3N05A

Crystal structure of nh3-dependent nad+ synthetase from streptomyces avermitilis
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
584
structure length
568
Chain Sequence
SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Nh3-Dependent Nad+ Synthetase from Streptomyces Avermitilis
rcsb
source organism Streptomyces avermitilis
molecule tags Ligase
molecule keywords NH(3)-dependent NAD(+) synthetase
total genus 188
structure length 568
sequence length 584
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00795 CN_hydrolase Carbon-nitrogen hydrolase
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3n05A03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3n05A02
3.60.110.10 Alpha Beta 4-Layer Sandwich Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase Carbon-nitrogen hydrolase 3n05A01
5LM3A 1K4KA 4IZVA 3H97A 2PG3A 3H9CA 1QRSA 3INNA 2QTMA 1O5TA 4KKVA 4JFAA 1OD6A 1EE1A 1ULHA 3IVCA 1TFUA 2PZBA 3P0JA 1MC1A 3ZXSA 5JQNA 4R2MA 3MMXA 1O95D 4YP5A 1ZUNA 1NZJA 4MVYA 5K0SA 3FY4A 2V0CA 1OWNA 1WY5A 5JBNA 4EG7A 1EUQA 3ILVA 2CYCA 3RFFA 2X1MA 3QE4A 1EFVA 3E27A 1YUMA 3A05A 3TQOA 3CLSD 4ZT2A 4X0EA 4EG8A 4IZWA 1T6ZA 1N2BA 3LOQA 1MB9A 2DPLA 2VTBB 2E2KA 1LW7A 1Y42X 2Z3VA 4OUDA 3RHSA 1NUPA 1NP7A 4ZCQA 4U7JA 4DNXA 1KAMA 1N2HA 3MUEA 4LF0A 1MAUA 4DDMA 2ZUEA 1F7VA 1YIDA 3CVUA 4TS1A 3ND6A 4MWCA 1FO6A 4MUIA 4FZJA 2H29A 1GTSA 1G59A 1P7PA 1QNFA 4K0RA 4JXXA 3VU8A 1KQNA 3N8HA 3CVXA 2CV2A 4MAFA 3SEQA 2XRYA 1OWLA 2C5SA 2A84A 1OWPA 2J4DA 1IRXA 2DXIA 4ARCA 1R6UA 1IQ0A 1QU2A 3IVZA 1H3NA 3AIIA 3KT0A 3P8KA 1MOPA 2ZP1A 3A04A 1F9AA 1KORA 2HMAA 3D6UA 3FI0A 1N2IA 2WSIA 3CLSC 4OUDB 1GPMA 3UK2A 4MUKA 3SZGA 2E0IA 5J5AA 3CVWA 4U8HA 1X6VA 4YP6A 4HJRA 3SDBA 2PFSA 4MUGA 2WQ7A 1WXFA 3P0IA 4JXZA 2J08A 4MW4A 1J09A 3KFLA 1BS2A 4NZPA 3QTBA 2WB2A 3FIUA 4EG4A 1SURA 4F4HA 3VGJA 3SP1A 4HGDA 3S3TA 3IOCA 3IODA 2QJOA 1PFYA 1WXGA 2A1UA 1IFXA 1V47A 4NAUA 2E11A 5DASA 4KPUA 2DEUA 1TYCA 3SEZA 3LCJA 4U63A 4ZT4A 3KI8A 2Z08A 4RUKA 3RK0A 2DERA 3ZGZA 1KH3A 3HV0A 1IH8A 4I6GA 1QU3A 4PY2A 1U3DA 1LI5A 1EMSA 2YWBA 2E21A 5HUHA 2IP1A 1TYAE 1QTQA 2CYAA 5LLTA 2DETA 4QBTA 4DJAA 1RQGA 1NSYA 1N2EA 4I6JA 2PXHA 4CQNA 4GYLA 3PNYA 1R6XA 2TS1A 4H5UA 1O96B 4KR7A 2RE8A 1YULA 4DDKA 3AG5A 4XFJA 2EJCA 1V8FA 1TYBE 1OWMA 5FNZA 4J76A 4ZCSA 3DO8A 3CR8A 4WSOA 1UF8A 1UF5A 1T6XA 4ND6A 3D6VA 1CT9A 3QTTA 3H99A 4I6EA 3X1JA 2QUIA 2BYTA 3L93A 3CVYA 3IMEA 1OBHA 1VBMA 4MW1A 2DLCX 2X0KA 1Q19A 1I6KA 2YY5A 3IUEA 4EGAA 3IOBA 1K97A 5DB4A 4DE5A 4OJMX 1NUUA 4ZCRA 1VBKA 1VL2A 4CDMA 1J1ZA 3IMCA 1B6TA 1I2DA 5DEOA 3UOWA 4AS1A 4PBRA 1XNJA 4MVCA 5F23A 4UZFA 4MW7A 4UZEA 5H8IA 4HG5A 4IZUA 5AHWA 3FG9A 5HG0A 3H05A 2HGZA 3ELBA 1JIIA 2H2AA 5IJXA 1OWOA 4K03A 4ZT5A 2JAXA 3FNRA 1ZH6A 3COWA 1O94C 2PZAA 1EFVB 1FFYA 1GN8A 4MVXA 1NUSA 4EG3A 1JGTA 2EL7A 3K32A 5TGTA 3MXTA 3IOEA 4ZT7A 2I1LA 4RPIA 3SYTA 1M8PA 1TEZA 4NDAA 2CV1A 3NV7A 2V0GA 4JZYA 2E89A 5TEWA 3AKZA 1GZUA 1WKBA 1R6TA 3IMGA 2CYBA 3M5WA 2J07A 1IQRA 3FETA 4MUNA 2AKEA 4GU5A 4NX2A 1O96A 1JZSA 4MWBA 1VBNA 3Q4GA 1WQ3A 1UF7A 1JEDA 5EKDA 5K0TA 2DR2A 1Q77A 3N05A 4HG3A 2CFOA 1ZJWA 1J31A 4MW0A 1M8FA 4P2BA 2QUHA 4EFKA 2W1VA 1NUQA 4JYZA 3GUZA 3FH0A 1HYBA 4NAHA 2E2LA 3VRHA 3RK1A 5FO1A 1PFVA 1X8XA 2A1TR 4MW5A 2J5BA 4MVWA 1H3FA 4R2LA 2A4MA 3PRHA 3NBKA 3BL5A 1Q11A 3CLRC 4KPUB 3X1MA 3N2YA 1MJHA 1A8HA 4MLPA 3DV2A 1N78A 3LE8A 1D2RA 5H8LA 3HMQA 1JIJA 1I6LA 2JANA 1OBCA 1KH2A 1N2GA 1U7XA 2D5BA 3FOCA 3H9BA 4CT0A 1EXDA 3CLRD 3RBAA 3P52A 3A2KA 2PIDA 3DPIA 4HPWA 1GAXA 1KR2A 1XJQA 4YBRA 4GRIA 2AG6A 3GMIA 1K92A 1N2JA 2D13A 3PNBA 2AZXA 4F3RA 3ZJUA 2CT8A 3F3MA 2RD2A 1ZH0A 1F7UA 4AQ7A 2GGLA 4ZCPA 4L2IA 5J58A 1QQTA 1IHOA 3IH5A 4EG6A 3L92A 3IDFA 2UXYA 1LI7A 3ZIUA 3UMVA 1O95C 1M8GA 1O0CA 5TEVA 3UY4A 3TNJA 1O6BA 2O8VA 4XFDA 4CDNA 1EUYA 4QRDA 1GTRA 1XNHA 1JIKA 1MRZA 1QRUA 1ILEA 3KT8A 2QUJA 3MLAA 1NURA 4ZCTA 1EJ2A 1PFWA 3JXEA 4MUJA 4ZT3A 1WXHA 3IVXA 4MUHA 4ND7A 1M8JA 2XRZA 4G5FA 5H7XA 5LFAA 2DYUA 3TQIA 1N1DA 2GKSA 1NYLA 3HZRA 2G36A 3KT3A 3A4IA 2NSYA 4QREA 2O5RA 2OV4A 4A91A 4DDHA 4KR6A 1MB2A 3HL4A 1N2OA 1DNPA 3CLUD 2A88A 2R5WA 1WZ2A 4EF6A 1T6YA 4EG1A 1KP3A 3I05A 1M1ZA 2X1LA 1O94D 4WNYA 1J20A 1G8GA 4PBSA 3CVVA 2VHIA 3IUBA 1PG2A 1G8HA 4XSVA 1K4MA 5H8KA 2CV0A 3ZJVA 4NATA 2IJGX 3FDXA 2QJTA 2IELA 1YIAA 1XNGA 3P0HA 4GYNA 1M83A 3Q10A 1N77A 1COZA 4BWVA 3ND7A 4CYGA 5HUJA 2VTBA 2A1UB 3CLTD 5IHXA 1WJGA 4MW2A 4CYYA 3COYA 5KHAA 1T9GR 3KLCA 4MUEA 2CUZA 3G5AA 1PFUA 1KKUA 4ZT6A 1H1TA 3DLAA 4KR9A 3AFHA 3FWKA 1UF4A 1JHDA 2NZ2A 1QJCA 5TS2A 2BTEA 2OQ2A 2QTNA 4EG5A 1O97D 4Q16A 1ERZA 3ZXIA 3KT6A 1U7DA 1JILA 1IVSA 3WUYA 4MW9A 4MQ6A 3TS1A 2YXNA 1G8FA 5H8JA 3HFJA 4G6ZA 2ZUFA 2VXOA 3ISJA 1S4MA 2GM3A 1FYDA 3CLUC 4YP7A 4G5YA 1UFVA 2E18A 3U1VA 1TYDE 2Z09A 1N3LA 5J59A 1N75A 4PBTA 1JMVA 1I6MA 2DUMA 3PXUA 4MW6A 3ZJTA 4Q93A 1J1UA 1NI5A 3K9WA 2QJFA 1H3EA 4KZFA 1GLNA 4HJXA 4L2IB 3IW3A 1VLHA 4IZSA 4MWEA 1EFPA 3G6KA 3UC5A 4R0NA 2HZ7A 1M8KA 5DK4A 2YWCA 3HKXA 2A7XA 4MUFA 3RJZA 1MAWA 4DLPA 2VHHA 1YUNA 2QTRA 3COVA 1JEEA 2PZ8A 1Q15A 1IQUA 1JECA 2X3FA 3AG6A 2WQ6A 2J09A 1T9GS 2JA2A 3GLVA 3CLTC 1KQOA 2DYVA 2GOYA 3G59A 3OP1A 1J21A 1WXIA 1KAQA 1KQPA 1TQ8A 1U0BB 4E1AA 1KP2A 3CA8A 2GGKA 2A1TS 3ZUGA 3ND5A 4YMIA 1QRTA 3AL0C 4ARIA 2D54A 1WXEA 4HK4A 5H16A 1F89A 2PLQA 1MBZA 4H3SA 3PNVA 4MULA 1U3CA 3IVGA 3FHJA 3HGMA 4IZTA 3Q12A 3NBAA 1PG0A 5KCMA 3COZA 3N9IA 1O97C 2B7LA 2A86A 1EFPB 5FO0A 3MLBA 3TZEA 1KH1A 4CYFA 4J75A 3X1KA 3TZLA 5KWVA 1WQ4A 1NUTA 1F4LA 2CSXA 2QUKA 4S1OA 1JZQA 3C8ZA 3OTWA 3SZ3A 1O0BA 5BNZA 1WOYA 1YI8A 4MWDA 1J70A
chains in the Genus database with same CATH superfamily
2GM4A 3HOUJ 2P2NA 2W6ZA 2WTMA 3K8ZA 3WLFA 4D02A 4DC1A 5E1OA 1EI9A 2J6HA 5F04A 1XVIA 1O5TA 4LVCA 3WL8A 1VP9A 2IF0A 2OCDA 2ZEJA 4JFAA 1EE1A 5BT9A 3TUIC 1SCJA 4JASB 4XJVA 4Q01A 3BHNA 2XCLA 3J80K 3I1JA 4FIZA 4LPSA 2RV8A 4R8HA 1E2NA 5TISC 1XE3A 3AB3A 3MMXA 3NEJA 4R83A 5ICEA 3MT9A 4X00A 2HXSA 4YP5A 1NZJA 5DSTA 5ILQA 5KC8A 3JRHA 1VHJA 4O1IA 3T61A 2OCGA 1N57A 3WIEA 3DT9A 4Y9RA 5SYMA 3ZD6A 2C7VA 3ZQUA 2P9EA 5IT5A 2W5UA 5E18F 4I14A 4R7ZA 1QP0A 1RACA 2VP9A 2ACWA 4D0SA 4F3YA 3RWBA 3KKMA 3QF7A 3J81K 1OCOH 4MLCA 5FOXA 4PWZA 2HF9A 1Z6QA 3ITDA 4I5IA 4OAYA 4BNJA 4GECA 2LP0A 4P3PA 2B0CA 4OYRA 1J7KA 4PU0A 3D81A 1QCZA 4EUSA 1RADA 4X7RA 2ZREA 4HAVA 3BE6A 4YMTA 4LB6B 3ROKA 3JAWA 3U7FB 2AMFA 4YEDA 3PJEA 2H17A 4UHFA 1T2CA 1NHAA 3Q3SA 2EYQA 3PFGA 3RK4A 4IV0A 4OB8A 3SDGA 2PLNA 2EZKA 3I54A 3PFNA 5I8ZA 3RHSA 1VDZA 2W7TA 1ZRSA 4PGMA 2A58A 4Z5XA 4DZJA 3G13A 4CMIB 4PZCA 4P3KA 4EX7A 3I5MA 4HDUA 2AYXA 3DC7A 3A2NA 5EUMA 3G2BA 1BI3A 1ZI6A 3SE7A 2ERCA 2C3UA 4FEAA 3FX3A 2F8LA 5U9CA 3KIOA 1DUVG 4BFUA 4D92A 5C3EJ 2QSZA 2ARKA 1ENHA 1XI2A 4DDMA 5LMUB 2ZSIA 4O2AF 4I1RA 1Y56A 3M4YA 4TS1A 1IK4A 5TB5A 2X6QA 1XDSA 4ODIA 5CH3A 5LNK6 2UZAA 4A0ZA 2ZIVB 2P6RA 1KZYC 3MM4A 5CW1A 5B5SA 1Q1NA 3GQVA 5DLYA 1IRZA 1VL6A 4MVJG 4E6KG 3WTWC 3IAXA 4DAEA 5B1DA 2R7OA 2NZWA 4HW0A 2O4CA 2HVQA 1JYFA 3HKEB 1OWLA 3K72B 3KV1A 4AVZA 2R2AA 2RHRA 3PRJA 3QVSA 4V02A 1OR8A 1C7FA 1R5ID 3S32A 3CM0A 4MXDA 1ZHOA 3UGTA 1YWGO 3C6KA 2X41A 3MAGA 2RONA 3AFMA 4EHBA 1VQMI 2DXIA 2JVJA 2VJNA 3IJRA 2I4MA 3ZHQA 4ZJUA 2JVHA 2HMSA 1M54A 2PUGA 1PHRA 3HXKA 2KRCA 3CJRB 1PZMA 4B2YA 2OAGA 4LGCA 2WWGA 3USCS 1U8XX 1ZDMA 1CJVC 3ZV6A 2A69F 4URXR 4M0DA 3RUHA 1ABBA 4BE9A 2XBLA 1B72B 1U8AA 3DAGA 4YIKA 5BNFA 4EOGA 4ENUA 4YRIA 2ORWA 1MG5A 4MGEA 3U3JA 1P1RA 3WNCA 5EEGA 2CMHA 4NU5A 4Q3CA 1WWKA 5HW0A 1EFHA 2A0XA 4WKBA 3SQXA 2CGPA 1YRNA 1XC7A 2HWWA 4O08A 2HNHA 2X6WA 3DB2A 3ROGA 1Q92A 4M0MA 4PUSA 2VOOA 2R0QC 1GZHB 4YRJA 4MHGA 2AC2A 4E51A 2IEZA 5I9MA 2RGWA 2WA1A 5D5PA 4HPXB 2NT3A 3W5BA 4J7CA 3UHAA 3PB3A 2VBZA 1FXUA 5AVYA 2XNJA 4HMOA 4WESB 1A50B 5AOVA 3RFUA 1K7XB 4TV9B 1AGRA 3UJHA 2X58A 2PVPA 4L73A 4LW8A 1MDFA 1D07A 1QH1B 3DSRA 4KC0A 2BCJQ 3CUQB 2OFPA 1CZOA 3MEXA 1VYHA 2AR9A 3AFIA 4E3WA 5BSVA 1K7SN 1YONA 4QFBA 2IH5A 1E2UA 4HZUA 2JT1A 2GA8A 4HLXA 1ZMXA 4EK9A 5DM70 2HRQA 2XMZA 4LJ4A 4BIIA 4KPUA 2R93J 3C97A 3ZHYA 3DWLE 3ZHUA 1F2VA 3FJ1A 1LJ9A 5AM4A 3SEZA 4HX4A 4O3MA 2R6CA 3EEIA 3S3MA 4O0MA 4KIFA 1C4KA 2XDQB 4IXNA 1Y1SA 2LRDA 2CEAA 3RK0A 3LHKA 2JJ8A 4KN8A 3GRZA 5TGDA 4H1HA 2UXCB 3AHCA 3QQAA 3HU1A 1Y7HA 4QO8A 3WG9A 1OW3B 4A0QA 4A5OA 1CIVA 4P7FA 4XCVA 4ECAA 2W6JD 3KAQA 1NBMD 1KRXA 5JEEA 1W1WA 2UUZA 3HNPA 2ZI7A 1A1SA 2BFFA 3K30A 3KQTA 4IFTA 4KUEA 3RKSA 1JB9A 5LNK1 1ACJA 2XY4A 4RL6A 5TF0A 1T0FA 2PT6A 4XWAA 5I9IA 1MB0A 2PVSA 3KR2A 4GOLD 2IZ6A 4F04A 1FIAA 3AG2H 1F8GA 5EPEA 1NWCA 1FTSA 4H5UA 3P20A 5K3SA 1TF7A 3TFWA 3K71B 3I01A 3EDQA 3U39A 1FL9A 1T3LA 5CQGA 3Q3VA 4JY7A 1Y0UA 5BOXA 3ZMUA 1YRHA 2HT6A 1O95A 1PNOA 1H85A 2PA0A 2HWUA 3IAS1 4EA9A 3AONB 3W2AA 2HMWA 3UVEA 2YRFA 4YAGA 3VR4D 4NOKA 5CDSA 5AOBA 4XWWA 3AVXA 2PDAA 1FYKA 3UQYS 5BMZA 1R5GA 1W47A 1XKQA 2W2XA 4ZVMA 3AIKA 1F12A 4KX3A 4ROTA 1N3BA 3ONFA 3QVJA 4YNBA 2X0RA 5FD6A 4EGAA 1VGQA 2NUAA 3P1JA 2DPHA 3TXXA 4D97A 4DE5A 3UJ8A 1Q7GA 3F5QA 4F46A 2H11A 3HXQA 1YL7A 1J1ZA 4A5NA 2VJOA 4L8GA 4N8DA 5FX2A 3UOWA 4P0QB 1O8CA 1TX4B 3RKRA 2M2EA 2DJIA 3D54D 1CVIA 4MVCA 1W4CA 3BWXA 2QTWB 2QTCA 3IAFA 2EWVA 1M2KA 3K1JA 1VJCA 1WI3A 2NNNA 2X0IA 2H9AA 5F1JA 1O54A 5CA0A 4JUIA 4YDQA 4N7RA 2W2LA 5LA6F 2PBLA 4BJ5C 1Y89A 1RYZA 3QU4A 4IX7A 3OTQA 2QQAA 3H1PA 3HV2A 2GCOA 3MBIA 4BEJA 4ESOA 1Z2AA 4INPA 3VZRA 3IAS2 3O31A 4MLOA 2FEAA 3BWEA 3H19A 2COBA 1IDN1 2H6BA 2UV1A 1VSVA 1L3BA 3HJAA 1KERA 4LYFA 1BU5A 5DMXA 4EG3A 2LKDA 5GZ3A 2F5EA 2L01A 4UBKA 3FUVA 3JATA 5KYWB 3K1NA 2IDKA 3NFRA 2HFHA 3IP4B 1MO6A 4URYR 2OD2A 5EP4A 2H1FA 4N4NB 3A1YA 1UM8A 3I0MA 2HL6A 2Q0XA 1F5SA 4A3GJ 2VT6A 1J00A 3GUVA 4EO7A 2KS6A 2QTVA 4HAWA 3GX1A 3TI7A 5J2TA 4NBLA 3CUEF 4J0EA 1JR3A 4JLBA 5KQMA 1OH8A 1JVNA 5LLSA 4QDOA 4UC0A 2XNKA 4H6PA 5FNVA 4GOMD 3M5WA 2X13A 2XF7A 4ZTFA 1VJRA 4IH9A 4IZ6A 1UBKS 2GEDA 1XD7A 4NMXB 4RENA 1QC5A 2FZWA 2XUQA 3KSMA 1QOQB 4YRFA 2O06A 3V4GA 3ESAA 4WK6A 3L4JA 1S2LA 1O96A 2I4NA 3IOYA 4ARSA 1PR3A 4MYUA 3TW8A 4LDNA 2VBYA 1YFHA 1NY5A 2W6OA 5IDVA 4TKUB 1JA0A 4JJGA 3VBCA 3G88A 5C5EA 3GGGA 1J0BA 1XZFA 5D5VB 2QUHA 2XTNA 3QA9A 1A9RA 2C5BA 4JWKA 2Q27A 4MS3A 1H0MA 2CVQA 4LG0B 3B60A 5AR1A 4KXFB 2RK6A 3JYLA 4IP0A 4GH5A 4M0UA 2HS5A 1H9BA 4MMZB 4QPPA 3SQOA 3KNZA 4L57A 3RKYA 1I3NA 1DQRA 4WWHA 3UAGA 4YJ3A 2DFVA 3TM4A 3Q7TA 4HGQA 4ROSA 5FNVB 4F2GA 1C81A 1BEEA 3GT4A 1A8QA 5FDFA 4AS3A 4CMCA 2KIMA 3RAPR 2G70A 3GFVA 4M6WA 4DEXA 2PUAA 1O7JA 3F3XA 1E1CB 1TCUA 2E5WA 4H4KC 2ANBA 4D1YA 3OI7A 4B34A 10MHA 1D5WA 4Q4ZF 3BIJA 1RLUA 5JH7A 1KO5A 1OASA 5LQMA 3EDPA 1NW3A 2RC6A 4J1TA 1NG6A 4HLNA 2Y68A 1MHPA 2XB0X 3M1YA 1XTZA 1FTZA 2XGOA 2ZI9A 4GI5A 4JL6A 2YL2A 3VISA 1WKVA 4Z2AA 1DV2A 4CPDA 5EZYB 3LUJA 1KOLA 2FUG6 3FOCA 4ZD6A 5ICMA 3VEPA 4BRZA 4OMFG 2IBSA 3PQ4A 4EHKA 4GMHA 3DPIA 3QV2A 4HPWA 4I3FA 3RARA 3HBAA 1NVDA 4GGMX 1UMDA 5I48A 1Q6ZA 1C3OA 3NWSA 4WJZA 1Z13A 5T8KC 4LEIA 5ESDA 2JIRA 3GMIA 3IIMA 3VNBA 1LK7A 1P6UA 1VZ2A 2HPHA 4E5YA 1NVTA 2GEFA 3ZJUA 5KWJA 2XNSA 4FASD 1KDZA 2ZANA 4AJ9A 2C5GA 3QEBZ 1V4BA 1TM1E 3D4IA 4L4ZA 2Q2EA 3BZCA 5E8IA 3L7NA 5GM1A 3SHVA 3SY8A 3PNTA 2L02A 2W2KA 3RYPA 3T3OA 1FRZA 1JT6A 2ZUUA 3ET5A 2MABA 5JVTA 2LMDA 2FRDA 2PGLA 2FNPA 2XTZA 4EJWA 4F96A 1RQLA 3RDIA 1PIWA 3ZE6A 1A7UA 4Y7CA 1ZNQO 3GDGA 3UY4A 2ZJ5A 1Z26A 2R7FA 3NBFA 4LG3A 3RKUA 4HQKA 3OKAA 3O1JC 4IRHA 4G6DA 4KJXA 3H3FA 4OGFA 3U3DA 3FXLA 5K5OA 3TNYA 4PJMA 2W24A 4QECA 1LDYA 2Z83A 3SZOA 1TBXA 2ZYGA 3KT8A 3R7WB 4CL2A 3ZY3A 4UW9A 3K05A 3TZ6A 4B81A 1N6RA 2Q2EB 3ZOBA 2M87A 2IYUA 4J3NA 2DVMA 1X2EA 1ZRNA 3G5LA 3KG2A 3MJHA 2ZRJA 3WIUA 4M71A 2D59A 2J9YB 2PQMA 1QHFA 4E5SA 4K9LA 3OE1A 3G7SA 5FI3A 1VMKA 4LDZA 3CMCO 4OJYA 3HN2A 4E5KA 3KT3A 2ZQ5A 3GFBA 5FV4A 4TV9F 4GE0A 4XR4A 1V7QA 2ZRAA 1GA4A 5LSAA 4TQ9A 1AH2A 2WB1A 1BEZA 3AH8A 4IDAA 4WAUA 2FQ3A 1EA5A 4TQGA 2BMVA 2FBIA 2Y0CA 3I42A 4B3BA 4BKPA 3V6MA 1X7ZA 3R9XA 3G7UA 4Q5IA 1JE1A 4FDAA 4KT5C 4WNYA 3L7MA 1KDRA 4B47A 4XD7A 5JH7B 4CKXA 4EHNA 1CIJA 2J5OA 3QITA 1FUKA 3FLMA 4HB2A 3PYMA 1XN7A 5AI8A 1GQSA 3EEYA 2ELHA 1JSRA 1E79A 1JIUA 2GRUA 1WRJA 2PANA 4DLXA 1PK9A 4Q7MB 5IAGA 3ER9A 4C89A 4D6XA 3ZGNA 3KB1A 5KSPA 2AFIA 3WWYA 4IUBS 4OL0A 2C0QA 3CSSA 4B5KA 5BV0A 1BG6A 3JSPA 4D5CA 2EX0A 3G7NA 1IJFA 2HIMA 2VUHB 4NU8X 1KAHA 7REQA 2EDAA 2W37A 3GDHA 3TKLA 2QVOA 2DCEA 1HKSA 2C2XA 3HKCB 2DQRA 1ESNA 3HYTA 1IOWA 2HQRA 4LJZF 2W2QA 5LBTA 2QUZA 3V9AA 4DSTA 4ER0A 3N3AC 4DA6A 5EIFA 5B55A 4JOMA 5K1ZA 1RXIA 1UKBA 2R1VA 3HSSA 3FNBA 5EIWA 3ONNA 2XUPA 2PR2A 3U7QA 1E3LA 3CYFA 1BIAA 5K0LA 1OXXK 2DT8A 3BRQA 3SGLA 4HRVA 5K7SA 1T35A 4I4CA 1SBHA 3D7MA 4Q7KA 4E7LA 1NT2A 3G0GA 2DFLA 2HXIA 2XVAA 2V7BA 3HR8A 3RYTC 3U3RA 2VHIA 1ARZA 4O4IB 4WDQA 5G4LA 5CP8A 4D5EA 1A4XA 1N5DA 2NYRA 3O4JA 4OHOA 1Y3DE 2G09A 2B25A 4FFDA 2AQKA 5LQNA 4E5DA 1JPUA 5K4GA 2ODTX 4EM0B 2QS9A 2R5NA 3L0OA 4PBTA 1CRLA 4RK4A 5ALLA 4PZEA 1AC5A 3HDYA 4QBFA 3UV7A 2X6RA 3TINA 1F17A 2LKCA 3I6QA 3OZEA 4N03A 4PLHA 1IN1A 2E36A 3A01B 4IOJA 2AS5F 4Q00A 5JS6A 5F1KA 3VI3B 3CEAA 4EA7A 4L1KA 4XONA 3CCFA 3IW3A 1NQAO 2DBVO 2X6TA 4BBSJ 3MJTA 3H5TA 1EVIA 4XUGB 3CR7A 2VH1A 3I52A 2Q6TA 1NAIA 1VSQA 2PTGA 5KSWB 3AZQA 3KQSA 3VBEA 1GL3A 3FSGD 3ZTTA 4HUQB 4XGIA 1B7GO 4MGIR 4A15A 4DLPA 1SZDA 2BV3A 2YNMD 2D0DA 4Y7DA 5LMCA 1PRYA 2IHJA 1OREA 4UEQA 1G8AA 3SM3A 4B3JA 1RMYA 4CUZA 4KPYA 2AK2A 3O03A 1VFPA 2AN4A 2I34A 2QRZA 1E1KA 3K5HA 4MDYA 4QUKA 1ZNWA 4EJ0A 1KDPA 2FW7A 2J48A 2FDRA 3I34X 1ZGJA 1W1IA 1TLTA 1XCOA 5DDGA 3PUFA 1MQ9A 1SBZA 4KFTA 2DA5A 3SCZA 3DMPA 4E4YA 3NWOA 2C8LA 5B4UA 3EX7C 1QMPA 3CURA 1EFRA 1XDWA 2VHCA 4E1AA 2DH6A 3FPBA 5DEQA 1Z5ZA 2WKPA 4YRMA 4B7ZA 1I33A 1ZIOA 1U0SY 2X8AA 1J22A 3KXLA 3L1KA 1W5FA 1Y1WJ 5D3MA 5I4BA 3H1BA 3UA4A 3Q0VA 1SUBA 3EPKA 1XDBA 3ZHXA 4IHQA 1INLA 4JLKA 2ATEA 1PFQA 1U3CA 2PA3A 5JD6A 2F4VB 1H93A 2ZDQA 3IDQA 2C29D 4ZAFA 3S40A 3J80Z 3MKWB 3ZG6A 3RTGA 2OPBA 1RXEA 4OQNA 2H09A 4IIGA 3WIOA 3KCNA 3NM4A 3W04A 4JSTA 3ESZA 4OA8A 5LWHA 3H8JA 2WWXA 2WKSA 3HVRA 3UMYA 3TZBA 1A5AB 1L7BA 4AKHA 1CS4C 3Q0TA 3CCSI 1H6DA 3IUJA 5LB2A 4G85A 2V6EA 2XCUA 1LWOA 2HO5A 3S2HJ 2PGXA 4MTLA 1BH2A 1E2MA 2HQ5A 1E62A 2F3UA 3F3SA 4E7PA 5HM6A 4M6YA 2QLNA 1JHUA 5EIEA 5JMOA 1E96A 1K4KA 2X76A 2ZPUA 2ZXIA 3F7NA 3T9FA 3KP5A 1AV6A 1Y7IA 5BSMA 3G02A 2AOVA 3T1QA 1ISJA 1J8MF 2N46A 4LC9A 3OQIA 4U3JA 3BF7A 3LWFA 1OXSC 4ASUA 3OOPA 2QDKA 4F4IA 5MF6A 1G9TA 4KLZA 1TT7A 4A2UA 4XLTA 1LQ1A 4MO7A 3D7SA 2XMSA 3MELA 4ZIRA 1VG9B 4KO2S 4RGRA 4MR8A 3SFIA 4MI1A 5LXTF 1U8ZA 1F4KA 4R2MA 3HGTA 1Z73A 2C03A 5L6MB 3IAEA 5I9BA 4MVYA 2IJLA 3I53A 1AQYA 1T8PA 4D25A 1F0PA 5ILSA 3ONDA 1P4RA 3W3AA 4RA9A 1P5JA 1U3TA 1W4ZA 2CYCA 3DPSA 3RS3A 3RSQA 2PKCA 1G5IA 1N8NA 3RFFA 1BS1A 1QH1A 3EGXB 5DNCA 8ATCA 2FSWA 3IELA 2XIJA 4QXQA 5GZ6A 4EHFA 4YX9A 1WSDA 2IPMA 4GMDA 3ZTWA 2DRIA 4UAVA 2XQVA 3IP5A 3RVDA 4BMSA 1S1CA 5T67A 1FMJA 1AOYA 2D5LA 1Y8QB 1R71A 4AMUA 3WAJA 7MHTA 1N32B 2GJ9A 3INYA 1DEXA 1SPXA 2SICE 4HDNB 3S70A 4N3CA 4CIVA 4BQEA 3LSGA 3WL7A 4V1CI 3OG9A 5F27A 1Z2EA 3AL2A 5P8WA 4WGGA 5A4AA 1EVKA 1XKTA 3FZQA 2EFDB 3LWNA 3CMYA 3MKYB 4XGNA 5BSGA 1JXOA 4RPHA 1ATIA 2D1TA 4ZAZA 3U3MA 3W1EA 4RAZA 1YZHA 1DADA 2IEBA 4RD6A 4UVEA 3LGAA 3JD3A 3NC1C 1JB1A 3A1UA 4RY9A 1FDSA 4R01A 5BORA 3KJIA 4DLLA 3KQVA 1N6HA 4L07A 4MRAA 1OT3A 5JPIA 3VR6A 5HDBB 2XHZA 1ESZA 1IBKB 2HI0A 4ZVKA 3G0BA 3OIWA 1E4EA 1ZJ5A 4D7NA 4N7JA 5AVUA 4E07A 2BYTA 1FO6A 4MUIA 2FWAA 3F49S 4FZJA 3DEWA 1VHWA 9ATCA 2C3PA 1Q0RA 4H0NA 3KQQA 1NBEA 3V7YA 3HCPA 3IOMA 5FXMA 1JQ3A 1M5TA 4JMPA 2A1IA 2G4CA 3AL0B 3G49A 1I27A 3UK7A 4BPRA 5IP9J 2AJDA 3CVJA 1LBHA 3H75A 1WZNA 3NJRA 1XRNA 4LA4A 4Y6QA 2Y9YA 1ZGWA 2XZPA 2ZVQX 5IC4A 4O25A 3AF4A 3M81A 4P80A 3WLLA 2OCEA 3BFXA 4X91A 4KQEA 4G81A 2PJRA 3AUKA 2MSDB 4FYHA 1U3UA 4OHWA 3T7SA 1IQ0A 2XB2A 3UR3C 1DBQA 4OY3A 5JCJA 3TQTA 5E1DA 2FMTA 1XL0A 1W0JA 2WY8Q 1T5OA 1YV9A 4ESVA 3HCBA 3H4VA 3DZFA 3PDCA 4BGVA 3PD1A 5HKBA 5JEDA 3ZU6A 2EP7A 2WWIA 4B6PA 1UZLA 4JJZA 2XGSA 2RGCA 1MX1A 1W1WE 3MWDA 5JJCA 1PT8A 1KAGA 2M5WA 2XB4A 2V1NA 3DOHA 4IDGA 4UCWA 2QIPA 1N2IA 1NU6A 3FWHA 3CLSC 3EYAA 3NOVA 2DWUA 2JAQA 1P74A 2JHFA 2REXB 2VJKA 2HLNA 4KAXA 4A8PA 2FXAA 5BN3B 1YD7A 3D0SA 3LQ2A 5E79C 3L9XA 4Y30A 3FBWA 2XNDD 2BUAA 3D6JA 2GJ4A 4NBUA 2ZAOA 1TZLA 4X20A 5CT9A 1X8JA 1XQVA 2TMKA 3IMFA 3OM1A 4MUGA 4ALNA 2I3ZA 1L7NA 2SKCA 4INOA 3NLLA 5AKIA 1J0DA 5EHZA 3DMTA 1Z21A 2QI9C 3EPHA 1QKIA 3RYHA 2JK3A 1IC6A 1SG9A 4O4HA 1OZ0A 1QHEA 1Q1HA 4C0LA 1QVWA 1RAGA 1XEWX 2BF4A 2PMBA 4KGXA 3TJZA 2DDAA 3C45A 4F4HA 1DKLA 1Q22A 3R6GA 2J7PD 3SSOA 3BTJA 1FZQA 1QO7A 5B3SH 3ER8A 4CLOA 3GN2A 1U3VA 1XWFA 4YPVA 5KSOA 3TUZC 2C9BA 1PFYA 1MBFA 2XROA 4BZZA 1ZH5A 2W83A 1VDMA 4Y1EA 3AR8A 8GPBA 4K9MA 1EX1A 2IYNA 4BV8A 4AULA 1KVQA 3FSJX 2JAOA 3WGTA 2II6A 3K5PA 3MCAA 3TBKA 1HT1E 1FJHA 4KGVA 4H7JA 3ZE2B 1MMAA 1FLVA 3K4PA 1VIDA 3BR3A 4PSXA 1PNVA 1Z56C 3GTGJ 2KZVA 1MDMB 2CCGA 3GXOA 4RUKA 1B76A 2RVCA 1ZOOA 2DBBA 5JAQA 1FF9A 5A02A 5BYJA 2ENUA 1Z36A 5CLSA 5LL6P 2FFJA 4CQLB 3HUGB 3DR3A 4CKCA 2W25A 3H4IA 2ALJA 2QX4A 4J9UE 3STVA 2CXPA 2J7PA 3QVOA 2B63J 1LDNA 1TUBB 3P8ZA 4X1KA 5HZKA 3WLIA 1M2OB 3I9V2 4M7PA 1RQGA 4UBLA 3HDDA 4L9RA 3UMGA 3ADKA 1WMAA 4F52A 5DHAA 3HJFA 2XUIA 4N40A 5C9ZA 3FXQA 1O96B 2NVQJ 1QOPB 3IVRA 3QE3A 3EXEA 1I30A 3OZFA 4MB6A 4YRLA 2VXBA 3I09A 2E1OA 1V4NA 3PQ6A 4YLEA 1T8IA 1TYBE 4OIOF 1OI2A 2N3ZA 4CCOA 1D8TA 4Y3OA 3L7YA 4Q9HA 5CGQB 3M4XA 3QOXA 3URMA 4DWJA 3I9JA 4WOKA 3M8EA 4TS3A 3A1DA 5COBA 3ICVA 3L2OB 1Y1VJ 3IV5A 4QBIA 1YQXA 3B02A 1FP6A 1IE3A 3A37A 4OA5A 3EYWA 5E9AA 4FC7A 3TB4A 1CT9A 3WMGA 2HFJA 1Z0DA 2BFPA 3E9DA 3EJWA 3F9CA 1MB3A 3O38A 2VQFB 4ZYGA 2R96A 1XLVA 1I6KA 3VPHA 4AP9A 4D0LB 5AJXA 3CB4A 1I7SB 3LH5A 3PUIA 1B0AA 2Z1DA 1NA5A 4L6CA 3FKIJ 3NRBA 1H22A 4MYTA 5BVHB 1LCIA 1KJ9A 4PSWA 4HQNA 1A9YA 2CJWA 1EVLA 5EJ8A 2WKWA 4DYVA 4CGYA 1ETUA 5CXUA 1L5KA 1EX6A 3ZS9A 4ZGBA 1NMZA 1UMCA 3SLGA 4QPNA 5JQGF 5EGNA 4UKDA 2VS1A 4P0PB 2VDQB 2AJTA 1VXOA 3QUSA 4XOPA 3CFYA 4OVKA 3SK0A 721PA 4E2YA 1PR2A 1FJ2A 1WCMJ 1SA0A 2ZIUB 3LUBA 4O8CA 3T3EA 2G0TA 3OQ6A 4BNFA 5IVKA 4Y7NJ 1U0FA 1Y98A 3B3JA 1A9ZA 1GN8A 1XZKA 2LD4A 3FTNA 1Y9DA 1T0PA 1EHCA 2Q1TA 1NP3A 4FJ0A 2VDKB 4I76A 2NQTA 4TWRA 4ZVQA 5I7SA 3S3OA 4KVAA 5K0BA 2QG6A 4B0OA 1EINA 1KY3A 2OBBA 2HSDA 1TJ4A 3VR5H 2B4RO 4MJLA 3PT5A 1N0IA 3QFTA 3ABLH 1UUFA 1M8PA 3PL1A 4Y15A 4IIJB 3NAGA 4B73A 1R12A 1RFGE 1YCFA 1W36C 2ESNA 3JPYA 5CA1A 4BRWA 2WV0A 2CFTA 1RJ9B 3GJ7A 3IMGA 1EKXA 1MA0A 3FXOA 3LK6A 3LQFA 4EGFA 2OP1A 2VEOA 3EFOB 3Q9UA 5E3IA 4RHXA 3DLIA 3FAKA 2J07A 3L0BA 4QVKA 1HURA 1PQUA 5KEIA 1A9XA 1RC0A 3LY7A 3VYUB 3P4UA 3ABRB 1MGOA 3MT0A 3A1FA 2GMWA 2ZI6A 3M2PA 4IKOA 3UJ3X 1RUOA 2CVFA 3ZY6A 2RGRA 1B8PA 2YJ5A 3ZI7A 2X85A 1GUUA 1S8OA 3SJ7A 3Q4GA 1Z62A 4OH1A 3W2VA 1P80A 4LMAA 2DY1A 4GP6A 4YJKA 1SOMA 3K4LA 1Z28A 1Z74A 2I7TA 1L8OA 2J3EA 2Q5FA 1IXZA 2EKZA 2BJHA 2XYQA 3E7LA 4DDTA 1HC8A 2JKZA 4QPDA 5EYPA 3BTVA 4NZNA 1G5TA 2XLCA 2HDDA 1V16B 3NXSA 4LJ8A 3SQLA 3TZCA 4ILEA 2H8WA 3PV0A 1FBNA 1B1BA 2O2XA 2YOGA 2ZRMA 3M89A 4TSKA 4OSOA 4HX7A 1K6MA 2ZSHB 1WH5A 2DTXA 3A1VA 4YAOA 4Q34A 4CEIB 1LB2A 3CX7A 3NTXA 1KU3A 3UV6A 3U09A 2M1ZA 1VL1A 5JFTA 3K6SA 2XDQA 3D7KA 2V58A 3IXLA 3QLTA 4EZBA 5ES4B 5JYCA 4R3UC 1YA6A 2FEWB 5MGBA 3TTXA 2HSEA 4YCMA 2X14A 2P1DA 2RI1A 3FYUC 3JQRA 4MVJM 4PC3A 3SN6A 1Q3KA 3R4CA 1QQIA 3E61A 4J0KA 2RDMA 4FB5A 3FMSA 4PXSA 1HYHA 3OIQA 3EVBA 1D2RA 1MAVA 1XEFA 3LFHA 2OHXA 2R7NA 4M9UA 1JP7A 3BXZA 1R6DA 3KVRA 5K3BA 3U48A 2FPIB 4MO2A 5K0CA 4BEVA 4MI6A 2R87A 3AEUA 4QASA 2AYZA 3TQRA 3F8BA 1EXDA 1XA4A 2GM9A 3FWNA 3R3SA 1E5VA 2JIZA 1XGNA 4IHKA 2ZRDA 4CT0A 2ZJAA 1WEKA 3WU0A 3K0EA 3KQYA 1BE8A 2VQ6A 3PHIA 2PPVA 4HV5A 3R2JA 1KIFA 3GAAA 4J1QA 1DI0A 1FX0A 4PQEA 1A72A 1PT5A 4QXAA 4Y2SA 4WFKA 3G6EI 5DCMB 1C1DA 1RKVA 3OJXA 4UUBA 3KFXA 1L7AA 4S04A 4HV4A 1ZH0A 1BQ3A 2RD2A 2GGLA 4WZBE 4WXMA 3GEEA 3WA6A 4JOQA 1SKMA 4YA6A 5J4LA 1ZY2A 3IH5A 5TVKA 2OHVA 3HM9A 4KHPB 1TLFA 3QE0A 2FMYA 3ZQCA 4X7BA 5K8TA 3FGPA 2FXIA 2VPQA 2CNBA 5AIAA 5FL3A 3GBGA 3HPQA 1C14A 4QQFA 5AXAA 2R62A 4YUZA 2VQGA 5HFNA 5IC6A 4AXXA 3I1YA 3NUZA 3MWDB 3WHKA 4Z4IA 4PFOA 1DRWA 1RM3A 2XNCA 1GCOA 1O4WA 2BIFA 2O8VA 1QIMA 2YY7A 2HU5A 2Z5GA 4BXOA 1UXIA 3VQTA 3MCZA 5EPOA 3KUKA 1QLHA 2Y1XA 5JVDA 4QFDA 4DR5B 3E7PA 1R8SA 3IBTA 2HDWA 4KBFA 3IRRA 1S72I 1ONNA 2GPBA 4QUJA 4A3FJ 1V37A 1P7JA 1FYEA 1F1JA 1K1EA 2KB0A 2X1VA 1ZGCA 3C4VA 3CRQA 2SECE 2A33A 3Q3HA 5DPMA 1ZG5A 3GEHA 2RQQA 2LBFA 1XF9A 3EGIA 2FBHA 4KQFA 1YFLA 1XPUA 1LDGA 3TO7A 3LUGA 1V43A 3QXGA 2R7VA 2NSYA 2VKHA 3G79A 5HCUA 3CE9A 3THSA 2KDOA 4A73A 5IDXA 5KWSA 2QR3A 2W2TA 4TZ6A 1ZSVA 1Q16A 3HU2A 1N2OA 3LHDA 2B5VA 1J23A 3QFHA 3OQBA 2QQ5A 1P9NA 2QX6A 2E7WA 3LLSA 1EZZA 5FUQA 1NYQA 3S8MA 2NVYJ 3KVYA 3H9JA 1GTL1 1X7GA 2IYVA 2RGUA 4X8OA 3TCXB 4PN7A 1COWD 3W3CA 2YKGA 2IYZA 4EZEA 1L1RA 2AQIA 3C1OA 4LHVA 3CVVA 3RTCA 5HS8A 2H63A 1GJRA 2EXXA 5H4HA 1T2NA 1WJBA 3A6ZA 3EWNA 2BHNA 2QRUA 2CZQA 2Q5JA 3GN1A 4MI9A 5AQEA 1DU0A 4X24A 3IEVA 3FXKA 2FY8A 4CMKA 2H00A 1H6AA 2QN8A 4D9HA 4I1VA 2EV0A 4GGOA 4X61A 3CBQA 3PXEA 1KNQA 3N2ZB 4MIOA 4URHA 2P3QA 3TLEA 5B1SA 5KOHA 3FOEC 1TVEA 5GJBA 2H31A 3I9LA 4B43A 1WEHA 3AINA 4OYHA 5F73A 1Z0UA 3QBEA 3UWPA 2ZULA 4XLPF 3ZXXA 3ACCA 5B12A 1A8PA 1V95A 1JTEA 5JZVA 1QYWA 1N5JA 4Z7JA 1SBCA 3NHPA 1ZI8A 4GDMA 3AXSA 2FPPB 2Q3JA 5ICSA 1NVBA 4F5ZA 2R6DA 3GI1A 3IP6A 2DWQA 3ZYCA 1GRNA 1UF4A 3MJFA 1ML4A 3G68A 3NMUF 1Y5RA 1ZUIA 3M0EA 5CFOA 4FDTA 1VIMA 3KJEA 4PC6A 2XDAA 1WJDA 2CJXA 5J2UA 4QGFA 3C43A 5TX7A 2R92J 1X7HA 3D64A 3U1BA 5AUNB 3MQFA 2F90A 3IE1A 4B79A 2ZTHA 4OQEA 1GIAA 2VNKA 2EWNA 5BNWA 4RYLA 4LV8B 3MKZA 1ONBA 1AKMA 3SQNA 5DO9A 2X9LA 4EVRA 5L3BA 2LD5A 1FYLA 1QFJA 3IUMA 4OKNA 4N8SA 2MWMA 4D5GA 2I5PO 1D04A 1R4AA 1SKYB 3AT1A 1JMVA 2DB3A 1SUWA 1E4YA 3QRWA 2GEUA 4G94A 5DI9A 1DTWA 1BYIA 1HM5A 4DB4A 5E1XA 2YN0A 6ABPA 1E7SA 1EDOA 1GA1A 3B6CA 2DTEA 1BC5A 2HKOA 2O9LA 1NI5A 1W73A 4KRYA 4R4JA 3WJ7A 1J1UA 4AXBA 2AKYA 5B3JC 1N6IA 4J2HA 4U7TB 4ZQFA 1XEWY 2Q3LA 3H5VA 2C94A 3OMLA 4L0MA 1VLHA 4IZSA 3L6RA 1QDUA 5DGHA 1RWNA 5LJLA 1B6GA 3WBBA 2OZKA 3KZ1E 3AG3H 2BC9A 1MGPA 4QYXA 5DV9A 3T1VA 1WD7A 4V39A 2DA2A 3RSGA 4I09A 1VA4A 5FD5A 2QTRA 4MOWA 3TXAA 1YB1A 3W90A 1PQYA 3NEYA 2Z5VA 4BNWA 3CWZA 2Q4DA 3D0RA 3VO8A 1IXSB 1G63A 1W9MA 2Q1UA 3PLNA 3MWEA 2YNMA 2QX8A 5DTEA 4TT3A 2SCUB 5H6RA 1L7RA 2QMEA 3VTAA 4DW6A 1E1LA 1KQOA 2ZB3A 3V4OA 4MQFB 2DYVA 2JARA 3IUPA 3RVBA 4DBLE 5BN4A 2K7ZA 1SCIA 4IPTA 4BNDA 5FBLB 2R7MA 1D1CA 2I6UA 1DMSA 3TFQA 4BGUA 2LKPA 3LCMA 1OC4A 4PONA 4XH9B 5I9SA 7ADHA 2X6XA 3SXJA 4GL2A 3ABOB 3IFSA 4PGGA 3TL4X 3TIXB 3ZIAA 1XFAA 2PZGA 4BRSA 4P9NA 2CXQA 1BFKA 3INGA 4IRXA 2X0DA 2IBTA 4ABZA 3P4XA 1JKRC 4QQ8A 1YBHA 1DGWY 2HQ1A 2WHPB 2XADA 4US1R 3TDKA 4JX9A 4UOZA 3LNQA 3SBXA 1E60A 3DDSA 3K0AB 1C7QA 1WCYA 4Q3DA 1GZ4A 3Q12A 3V55A 4IZTA 4POOA 5ICFA 1WG8A 2QSUA 2ZC2A 2QT0A 2I7XA 3GJ6A 2JLVA 3LPCA 5KHDA 4EEKA 1R0WA 2O3JA 3L18A 4C5AA 4HAZA 2C2MA 1OZGA 3IPCA 2E71A 2DUNA 4BDYA 4HQMA 3EDMA 4NZMA 5FD8A 4A3MJ 2B8NA 2ILVA 2I4IA 1ZD4A 3K9HA 4F8EA 3C16C 2EBUA 7MDHA 4J90A 4NCHA 5CM8B 4K9DA 2R5YB 3COPA 3LC7O 3M7GA 1Z77A 5FUBA 2GBCA 2OESA 3C8ZA 3OTWA 1YE3A 4FFRA 1YQDA 1G3YA 2R7KA 4WEOA 1FSPA 1T9DA 2F8TA 4GMKA 3H9CA 3GF2A 3D6AA 3OX3A 5HVQC 1UQUA 4NS1A 3ICWA 4B71A 5BW4A 1NVGA 1DX6A 3O8QA 4FHTA 3LG2A 2HCFA 3JQ9C 2Y99A 4U1RA 3LKBA 3Q3GE 1O89A 2VBXA 1EKEA 2J46A 4ZO6A 3CG0A 2HNAA 4HVAA 4R2KA 2YV2A 3L8EA 3DCJA 2A07F 4BCDA 4CYCA 1B15A 3TD2A 4PSCA 2QUAA 3HXTA 4M53A 3TCKA 2O8XA 4QOEA 2VPLA 4FHEA 3FFBA 2VNHA 3ND9A 1H2ZA 1WY5A 1EVJA 3LUKA 4FNMA 4AYBN 1ECLA 2X6OA 2XQGA 3ELDA 4OGGA 4DNPA 1SFEA 1Z67A 2VHWA 2R1VB 3H9EO 1E6WA 1LV8A 1FT9A 1G60A 1RI3A 2H51A 1WJCA 2L7KA 3V8JA 2QVBA 2R65A 2R79A 3A05A 3W3AD 4ARVA 2X0LA 5JC8A 3GELA 2OSBA 5KKAA 4EJSB 1XTKA 1M33A 4R9UC 2OFOA 2PUFA 1G2IA 4QDZA 4XEHA 1S89A 4V0MA 2AEJA 2FWIA 2QZJA 1ADCA 1GYQA 1LZKA 1N2CB 3NIDB 2R7RA 4DTIA 3P9PA 3CP8A 4RLFA 3P26A 5HDNA 1CW2B 1I3OA 3QOYA 3BILA 4FTWA 1J5XA 1JHRA 1QXSA 2GK3A 3F1LA 4GQAA 2QYHA 3WBJA 5F7XA 1TZMA 3E9ZA 1B8NA 3KZIC 1TVKB 5LIPA 1IY9A 3C85A 5FLKA 2IUFA 1TC3C 1C41A 2WU0A 4R0MA 2FQ4A 5A1TA 3ZQQA 1V0JA 1N2HA 2WP0A 1TKCA 5GIPE 3JAKA 2M1XA 5FUMA 2CK3A 2L18A 1N3IA 2IX9A 5K7ZA 3B6KA 1JDNA 1YE5A 2AN3A 1SKQA 3IRQA 1K5HA 3RVQA 4J0HA 3CONA 4EYKA 4L51A 5AO9A 3ST7A 9LDTA 3W8DA 5JW6A 2XWPA 1OB2A 4MWCA 9ABPA 3FWZA 1VFCA 5CFRA 5KYYA 5AW2A 3QEAZ 1I7DA 1DIAA 5L3EA 2IL1A 3N59A 3UYLA 4BGEA 2VK1A 4BXXJ 5LCXA 4Z6KA 2Q45A 2G9NA 1CG6A 1GKUB 3PQDA 3VU8A 2J3HA 1GSIA 3AF6A 1XLUA 1LUAA 2V6JA 1CQPA 2ETHA 2HTJA 2MT9A 3O2NA 5CNKA 4DCTA 5DM6F 3T5GA 4D9NA 1Z6PA 4JB8A 3ZV5A 1X2NA 1F5NA 1ZQ3P 1XQ1A 3DVSX 4PFQA 2H59A 3IT3A 2R66A 5K51A 5G02A 1XSVA 2OV7A 1FMCA 4B2PA 4PG8A 2G5CA 4F8JA 3CH4B 4RJTA 4ZDJA 3KSAC 5FR1A 1T56A 2JLBA 3OCUA 3ZQ4A 4BMZA 4UTNA 2KP6A 3JRIA 2G25A 2OV2A 3HO1A 3NP7A 3BGDA 3QMPA 4PJ0C 1OFTA 2AG8A 4JLDA 5B6IA 5CVTA 3LK7A 4DIFA 4DOMA 5EZ5A 3K8OE 4F3KA 2W2NA 4DA4A 3HUTA 1JEJA 1SM4A 4OAPA 1BAPA 2RIPA 1TI7A 4IOKA 1P9WA 2JFPA 2WSBA 4ZU1X 3LRPA 4XLCA 1F9AA 1QFSA 4KCGA 2H52A 2QN9A 4IL5A 3LL7A 4G25A 2C98A 4OQQA 1L3CA 4CMJA 5C4JJ 4EB6A 2ST1A 4HFMA 2XYGA 4M55A 1DG3A 5D84A 1HR0B 1C8LA 1R15A 4AX4A 2LY1A 4RIFA 2B2XA 4E22A 2VT3A 3R0QA 1TIPA 3P5SA 4CCAA 1T36B 4C78A 1ODSA 3OQNA 4RZ2A 3A6LA 1EWKA 2X2FA 3NGLA 5KPDA 4J0QA 3BVPA 1LPBB 3MHPA 5CD1A 1L5NA 4OQLA 1NN3A 4Y2VA 1ZOIA 3GEZA 4DR4B 4OHXA 2J08A 5AW5A 3PUWA 4R1LA 4JN6B 1JJBA 3BWYA 3ITEA 1FIPA 1AKVA 2PBRA 3EXFA 3G0IA 4I1SA 2P7HA 1A71A 4G26A 3KYCA 3E97A 4NCXA 2OAQ1 1AJEA 3VKHA 1JFSA 2A14A 4MCIA 3IODA 3FISA 1W4BA 3M1EA 3CNHA 2RI6A 2Q7OE 2W48A 2A5LA 3DZIA 2FZEA 4NAVA 4UM9D 1HE8B 3HHEA 2CDRA 5H80A 5M29A 5IRCD 4KLCA 5FWAA 2K6GA 2V54A 2AT1A 3TL2A 1N1MA 3ASYA 3EDYA 1Z0KA 2VL7A 1XTSA 2VTEA 2XECA 3LY8A 4MS4A 4RVOA 3W8FA 3U4MA 1TYCA 2IGTA 2OCLA 3LLCA 4F84A 4DBRA 1GXSA 1Z0JA 1UKVY 2WJHA 1U2PA 1BJRE 1L3IA 3HWRA 4MI3A 3EA5A 1OCTC 4JX4A 3DF7A 1WD5A 4R69A 5JAOA 3ZCUA 4RU1A 3ZGZA 1O58A 3R61A 3CT6A 1HMYA 3HDHA 3ILXA 3DE1X 3UHFA 3DL0A 4BTEA 3RKWA 2ZR7A 3UWOA 4TM8A 4Q4DA 1FP7A 3AWDA 4G1VA 3I04A 4BVGA 3EH2A 3GRPA 1R50A 3FHLA 5EQTA 2ZGVA 3WS7A 4YCLA 4DYHA 3UUGA 3SFZA 1G20A 4CCMA 4X45A 2DTZA 3PXGA 2LTPA 1D09A 4ALJA 3KHTA 3JCZA 5L95A 1VBFA 3D4BA 3PWTA 3PVZA 2J3QA 2YZ2A 4HDAA 4C7JA 1TU3A 3BG5A 2XE4A 2QAIA 2IXDA 3QLJA 3BWBA 1G2PA 1CIPA 5HXAA 1V8FA 2ZM5A 4FISA 2OAZA 1YZTA 1CUGA 3DZJA 3SHWA 3SIXA 1NSTA 2ZRBA 5A5VA 2I91A 3CKLA 1RWOA 1Q1VA 2C2YA 3BIWA 4G0VA 1PTJC 2RKWA 1TTTA 1L8XA 3QX9A 2DY0A 1PSDA 3GT3A 3K94A 1KVTA 2VIXA 1IMJA 1WZUA 3CUWA 2NS7A 2YJ3A 3IT0A 3IUQA 3LC2O 4FCTA 5DYTA 4X64B 1ORTA 5E3NA 1YZ3A 3C5HA 1IN7A 1H2FA 1L7DA 4HLQB 3JYHA 1IG3A 3O4FA 4YJDA 4OBEA 4MS1A 5AHXA 1VP3A 2UZ0A 1II8A 1A5JA 2FFAA 3IR6A 2O59A 2CSOA 1CX9B 1T13A 2I7VA 3F98A 3K9CA 3Q6MA 5FWDA 4XRGA 4CIBA 2VDJA 5AK5A 3DDUA 1J0EA 2YWEA 4L5AA 4QU5A 3R9WA 3C3KA 4UULA 4A6DA 1GNQA 1XZMA 3M4JA 4BC0A 1ZK0A 3KL2A 4B3RB 4UOQA 4WXPA 3GH1A 2R7DA 4CO8A 2FPXA 4E5UA 4Y2XA 4C03A 4RVCA 2ODQA 1ZMTA 1HK7A 3VDXA 2DQYA 4E33A 3HP4A 4QFCA 3QQ5A 4EPWA 1ZESA 2ZBFA 1ZRHA 4HLCA 2BEUB 2WYWA 2DBYA 4MIEA 2P11A 3STTA 4UAJA 1KKMA 2ASEA 3WHPA 3O90A 3TCNA 1RRCA 4C2UA 4LY6A 3Q8XB 2HYGD 3H3ZA 3UKOA 3OEHD 1ZINA 4ZQHA 3K9GA 4ZQEA 1VECA 4BQFA 2K4MA 2YWJA 5GV7A 2NU9B 4C0KA 5CDHA 1JQAA 1JU3A 2ZCWA 1Z07A 3DMNA 3K70D 5JD4A 1D9ZA 2QUFA 4FYVA 1PAUA 4PNZA 1XMXA 2QSGX 1JBQA 4DQKA 4EMBA 5KTYA 1NASA 5JPCA 3D9QX 3N2IA 2HH9A 2V0GA 4ZEXA 2Z2JA 4ZTBA 2D7DA 1I4OA 3B9BA 3FUCA 3P9XA 3W1WA 3K4NA 1Z05A 1HQCA 1B14A 2LV8A 3KLCA 4Y6LA 7YASA 1NBIA 2CLLB 1LY1A 1KJJA 3RIHA 2RBGA 4JQCA 4LJSA 3RASA 3KTFA 2OBPA 4H2DA 1OFHA 1Y6FA 5LP6A 5FIUA 4GP9A 4ZEWA 4JYCA 4IXAA 3RZDJ 1TKRA 3AVQA 4UM9B 4RCZA 3EEBA 4JOBA 1QBGA 3V2GA 2NU6B 1KYVA 5LLQA 2I2XB 3L6OO 4MYSA 4RMHA 1N2ZA 2FWBA 4P2BA 1CUZA 1OVMA 3NJ8A 3OCJA 4I01A 4JC5A 3UMBA 4E11A 1ZNYA 4Z1OA 4BNVA 3V8EA 3IEIA 5ALYA 5CG2A 2F5CA 2V6MA 4I4TF 1QP4A 2CFXA 2H2WA 1OMIA 3DWFA 5AVZA 4KT6A 2FWRA 2WU4A 2VYVD 2XUJA 3AF5A 1IZ0A 1R0KA 2X22A 3T7AA 1R0ZA 3DOOA 3HFGA 1SXPA 3UPUA 4DLAA 3SMQA 3C7KA 3GO4A 4JT2A 3STHA 4JV5B 4E7JA 2A1TR 3UAXA 1RQ7A 3ZYZA 2X3YA 1DUXC 1P2BA 1TJPB 4R71A 1QQ7A 4QKQA 1OILA 2VHJA 3L0IB 2HZDA 1OXUA 5D1NA 3SYKA 1ECFA 4LFCB 1AQNA 3ELKA 4HDKB 4LZLA 2Z9DA 5AW8A 2VNAA 5JRZA 2FEPA 4IX1A 3SX4A 1NXVA 5F2KA 2Y69H 4RK0A 3ZCSA 5CIQA 4HDMA 4KQXA 5BSHA 1OI7A 2YC2C 4CT5A 1V71A 1DQPA 1VA5A 3DEEA 2X77A 4MVJD 1XJQA 3ICEA 3BHIA 3BQ9A 4KQHA 5A4JA 2PUJA 4JKYA 1E59A 1KBQA 1NX6A 4B84A 4F3RA 1B0UA 2VKDA 2GD0A 3IA7A 1QH8B 4E7OA 4MV4A 4AQ7A 1RR7A 4ZCPA 3MGCA 1L6IA 3K96A 5AMXA 2EX4A 4CR7A 2JFOA 3JQ8B 3LZCA 1B1AA 2DMQA 4YYEA 5A6VA 3LKDA 3ASNH 4PNHA 1IRFA 2H1IA 3A9WA 2OCBA 5K0FA 4JR2A 2AX4A 3H1FA 3VHXB 6CHYA 4DQDA 3SFVA 3GFFA 2E1PA 1Z63A 4LFBB 4RGVA 4QUGA 3EAQA 3UJ9A 2PZKA 5BRNA 5KNBA 5JJIA 4AUEA 3I56I 4L5JA 1YIOA 2BMJA 1DOZA 3A0UA 2PZLA 3IBSA 4KW7A 5H8WA 1GTRA 4MKFA 2C82A 1H69A 2Q6OA 3SLKA 2PS0A 4YLYA 2M98A 2W42A 1GPAA 2J7KA 2QQFA 3QI7A 5GTIC 3JQ8A 5A1JA 1L4GA 2HXYA 4MCAA 4UTXA 4Y8VA 5ALNA 4BFZA 1VC2A 4FUTA 5ILGA 3H35A 4NP6A 1ADJA 3DDOA 2PLRA 5LFAA 5EUQB 1U1EA 2GLTA 1JKIA 2GA1A 1T6SA 3JQ6A 3WIBA 2Y2ZA 4GFDA 4Y0AA 3UJ7A 5EYRA 2V7UA 5DN6A 1Y6QA 1W35A 2WUVA 1JG6A 4FETA 3K0FA 2IXBA 5J9FA 1UEJA 2KPOA 4A8JB 3ZV3A 4ZI7A 3ZWDA 3WGLA 5BV2P 4OIMA 1A6QA 1D9XA 1WZ2A 4JQYA 3ZCTA 2MH9A 3CJQB 3IHUA 1KP3A 1Q0PA 1L8QA 3WHCA 3QBJA 4L8LA 2QAJA 1OHHD 3DDCA 4CKWB 4S3MA 5KREA 1K7EB 2X1LA 3PLAE 4ZJPA 4HWTA 4EBBA 1OX5A 4KWEA 1OZHA 4UHCA 4PCQA 3KPWA 1K4MA 1QHXA 3ZWXA 5AVWA 1E3SA 3SWWA 1MMGA 4ZYDA 1DJLA 1LZLA 1S3FA 2OWDA 3W4IA 4EYQA 4CEJB 2W6PA 3CSUA 2O5CA 5EZ6B 2Q1XA 2YHBA 3FMFA 3KYDA 1LFPA 2AL7A 3OYMA 4ZEVA 5HUJA 4Y67A 3PS9A 3CLTD 5JOQA 1WJGA 2QZ9A 3DTEA 5B1HA 5U4QA 3I4NJ 5AJTA 3G1OA 1TM4E 2I1QA 1KY5A 3MAAC 1AKHB 5L4SA 1ZAYA 5J8CA 2FZGA 2VCEA 4RULA 1O4VA 1ZPDA 5F78A 2ZVJA 5LYYA 5F0FA 1CQZA 2IQIA 3M8JA 3KP6A 5TMEA 1EFKA 4QGBA 1UPXA 2CLFB 2PZEA 3O8GA 4JEIA 4WJKB 5LQCA 1XVTA 1XRRA 2ZATA 3V1NA 2Z2ZA 1XCBA 3PD7A 3WTCA 5A5GA 4AIKA 3P2EA 2W00A 3ZE9A 3HYLA 3H5IA 3L0DA 4PX9A 2INGX 1JUMA 3Q1LA 5TPWA 2HV9A 4LBWA 2HSZA 1ZXLA 1RIIA 4DWVA 3KT6A 2EEPA 5CRIA 1QUEA 5CVCA 2WYIA 5EZYF 4DIBA 3AIMA 1JG7A 5CLHA 4Q19A 2GN1A 1Q95A 3MB5A 1ZFNA 4ZAVA 1S02A 3VTFA 4G6ZA 1ES9A 5K0NA 5LUBA 4ZOCA 1EMDA 1QIJA 5DU2A 1UJ4A 3OYNA 3VUFA 4B6GA 4DBVO 4EKIA 3QU5A 3I12A 3OPMA 2NO0A 2PX4A 5AIQA 2Q4TA 4AB1A 4F3CA 1EPUA 1AV7A 4HV6A 2ONKA 2DUMA 4JQOA 4N0QA 3ZDYB 3NYQA 4BKMA 3HRTA 1U3FA 2QX7A 4BZPA 2ID3A 3HOSA 2VKQA 4KACA 2ZJBA 3QODA 1MXFA 3K9WA 4LE0A 5BN5B 3I28A 1MTOA 3FCYA 3I9V6 4KZFA 3L04A 1G3WA 5DYGA 2JRMA 2JN6A 2GLOA 3ABMH 3K4HA 4P3NA 1A04A 1UWVA 1AKWA 4P81A 1XQXA 2REQB 5GP1A 4KWIA 2VXYA 1P4SA 3C6QA 4BO9A 2WHEA 4RTOA 1F36A 1ZYUA 2QTZA 4FFMA 2G7UA 4PHCA 2GYVA 5DRYA 5GONF 1X74A 5J43A 1U65A 3NEPX 1PJZA 1I7PA 3OT5A 3REFA 1EWRA 4I50B 2IZ5A 5T6BA 1XU4A 4UVCA 2GDJA 1EJ6A 4RGUA 1UZMA 1JECA 3BTOA 4NJEA 4QO7A 3QA3E 1U7TA 1WPGA 4QAQA 5KQRA 2JJ1D 2JA2A 1TZKA 2A05A 3VDMA 5KVSA 1T9HA 3BGVA 3PG5A 3IR5A 5HIIA 1AA6A 4C3UA 4RK1A 3DFMA 3G59A 3OPYI 1J21A 2H4WA 4Q1DA 2Y1DA 5MN4A 2JASA 1PZNA 5L40A 1HT3A 1NXTA 2ODEA 4GXOA 3FRHA 3GJ4A 1X1AA 4JHXA 5EY5B 3RS9A 1EK1A 1I50J 5AVTA 5KVRA 1EJBA 4GO1A 1UANA 1ZK1A 4XLEA 3GJ0A 1QF9A 1SB8A 3LECA 1F2UB 1VQ5I 3HBNA 5EL0A 2M8GX 3HL0A 3MK31 3AL0C 1NHGA 3B82A 3PCTA 4PPNA 2PFBA 4A3IJ 5EIAA 3QPTA 1PW5A 2BFEB 3M4OJ 4V0ME 3QPDA 4UFPA 1JJFA 5EF6A 3IAUA 3CTAA 1VI2A 3NBAA 1PG0A 4GWKA 1AOXA 2ZRFA 2E19A 1KO7A 1NLYA 4FCWA 2G06A 4O8ZA 4OU5A 2GAUA 1ZN9A 1RESA 4KAFA 2P1ZA 3E7WA 3IO5A 1Z0SA 4XGKA 4ZKEA 1GVDA 1L7XA 1IPEA 1UBLS 5IDYA 2EHDA 2XRMA 1SMKA 4MGHA 3OOWA 3AZOA 1XTVA 2XRLA 3JQDA 2I10A 2P7IA 3FSEA 1SVSA 5IJAA 5IMBA 3STXA 5E6SA 4AJPA 5DYMA 1F4LA 5B7QA 4AY6A 4NR0A 2CSXA 1PLJA 1JZQA 4JOCA 2IV2X 1RR6A 4BPBA 1JDZA 2PGAA 3CPJB 1X7DA 5LM3A 2GQ0A 1SOUA 1XDDA 1Z12A 2NT4A 2VDWB 3H97A 3OSUA 1BSVA 4P38A 4QPJC 5JFGA 2QPAA 1NDQA 2QTMA 3NRVA 1JIXA 5AK3A 1PT9A 1MC8A 3WMEA 3S2ZA 5F0CA 3CCJI 4F7WA 2BTEA 1MMFB 4GSYA 1DKQA 2GQQA 4FDVA 4D3ZA 1KWGA 1R22A 2CW7A 5B5EC 1G3IA 1P3JA 2NIPA 4FMPA 3S0JA 4DA7A 1VKNA 4WLUA 3OZRA 4MQUA 1Y9AA 1JAZA 3DEAA 3K5WA 1U8EA 4KG7A 1XJWA 1TAQA 1NXPA 2V0CA 1E9VA 2HKIA 3GEMA 1H9AA 2MSEB 3K9BA 5DVZA 3GRAA 3EA0A 3TLAA 4EG7A 1N1GA 5FOUA 2OYRA 5IOYA 3C3JA 1Y9ZA 3E1GA 3IXQA 1IBCA 1GEGA 5ALQA 2C6YA 3OYHA 5EG0A 5DBIA 4Z8YA 3N7AA 4DUPA 2DHDA 1N0VC 5LP1A 2CVHA 2J9ZB 3U1DA 2P4UA 2Q21A 3OETA 4IEIA 5H68A 1U6IA 3R5XA 1HA8A 1T29A 2V65A 3EUHC 4XL9A 2IU0A 3JRDA 1VJTA 1UFOA 4QNRA 4X1EA 4URVR 1CF9A 4Z8XA 1P9QC 3DE2X 6PFKA 1PVOA 1LTKA 4KMMA 5LOVA 4KOAA 2Q8KA 1M1YB 2EK5A 3PFCA 1T0HB 1QV7A 1E2IA 4FMCF 1I5RA 1PZHA 4G4JA 3SBDA 3V5NA 4EP1A 1PN3A 4HGPA 4NE2A 4ZVNA 1RZUA 5HP4A 3TWOA 4W7SA 4IH1A 3IDZA 2IFTA 2JJ2D 4A1OA 4UUPA 1YK0A 4U6QA 1E9AA 2EPFA 4H3HB 2M7BA 2VOPA 1L4MA 3JWGA 5DBEX 4P4SB 1YASA 2W6QA 4REOA 2D0OB 4LSZA 5AVOA 4GBMA 1O1YA 3OFSA 1N0WA 3ND6A 1A97A 2CS3A 3O4HA 4RVSA 5G0VA 2FDXA 4K9QA 3QHAA 3RVNA 1RDFA 5JBQA 3NATA 1FDWA 1OIWA 4FCCA 5A5DA 1FSEA 2YZGA 3G0DA 4QA9A 2CV2A 4MRVA 3HB4X 3UAOA 5C8YF 4LGWA 5E3MA 2OM6A 2LY2A 3OIPA 2AO9A 1VJ5A 2D5AA 4F21A 4H0EA 2OV1A 2FJPA 4HAXA 1E6MA 1NV8A 3SOZA 1P73A 3ZE7A 3SHFA 3HJBA 3K2AA 3QLVC 3S6JA 3HJUA 1NG1A 4P83A 3IERA 4F93B 8AT1A 4ARCA 1C3LA 1JTFA 4C21A 3OOHA 4A3JJ 3IVZA 3EY4A 3DQVC 2L54A 2C84A 2IOFK 3EGDA 4AFNA 3DEKA 1SCBA 3CRMA 3T3IA 3CX6A 2CNWA 1EWTA 2ZJ0A 3G9ZA 4Y2GA 2G3YA 1SVLA 1EJ0A 1FU7A 2GAIA 2Z3ZA 3PTZA 1UDWA 4RF3A 4C0QC 4UVGA 5JMTA 2PD6A 4BHCA 5IAKA 5EE0A 4ZODA 2AI3A 3AVVA 2NU8A 1AO0A 1OKKA 4IKEA 4AWBA 3FTPA 3ANXA 4FINA 1FFEA 3PZRA 3OHMA 4LMYA 2PE5A 5HA5A 3NTOA 4JJ7A 5IW8A 2AH5A 1USUA 1N2CA 4ZVRA 5TSDA 2ZFWA 4HJRA 3TRIA 1LPPA 1FVHA 2EBHX 2PFSA 2Z04A 3KKNA 3F21A 4IVRA 4RY0A 4BB6A 4E2FA 2OYSA 1G4HA 4AO7A 1IEXA 3P0IA 1GPYA 1HDZA 1W9HA 4KKXB 4AKGA 3SR3A 1I3MA 2XWQA 2WNSA 4FYWA 4C4RA 1UJBA 4GR5A 5ITVA 3Q8KA 2K9NA 3VGJA 1JKXA 4AMVA 4GYGA 1RRVA 3HKCA 5E8RA 5A4IS 2Q3FA 1O5OA 2BFBA 3QLUC 1NATA 1QQ5A 2OCKA 5EMKA 4DA9A 2IBMA 5BQTA 5H02A 1OR7C 1EP1B 1TWFJ 1EHYA 1NJ2A 2FPGA 3MSCA 2A5WA 4MR9A 1N5KA 3KWJA 5HJ5A 2YXBA 4HWOA 4F4CA 5K2OA 2BW3A 1WM1A 4M2LA 5M04A 5KYTA 2VSNA 2HTSA 4QGGA 1JF8A 3NT2A 4RXUA 3IEKA 3L8GA 1G5QA 4L4RA 1KI2A 4AMZA 1U3WA 4GQIA 4CKYA 4DA8A 1D2HA 4LE2A 1LSUA 1KMHA 3L02A 4YECA 5IJZA 1B72A 1OBVA 1QUFA 6GPBA 4DG8A 3UUFA 1PR9A 5BQ5A 3LSMA 3CC8A 4NK5A 4Q4JA 3ZZNA 3I5UA 3ZHSA 3GJRA 4L0ZB 3THXA 1U9IA 3V33A 1T8RA 2ZSEA 3LY5A 5TDHA 1QCDA 4UJ3A 3WJAA 4ETMA 4ZMRA 2IW1A 2JJ2A 1FP4B 3LAWA 3NHLA 1LC3A 4MMYB 4LRUA 4YT4A 1OZAA 4XM0A 2NUPB 1B4AA 2ADUA 1I39A 1JTXA 3F72A 3W6KB 2CYAA 4Q47A 3MF4A 4RPCA 3M3DA 2N9UA 1HLVA 1KQ0A 2BY0A 1OFGA 1YACA 4ID3A 1DELA 1KJZA 1Y37A 4NBKA 5DKFA 3SC6A 4B8WA 2A94A 3TDMA 1N2CE 3SJMA 3A6DA 4EECA 1RWKA 1DHTA 1IUFA 4J0JA 3ZEIA 4F9TA 3AG5A 1WB4A 4U9HS 4XD2A 3BR1A 5IAEA 2ZM6B 3FTEA 5DW3A 1V5WA 4X8LA 1YJ8A 3K4BA 1YA8A 1PS0A 2BF7A 5LKRA 4JLAA 1VE3A 4XM2A 3K0BA 1XR3A 1E3MA 3ZXUB 3PFFA 4PIPA 2GN8A 2PEZA 2R8RA 1WS6A 3E9CA 3VR5D 4CKBB 3H99A 2IYTA 4XRSA 3FM5A 2P2GA 3NBZC 1OBHA 2X1DA 1KEEB 1DP7P 3BMOA 4G0PA 4MW1A 4ZK2A 5JFOA 1XHFA 4UTPA 4ANJA 2JRCA 3I0TA 1T9ZA 1H65A 3JQAA 4EL0A 1FJGB 2D06A 3KQKA 1QG2A 3CF4A 4ZXFA 3AERB 3ZMVA 3IHKA 4RBNA 3MWEB 4IZZA 1RQNA 1G41A 1EH6A 1I2DA 5I3ZA 1TVMA 3NBMA 1MABA 1ISRA 3GYBA 4ZREA 4LFUA 5T41A 4AS1A 3HK2A 2BOLA 2DPDA 1A7AA 4DFDA 1VLVA 1UPCA 2VYVA 3QKRA 2D1RA 4CN8A 3BROA 2BEUA 2IUYA 2X1HA 3FDZA 5TT0A 1YYVA 1GU0A 2MD0A 2VYQA 3EC1A 4K6HA 4R8LA 5L9AA 1ZVVA 2ECKA 4COOA 3H05A 3NTVA 4C04A 1HX7A 2H2AA 4FVTA 2X4IA 4CZZA 1YS2X 2ID7A 3NIFB 4R9VA 1A35A 5GOZA 3ZOKA 5GJVC 1CDZA 1HLGA 1W5EA 1LQ2A 1PX0A 1XRLA 1YRBA 1JSXA 2DFKB 3CHYA 4YI5A 3TSOA 4ARUA 3MCVA 5JSZA 2EJUA 4WA7A 1CXZA 1SD2A 2JKVA 3OBIA 1MABB 3AP3A 3REQA 1ZW6A 3E6CC 1SQ6A 2FV8A 4TUYB 3W6OA 1GKIA 4H7EA 3WY9A 2XITA 2H1VA 4H3VA 1ZUNB 1ISFA 2ADOA 4PDKA 1XLWA 2FMUA 2YFYA 4LYAA 4TRRA 3CO5A 2KIQA 1YSCA 4U2DA 4LF7B 1T5DX 4MRRA 4DGSA 1VPTA 4K87A 3OA0A 3WRYC 3DXYA 3TG2A 1T6NA 3HKZA 1NNLA 2WMOB 1BDJA 2LW7A 3ENQA 3L6BA 4R5HA 4WRRA 1EIWA 3KL4A 1H9GA 4HB4A 4RZSA 1BI2A 5B4VA 1NGSA 2OD7A 3E9RA 3TVTA 3VSCA 3H0GJ 4IYJA 2P27A 1E1YA 1WBJB 2ZAYA 4OJQA 1KEKA 1S01A 3UICA 4O33A 2O5EA 9LDBA 3T12A 1FW8A 1HZJA 1OCEA 1WF3A 1R0SA 2G77B 3A7DA 2ZSHA 5CK5A 3LHSA 3I6BA 4QM6A 3CUSA 1CDEA 1OAOC 4LGVA 2WIFA 2WUGA 3DE7X 4HD8A 4NG5A 3PPXA 5LGTA 5IH3A 3TQSA 4KN9S 2YS6A 5IPAA 2JD1A 5HUQA 4HG3A 3LRTA 4CVNA 1SUAA 2WP8J 3DVAA 2QQ0A 4EJTA 4WXHA 1NJ5A 4RSGA 5AI4A 1BD4A 1YJAA 2QN2A 1VLMA 2W2OA 2X8WA 4GMGA 4RKEA 2VHVA 4PS0A 3GUZA 3V00A 2PWBA 2GHQA 4L75A 3CC4I 4B3IA 2X0NA 4C3ZA 4EGSA 2O20A 1UAGA 3QVWA 3UIEA 3VRHA 4X3OA 3IGFA 3RS4A 1WKCA 2BVNA 2JIZD 2XSZA 5AVQA 1NDUA 2H5EA 3UBMA 4ICIA 3MGBA 5FO1A 2I2AA 5ARBA 1F2UA 3I9KA 3NDIA 1DO0A 3W8NA 1AT1A 1YZFA 2OFWA 1PP7U 2CNNA 5JUWA 1MJGA 2VHUA 5IEBA 2IH4A 3ESWB 5IXSA 2R1UA 3BM5A 3DH0A 1MJHA 1PUFB 4P96A 3N0XA 4MLPA 4J01A 4N0EA 2BY4A 1LNSA 1TKBA 2OSVA 3WGIA 1Y1LA 2F1KA 3GU3A 1U5TC 4QHTA 1GQYA 1NV9A 5CPBA 3T1OA 4C4SA 4JEHA 4EA8A 3ZQLA 2PYIA 3EZYA 2BGUA 4YV7A 1SXJE 1CHNA 1DG1G 1S9HA 2E1RA 2JANA 1U7XA 3SMVA 3QX8A 4AJNA 5C8XA 3R24A 3Q2OA 3KZZA 3RBAA 2FPUA 4FZ5A 5CDGA 4EAQA 3DPLC 1LF0A 2JBWA 1CGPA 1IG0A 4KQ9A 3MRVA 4WKGA 3X44A 2X2PA 4LZAA 2ZYTX 2P2LA 3DTNA 2Q2WA 3QI2A 4GWLA 2WNHA 3G3ZA 1FFCA 1H4QA 1EXMA 1W0KA 2UUPA 2L2OA 3KZXA 1SHUX 2TECE 4K6KA 3ENKA 4KO4S 2AQHA 3RU7A 1ND6A 2O8FB 2XCIA 3OTHA 3GJZA 5TGZA 3SSMA 5I8WA 1V5GA 2KZGA 2DZDA 5GTDA 1BN5A 2XGDA 2GUGA 2DQSA 5FF9A 3LV8A 2JLWA 3ILHA 2BKLA 1TB4A 4BXOB 3P97A 1VIAA 1SVKA 4C2BA 4DDUA 2P9QA 1MO5A 1A4IA 4R79A 1LNZA 3AKEA 4KP7A 5MN6A 4LFAB 1KY2A 1XO1A 3G2KA 4R1NA 5GGXA 2Z8YM 1JIKA 3I8XA 2OQRA 4K40A 1K66A 4MPPA 2BSXA 3K1ZA 3MLAA 4JJAA 1GUAA 3EGDB 4MP8A 2NPFA 2QG4A 1YO5C 5L3SA 2GB4A 2B98A 4TTRA 5C32A 4BH9A 1MPXA 1SCUA 5CLIA 2XRZA 2HOSA 1M8JA 4YMVA 3LP8A 2M6LA 1L5GB 3AZPA 3QVMA 3B1KA 4IHJB 4RVGA 4LECA 3KQUA 1F9EA 1ONSA 4DLSA 2IU4A 2FN8A 1BJKA 3GJXC 1QF6A 1TJ3A 2WW8A 4MVJP 4MX8A 3NETA 2AI1A 3DPTA 2J67A 2YV1A 3W9YA 4N5DA 3EG5A 1QCCA 4W9RA 1BI0A 3SEAA 1CC1S 2CC2A 2Z95A 2ZSFA 2LNDA 3E03A 1GO2A 3MTQA 5M3MJ 4GXNA 5IFLA 4MV0A 2C88A 4UCFA 1H0KA 1PHPA 4EG1A 4CFSA 1V48A 2FPIA 4G0MA 4MKHA 4U7WA 3S2EA 4BE7B 3ETGA 3T8TA 1KS9A 1VPVA 3I1IA 4E5MA 1H23A 4K7JA 4LTDA 3RI3A 4F45A 3PXDA 1U8BA 4QELA 2KKOA 2JFVA 5M5XJ 1E1CA 1NVUQ 3LFTA 1U5AA 2BHZA 3IT1A 2DFNA 4X1YA 1T2KA 3JSOA 1PZEA 1U5CA 2CL0X 2RAPA 5FTLA 1XNGA 2NV0A 4X1YB 2ME6A 1ADBA 4AKSA 1J4AA 1NAHA 2WIGA 4UQLA 1ZN2A 3S1AA 3UFXB 3ULKA 1ICEA 5F33A 3KTAB 4KODA 1PYGA 2I2BA 2A1UB 4FYMA 4PRYA 3URKA 2PKQO 3EIWA 4R6WA 3DKYA 4CXFA 5DYNA 4IW3B 4CYYA 1C1HA 3Q3CA 2DGDA 5IF3A 5EIBD 5IZCA 1JX6A 3DZDA 4JK1X 3LIPA 1T2AA 2BHRA 2XUOA 4I99A 4PZZA 4PHFA 1Q2XA 4W5WA 1BIBA 5AI0A 3ZGVA 4DNFA 5KNCA 2FU4A 1NYTA 5EPUA 1I3CA 2IK8A 5BURA 3KP7A 1OUMA 1LKXA 4BNLA 3L1PA 1RBQA 5AKKA 3FR7A 2MCFA 3GDOA 3LNTA 3RYFA 4PFPA 4WKOA 5AW4A 1ST2A 3BZWA 4MKGA 2NZ2A 3D2LA 4ZMBA 5HRUA 4ND4A 4WUTA 5KNCH 3KP3A 1ERZA 1VHQA 3ED5A 1JDUA 5AVJA 4URZR 5JZ9A 4M99A 2CLMB 3TLJA 3VR3A 5HLIA 4WOCA 3AY6A 5MDHA 2F8MA 5E8GA 3DW3X 3QOFA 3ITKA 2X9GA 1S4MA 3F7TA 5JI2E 4RD1A 2HOAA 2QTVB 1YCHA 4R2JA 3E48A 5DLDA 2GOXB 1NN0A 4PSKA 1B73A 1K5DA 2A4KA 3DU5A 2GJKA 2QVZX 2UYQA 2X7XA 2K85A 2Z09A 4JU8A 4Z1MD 1GM5A 2VHYA 2GYYA 3K1AB 2ID4A 4H0FA 1G4DA 4PXYA 3RWOA 2YX1A 2W4MA 3JATB 3QPVA 3A8TA 2LDXA 3HM2A 4HH1A 1W93A 4JJEA 1I3LA 2VTVA 4EY8A 2EJBA 2H4XA 1E0KA 2BMDA 4MMXB 1WMEA 3T7CA 4FFPA 4GQBA 3CS3A 3R4VA 4HJXA 2DFEA 2PJRB 5FKLA 3M07A 1XHLA 1F5TA 2QHXA 3I32A 4X41A 4WV3A 3WAKA 3G9QA 4MGYR 3GLIE 4ZAGA 1C5KA 3LDAA 2GYWA 1EG7A 2G76A 2O3UA 3PCRB 1RJEA 4P08A 2IH2A 3VSEA 1ND5A 4PSVA 1YJXA 5FTWA 3KE9A 4FGUA 2RGYA 1K68A 1U8YA 1YUNA 2EGGA 2JI4A 1JEQA 2DFHA 1K3TA 3JRBA 4R05A 1IGNA 1NNI1 3KKKA 3L77A 4MCHA 1TK9A 4JQZA 5F7ZA 5G1NA 1JFFB 3JPWA 2F6CA 1QGOA 2JHCA 1SXQA 1POWA 3R23A 1F60A 1SB9A 2XMBA 3GLVA 3QBVA 4BVBA 4C3VA 1HKTA 1IONA 5TLSA 2ZSIB 4HR7A 3OP1A 1V3QE 3D0KA 4E7KA 4S2UA 1DAPA 4X92A 1JSZA 2VP3A 1JDSA 2BGJA 4RFVA 3AW8A 5KO2A 1OCCH 2ECBA 5J6XA 1RQRA 2NO7A 3HY4A 3CA8A 4PF1A 4HWGA 5DT9A 1YQTA 3SF8A 3T06B 2GGKA 1R1VA 3D8HA 3PZBA 4YMIA 2H5IA 1KPGA 1DL5A 2A92A 3PFBA 2R6GA 1E3WA 3OF2A 4JH0A 1WXEA 3LF1A 2G7ZA 3S5JA 4MULA 1LDKB 3UNGC 2OZPA 2DK5A 2ZRKA 3LXRA 4PYJA 3SDZA 5KYYB 2OORC 1UOQA 4XUCA 5GPCA 3ZOZA 1Y6GA 3FA2A 4RA6A 5KOJA 5IKXA 4OHRA 4RH3A 5JXGA 2EG9A 2PZFA 2HRDA 5KWEA 1CUVA 3RHZA 2BFFB 4H1VA 1UFMA 3PQCA 1RRFA 4OLHA 4X1KB 4OHZA 3H8VA 3ASVA 1Z2CA 4REQB 4ENTA 2FQWA 4FYKA 3VFDA 3VA7A 2F5DA 2BWJA 4GYIA 2OQIA 2MTBA 2CF5A 3A9RA 3AKCA 1VMDA 5D5QA 1APBA 4I4NA 3NEUA 2UZKA 1AK1A 1T8TA 3U9SA 2H4HA 3S28A 1YIJI 4R2IA 1K3UB 3ES9A 3QKUA 2CZCA 1XSXA 1D2NA 1XQWA 1WW2A 1NR1A 2SKDA 2LFBA 2H1KA 2LE0A 2OOSA 5IYCJ 3PFWO 4F60A 1DAMA 4AWXA 3E3OA 1TTYA 2PZBA 1PGJA 5KI6A 4MZXA 1UIMA 1HCRA 2NVBA 4RMNA 3ZZUA 2XGGA 2KBFA 4LQ4A 5B1IA 1KEZA 2CHEA 3F71A 4PXAA 3VVCA 4FS8A 5C4MA 3N0RA 2OAEA 1C9YA 3H2BA 4D26A 3U2QA 2VDOB 4HAYA 3D1VA 4M88A 4RESA 5ALKA 3NFYA 5ITWA 3P8KA 1H5UA 4BNYA 3HM5A 4ZC8A 2JA5J 2NMVA 2IP2A 2SNIE 3OJFA 4KAJA 5JSZB 2D4AA 3K9NA 2BKAA 3HB7A 1Z4JA 2J30A 2PCLA 5AIPA 3AEKA 3OMYA 5A4KA 5CJ2A 3CLSD 1NBMA 4WERA 2J9XB 3RT9A 3FMPB 1XMVA 4D0GA 1JQEA 1UC4B 1YGPA 5CA0F 1BVRA 3ROQA 2PM8A 5JXJA 2FPWA 1GV0A 2VDRB 2DBRA 1YITI 4UU8A 2GEBA <