM5A 5EIBD 5B6JA 4CIBA 4HP8A 2B99A 3UUFA 1KHHA 821PA 3LZ6A 2B35A 3I9V2 2XVAA 3CF4G 3HHHA 3NNNA 1WPQA 1J97A 4YACA 4DC9A 3IMKA 5IZ4A 1XZ8A 4OGGA 2K3FA 3L09A 2Q3EA 3AVQA 4CCWA 5H4GA 3LYLA 3E61A 1OCZH 4WY8A 3PFYA 3QEMB 4K6OA 4Q12A 3RROA 1M34E 2B61A 5EJGA 5A4JA 4RHYA 3S1LA 1AQ6A 2FB9A 4ID9A 2QTVA 4F4CA 4EABA 3WJAA 4N41A 4CKBB 4GX0A 2BLNA 2PMDA 1Y1RA 2H4ZA 1S8OA 4QWQA 5F0HA 3QVOA 2NTJA 4LZPA 2XE8A 5H8LA 1I6LA 3WGIA 4U7TB 1FYLA 5K8LA 3GR6A 4OUDB 1BAPA 1C0EA 1XTPA 1QLJA 1E0KA 1F51E 2BEWB 1UHWA 4K8RB 3C45A 1NBME 4OHXA 1FFBA 1WPRA 5CW1A 3W6UA 3EGVA 3ISPA 5LIRA 1A72A 4OFXA 1VE7A 3U17A 1A9TA 1RBMA 4X84A 3F9KA 4EATA 2RGGA 1OR7A 3ZCSA 1O58A 4AAYA 4CFYA 1RI5A 3A26A 3B38A 3I83A 3K1AA 4PNPA 5M3BA 1R9GA 5EE0A 1QTIA 4U5XA 2FPUA 2P62A 1FDWA 2VUMJ 1GL9B 1PWYE 2NZ8A 2X0EA 3RGWS 5FLEX 2XC7A 3IO5A 3D6FA 5I01A 2BBYA 3KZYA 2MTBA 3O90A 2IEKA 3FKIJ 2GH1A 3BB1A 2R7AA 3IUQA 1XQ6A 4XX0A 3OEEA 5CBKA 4OGFA 3F73A 3A6HA 4MDYA 2X5JO 4GMFA 4NBNA 1GGNA 2PRYA 4CLXA 3JTHA 3JSOA 5BS6A 1D7AA 4KMSA 1QPBA 4LJAA 3ZCTA 1YDWA 4YRSA 5JBIA 2ZU0C 3NXSA 1DXHA 2GZAA 2ANCA 2RGNA 4Q9IA 5IM5A 1H3EA 4DWVA 1PUFB 3IO3A 3KR9A 3OO1A 4GZLA 5F2NA 3FBNB 3GTLJ 2BKUA 1TFRA 1ST3A 3HACA 4Q3NA 5EIOA 3W5JA 3PC7A 3WHPA 4ZTZB 4EJSB 1F3LA 4S0XA 5EJ5A 3HLYA 1EA5A 3COYA 1ABEA 2ZB8A 3M4ZA 1BQ4A 4HSGA 4I4CA 3K2IA 3H3JA 1V5IA 4LDZA 3L0ZA 4XLZA 2VSOA 2CVPA 4ZOEA 5EZ6B 4XLFA 1J56A 1I0IA 1QB7A 3AV0B 1ISPA 1UK7A 3B82A 4FHFA 4TS1A 3ZIUA 1NQTA 1AKTA 5G53C 5JBQA 2AFHB 3M4YA 3QKUA 4GICA 2CV2A 2GAUA 2PYZA 3TLBA 4V1CB 1E1KA 5AVTA 5L6LB 1L3CA 1QOPB 1LI5A 2QWWA 4MTDA 1WWKA 2OFPA 3NQOA 2PEYA 2ZJ6A 2J32A 1PX0A 1TCCA 2G0NA 1DOZA 3L7YA 3IH3A 1YITI 1NE7A 4POAA 4QM6A 5DN9A 5DHQA 4UTZA 4Z3DA 3CDIA 1WB5A 1L5RA 1C7JA 1WSDA 1HRKA 4AUKA 2G8LA 4OI1A 2ZJ2A 4B4UA 2KT0A 1V43A 2QBYB 3U3KA 4Y9UA 1OAAA 4FZJA 5IP7J 2DPGA 4FFSA 2NPFA 2DPUA 3CXRA 1WXXA 1XKLA 2H27A 3GJTA 2ODAA 3Q8KA 3ONQA 2LBPA 4GE3A 3TGWA 4LUCA 2HZBA 2W98A 4UUVA 1NVBA 1QDUA 2LCFA 2DA7A 2EA2A 3ZG6A 4WESA 3LMKA 4RS8A 3OM9A 3S8PA 1WJEA 3V7NA 3S2HJ 5JS6A 3ED1A 2AEJA 2OBXA 2F59A 4P34A 3THYB 3V8MA 3QA9A 2TMGA 1PV1A 4AVYA 2QVXX 1VGQA 3ON5A 3GRAA 4ZVOA 4MKXA 3IAHA 2OCLA 1UHSA 4K2AA 2IGBA 3FYUA 2A9RA 1MHTA 1I3OA 4DL9A 1XLVA 4Q47A 1N2CA 4NMMA 5HX7A 2G9QA 2E5ZA 1WJFA 4KKXB 3QPLA 1KFKB 3QRWA 8AT1A 4C0XA 1N4DA 2HO4A 3BAFA 3K0KA 1T8PA 1BE0A 1IHDA 2XX3A 2WSYB 5DBGA 4JGGA 5DKFA 5LZ7A 4DT1A 1J1UA 4KUGA 3LUGA 5KJEA 3K9BA 4JB0A 1B8IA 1Z22A 3KWJA 1V9LA 1UJ2A 4YP6A 4P0PB 1Y3DE 2L7KA 3OYLA 2POQX 4F5YA 4NE7A 2JL1A 4HVLA 3GJ4A 1GOTA 1P6QA 5LWHA 2P2NA 2WM9B 2QTLA 3ZWXA 4UQLA 4XKCA 3DOEA 4WXMA 3E9YA 2Q2OA 2AQHA 2V45A 3AF5A 1BVUA 3A10A 3IMCA 4HV6A 2ZI6A 2HOEA 4BHPA 3HB9A 1FNBA 2AUNA 2GNOA 2WHPB 1JLLB 2C4UA 1KK1A 2BC9A 3GCWA 1QX4A 5CEEA 5K0CA 3GEZA 4XMYA 3DZKA 3R23A 5KREA 4GC9A 4LOJA 2JUCA 4LK2A 4O4IF 5E6UA 5G0TA 3SF8A 5KSOA 5LQCA 3HVRA 1Q1HA 3C39A 4LFUA 4HPXB 4BVGA 2IUSA 1FSZA 1XX6A 1OCEA 1UINA 3I5AA 3LOQA 4K9RA 4RGQA 4W5WA 4HB0A 1Y33E 5BN5B 4F96A 5HJ5A 2HDWA 1JTEA 3KALA 4R3UC 1RAEA 1E1QD 2A3RA 3ZE1B 4ENNA 4OHBA 3ZK9A 3S1MJ 4N18A 3N0XA 3MT0A 1P17A 5PNTA 1QCCA 4QSMA 3P4YA 1O5IA 2JK1A 1G8SA 3D8SA 4Q6WA 3RAEC 3FWNA 4EO7A 2G9WA 2E7WA 1WF6A 3OQMA 2HPZA 5IHXA 1ZAOA 4N4NB 1QQ5A 3K0EA 4A1FA 3O47A 3QNWA 4UHFA 3ZZTA 4X66B 4RE6A 4R2MA 2R5ZA 4RK5A 2GAJA 2Z30A 2ZIVB 4RY0A 1M6VA 1FDVA 1T8SA 2WPNA 4RO0A 3D3WA 3H2KA 5AW6A 5FOQA 2PL3A 1YB1A 3SZTA 1AY0A 2QL7A 2XGCA 5EGOB 4LJ6A 1NN1A 4M86A 1JUMA 1Q0PA 3LUDA 4QUAA 2IZ7A 2MLKA 4KIUA 3CUQC 4OIFA 3OSGA 2JBAA 5SZIA 4C05A 2QP9X 3PHIA 4V0KA 1A04A 4YO7A 2CXNA 5F4BA 4ALIA 3E70C 5AVWA 5DS9A 3FLBA 1L3IA 4YELA 1TCBA 2QN3A 4HLCA 3C6BA 3W5SA 3WNCA 3E2IA 4BX0A 5GTDA 2HQSA 4ZWNA 5FGMA 2VP4A 2QPTA 2YINC 3AETB 4BNVA 1Q0HA 4FM9A 2W0SA 3B3JA 4LY9A 3SMQA 4US0R 4YH1A 3TINA 5BSTA 4GMGA 1MSFC 3D3JA 3K1MA 4ZJUA 4BB6A 1XEXA 3FMSA 1V54H 4MR7A 5LLDA 2Q7OE 3LPAA 1D1QA 3LSMA 3RLIA 4DABA 2EJWA 3NTVA 4MH0R 4XLCA 4MIKA 5KJ1A 2FGJA 5M34A 2YASA 3RFTA 4ZVVA 2HIHA 4E88A 2BFWA 2J5PA 2EATA 2IHKA 4RA6B 4V38A 5CHEA 1HDZA 1IL0A 2VYFA 3NIBA 3W8DA 4MGYR 4AY3A 4FKMA 1J9ZA 5IARA 3GFGA 1E9CA 3GDHA 3PQ7A 3FTEA 3R6SA 2EP5A 4W8HA 5F35A 1KEKA 5J1SB 4N39A 5HXAA 4EJVA 1ECGA 3AF2A 3KJIA 2YU3A 5EP2A 5FPSA 2VZ9A 1L5WA 2GUWA 2ZJRF 2XUDA 3NHSA 2HFKA 4KDRA 4CTKA 5EWJB 5D5UB 3DV0B 4Z8YA 2BV3A 4DA0A 3K7AJ 1YNOA 1D6JA 1D8JA 2FDXA 3TIVA 1VLLA 4Q4CA 1SELA 2HIMA 2X13A 4IV5A 2V9ZA 3TQTA 2RGDA 3G0OA 2GM5A 2WF5A 4XVQA 4B3BA 4JDPA 2PX5A 3FHOA 1JJ7A 2OD2A 2XTNA 5DCFA 2B5VA 3LXMA 2FEAA 3O74A 5DK4A 3TZCA 3ZU5A 4DRYA 1SVKA 2N46A 2UUBB 2R1VB 5B5SA 4R2JA 4MUEA 1D6NA 2IC5A 2R4UA 5GAHJ 1E9AA 1RAGA 2XV1A 1BXRB 3ACDA 4PY2A 1ZR2A 1Z8HA 4JSYA 4YXWA 5JS8A 1K7FB 4MAFA 4FGLA 3H35A 1PL6A 1JGSA 1MG5A 1XZMA 3C3PA 2WILA 5H80A 3KLNA 1UBRS 3D8NA 5LUAA 3K0CC 5C5IA 2Q2QA 3SFZA 2UV1A 5JVGF 1SQ5A 1YRQA 3A31A 2R7SA 3DFUA 3NC4A 3GPIA 2QGZA 1L5KA 1XWIA 4L9TA 2JGNA 3ZE9A 1KZ4A 3NJ4A 1I3KA 4H3KB 3B6CA 3LA6A 3HCFA 1H69A 5BUZA 1BI2A 3A01B 3C1DA 1N6IA 1N0UA 3F6BX 3I6ZA 1IUKA 1VGRA 3P5SA 2DFTA 4Q9NA 4R8RA 1NV9A 1SXJE 1KFJB 1DIHA 2FU4A 3G1WA 3G1UA 4U0KA 2ID8A 3KXDA 1OFVA 4H3VA 1ZI9A 1DBVO 1YR7A 4QBFA 2DE0X 4D56A 4J1NA 1EQ2A 3GJRA 3UWMA 3PGA1 1HWYA 1IN5A 2VH1A 3V8BA 4BRZA 2ESNA 5FUXA 3DEUA 1V11A 2CHQA 4TRMA 5I4CA 1PJTA 1IMOA 1RQ2A 4RQTA 1X74A 2C5HA 5KCMA 1PE0A 3AR6A 1Z5UA 2D5BA 5DRTA 5HBRA 3NP9A 2VNSA 3QPBA 1B74A 4HLQB 4WLOA 5H16A 2L5QA 2MT9A 1YJ8A 3HS3A 4XLLA 1GGHA 2HMYB 4HF7A 2EBHX 2ZVJA 1H94A 4UNIA 5K0NA 5JW6A 1JWBB 1ITZA 5ADHA 3X0DA 5IXYA 3F98A 4R81A 2EIXA 1R5GA 3MK31 4EY6A 3LUKA 3FXJA 4OQPA 3BB3A 1WRJA 4FTHA 4UHEA 1KU3A 3RJ5A 5BV0A 1IPFA 1Q0LA 2AWOA 2NZXA 4F3NA 1SFUA 4CR8A 5KOJB 4AVZA 3WGKA 1LX6A 1U0RA 1JFTA 3LDAA 2VJDA 4K81B 4XGKA 5BSGA 4DQ2A 1PKEA 1XRRA 2VBFA 2Z3WA 4KYUA 5HR5A 4PRZA 3KHTA 4HGYA 3ZMZA 4QPOA 1Z6XA 2UAGA 4POOA 1R9JA 3F2IA 5B1EA 5KINB 5JC1A 3SFIA 3GXOA 5JHHB 1RQNA 3WB2A 4DIFA 1H0SA 3RZOJ 2WHEA 2XVZA 1ZK0A 3TO5A 4UHTA 2OESA 3W5VA 3OY9A 9MHTA 1T1IA 2E85A 1MOPA 2C82A 1JKJB 3IRRA 1YHZA 3WOHA 4FASD 3NTUA 1T2DA 1HDCA 1ETOA 2GD2A 2IKQA 3UAXA 1CCWA 5CLGA 3SD7A 1MP0A 4BQSA 4YJFB 2AYYA 3IP7A 5KEIA 1NPTO 3LHSA 5FFFA 5I4BA 3KD3A 3U09A 1KYXA 3KKQA 1FRFS 1NTCA 3BSWA 3PT9A 3KOZA 3O2JA 3QFFA 2DTEA 2OU2A 4BLRA 2Y6VA 2XGJA 4M1EA 3VPSA 2RHJA 2DWOA 2WTEA 2JJ2A 4F55A 4HDQB 2HRBA 1YDMA 2BWJA 2AJDA 2WBLC 2ZUWA 4HNSA 4XUGB 3A3PA 4V2IA 1ZQ9A 2BDEA 4N3BA 4UUOA 4JK1X 3AQ4A 1XNRB 2E2HJ 4GR9A 1UJ8A 3OECA 3OOWA 3TAUA 2XT6A 4YCMA 2O8EB 5A62A 1W1IA 1KP9A 4R2IA 2ATXA 4L4SA 1QA6A 2VKEA 3FVTA 3UT0A 4DY4A 1JU4A 3K09A 1RHUA 4XDYA 2Y0BA 2GYYA 3GGCA 3GLKA 4IXMA 5C81A 3VHXA 3HJFA 1DAPA 1K7EB 4ZZDA 1GZ3A 1AA7A 1IJBA 1VTKA 1O94C 2O8KA 3DDSA 2EB7A 4REOA 1NOIA 4PPNA 4X6LA 3UC9A 1FX7A 2NLOA 3JRHA 5E1WA 3Q4GA 4LC0A 2RGRA 1A5TA 3U80A 2A5LA 4Q1DA 1MIOA 1ZINA 3RVJA 2GS9A 4ZO4A 3VAYA 1O87A 3M7IA 3QPVA 2B21A 4R41A 2R79A 3EUKL 1XRLA 3CVXA 2BI7A 1QK3A 4NJEB 2R68A 4OHYA 2RJNA 2HZDA 2VUHB 1QZYA 3VAAA 3O4IA 3NH6A 1QRYA 3VODA 4EFKA 3IVZA 1S9DA 2GILA 2HA2A 3ECOA 2ISSD 2ZOSA 1N7GA 3S1QJ 4J16C 3GN2A 1TX4B 3V8LA 2F6CA 5FV4A 5E8GA 3MCUA 5E4YA 4DCSA 1SVUA 1V1JA 2ESHA 4NP6A 4ZGWA 2V3CC 2UVPA 2QORA 3JTMA 1V26A 4QYMA 4TRNA 3UJ7A 5IRCD 4BEHA 5FBHA 3UPUA 1P7IA 5K3BA 4EGJA 1GQQA 1QPIA 1R8XA 1JEAA 2O1XA 3WGNA 4H4CA 1QHIA 1B3BA 4NOLA 1T0UA 3WLQA 3Q8MA 1FP6A 3UKOA 1EBBA 1DRUA 4P38A 3WTVC 1J0BA 2F00A 4NBLA 3JVEA 4WXRA 2I2AA 4RF2A 4RK0A 2F43A 4YJHA 4DCJA 1SUBA 1YFLA 1LFPA 2HMAA 1QP7A 1EUZA 4FN4A 5FRNA 4CMEA 3WU2C 4QD3A 4D3ZA 4JOMA 3HJEA 3CUQA 1XZJA 2HWYA 2GBLA 4RK4A 4LQLA 1AUQA 2A9JA 4HDCA 4R1QA 1G7CA 3HRIA 4FPXA 5IBPA 1H3FA 1D04A 2C4HA 4BJ1A 5JMOA 2R7UA 4I4LA 1KY4A 2AMVA 4X5OA 5JAPA 1H9AA 1WHTB 1ZD2P 3TNFA 3IUOA 5ITZA 3QYFA 2OZEA 4G2NA 4I55A 4LVUA 2VS1A 2ZBDA 4PYIA 4ZARA 3QVTA 4AN4A 1R18A 4LOLA 4LGYA 2H52A 5LQJA 3BQNB 2P3QA 2WJ4A 3OLXA 1AZWA 2H4XA 2ZYIA 4TM8A 1TQ6A 4EEXA 4F04A 3WIVA 4NC7A 4HX5A 3T4PA 4Q3OA 5EHZA 1P19A 3ZW7A 4UBKA 5FOXA 1PJ3A 1F8GA 1A7JA 3ZWOA 4B6OA 3AHGA 3EVFA 3H3VK 4GUAA 5G0WA 3RK0A 5K4GA 2W37A 5HGXA 4QVKA 4HH0A 4M9CA 4ZN6A 1H2RS 2ZFWA 3OLZA 4XJVA 5LXTA 3BWDD 3HU3A 5FTWA 2CL6X 4KEAA 4UUSA 4IJ6A 3GFQA 4BLQA 1EJ0A 1JFVA 1SZDA 1B8PA 5L45A 3DXYA 4M7RA 4C4ZA 1GUUA 4LJ5A 1RRCA 1I10A 4ZCLA 4YDRA 2ZCVA 5LXTB 1AV7A 3CG0A 3DWFA 3FCSB 3T52A 4A3SA 2DQYA 1TNDA 3BERA 4GKAA 4TWRA 2JA8J 1NXPA 2FEOA 5ERYA 3BEOA 3KQKA 1SC9A 4RMNA 4GRAA 1S0UA 1M72A 3FSGA 3E6BA 5EKXA 3CZ9A 3VYUB 1AKMA 3CVUA 1KQ0A 5HDNA 1ZKGA 2PGJA 2HY7A 5JI6A 4G65A 3RSHA 1JTFA 3UHOA 1N36B 1PQPA 1FU8A 2GO1A 3HYCA 1RDFA 3T0GA 4X7BA 3GRUA 4BZZA 1XGOA 3QVGA 2AIRA 2CNLA 2JJ1D 1BW9B 4CIDA 3ITNA 3UYLA 1UEJA 3NOXA 1AN0A 2V97A 4U63A 4XKWA 4CUGA 4XX1A 1GG9A 4FCVA 4I55B 1I1HA 1GEGA 4WBSA 1P0IA 4C9YA 4MPTA 4MRVA 5AWFC 2PS1A 3VHRA 2Y0CA 1K8ZB 2O3JA 1MMGA 5EDNA 2VC1A 4UXNA 1KZ6A 3GL9A 3NHRA 2E82A 3WLFA 4D3XA 4FEEA 4RJLA 5JZMA 1TD1A 3CD6I 2WWFA 3TQOA 1WDLA 4LJ4A 3W06A 4B9AA 1MO2A 1PS8A 4W6QA 4N4OB 3GFBA 3MMXA 3WGGA 3CPEA 3NEPX 3RVLA 1QONA 5C18A 5L4SA 4DR6B 3F9CA 4LDRA 2HIAA 2R86A 3ORSA 2ZAOA 3AERB 4BFZA 4XONA 3A0RB 1BMQA 1DNPA 2H1OA 3VH4A 5LZ2A 3E23A 1QF7A 2ET6A 4I8XA 2VQGA 1KZYC 4GOND 3AINA 2KE5A 1YJNI 1VB5A 1B1CA 2XH8A 4IO9F 4KYTA 2JI4A 4DQDA 1L3LA 3UOGA 1SQ6A 1E5VA 3I8XA 3P7MA 1U2PA 3NATA 1BJZA 4LOKA 5JCZA 1R6RA 3EZ7A 2YRWA 1KNXA 1WY5A 3PC6A 1R0SA 1WIWA 5KOJA 3OZUA 3G1TA 4MUJA 1A1VA 3S3OA 1NUTA 2A78A 3SJZA 2J9XB 3N2IA 2DUNA 4PBRA 5DXAA 3HXLA 4HV5A 4EVIA 3GPDG 4XIFA 4ZYZA 4BAGA 1EDOA 4B3CA 4NATA 3UK2A 5K8TA 4R98A 2EYQA 4NCBA 4RAGA 5JAUA 4KRFA 2DDAA 4HWGA 2HMUA 1NVVQ 1YYVA 3DT8A 2OHFA 2ZYTX 4IHAA 3VAZA 1RRMA 4O2LA 4L5CA 4UM7A 1VJGA 1PJSA 3V8KA 2PMWB 3VR2D 2GBFA 2X41A 4PWZA 4JVLA 3REGA 3UGJA 5KSPA 5C8YA 4AUMA 1RZVA 4YMLA 2F1IA 1H1TA 3IT2A 2QX7A 1WB9A 4OREX 1Z67A 2C2WA 2VYCA 2GN0A 3KE9A 4P4UA 1T6SA 3ZNOA 5JNTA 1RC8A 1R6AA 4ZT7A 2Y48A 3RANA 3DOOA 3OLQA 3X2EA 5U1PA 3ZH2A 4MQ5A 4OXRA 2C20A 4ED9A 2EFPA 2M32A 3FWPA 1JLMA 3MINB 2R8YA 2ID9A 5G4LA 1YNSA 3TQRA 4CF4A 4B3FX 1QH8B 3FH0A 1F2UB 2AV6A 3VR6H 1F2TB 1T0HB 4P3XA 4XLPF 4L1KA 4DYQA 4JT8A 2OM6A 1K98A 2GBIA 2GJ4A 1AHIA 1B9MA 4DR4B 1EB9A 4F38A 1C4KA 1ZUNA 2K4JA 2VL8A 3HEAA 2OZKA 1DTEA 4A27A 5E4JA 3LQ1A 4QC2A 3DZBA 1FJXA 3ZWYA 2C97A 2PLWA 5AP9A 4KSBA 2QQ9A 3RWMB 4RTJA 1A3CA 5FUWA 2FUG2 3N9IA 2J9ZB 3Q40A 1MN6A 5DNYB 1QZEA 3RSOA 1QE3A 4A3BJ 2Y2VA 5TISC 4IHXA 3I4CA 2QN7A 1ZK8A 4ZGGA 4IDOA 5JFTA 4E7IA 5B7NA 4JXKA 1IM8A 2YXDA 3FI9A 3MWLA 3X1ZA 3S81A 3T1HB 1TJYA 4IUYA 4XLNF 4IL6C 3K1PA 1I3NA 4MVJI 4TKMA 3KPJA 1XPUA 1V16B 3B9RA 3MWEA 4HHEA 4NQZA 3HDTA 4BLVA 1Q95A 1SRRA 2ZVDA 1GQRA 4WA7A 4EPRA 1R64A 3QNUA 2YOGA 4L9RA 5DF1A 4X1YB 1QJCA 2VJQA 2UUZA 3MB5A 4U2KA 5K0TA 3MJSA 1CXZA 5KNLA 4JAVC 3OPVA 4J07A 2ZE8A 2X8JA 3L41A 3FAZA 5IY5H 4A8TA 2PS9A 2BH2A 2EGUA 2A61A 2PUHA 4M1QA 4BO7A 5H9VA 2BRUA 2Z5LA 4UTPA 2EK5A 1PR4A 2A3SA 4NARA 2J4FA 4RORA 1Z33A 2CF5A 3FPJA 5JCXA 1J06A 1UB9A 5CFPA 2VAPA 4E5KA 3VSDA 3EGDA 3LW7A 4XN3A 2AW3A 2W2LD 3A6LA 4AC9A 4R71A 5KS2A 1JZQA 1U4NA 1E9EA 1TO1E 2E4WA 4WCFA 3ESRA 1I7DA 2G1PA 3OYKA 2RN7A 4XB6B 2XA2A 2H2AA 2LNBA 2JAOA 3KLCA 5B3LA 4ZQGA 5A04A 2C2BA 4FSHA 1JH8A 1US8B 2GZ1A 5DGCA 1X42A 2FQWA 4EZIA 4DV2B 2OCCH 1J0XO 2QXTA 3EUWA 5DM1A 1DC8A 5I7VA 3R7LA 3MPOA 4K9PA 1IQUA 3LX4A 3TLGB 1F2VA 3UJHA 2Z98A 3HBFA 2FPIA 1LPOA 3IXQA 1ZBQA 3D3EA 4NK5A 3JQ9A 3F5QA 4BC0A 2GGLA 1LRLA 3C16C 4F5EA 9ABPA 1YCHA 5B12A 4LIVA 4KYWA 3U1KA 3B1YA 3O3MB 4P0TA 3KXIA 5H8JA 1L9XA 3PZRA 5F64A 1RWQA 1JHOA 1LPSA 5DCMA 4DMCA 2INGX 3AF0A 4HD8A 5KVRA 2QRPA 3QPDA 5J5CA 3STHA 5JXHA 4EJFA 1PU2A 2PS3A 1GWNA 2FFJA 3T8YA 3RG8A 4K1XA 4LMRA 5IC6A 4Y9RA 1CNEA 3BG6A 2NYAA 1L7QA 1VJ0A 2W2KB 4UFNA 5AW9A 1R3UA 4PUSA 3B9QA 2P4EA 5F3RA 4BBAA 3TO6A 1X8JA 2B8TA 2D5AA 2HA4A 3ESCA 5HS9A 2NAFA 1AB6A 1JR4A 1U9JA 3EXHA 3NBKA 4NCIA 3TS1A 1GKUB 1XTRA 2I62A 3D8UA 2Y68A 3LT2A 3PHBE 2QG4A 2VPQA 5D1HA 5A7GA 3NBMA 1RQRA 2PL9A 3FUXA 3G2KA 4KAJA 1F0PA 1K6XA 2PJZA 3KQOA 4Z0TA 5JT1A 2X9QA 1XGKA 4FZ3A 4EQQA 3GAZA 4RH0A 1XDUA 1ZN7A 3G0GA 4HOBA 2W6NA 4GSKA 2XCTB 1FY7A 1WV1A 4EARA 3D2LA 2R8RA 4OKIA 3OVMA 4D8TA 4ESOA 4WBNF 3DONA 2WJAA 3ZHZA 3HKEB 4PAMA 4COKA 1EM8A 3WJ2A 1W93A 4CV0A 3NAMA 1ZIDA 1MF7A 2DFEA 4F86A 4A3CJ 1J5YA 1C9JA 1PYOA 3K0BA 5L4NA 3QYJA 5A6SB 4CM5A 2ZUSA 4F11A 3ZRGA 4DYRA 1GTL1 1LBIA 4LWOA 4N0PA 3IVMA 1QTRA 4QGHA 1BIFA 2WOOA 1XMOB 3WGMA 4N3CA 5AUQA 2DQSA 4ZCIA 5CLLA 2V1XA 1C9EA 4ZI7B 4AC0A 3TQIA 3Q3GE 2NADA 3IDSA 4JEHA 5AUPB 3AUAA 1U28A 3ZWBA 3G3ZA 5EMHA 4UTNA 1VL5A 3DHWC 5K0BA 3AEXA 2VDMB 4LZOA 1RQXA 4V2GA 2QSUA 1NG6A 4HX9A 4Z0PA 4QGSA 2IPNA 2ISZA 3QTLA 5AH0A 1AA9A 2FN9A 5AK0A 3RPEA 3UJ9A 3LC7O 4CF7A 2ZS7A 1ZVKA 4YT2A 3E5UA 3NAQA 4M8NE 3PM1A 1QRRA 1XEXB 3CV3A 2PMZA 1POWA 5AK4A 4B4OA 1CNFA 2P6RA 2AQEA 1LV7A 1CUXA 3H0DA 4UZFA 3UAGA 4JCCA 4M9QA 2X8JB 5TPWB 4ZCPA 1MO5A 4AJOA 2WABA 4EF6A 4EMBA 1OWPA 1U3VA 5DX8A 1IBLB 1XP8A 1S2IA 4K87A 1SVSA 2HSDA 2YDYA 5H59A 4EYEA 2HOAA 1U1IA 4HGPA 2NTVA 3ULQB 3CH5A 2ADOA 1OBVA 4RKEA 1EPUA 3ZE7A 4MAMA 1O6ZA 3V4OA 2W00A 3O03A 2ZSKA 4KVGA 3MCTA 3U26A 3O9MA 2I8CA 2W70A 2ERYA 2EZ4A 3PGKA 5JS2A 1G20A 5KQMA 4WOPA 3G17A 3WMEA 3GFMA 4LEIA 3TSOA 4PZ0A 4RU1A 4H0EA 4OBXA 2XGMA 3D0RA 3C1OA 1V9SA 1FBTA 1OV6A 1KIMA 4PZYA 1DOHA 4BO9A 3SDGA 4J9VA 3HNRA 3DKXA 1MORA 3R3SA 1FYEA 2AZTA 2QVYX 4TMYA 4AJNA 4WACA 4UB6C 3HP7A 2PBZA 3OZ7A 3F8TA 2RQQA 3BMXA 4QUBA 5AHXA 5A02A 5KTYA 1ESNA 3NORA 2ISYA 4G7HF 3F8SA 3M1YA 1AZTA 3KKKA 1RQPA 1QIGA 3PNLA 4JC0A 1MB3A 1E5QA 4RVCA 3J81K 1T2UA 1JB9A 4Z99A 1XZFA 3QX7A 3JSPA 4L15A 3E6DA 2BM9A 1TT0A 3SN6A 5LOVA 5HIJA 3NBYC 4W63A 1H8HA 4QGGA 3BBLA 5FBWB 1GU7A 3ZGXA 1CJTC 1E1CA 1AKVA 4P7FA 2FWIA 4HAUA 1KI4A 4P36A 4DS3A 5I51A 5D8LB 1OXUA 4KSYA 2V7VA 3VC3A 1U8AA 3HG7A 5AKLA 2WAOA 3E27A 4D9NA 1DCTA 1R9TJ 4DLVA 1W19A 3BICA 3LLSA 1IXYA 1E1LA 3DOHA 3WE2A 3GJZA 3KZNA 3DE2X 4ZZ1A 3GW2A 1BWPA 2PXCA 3ODGA 2WFAA 4HNAB 4P5OA 3L6BA 4Q1CA 4R0VA 3ZTWA 1MMSA 3MJDA 3RS9A 1GV1A 2Y99A 2FZEA 2WSSA 4IHKA 4V19K 2X0LA 4ESFA 2XB6A 5K5OA 4ALMA 4EVQA 5AW2A 3BR6A 3RH0A 5CDYA 1JPUA 3V4FA 2XMGA 3PUFA 1YR2A 3N7TA 3WK7A 1JHVA 2K2QB 3IH5A 2BFPA 2JFBA 2Y2UA 3R2JA 3TMYA 4D4IA 1YI0A 4MJXA 2CZQA 1FOXA 5TMDA 2NQ2C 3S1AB 3N6XA 4BKRA 4KR7A 3GQVA 3DWLE 3H2GA 5GZ6A 3RYFB 2ZUBA 4OATA 1U9IA 1N2CB 3CZRA 5ALDA 2KLOA 1PI3A 2Q5IA 3TGPA 3VR4H 3G0BA 4ZEWA 1GZUA 4D8XA 1PNOA 4NAUA 1U8ZA 4CXFA 3CP8A 3L2QA 1UAAA 2B4YA 2GD6A 2PRSA 2ZIWB 3BZUA 2R6JA 4A8JC 1HC7A 1JFFA 1GNQA 2VK2A 3LL4A 4JUCA 4P96A 5HLHA 3VSKA 1ULSA 4L5AA 4RK1A 5DHFA 3MKLA 3WFIA 1UJ6A 3ISVA 3M6VA 3ESDA 2B20A 4Q39A 3SJAA 2SKEA 4C0BA 2YX7A 1B42A 3D3KA 3B1XA 3BXHA 4ZDKA 1SB9A 2DB3A 5CITA 2P6NA 4WCGA 1E64A 3F46A 5DK6A 1AV6A 1X1TA 4GVPA 2X58A 3DKRA 1W1WE 1BC8C 5T4HA 2VUIB 1CUIA 1Y5MA 1TGVA 4IR7A 5IXSA 4DZZA 2JRTA 1Q1AA 3MWJA 2VKHA 3SXYA 1AF7A 2GCPA 3CCEI 5E7QA 5BN4B 4N9IA 3TL2A 1U0JA 3U2RA 2Q21A 5CVIA 3N8DA 1YGPA 4G56A 3R6GA 4AIRA 2TRSB 2CH0A 1XP5A 5KHLB 2AFHE 4J4BA 4DILA 4OGWA 1VSTA 3B8HA 4YCSA 1UF4A 3T3GA 3BXGA 2DSNA 1QG6A 1YE3A 2YUIA 3G2PA 3NHFA 3OQJA 4GRDA 4LKOA 4MWOA 2AVDA 4OYRA 5DU2A 3VI4B 3EZ2A 1JHAA 1Y3FE 1OR7C 2Q6OA 3RUIA 2WUDA 4A23A 4FD3A 1LC0A 1NSFA 1JMVA 2FF7A 5GOZA 1M75A 3I2JA 3TNLA 1WSAA 3MF4A 4N01A 3CCSI 1AG9A 2RBGA 2ZI5A 1S3IA 2CMKA 3G8CA 1K7AA 2XXBA 4HWSA 4M9RA 4NWIA 4DBLC 5IJ0B 4S04A 1SAYA 4QLOA 4TTJA 1JW9B 1HF3A 3WYNA 2CEAA 3V80A 3RC1A 4ZYLA 1L1EA 2IXBA 3A3OA 4QXMA 3W2FA 5CFLA 1M0WA 3LA7A 5GV7A 2B1QA 4LB6B 3N74A 2VAWA 3PYLA 3S0JA 4DIDA 4UUSB 1WCMJ 2AR7A 2Z57A 1WMEA 1N2XA 3ZDCA 2HJHA 2NP7A 4AY6A 3JSAA 3ZDFA 2XRYA 3QX9A 3CG4A 1ZOSA 4PN7A 2ECCA 1CQIB 3CF6R 3QV2A 3FXKA 5JH7A 4FOTA 2DETA 3CEJA 2WTXA 4NEQA 5LNK1 3QUCA 3RQIA 5FBVB 1VRWA 1XFDA 5DP2A 3SCZA 3I9V1 1QYVA 4MR9B 1BS9A 4TWZA 3ZV4A 1A71A 3TOAA 4MUMA 1QS0A 2EAUA 5HK9A 3QP6A 3IV5A 5GIOE 2PUVA 3L8GA 4XR6A 4CGZA 3ASNH 5HCNA 3V8RA 4Y2RA 1FTNA 3K05A 4MLCA 4A3JJ 3PQCA 1KVSA 2P40A 4OSOA 1KERA 4BTEA 3K1AB 1VMDA 4XPIB 2PV7A 2OV2A 1OC2A 3QOEA 2NXWA 2R7NA 4JQOA 3D0OA 3UOAB 4HDRB 5JSZA 5CAEA 3R9IA 4G5FA 4K05A 4DRZA 1V8ZA 2JFUA 1JDTA 1WOYA 2JAQA 4LG1A 4PX2A 3RU2A 4AP5A 4EW1A 2AZXA 1E60A 1I2ZA 1N7JA 1HQDA 2CYYA 1Y6QA 2B25A 4GECA 4YPVA 4NCAA 4YFNF 3KKMA 1T6YA 5E1OA 5GM1A 2HOSA 4ZAGA 1WP9A 2F43B 4OWRB 3G82C 1ZONA 4WWHA 5T6BA 2QP4A 1LU9A 3WLNA 1VHLA 1EX6A 1CIVA 4D74A 1CDDA 1AXGA 1NZFA 2AZ4A 3C8UA 4F3CA 4F4FA 4YV7A 1TUBA 5EHQA 1HLGA 4R3WA 1XMQB 2HQBA 2C92A 1QOQB 2AFVA 3PICA 4HJRA 1W0UA 1GTMA 4NU8X 3L7LA 1HT0A 3R7WB 3BDAA 5EE1A 5E7MA 1TOAA 4L4XA 2J0QA 4X64B 3GMIA 2D7JA 4JJ6A 4MYRA 3OYEA 4P86A 2P2DA 3DTYA 1CP2A 5EWMB 2AKAB 2WG2A 5DYTA 1V7QA 1CY1A 2ACWA 4FHEA 3WADA 3ZR8X 1U28C 2C5AA 2D2XA 3A1WA 4X3PA 3I2FA 4DM7A 5F76A 4IH1A 1T1SA 2MINA 3MT8A 3Q98A 3ZR4B 3WO1A 5HS4A 5IJ9B 3A37A 5KC9A 1G21B 4F9EA 5JHFA 9GPBA 1HEIA 2J07A 3EMDA 1VPLA 4U02A 2A0FA 4YV1A 3T4UA 4LJKA 1TQ2A 2CLLB 3H87A 3UG6A 4CM7A 3EG9A 1UMKA 5EPOA 1XTTA 1MC1A 2WADA 1YUMA 3LOPA 4K9OA 3HI4A 4EHLA 5F23A 3TW6A 3K9QO 2I71A 4FXOA 5CH5A 5I8ZA 4FNOA 2JVGA 5JTUA 1O57A 5BN3A 2WB2A 1R0WA 1J75A 2A69F 2F4IA 2LP0A 5IYDJ 1K5HA 1GQFA 2RC6A 1SQ0A 3DSRA 3QLUC 1JHRA 5ALLA 5KNBD 2A05A 1TW3A 2IITA 2HWUA 3PUJA 2EPFA 1N2EA 1OJ7A 1KJJA 1Y6ZA 3H19A 4MK4A 5AKJA 3S40A 3SE7A 2UXCB 3W79A 5JYEA 3A03A 3E4DA 4YRFA 2AR0A 2KJQA 3OE4A 3ZCUA 3TUZC 2YS7A 3I1JA 3EZGA 3ZOBA 3ANTA 3CN9A 4ETMA 3SIWA 3D3QA 3EYIA 2Y71A 1JNXX 2F5FA 1MZVA 3FA2A 1EVZA 3MVEA 4RVDA 2Y67A 3HM9A 4IH9A 4HEQA 2XQFA 2AFRA 2MSWA 1CR4A 1UBNA 1E5DA 2HCFA 3V1MA 3VJLA 2J9FB 1IM2A 1KFBB 4N48A 2Q8KA 1FZPB 2CJXA 3LD9A 1EHIA 3FXRA 2R8BA 4HX2A 4B6EA 1GTVA 3WIBA 1Z3IX 4C0SA 3M2TA 3JYNA 4XXHA 1QMPA 4ML3A 4RZIA 1M2OA 5KYXB 1TWGJ 2BSQA 3AR3A 1IWBB 4OMUA 3PUZA 4RD4A 1YUBA 5L9AA 1NMSA 1T2VA 4IM7A 3I09A 4ZHQA 2YJNA 4KK4A 1Z63A 2GUGA 5BT8A 1QHYA 2QTCA 5FUVA 4P35A 1TK3A 2BEVA 1HG1A 2XWJI 4Z0HO 3D5QA 1T4CA 3S8MA 4CWAA 3DCYA 3K6RA 1WXHA 5JRZA 1P2BA 1YVUA 4IZIA 2O50A 4YRZA 3QJ5A 5HKBA 1B0AA 2IA1A 4CYYA 3UCFA 3KEOA 2NO0A 1ZIYA 1A9OA 2AUTA 2JA1A 2Q9BA 3AM4A 3PDIA 4JLDA 1QHGA 2JLRA 4PVCA 4ZK2A 1UADA 5SZHB 5LHIA 1TKCA 2O8VA 4MUGA 4NR0A 1A9XB 1ANKA 4C7MA 4UFPA 2IBDA 3LWNA 2FDRA 2EQAA 1YHQI 3R5FA 1MC8A 4MUKA 3QEAZ 1RYYA 4EY3A 3I61A 3CEAA 3ZE8A 5LNK6 4QOGA 2P9JA 3L43A 4HLXA 3OIWA 1YOVB 1SCNE 1R23A 3NANA 5HG0A 3RIEA 3IEVA 2C88A 4M22A 1SXGA 3DB1A 2AHRA 3HMKA 1NXVA 3RKWA 4H6XA 3BG5A 1M73E 2OBYA 5DM7F 3DFFA 2OSVA 3CUVA 4DCMA 4LHWA 4KH1A 2EZUA 1RPNA 2RHOA 1JTYA 1O94A 3TP0A 3IT0A 4GFDA 4JU8A 2JGLA 4YASA 3GRCA 2C5SA 2RDPA 2WIKA 1PIWA 3MZYA 5EIFA 4A0RA 4BNWA 2YZ7A 5F7JA 8MHTA 3ZDRA 2VPTA 2O8XA 1K7YA 4X45A 1V11B 5CA0B 4BUPA 1P92A 4IOMA 5JAOA 4BKXA 3H8JA 2O0MA 5AW3A 4B8XA 4CEIA 4QU8A 3HRUA 2CUNA 3RDPA 1WKMA 1NKSA 3A9UA 1Z38A 3T7IA 3OU2A 1IHPA 1E92A 1UOPA 5FWXB 2WAQA 1M33A 4WEOA 4WVLA 4B6GA 1WMAA 5EPEA 4BRWA 4W4TA 4C7KA 1BR2A 2PK3A 2FSHA 2WM8A 4LKRA 3CLTC 1JWAB 4QYTA 5EXXA 3TIIA 4BLUA 3FWKA 1A82A 5CU7A 5GPBA 4J0EA 3DB2A 4Z1MA 1K6OA 1REPC 3IOEA 4X7MA 1UFMA 2M6LA 3H99A 5L7WA 3UT5B 2SICE 2NXNB 1JGGA 3A9VA 1I7PA 5CJPA 3TOBA 3GO4A 3CDHA 2CVZA 2F4VB 1VG8A 2J6IA 4MYUA 1L3BA 3PQKA 3ZCRA 5I9TA 4C3UA 3P96A 4D81A 1E3MA 4DLZA 5E3LA 3GLUA 3MOGA 4BVEA 1HQKA 4D43A 1KK2A 5BXYA 2RHTA 3RZDJ 2AJBA 3KJZA 1VYTA 3RAPR 4M1TA 1VCOA 3WMFA 2ZXFA 1F8FA 1FLVA 3O93A 2JA5J 1LQ2A 3DEEA 3K9CA 3OYDA 5DHPA 4Z4CA 5AW1A 1V5EA 3OE1A 3GZ6A 1UK6A 4KR2A 1EFVA 4JQCA 1FOYA 1AC5A 5DNVA 1XEFA 4LHYA 3T7DA 1C80A 4CMIB 4M1WA 4PICA 3WZMA 1FMFA 4I50F 1JDPA 2D06A 4OL9A 4BMCA 1Q57A 1UM9A 5J1TB 3DF7A 5CEFA 1RXVA 2QIOA 3DF9A 3GWGA 3IMEA 4HADA 3EWSA 4L6CA 1Q1GA 4YJ3F 1COWD 1KEEB 3OG9A 4LFCB 1KPGA 4A8PA 1BOBA 5K6AC 4TV7A 1A5BB 1MOSA 2GEUA 3IERA 3NVKI 1PQUA 4OIMA 3B73A 4D45A 1LPPA 2OT3B 4O0LA 3BTSA 4E3WA 3JYQA 3WGJA 4ZC1A 3FZVA 4QOEA 2VPWA 5LU8A 1IBKB 3O82A 1PN3A 2OQVA 4RA6A 1J59A 1M2VB 2C29D 4PC1A 4WBNA 2YJTD 3FDFA 3UVEA 2QN2A 2FVXA 4DV1B 3IB3A 4O4LA 4XQEA 2NNWB 3DMRA 3ZY6A 1KY2A 1ZA2A 2BF4A 4EIWA 4RGUA 5K0JA 4PG8A 4G0XA 3EDMA 1R4NA 4XI9A 5D5XB 4DJJA 3CJNA 3Q6MA 3MILA 3B12A 3OU6A 3QXSA 1PLJA 5K1ZA 3UIEA 2XB2A 3I9LA 3MWDB 2GCOA 3BD9A 3DMTC 2ZIXA 3EHDA 2O5RA 1IUNA 4XWGA 3TTUA 4R8HA 5K2OA 4OI2A 4ON0A 4FJ0A 2WUFA 2XKBA 5G0VA 3WQSB 1X80B 3LLUA 2VEDA 3D1VA 3FETA 3HDHA 3QPTA 3UGQA 4GO1A 1N8KA 3Q0EA 4LE1A 3GPBA 4YRIA 1AVTA 1ADCA 1DADA 1NUQA 4LDQA 2B37A 5L95A 4D4JA 1OE0A 1GG2A 2XA9A 3JQEA 4Q1EA 4EX6A 2JFXA 5F1JA 5CXXA 2NU8A 1XXHB 4TTAA 2WNIA 4TLDA 2UZ1A 1C3XA 1OFHA 4GKVA 4OGLA 4ETNA 1VIYA 4WZZA 3N2GA 1M76A 1JKOC 3CW2A 3R4KA 3FBGA 4YRDA 3H2SA 4M54A 1V8FA 3STUA 4YMSA 4OOEA 2C7OA 1Y7HA 1SFRA 4XWYA 4B5KA 1QO0D 4MW6A 5HCUA 1X19A 2Q6KA 1S4MA 3BH0A 2JGJA 2CU7A 1ABFA 1AUVA 3U1BA 3TDUC 1G9XA 1U7HA 2O2SA 2CQKA 4L85A 3OZRA 2Q99A 4PAOA 2B6NA 2X1EA 3BZCA 2F5DA 1WCXA 2I1VB 1Y8RA 3C6XA 4Q9HA 1W0JA 3KT6A 1AMOA 5IT0A 2ZYGA 1CQJA 1EFHA 2P90A 4WGGA 1RCUA 1SUIA 5IDXA 5LIPA 3EFOA 2GD0A 4LYJA 2IYZA 5CTJA 1LFBA 3OYFA 3PQ3A 4Q34A 3L3BA 4B34A 4OMFG 2M2IA 1T6NA 3UK1A 3MMYB 2EBWA 3PEYA 1M1YE 3KFLA 4DDKA 1ML4A 4Y13A 3OCWA 4P22A 4S1NA 1XQXA 5IT9K 3FYDA 2GPTA 3IRQA 2DH5A 3C5HA 1BA5A 5DGIA 4U7HA 1UDAA 4ESHA 3L2WA 3BDDA 3OPXA 4QPDA 3BQZA 3KOOA 3ZXXA 2W8ZA 3JVUA 3J7AO 1Z0FA 2R1TB 3B85A 4FILA 5F9FA 2E2LA 5BOVA 2X1DA 3D7LA 4WK2B 1VYVA 2BGJA 2IU6A 1UBKS 2JKVA 3AL3A 5DGTA 2ZSIA 1FRQA 2H5LA 2HDHA 2EFNA 2G09A 1DBIA 2WLSA 4FX2A 5DI9A 3VMMA 1Z12A 4FFWA 3C3DA 5LMZA 3GEEA 1BEZA 4OQYA 1QV9A 4E6EA 2KW5A 2QRJA 3NWBA 4RA2A 1R0XA 2WMOB 5DCYA 4YONB 5C9ZA 3CVYA 1HNZB 1KH1A 1Z9BA 3M5WA 1MJGM 2X1HA 4XORA 3WG9A 2VJAA 4WBNB 4RSMA 4YRBA 1ZCBA 4J3FA 3WLTA 5IM4A 2P6PA 1W5BA 2FRHA 3F3YA 3S15J 3CF5F 1FU4A 4OBWA 4P32A 3SHWA 3IAFA 1K0FA 2R4QA 4ZVUA 2XAHA 1ACJA 3CWQA 1XCVA 5F2EA 4JI6B 4ZAYA 1JUDA 5G1OA 3EVAA 3VR5H 4HRXA 2EWVA 3GCGA 1U65A 2WLTA 3KPYA 3FNEA 1GGFA 2CDCA 2J46A 4N8DA 3P9IA 1JJBA 2W2TA 3NKLA 5JQGF 4J6FA 3K8ZA 2V4JC 2YV5A 4LF5B 2YSRA 1J0DA 1UP4A 1KKUA 2VP9A 3KZKA 4ZVTA 3GNLA 3LF1A 1Y56A 1HBXG 1EFRD 1IBCA 1U2DC 2PA0A 3GZJA 1S3SA 3L77A 1SC6A 1EFCA 2G08A 4R8VA 4XFJA 4CTMA 4ZMSA 1GUBA 5EAIA 3D5LA 1U0GA 3MVPA 4RD6A 3S2FA 1MO6A 1SKBA 2H9YA 5J4LA 1EMSA 2QZ8A 1U80A 1VL2A 2BMWA 1YS2X 2QR2A 4RVFA 4JLJA 5TQ2A 4YHHB 3I64A 2C6YA 1YT5A 2DECA 2XDAA 3CC2I 1L9KA 2EWWA 1MEEA 5ADUS 2MSCB 5FI3A 2V9PA 1GZHB 2KBEA 4AYBN 2AN5A 2H48A 3MFQA 3TFQA 1L0OC 4CM1A 1R5JA 2YY6A 4JKYA 4YIKA 3SI7A 3ADDA 1RR6A 3M6XA 2X0DA 2I55A 2CWEA 4XKBA 1HCRA 1DE0A 4WKOA 2C0PA 4G6DA 4BN5A 4NC6A 1N2GA 2G63A 4BNGA 2HDDA 4IFIA 3ZJ5A 5EZYA 3EXG1 4KDPA 1KU7A 4ON9A 4G5GA 4LLGF 3DNPA 1Y7PA 4BNXA 1XCMA 3IFSA 4MLDA 1DPGA 2VZ0A 2W5UA 4K40A 4GGPA 1O77A 3P52A 4C20A 2Y1DA 3GX4X 2CL5A 1TQMA 1FQWA 2ZRPA 5CKTA 1KQNA 5U4QA 4G81A 2H4JA 4H2DA 5EHXA 2HWXA 2ILVA 4H27A 2C4VA 4NJMB 5HJ7A 4EI9A 2MYNA 2DP4E 2G5PA 2JLSA 4Q9JA 5CD9A 3U5TA 4JNKA 1PEKE 2CV0A 2XMDA 5CX4A 1ODCA 3MSCA 1D4ZA 3T7EA 1LPMA 3CX3A 3GDWA 4UHJA 4F2WA 3DPLC 1OI3A 1I3QJ 2VSYA 1UQUA 2VDKB 2KHMA 2BGRA 1SGWA 3IUSA 3ITKA 4JBXA 2WY7Q 4NU6A 4CVNA 1SUSA 1Y81A 3AX6A 5FKJA 5LHHA 2H4HA 3BF7A 3M6FA 4LXHA 3RIGA 3SOZA 1OTXA 4NSNA 3AU9A 3WGOA 4HDSB 2LDXA 1CGPA 2VG8A 1KF0A 3PUHA 3B5EA 4IRXA 1QE5A 4I9HA 2CYCA 3PR2B 4TSFD 1CNMA 2Z5VA 5F9MA 4WZBE 5I7AA 2BZTA 1YQAA 3KYDB 2B3TA 2JHPA 3D4NA 4U7PB 4CI0B 3BXEA 3RS0A 2PLQA 3TLMA 1U90A 3PGMA 3TO7A 4W1RA 1E4VA 4BQQA 2VF4X 4ISBA 1ECBA 1YJBA 3OOUA 2AX3A 5DZSA 5BQ3A 4HEA6 2KRCA 3FDYA 2BL4A 1FEZA 2O0JA 4OUDA 3PC4A 4GYIA 5J1RA 2FCRA 1QYRA 2XXJA 3NOQA 1XAGA 1QVTA 3W77A 3PXEA 2XD9A 1MOQA 2HX1A 4BMXA 4DJDC 1SUDA 4JUBA 3E5NA 4FR5A 1JEYA 3FOZA 1K4SA 4MNTA 4MRSA 4PO1A 5IMSA 3EMBA 4ASUD 4OHKA 1USUA 2GT1A 3VTKA 3CJRA 4ZAZA 3RS5A 3FIJA 2XZDA 2BEOA 3WA6A 4LV5B 2JK3A 2EWNA 2Q49A 2F3SA 3BFVA 3I9OA 3UUEA 4EA8A 1AU7A 121PA 1ISMA 1DJLA 1OSNA 4KXVA 4URWR 2QD2A 1FTGA 1JHXA 1UPTA 1B8UA 2VDQB 3AUJB 4HQ6A 4IIBA 4TZKA 1QIKA 3JWPA 4UQPA 3OJCA 1Y5NA 1CIJA 3RF6A 3KAPA 2EX1A 3DAGA 4XJTA 4PRKA 5LXTF 1I1OA 1U0OC 4K2EA 2PGOA 3HCPA 3IKJA 4PE5B 5P21A 1YMUA 2ZMEA 3F6VA 2BKLA 2GEFA 3HZZA 1OPXA 4WDRA 4UY8I 1HKQA 3SVZA 4DHWA 4E5SA 3WA7A 3R09A 1EXWA 2ZB9A 1ZO8A 4NZ9A 1B0ZA 4Q93A 3WV4A 1TM3E 3CMYA 4RIIA 2BKVA 1JJAA 1MA0A 2ZTVA 2PS0A 3CNOA 4JLWA 4BGDA 2JFWA 2XYHA 4KPYA 3RS3A 4QDTA 2EOAA 5J63A 4D1YA 4OB6A 3GVCA 5EVJA 4N0BA 3FZYA 2QR3A 3CMMA 1UMCB 2QD1A 3C8ZA 2VIIA 5TVKA 1IZ9A 3VBEA 4A03A 1A4IA 4KPGA 4D4KA 2DYUA 3RJ9A 2W7NA 2GZSA 2HD4A 2XKAA 5AVZA 2GBYA 1NMEA 2J41A 1ZLKA 1JDVA 5KHDA 2ZTSA 4UZEA 3GF4A 4YRTA 1D7OA 4GYGA 3UMRA 1L5ZA 3EGCA 1QG4A 4G0PA 3K15A 4LJ7A 4HB2A 4NI5A 3SDZA 5J2TF 5DGHA 4EUFA 1BRTA 4GZ6A 5A1TA 5FD5A 2HMWA 3UB4A 4BFXA 3IIJA 3LA8A 4NBRA 4F4HA 2FWPA 3QELA 1JR3E 5JJBA 4ETSA 1E6CA 2OAGA 2MABA 4NMLA 4QBTA 6ABPA 1SBTA 3E2MA 3GGDA 3M4XA 4HY3A 2VA9A 2M9HA 3IV9A 1Q0UA 3VZCA 4J19A 1F9NA 3HXPA 3JAWB 3C1UA 1A7UA 1K3FA 3BORA 2J5KA 3FLAA 1U8XX 3VSLA 1YBAA 4G5XA 3H4VA 4LSZA 4ZIRB 1T36A 5E4TA 5HTOA 2O6GE 2IHTA 1BNCA 1KI2A 2PD6A 3L6RA 3HJHA 4Q16A 1JIIA 4BFCA 4CQMD 2YMPA 4B3RB 1XD2A 4X94A 3L0PA 4EQ6B 4AW9A 3PR1A 3BGVA 4LBZA 3GLIA 3PL8A 1PTJC 1KVRA 2JS7A 2PZEA 2ZJBA 3HGTA 1WB6A 4YRAA 5BSKA 5CFZA 3HNOA 3R7WA 5IG2A 1EK0A 3P9YA 3IUJA 2MSNA 2BFFA 3F3MA 5HE8A 1L5VA 1TTHA 1U7WA 4BHTA 2A8YA 4PTYA 1DKRA 2QN8A 3PDIB 3LUFA 4O02B 5K8IA 1R5OA 1GQ2A 1U2ZA 1VCHA 3MIZA 2V6IA 3GAAA 1A77A 4MQEB 4ENWA 2VDPB 5D6EA 3JTGA 1Z8NA 4NHOA 3BG7A 5GTHC 4KFRA 5FADA 1CZNA 3CX8A 5C3UA 3G9XA 5CFNA 2RJOA 1PJ8A 4GH5A 1EEXB 2BEVB 4MW7A 4RKYA 3ZKWB 4HSRA 4PAQA 3O3NB 4OJQA 4YCCA 4MQEA 3B02A 4BGVA 4FX0A 1ZUIA 4MV9A 2RIRA 5KNBH 5HP4A 4R2HA 1J21A 5T8KA 4ZHQB 2ZQZA 2YYZA 1YL6A 2CLDX 1KJNA 4AWXB 3BMCA 5A06A 2ZO4A 3KTAA 3FHJA 1JSXA 4GM0A 4Q4HB 3IR5A 1OXKB 4UUTA 3IPCA 3I54A 1P81A 3EFHA 4BJTA 3QZUA 4FNAA 3M0EA 4BNTA 4D3FA 5T7BA 2M1ZA 3EAQA 3W9BA 4E15A 5BSRA 4YLYA 2DM6A 2ODNA 5JLWA 4I2OA 1JGTA 1XK6A 1GO2A 1XNGA 2A35A 4MQFA 3W6NA 5G02A 4MDEA 2L17A 5AVKA 3RUCA 4AQYB 3ZD7A 2ODQA 1WHSA 1W2GA 1B4DA 1PYVA 1J1ZA 1IK6A 4KKVA 3ZHRA 3H1BA 5ALWA 3UH1A 3K3PA 1E89A 5EJAA 2XRFA 2KIUA 1XDZA 4HAOA 3SK0A 3SIPA 5KOHA 3WMWA 2M2EA 2QGUA 2RGXA 4MTCA 2R7FA 4OQNA 1BHQ1 1CQIA 4BWYA 1Y80A 3FGPA 1D2MA 4R5MA 2R8ZA 1YJ9I 2HJGA 1ZSYA 3K1YA 4Y67A 3HOSA 1XDDA 1CDEA 1R15A 1A36A 2PKWA 2A5FA 4R1NA 1EWRA 3FPSA 3KL2A 3ADKA 2HSWA 3OMWA 3NZEA 5J4VA 1L4EA 1OYWA 2CZCA 2JFZA 1EIZA 3LSHA 2F4MB 4CA0A 2GPNA 2QXYA 3RSLA 5LMCA 5LP6F 3DPSA 1OTHA 2IF2A 3DO5A 5DTIA 1E5TA 3R74A 2IDJA 4B4DA 1VMIA 1Y6JA 3U39A 3TL3A 1LDEA 1HT1E 4UVCA 1M67A 3WKDA 1JR6A 2VCYA 4P4GA 2C9ZA 3OTWA 3TDNA 3ZVRA 3EZXA 5T64A 2O7NA 4D3SA 3O4JA 3RRZA 4J0GA 3CLTD 4GQBA 3SQDA 1QRUA 3OZVA 3GT4A 3CRQA 1TCAA 4CQMA 4OG2A 5CIQA 1FPQA 5AR1A 4B3TB 1ISRA 1XTVA 2GO7A 3TTYA 4GOJA 4A0SA 1UFOA 2NYXA 1Z77A 2Q5OA 2VJPA 2GJ9A 4I1IA 3UFXB 3WRXA 2G72A 5EWMA 4C9BA 1NDQA 1WMSA 2QVOA 1HL3A 5FL7D 1W4RA 3TQHA 2Y9MB 4AG6A 1XLUA 1T8IA 3K4MA 2B1RA 2C78A 2HK7A 2QUAA 3BMCB 2GXAA 1J24A 1W1UA 5AJVB 1YBHA 2ZSDA 1YF3A 4DHEA 3LFTA 2ZRIA 7MDHA 4KISA 4MVJG 4A6EA 1KI6B 3ESYA 3BFXA 3Q15C 5B1HA 2I6UA 1BVRA 5FHRA 5JRJA 2H8GA 1J0AA 5MGNA 4A82A 2GK3A 1OYIA 1OZGA 1Z7GA 4DZRA 5E3MA 2QRUA 2QRHA 1Y34E 4FWIB 5GP1A 3RVNA 2FX0A 3TB6A 3N0RA 4Z54A 3CVVA 2RKWA 4N49A 4HUTA 5KYTA 3WL8A 5GQSA 3K92A 3W9UA 2OQGA 2JA6J 1BXGA 3W7AA 5TPZD 2Q4BA 1NYRA 2V5VA 1QG0A 1M1NB 2ZJ4A 4RFSB 2CBZA 2WV9A 3FWZA 1FNMA 3N39C 4FBMA 1OV4A 2QAGC 4ESEA 3CKLA 2JLWA 2O8FA 1GDDA 4ZJYA 1G6Q1 3F8MA 4ABZA 2OZLB 1AGRA 2ZJ3A 3CNBA 3SQMA 4IQJA 1P1IA 2CK3A 4XVCA 2FJ1A 1QGAA 1YB6A 3PI7A 1TE2A 3GVIA 1N9GB 4KRXA 1QS0B 5DT9A 5HDBB 2PPVA 5BQOA 1QBJA 2IYWA 4ER6A 3ZN0A 2PSHA 3IPAA 3OAAD 4QGFA 1AF4A 5AJYA 5EG5A 4A5NA 1LNQA 3EB9A 2NACA 1FSHA 2F8MA 1U5TA 3GFJA 2JW5A 2P0YA 2XMZA 3FKQA 4FQ8A 1Z4JA 5GGXA 5ITWA 1G2PA 4Q3EA 5J2UA 1JEQA 2JIBA 1ZG3A 1KS9A 2R9VA 3OUTA 2BOLA 1W48A 2BR4A 2IDKA 2WFZA 3DHEA 4GYYA 4M53A 4J0QA 4B09A 2QA4I 1AKNA 1GPLA 1NW9B 3G9QA 3KVNA 4QYXA 2NZ2A 4U2DA 1GZSA 4BPRA 4M87A 1ZD3A 1YRNA 1X7ZB 5HTKA 4HPQA 2Y4NA 4B45A 4EJUA 1G7SA 1MZBA 1R7JA 1ZLXA 4BN4A 4C2AA 2QUKA 3NUQA 4ES6A 1E1CB 1R50A 2XAUA 1W1WA 3WU1B 2YJ3A 4G5SA 4Q7QA 3VKUA 5IJ0A 4EHNA 1KQ8A 1Y9EA 2A5YB 2OTCA 1COZA 3FMGA 1U7ZA 2O6HA 3VC7A 1GU0A 1Y3IA 2P1RA 3NRBA 1JXSA 2UUOA 3GJ7A 4HWOA 4KQFA 4M7WA 2ZVPX 1NF3A 2IFTA 2ORVA 3C8DA 4MW9A 5LB2A 5LQMA 3BDVA 3HA7A 3CUKA 1K92A 4QREA 1B0PA 2XB0X 4XIIA 3GZ5A 3UKJA 3HWWA 1Q6YA 2EFYA 2FETA 2Q2EB 3NGXA 4F4JA 2R7DA 1MV8A 1X9IA 2D5CA 3ZHXA 2CJWB 5JJLA 3BWBA 3GBSA 5A4IS 3LDUA 1K7XB 4KP7A 1EZZA 3ORYA 3OS1A 4HBGA 4CCYB 2RBEA 4KFTA 4X8MA 1OOEA 1UZAA 1RMYA 2XECA 1Z2NX 4RSRA 3ECSA 3AR7A 2HBYA 2Y1WA 1NYLA 4BY7J 3KRTA 1K6EA 1WXIA 1OCCH 1UMBA 1W2WB 2DQZA 2VL7A 4G41A 2OV6A 5MFZA 4D2IA 2H51A 2OXFA 1Q44A 4BY1J 1YW7A 1DPUA 2YWEA 1RIIA 3AIMA 4U7BA 1NXTA 3EOZA 1OYOA 5CB4F 1EP2B 4C6TA 5A2QZ 2Y76A 1ETQA 3ER8A 3STWA 4TWIA 1TA9A 4QODA 3FPAA 2F17A 2IHBA 2CRGA 1IQRA 2VT2A 3OIPA 4KLRA 5ELMA 4OAPA 2DDBA 2OP0A 1NVTA 1R6TA 2ZRLA 3WMXA 3TTVA 4ARZB 3L01A 4FFPA 1GUZA 4RZXA 4TKUA 1Y89A 5EMJA 4EDHA 3I8SA 4E94A 1LRJA 4EGSA 1J8FA 1TZBA 5LQDA 1DWOA 2CGEA 4A5OA 1YRLA 3BK2A 4PQGA 4ZVSA 3QKSB 1B8OA 2IH2A 4QLCU 1YO6A 3GD7A 4PIPA 4WNAB 4GP7A 3I2IA 3KYCB 2PBRA 4HWTA 4MW0A 1B2RA 3J7ZI 2KLBA 1IHYA 1U99A 3AWDA 1YS6A 1JJ8C 3OURA 4YN3A 5IANA 3CU5A 2BJHA 2IYFA 3D4BA 3P9QA 5BYBA 1JYEA 2QVGA 4QRDA 3EOBI 4LZAA 5DLDA 4ZU1X 4P54A 2CFCA 2YQ5A 4N4AA 4MEYF 2GAAA 3ZMTA 1DP7P 2R7XA 2I6XA 3LK7A 4B3MB 1GA4A 4NXMB 4A12A 2FW1A 2OV4A 2P7HA 4L57A 5JEEA 1JE0A 1NYQA 4FYMA 1LDNA 2I5PO 2JGAA 2E5LB 5AVOA <