3N05A

Crystal structure of nh3-dependent nad+ synthetase from streptomyces avermitilis
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
584
structure length
568
Chain Sequence
SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Nh3-Dependent Nad+ Synthetase from Streptomyces Avermitilis
rcsb
source organism Streptomyces avermitilis
molecule tags Ligase
molecule keywords NH(3)-dependent NAD(+) synthetase
total genus 188
structure length 568
sequence length 584
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00795 CN_hydrolase Carbon-nitrogen hydrolase
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3n05A03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3n05A02
3.60.110.10 Alpha Beta 4-Layer Sandwich Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase Carbon-nitrogen hydrolase 3n05A01
1QRTA 4DDMA 2V0CA 2D13A 4MUKA 3MMXA 1G8FA 1J70A 4X0EA 1QU2A 2A88A 3ELBA 1O95D 4AQ7A 2PFSA 3VU8A 4I6JA 3ZUGA 1KH1A 1JEDA 2ZUEA 1JIKA 3HL4A 4JFAA 4OJMX 1H3EA 4ZT7A 4G5FA 1VBNA 1F7UA 5KWVA 1UFVA 2DYVA 1O5TA 1EUQA 3L93A 1G8GA 3X1JA 4EG4A 3IMEA 1H1TA 1J20A 2A1TR 3ZJVA 4QREA 2YWCA 3N2YA 1QRUA 2DERA 1MC1A 1M8GA 1GTSA 4HG5A 3P0HA 4U7JA 3LCJA 5H8JA 5JQNA 2VXOA 1GAXA 2WSIA 2H2AA 1T6XA 2O8VA 1A8HA 2PLQA 4MWEA 4EGAA 1FO6A 3ZJUA 3AKZA 2VTBA 1V8FA 1MAWA 1R6UA 4HPWA 3AFHA 4YP7A 1OD6A 2QJOA 3CLTD 2CV2A 1NSYA 4MQ6A 4JXXA 2NZ2A 2DETA 5LLTA 2E21A 1QJCA 4R0NA 3VGJA 1K4KA 1QTQA 1NUUA 5DEOA 1XNHA 1IQ0A 3Q10A 3HFJA 3CVXA 1WKBA 3H9BA 4CYYA 1WJGA 4FZJA 2J07A 1G59A 3K32A 3Q12A 2BTEA 3TZLA 1JILA 2JANA 2YXNA 1N2IA 2B7LA 1MRZA 4XFJA 1BS2A 1ULHA 3QTTA 3ZGZA 2AG6A 1TYCA 4KR9A 3H97A 3ISJA 1O94C 1D2RA 1U3DA 2Z3VA 1M8FA 3IOEA 4MW5A 3HGMA 4NATA 4ZT3A 2CV1A 2DLCX 1TFUA 1PFWA 1WXHA 5IHXA 1OBCA 2YY5A 5TEWA 1YI8A 1GZUA 4F4HA 4XSVA 1NI5A 3DLAA 2A86A 1M8KA 2DPLA 1LI7A 3KI8A 2X1MA 4NX2A 3IODA 4MLPA 3HZRA 4ARCA 1O96A 1O97D 1ZJWA 1XNGA 4MW1A 1N1DA 1NZJA 3QE4A 3FIUA 3IW3A 4GU5A 1I6MA 3IVXA 3BL5A 3H9CA 5FO1A 2GGKA 3GMIA 1UF4A 2YWBA 4MW7A 4EG6A 1TQ8A 4MULA 3MXTA 3OTWA 5K0SA 4JXZA 4HJXA 1Q77A 1LW7A 2PZ8A 2Z08A 4MWDA 1I2DA 1X8XA 4MUNA 5BNZA 3IOBA 2DXIA 1KQPA 4XFDA 2GM3A 4CDMA 3VRHA 1NURA 4PBTA 3IH5A 3SEZA 3HMQA 1KR2A 2A1TS 4MUFA 2VHIA 3A2KA 1ILEA 5TEVA 3CA8A 1ZUNA 3ND7A 4HJRA 1CT9A 2DUMA 1WXIA 4RUKA 3IVGA 2E2KA 4EG8A 2J4DA 1X6VA 1M1ZA 5K0TA 3TS1A 1KH2A 1HYBA 1TYDE 1EXDA 4NAHA 3FG9A 3X1KA 1IQRA 1VL2A 3NBAA 3JXEA 1FYDA 3I05A 4K03A 4KKVA 1EFVB 4ZT4A 4I6GA 1YIAA 3COWA 1O6BA 3PNVA 2C5SA 1MAUA 4MUEA 1LI5A 1OWMA 1QQTA 1YUMA 4AS1A 2J5BA 5AHWA 3UMVA 1QNFA 1T6ZA 2QUKA 5FO0A 2A4MA 1VBKA 1N2EA 1OWOA 1U7DA 3LE8A 5JBNA 4KR6A 1WZ2A 5H7XA 1M8JA 1P7PA 3FNRA 1O94D 2D5BA 5TGTA 4QBTA 2E11A 4CT0A 3DPIA 1MB9A 4U8HA 2WQ6A 1TEZA 3KT8A 4S1OA 4YP5A 1N78A 1T6YA 1WQ3A 4CYGA 3RK1A 4ZT6A 3CR8A 4MW4A 4F3RA 5F23A 2TS1A 2RD2A 2DYUA 3SZ3A 4ZCQA 1O0BA 1IFXA 3H99A 4EG1A 1NUPA 1YUNA 3PXUA 4TS1A 3KT0A 4G6ZA 2CV0A 5KCMA 3GLVA 2E18A 3ZXIA 1N2HA 3FDXA 4NAUA 2XRZA 2PG3A 4IZVA 2IP1A 4PBSA 4KR7A 1Q15A 3KT3A 1N2BA 4CDNA 2EJCA 4YMIA 4ND6A 1GTRA 5H8IA 2CYBA 4J76A 2ZUFA 4DE5A 1J09A 4MW0A 2X3FA 3COYA 1KQNA 1WQ4A 4OUDB 1WOYA 2R5WA 1R6TA 4ZCTA 3IVZA 3IUBA 1M8PA 4PBRA 1MB2A 4ND7A 3CVWA 2DR2A 4MVWA 2DEUA 1QU3A 1TYBE 5J59A 3UY4A 5H8KA 1WXEA 3K9WA 3WUYA 3QTBA 2IELA 4Q93A 1G8HA 1PG2A 1S4MA 1JIIA 1COZA 3CVYA 1OWPA 1MJHA 1DNPA 3SZGA 1NP7A 4L2IA 2CYCA 1GPMA 3ND6A 3PNYA 3RHSA 1F4LA 3CVVA 4L2IB 2W1VA 1I6LA 1JGTA 4MWCA 4A91A 4IZTA 3GUZA 2IJGX 1JIJA 1ZH0A 4UZFA 5IJXA 5TS2A 4EF6A 1V47A 2E89A 1OWNA 2QJFA 4U63A 2VHHA 3TQOA 1XJQA 5FNZA 1EFPA 3FI0A 1JECA 3P8KA 4RPIA 1U0BB 5H8LA 2CT8A 1F7VA 2D54A 4KZFA 2I1LA 3D6VA 3IUEA 3FWKA 1JHDA 4OUDA 1IHOA 4EG7A 3AG6A 3G5AA 1K92A 4NDAA 3RFFA 1PFYA 1JZQA 3NBKA 3TQIA 5DASA 2GGLA 4ZCRA 4J75A 1QRSA 3E27A 3CLUD 4EFKA 3D6UA 1GN8A 3IMCA 2QTMA 3MUEA 5J58A 3DO8A 1B6TA 2J08A 1M83A 3UOWA 1EJ2A 1UF7A 3G59A 1N2JA 1SURA 4YP6A 1I6KA 4HK4A 3ZJTA 2CUZA 2ZP1A 3PRHA 2XRYA 1MOPA 3CLTC 4DNXA 4ZCPA 2A84A 3M5WA 3A04A 4I6EA 2A7XA 1EMSA 1NUTA 3CLUC 4DDHA 1O95C 4ZT5A 2E2LA 3SDBA 3CLRD 1N2GA 1J1UA 2OQ2A 3P52A 1GLNA 1KQOA 3CLSC 3F3MA 4MWBA 4ZT2A 2BYTA 1J31A 5HUHA 4MW9A 4Q16A 2AKEA 1FFYA 1YULA 2A1UB 3DV2A 4EG5A 3A05A 2GKSA 4H5UA 2OV4A 3HV0A 3IDFA 4DLPA 4JZYA 3RBAA 3IVCA 3IMGA 2V0GA 1K4MA 1K97A 1RQGA 2EL7A 4HGDA 3COZA 3A4IA 1PG0A 3ILVA 1VBMA 4WNYA 3RK0A 3SYTA 2A1UA 3MLAA 4YBRA 3KLCA 3CVUA 1J1ZA 3ZXSA 1KAMA 1WXGA 1EUYA 1ERZA 4MW6A 5HUJA 1KP2A 1MBZA 3AIIA 2RE8A 2X1LA 1KORA 3AL0C 1JEEA 1N75A 2PZAA 1N77A 3RJZA 4DDKA 1O96B 1T9GS 2QUIA 1NUSA 3OP1A 3TZEA 1JZSA 3IOCA 2QJTA 2UXYA 5LFAA 4DJAA 1OWLA 4BWVA 2PZBA 3N9IA 3H05A 2J09A 5H16A 4MVCA 2CYAA 1N3LA 4IZSA 2GOYA 3Q4GA 1T9GR 1IRXA 2H29A 1KKUA 3COVA 1VLHA 1Q19A 3FETA 2JA2A 1NYLA 3C8ZA 1YIDA 4H3SA 2WB2A 3NV7A 4NZPA 2JAXA 1H3NA 2PXHA 4GYNA 3S3TA 1O0CA 4MUGA 4MUIA 1IH8A 2G36A 1N2OA 4WSOA 1UF5A 2HZ7A 3LOQA 3N05A 4R2LA 2CFOA 3HKXA 5DK4A 4E1AA 4CYFA 1EE1A 1IVSA 4HG3A 3U1VA 2O5RA 1WY5A 3FH0A 4LF0A 1O97C 3CLRC 4MAFA 4QRDA 2PIDA 4ZCSA 2E0IA 1U7XA 4KPUA 3UK2A 4JYZA 4IZWA 2NSYA 2WQ7A 3FOCA 1KAQA 1NUQA 1IQUA 4MVYA 3KT6A 2VTBB 1Y42X 2Z09A 3SP1A 3MLBA 1PFUA 3FY4A 3ND5A 1F89A 1Q11A 1ZH6A 3P0JA 3INNA 3N8HA 2HGZA 4MW2A 1PFVA 1KH3A 4K0RA 1WXFA 4EG3A 3P0IA 4MUHA 2QUHA 3FHJA 3UC5A 2QTNA 4PY2A 1JMVA 4MUJA 4R2MA 5J5AA 3SEQA 1H3FA 2CSXA 1UF8A 1KP3A 5KHAA 4CQNA 3CLSD 1F9AA 1EFPB 3G6KA 1R6XA 4KPUB 3L92A 4UZEA 3TNJA 3X1MA 3AG5A 2X0KA 4GYLA 1U3CA 5LM3A 2AZXA 1OBHA 5DB4A 4P2BA 4MVXA 4G5YA 1XNJA 3ZIUA 5EKDA 3KFLA 2QTRA 4GRIA 2QUJA 3PNBA 5HG0A 2HMAA 4IZUA 1TYAE 1EFVA 1J21A 4ARIA
chains in the Genus database with same CATH superfamily
5G0TA 1DUVG 2Y1KA 3MJDA 5KX5B 3VKGA 3CBGA 5EE3A 5IM4A 1O54A 1JHAA 2AS5F 1EM8B 2C3OA 4G1UC 4N54A 1P0PA 3W4KA 1EWTA 4L73A 1YB7A 4C01A 4I19A 4TWAA 1FJHA 2DFEA 3ESWB 3E6MA 4WECA 5E17F 4HR7A 1XQXA 4B7UA 3DF8A 5B2FA 1ETUA 2YHUA 1EVEA 2YINC 5CGQB 1USWA 1W85A 1G3IA 1GNSA 3TBHA 3PSIA 3G9XA 3SC2A 3MYYA 4IQGA 4ZYHA 2JVHA 4YCSA 1OI7A 4L16A 5HKKA 1OI4A 5HVQC 1N6KA 4JLAA 4RQBA 4ZRNA 5EIBC 1AK9A 3CY6A 3BG6A 3IL2A 2ZJAA 4O2LA 1ML4A 4S3MA 3CTPA 4YRMA 3O4HA 5C8YA 4I4LA 4NDNE 2BEKA 4QDTA 1JUPA 3C3AA 3S4YA 3CDIA 4AJ2A 3SDGA 4EG4A 1JJFA 1KJWA 1TUEA 5EZQA 3R20A 3HO6A 3BWVA 4M99A 4NOMA 2XHEA 2V6JA 1WOMA 3PO2J 4QICA 1P6QA 1M8GA 1XSEA 5ALDA 3P0HA 3I9FA 1LK0A 5IEBA 2VJJA 4H7PA 2P9BA 3BJEA 1QGOA 2Y1LA 2CXXA 1QWSA 4I1OA 1R27A 1EINA 5F1JA 1BKYA 3LK7A 3RWOA 1OD6A 2CV2A 1PEAA 1M0EA 2P6SA 1V37A 4BNIA 2L18A 2SHKA 5EYPA 3DZGA 2FWBA 5JAZA 1UJ5A 1MAAA 3GFQA 2WTNA 2DA7A 1M5RA 1OU4A 2YW9A 4FD3A 1KDTA 1HE1C 2HQ5A 1MMSA 1TPYA 3E22B 1V7QA 5M5YJ 4MB6A 1EXWA 1FFXA 2O7QA 3OF3A 1EWQA 4INOA 3I64A 1YITI 3S2DJ 5ALHA 4B8YA 3LQQA 1W2GA 3OZCA 3U4QB 3IP9A 2FZ4A 3F90A 2I03A 3FLAA 2AYZA 1WKBA 4KA4A 4IJKA 4CPDA 1UHMA 3CXRA 4BCDA 1GSHA 3BD7A 2Y1CA 1DIGA 2EG9A 3IAS6 1H9GA 3L1PA 2FPWA 5HW0A 1ZUIA 3P9PA 5D6NA 4E4YA 3CMEI 1QE0A 1Q1VA 2H4FA 1I4EB 2H5EA 2G9QA 4KLNA 4RKYA 2OD9A 4Y2TA 3W4IA 3NTQA 3WL5A 1JF8A 4ENSA 3D7KA 2C2KA 3P4YA 3M8JA 1MRZA 5KQRA 1WH5A 3L6UA 5M5WJ 2VDMB 1Q20A 5IJZA 4A0SA 1EVIA 4KX5A 4HEHA 3RSCA 3FFAA 1M8FA 4G9EA 2C57A 2GD6A 3R9XA 3DEIA 4ZQEA 4GDFA 4RD4A 1OYIA 2Y27A 4BO3A 4E6EA 1G2HA 1QQ5A 1US8B 2DCMA 2OC6A 2P4HX 1ZGZA 2O4CA 3DV0B 3PU6A 1GA6A 4GKAA 5DXJA 1ACLA 3GH1A 3N6VA 3ZDBA 1EHIA 3DAFA 4GKKB 3IE0A 1AO3A 3KZKA 4GZLA 4QBHA 2ZWIA 4ENMA 1A76A 2K4JA 3LF2A 1RZ4A 1GN9A 1LX7A 3PFCA 4G67A 4GE3A 4JGGA 4RABA 3CJRA 4RAZA 4I3GA 4C0QC 2CU7A 3PCTA 4PX2A 4HYEA 5FTMA 4RTSA 4FHEA 4OXNA 4IEFB 5EMNA 2W2LD 2WVJA 2QW0X 2AXEA 4V24A 4AJ1A 5B7NA 3WA7A 1IW7F 4HS4A 3DVAA 4H7DA 4TKMA 1QE5A 2QRKA 3DDSA 3U7QA 4B4KA 3BRWA 4P5EA 1NN3A 3HFRA 3QELA 1AN9A 1MJBA 2V98A 4PTZA 5A04A 1FLVA 5EIFA 2K4BA 4ZGWA 2VYVA 3GBVA 2OUKA 2XNSA 1YQQA 1QRAA 2C95A 3K2BA 5DYGA 5CA1A 3NBFA 1OIXA 2IYRA 3RRYA 3ECOA 2DXIA 1MORA 2CMFA 2EJTA 2IYLD 2K87A 4XFDA 4IQFA 4OFBA 4B2IA 4LFCB 3AETA 3UV6A 5DGXA 3AH8A 1N5RA 2P1ZA 2Q5LA 4NU8X 2BFEB 2AMJA 2XE4A 5HZHA 2BKLA 4AY4A 3H87A 1JHXA 3GT7A 4Q37A 5JNWA 5DPMA 2VQEB 4OIMA 2XC7A 1E6MA 1NRWA 2I33A 5KYUB 2AXPA 1BDIA 1QPMA 1YJWI 5J23A 4ODIA 3KFWX 2PLRA 2E19A 1D4ZA 3WE3A 1QP8A 2FPOA 3FCCA 1BA2A 2DA4A 4A9AA 2UXDB 1SC4A 1Z7EA 5A6VA 1XZGA 2QSJA 3S1NJ 3SX4A 3L3BA 1LKXA 4YROA 3QE9Y 4U00A 5KSZA 1D6SA 5EG0A 5L51A 3E7FA 2FOIA 3GYBA 3PUVA 5AO9A 3W8RA 4ZHSA 3FMGA 1Q57A 4RS8A 3FE2A 4RHUA 3O73A 4EB3A 2EINH 2C5LA 3QLEA 3KUCA 1M1NB 3CNHA 2OV7A 3EWNA 1XKLA 2OHOA 5E6UA 2ZBDA 2E35A 2KJBA 1CFZA 4F6CA 2F1JA 3QWBA 4MEBA 1JFTA 1NR5A 2XGOA 4X1YB 1AF7A 3H8VA 5E3NA 2CNLA 3LOCA 1TC2A 2KE5A 4PQRA 1H2BA 3WGLA 4BLSA 5JD5A 1OLSA 3I2HA 5AHWA 4X91A 5AW9A 4HVLA 3UGJA 2C88A 3K5IA 4Q9LA 1UXJA 2LK2A 2QUKA 1S3FA 2IX9A 1NMYA 2JFOA 3C3XA 5EE9A 4BV8A 2YRXA 4A3SA 1ZN7A 3ZE7A 5JS7A 2AOWA 1H05A 2XUJA 1KF0A 4OXIA 5H7XA 3R7DA 1O5OA 5CJ9A 2XDAA 2ODTX 1HSTA 2A0UA 4D8UA 4JIGA 2KBEA 1EE2A 4OOFA 1U8BA 1GUBA 2GJ9A 2KS6A 1QBGA 2VKQA 2XCIA 2ZRJA 3GJ8A 3KS9A 3K09C 4WN9B 5LLDA 1TEZA 1OILA 3H3JA 221PA 4J0CA 1FC3A 2CL0X 3D6NB 4BP8A 1BOOA 1J2EA 3KXPA 3RASA 5JISA 3VWBA 4MPDA 1WAMA 3DLBA 2K9NA 3MTEA 1IWOA 3QA3E 1YQAA 1KY5A 3QOEA 2BHTA 3ED5A 4JLMA 1FLDA 5CB4F 2QN9A 5FV4A 5H4GA 5AJZA 5F04A 4OLAA 1QS0A 1E2HA 1O0BA 1WJBA 2ECKA 3ETDA 3A4CA 5J4YA 1GPBA 2BR4A 2H7XA 2JZNA 3KT0A 3QBDA 4W4TA 5JG7A 1T43A 1MX1A 2OEPA 3E18A 3AG4H 3ORYA 4HYTA 1XGMA 2B1GA 3PLRA 3EUKL 3G3EA 3K1YA 3REQB 2ID6A 5LGTA 4RYLA 2IU0A 3TTVA 3ZBUA 2DK8A 2H5IA 3FMPB 1FTWA 3G5LA 1OYOA 1N0VC 4CODB 1H88C 4JUAA 4IHVA 3KT3A 4PAOA 2I2BA 4WD3A 4ZPXA 1R3UA 4OM8A 4J49A 2E7XA 2M9MA 4G5XA 3W7VA 1U4NA 4EPXA 1NL3A 4GM0A 3ABLH 4P7BA 5J5CA 1ISPA 2F3RA 2M6KA 3OCJA 5IDWA 4U5QA 1P2VA 4KICA 2PTGA 1WOYA 2X1HA 1JYEA 3PEUA 4A3CJ 3DZJA 3E0QA 2PNJA 4RZSA 1PLJA 1TKRA 3ZXUB 3PKJA 3JCUC 4GZMA 1FYXA 1RKWA 2O8NA 3CINA 4P36A 1GRVA 5E6UB 4EB0A 4ZJPA 3HVJA 5KC9A 2K85A 4M3FA 1NQ5A 2X5NA 4CIDA 4XLFA 3LAPA 3IAAA 3KOUA 3RW9A 1U2TA 2CRGA 5EYRA 2ZJQF 1Z5WA 2I4NA 2FZVA 2NNWB 1UELB 4FT4A 4IJ6A 1LH0A 2JUGA 4JUBA 5TMDA 1YMUA 2VAPA 3EHDA 3V1KA 4BATA 3WLKX 1YRQA 2GPYA 2OHJA 4KWTA 4RIFA 4A0FA 3K0SA 2VQ3A 2H17A 3GY0A 2IYZA 1ESEA 1UF9A 4FHFA 1V1RA 4QQ8A 1UCRA 1EWRA 5TR9A 2FKNA 1ECBA 2ZROA 3PC8C 3RS7A 4OHKA 4GOND 5BSKA 5KTMA 4IW3B 5TMPA 1TM3E 1Q21A 4P86A 1OFGA 3DNMA 1WB4A 2HNBA 1LLFA 3C8DA 1S2IA 2IEAA 3TINA 3H1GA 2OV2A 2G8LA 3NGMA 1RHKA 4WERA 3FCUB 3CNBA 1PS8A 4II3A 4EJSC 2FX2A 2LKXA 1SPBS 4JI6B 1BI1A 3WYCA 4FGSA 4TLAA 4CUKA 4CMIB 1SMYF 3GQVA 1XJQA 2ON6A 4IUBS 4YNBA 2OFPA 4ZYTA 4OK6A 4BH9A 1CFJA 2H9IA 2P9EA 1M3SA 1ZKMA 3LXXA 4JEMA 4X00A 5I6DA 4IY1A 3GWZA 4J19A 2CFXA 4I1PA 4UQPA 2VZ8A 1BXKA 2DAOA 1FPMA 1NKVA 2V79A 1QGZA 1Z5OA 2WSSA 3P9SA 4GMGA 4IH9A 5B58T 4CI9A 9LDTA 1BA5A 1DXHA 1WULS 4S1VA 4J16C 1ETQA 3NHFA 2WMYA 1GEEA 4ZVMA 2JFYA 3QELB 3VTFA 3U3DA 1I24A 4TLDA 5DHAA 4Z4IA 4P9UA 3R3HA 4YB8A 4MPTA 2GK4A 4ZYWA 1NG7A 3LSMA 2O57A 3HEMA 4LF5B 5GAGJ 1BI3A 1BNCA 1OIVA 3TMOA 1TM5E 2HUNA 4QJ5A 3ZDFA 4LXHA 3B3FA 4YFYA 1TJPB 3KR9A 4RV4A 4B75A 3ICQB 2NU8B 3EIFA 2NAZA 1FUKA 5TLSA 3VUFA 1V43A 2W2KB 4I9NA 3TAUA 1X74A 1P2DA 1H5NA 3VSDA 1M1EB 1Q2UA 3COSA 4P81A 3O4RA 2C4KA 1HKUA 1QZZA 3OM0A 5ENZA 2X0DA 4O3MA 3EPKA 2IYWA 3E84A 4BUZA 4RHTA 2B82A 1UBEA 3ZZTA 4DM4A 1I6KA 1A8PA 2W9XA 1QDUA 1I9GA 2XTAA 3BGIA 3C5WP 4HK4A 4YRCA 3FOBA 3RJ5A 3RVSA 1XP5A 4B6FA 5EWMB 4C0HA 2G5GX 3CT6A 2RBGA 4W9RA 2SKDA 1EXMA 4KYIB 4LKRA 3WK4A 1ZSYA 1NV9A 3JVVA 5CLIA 4XICA 1CUDA 4FIDA 2PBIA 1NRXA 1YJBA 1DUIA 3BSFA 1X2MA 2VR1A 1KKLA 2B1IA 4O4IA 3AWIA 4ON9A 3W77A 2O8FB 1Q0TA 3G2KA 3SDBA 1IAWA 2WABA 3R3JA 1R37A 5M3MJ 3W3AD 3ZZNA 1U63A 1ZIXA 4RIGA 5E18F 2XDYA 2XITA 3L9WA 5E1MA 5BQTA 5EKSA 2ZSHA 5BN5B 2Q5IA 4B6JA 4BQEA 4A2UA 4HUQA 5ICMA 1UZNA 3BTLA 3RIYA 5SZJA 3GL9A 1FBQA 2OLEA 1I50J 3E9NA 5DYNA 4R3NA 1YTLA 1R5GA 1GTMA 3QQPA 4H5UA 3IDFA 1FFXB 3HL0A 1CUAA 1Q0SA 2DG2A 2B35A 2GXUA 3OY9A 1UPBA 3SYTA 5I9IA 5EYPB 3NOQA 2D1FA 4CMAA 1JIVA 3B5IA 4MWZA 4EBFA 1N1EA 3ZU6A 4C1NA 3V8LA 1I2AA 2EBWA 1PN3A 4GVXA 3ZWCA 4AJKA 1BROA 4XJTA 1UAGA 4RJJA 2K5UA 4YK7A 1I7SB 4LOHA 4AMGA 5JJBA 3CC4I 3EAGA 2ISYA 1GZSA 2QL7A 3B8HA 1VQ7I 3QVLA 4L0MA 4M0FA 3HGGA 4H7EA 3CE9A 4QE3A 1NJ2A 4YHBA 2D2EA 3SM3A 2E1OA 1UPTA 3OX3A 4W1RA 3CB4A 1GQFA 1Q7EA 3GB9A 1O96B 2ZJ6A 3O8OA 1W9HA 4KL8S 4Y15A 1HDDC 3I6YA 3RFUA 3UT5A 1YB4A 4JLBA 3OPMA 3LUPA 2YCBA 2ZE6A 2FQ4A 4ARZA 4ZOLA 1F3LA 3MTQA 4KXUA 5AI8A 5LWQA 2JLVA 1WL8A 1NVMB 3PIDA 1VG0B 2XTMA 3RSHA 4OK3A 4EEKA 5JMTA 2CYAA 2EGGA 3TO7A 2J5XA 4LV8B 1I7DA 1UP6A 1V39A 2I1QA 3DUFA 3REQA 2PSFA 4LB5A 1T9GR 3W8FA 5LHHA 3QENA 1DX9A 3IC7A 4PR3A 5FYDA 1W85B 3RVLA 2OO5A 3FETA 4UB8C 4L9SA 4FFNA 2G9WA 3D3WB 1B6SA 3I52A 2YFKA 3TLEA 3K6SB 1VPTA 2LXNA 4F6RA 2VP5A 3WE2A 1R0KA 1VFPA 3FHNA 2UZ0A 3RSOA 1I30A 4TLBA 1WMEA 3SFZA 2DPYA 4YLEA 1Z5VA 5AIPA 3KPVA 1E1RD 4R8RA 4WSOA 4XGKA 3X2QH 4Y2GA 3E8SA 1UF5A 3PQCA 4Z7QB 3DMHA 2IXFA 2VNKA 3OE5A 4MKHA 5EINA 1DQZA 3IAUA 1ABFA 3DTVA 2G83A 3TGLA 4R2LA 3DOFA 5ERYA 3G1LA 4Q1DA 1TLTA 3ZGVA 3T4UA 4YX9A 5KYNA 3GD5A 1MDBA 3EULA 3HYNA 5HOQA 4M22A 5K0BA 1QHGA 1HR0B 1THMA 1Z7YA 2BVNA 3IAFA 2DCEA 1DC5A 4JP2A 1NT2A 2JD2A 2YXBA 3CIOA 3M6FA 4OLFA 4PO1A 2VDRB 2B2CA 4A0GA 3W6NA 1O9GA 3RAGA 4RV5A 1ZD9A 3A6LA 2IY8A 4ZCSA 4A03A 2GIZA 4KG7A 1ETXA 1SFRA 3FXRA 3WZLA 3FOCA 5AKZA 1LFBA 5TPWB 2RNGA 1HOMA 4L85A 3SZPA 1WMDA 3E3LA 1FTNA 4ILEA 2WEKA 4L7VA 4TV9F 1K6IA 3WL4A 4A73A 4LLLA 3B6MA 3G1UA 2JKVA 5CD1A 3BZKA 2G40A 5AHRA 4NQWA 1XPXA 2OCXA 1NT4A 2RH8A 2V9CA 1JQ3A 3N8HA 5B30A 1Z37A 5K09A 2XGEA 2J41A 4TQAA 1MBGA 1FU7A 1MIJA 1U2PA 1W30A 3ASVA 4H7IA 3OO0A 2PBRA 3RHFA 5A0TA 5TGDA 1BKDR 5K8CA 3OCZA 1CLUA 3GCZA 4RL4A 1EM6A 3W7BA 1K3FA 1V55H 1SFXA 3K9CA 3U1DA 4FJ2A 4L8YA 3VJLA 2V4JC 3G0CA 4WEQA 4DWWA 2WHPA 4FZVA 1VQOI 2AKYA 3HEAA 2GILA 3P32A 5FORA 1RRKA 4PWZA 5A4JA 1XE3A 4FD2A 2RC5A 4OHXA 3QY9A 1SK9A 3DZ8A 4G1MB 3IIKA 2RGVA 3DVSX 1WTAA 4BFZA 5FLXZ 3QEKA 3IRRA 3RSSA 4RMGA 1R9MA 4GH5A 3X1MA 3EMKA 2CNBA 5F52A 2QMEA 1M6NA 3K9LA 2L69A 3ZOBA 1QIJA 1P29A 3IUNA 4JCCA 4UEJA 4F72A 1ZRHA 3K6SA 3KSUA 3V8VA 1UKAA 4AT1A 2FR0A 3L84A 1I2BA 2OP1A 1U2ZA 1AUPA 2EX1A 2O0JA 5BOSB 4BBAA 4R1MA 1Y8AA 3J81k 3IKLA 1L4MA 3FNHA 4WFQA 1HQDA 3FVQA 5EA2A 4KUEA 1VJ0A 1E94E 3KLPX 5AJWA 4F9TA 4D25A 3CPSA 3A1TA 3IMKA 4U39A 3O84A 4PPNA 1CC1S 2PGNA 3KYDA 3TLXA 3LZ6A 1KEWA 1WS6A 2QN3A 3A31A 2E3JA 2ZS7A 2KRHA 1ZGBA 4PO9A 4HKTA 1OZGA 1NYRA 4MICA 1NP3A 3OPYI 3W8EA 2E2JJ 1M2FA 2JSCA 1QLHA 3C1TA 4WPGA 2FF4A 1HQYE 5DULA 5FA6A 4OLBA 1F0YA 1EPUA 4I46A 4F6LA 3G7SA 5EQJB 3VU1A 3LGAA 1GCOA 3QMWA 4F0JA 1Q7BA 4JFAA 2YUSA 2F1HA 2AQKA 2QG4A 1Q7CA 4G5FA 3QVJA 4PDKA 1JSLA 1QV9A 4JP8A 1OA0A 821PA 2ZXUA 2WPDD 4X95A 3KG2A 3OZUA 1GZ7A 1GVDA 4HAVA 3IUMA 5BNGA 2A1TR 3UHFA 3EVEA 1KJYA 1L4EA 4ENVA 1SQ5A 3GRAA 1RZRA 2I7DA 2IBMA 2FDRA 3JARA 4R51A 3OQNA 3T3PB 4LQCA 2TMKA 5KPDA 5ALJA 2AK2A 5A1TA 2F9LA 5KHLB 1VPDA 1IPEA 1I3KA 4YAKA 2MD0A 5CG1A 2OTJI 2DQRA 2AJDA 3DPLC 1ZR2A 1OOEA 3LSYA 4MCAA 1WHTB 8OHMA 1E63A 3ZYZA 3U17A 4BNFA 2Y75A 4IIYA 3P0FA 2JSPA 2H27A 5AK3A 4YP7A 5ITSA 1C1YA 3OYKA 1XZKA 2NO9A 3V2UA 2ODEA 1WHSA 3D43A 4LYHA 1Z21A 3K71B 4JXXA 2DZDA 2PN1A 2CZCA 1MOZA 4FCVA 2ZTUA 3W2HA 4F8YA 4AJPA 3G9ZA 4I0AA 5JJIA 2AZMA 4O4IB 3HXMA 4J4HA 1IN7A 3KHTA 1LPSA 1N1MA 2GN8A 2W6CX 2WKSA 3QMVA 4IG9A 1ZOIA 4TROA 3U9LA 3VGJA 5CB6A 2BSAA 5BMVF 4XLTA 1IQ0A 1C3JA 1K5DA 1Q2XA 2GXQA 2BL4A 2R47A 2YQ4A 3Q10A 4OHUA 5EWJB 4BBRJ 3TG8A 2R6GA 3X1XA 3K0KA 3Q0EA 4WF2A 4ZAXA 1MHTA 2PUGA 1LEBA 2I3GA 1JHFA 1AKWA 2VQ6A 4XR9A 1TWHJ 1NF8A 2A9OA 2HM7A 3D5TA 3I9NA 4HO1X 4PX3A 2E48A 4RMNA 1Y48E 1N2IA 2INGX 1KIMA 5HEKA 1T3TA 3DSRA 3OD1A 4HA8A 2H2WA 3VODA 2O61A 2WIGA 1RPNA 3BTSA 2IHKA 3K4HA 4NDZA 4QD3A 4RHCA 3UM9A 2DT6A 1BCRB 1IM8A 4MEXF 4KR9A 1NM5C 4F3CA 3F21A 2YXLA 4CZCA 3FBWA 4NFHA 3KPHA 1E7YA 1QNTA 1QO9A 1VA4A 1WZUA 2PUWA 3GOHA 3VC7A 4ZT3A 2CV1A 2IS2A 4U9HS 3STHA 5FAXA 1D2MA 1U3EM 1T0HB 2ECFA 2CXNA 1DWPA 4NIMA 5D5WB 1PWEA 3EK2A 1YI8A 5HS8A 1BI2A 2A07F 2AOTA 3I9V6 1M2VB 4LI0A 5DM70 3CJQB 1ZIOA 4FBMA 2JUCA 3B1VA 3S1LA 1P75A 1DTWA 4YJ2F 2QUAA 3TDUC 3FB4A 3JVIA 3WHLA 1P7WA 4XQFA 1O97D 1S7CA 3MBKA 3QEMB 1IHUA 2R60A 3KVRA 3FOWA 4GOMD 3FIUA 3W9UA 1P2SA 1RJ9A 2N3ZA 3DWFA 3RFXA 2H7VA 3THWA 1RPWA 2CD7A 1JAXA 4BNWA 2VPQA 5KOJB 3FR8A 3PNKA 3C18A 2ZRQA 5A2QZ 4A2CA 4DXDA 3JZIA 3IPYA 5KNCH 5E9JA 5ETJA 5F9MA 3LT5A 2J32A 3W2EA 3F8MA 3WQHA 4MW7A 5C8VA 1WSWA 5DH9A 3I5XA 4U7GA 2JCSA 4PQEA 1E3MA 2X0LA 4IOLA 1DKPA 1GGEA 1ZISA 1HSJA 2Z08A 1RXUA 4FINA 4JL6A 1GTVA 3FISA 3W5SA 5H9VA 3OYLA 4TT3A 2JFQA 4GGPA 2CSUA 1SD2A 2VRNA 3HBNA 3O2JA 4QXOA 5E1WA 5EJ5A 3G2BA 1MQ8B 2GVZC 1M6WA 1SXIA 1GKLA 3N2KA 4HAXA 1RBYA 4E03A 1ETWA 1P8JA 2H85A 3BXGA 1J07A 4YFNF 1HTWA 4JBAA 5EL0A 3VH1A 3EAQA 4R3UC 3OLWA 2Q99A 5K5OA 1GPLA 2I8AA 4YACA 1UFQA 2P67A 1UFRA 2QLFA 5JNSA 4HJRA 5EIBD 3QPTA 2PFKA 1EB8A 3GTOJ 2WF7A 4JC8A 2ZR0A 4BHTA 3GPIA 1JIUA 1RTTA 2QU8A 1UQRA 4G1BA 3RC1A 1DKOA 3I37X 3NWBA 3ONFA 4LOAA 1G21A 4CCOA 1VL5A 1D0SA 4FYYA 1H6AA 3BE4A 4D57A 1KZHA 4DC1A 4OI4A 4F2HA 2Y2ZA 4AIHA 1TM2A 2DK5A 2Y9MB 4POAA 4MLOA 2CCJA 4CCYA 3NBMA 4M1EA 1ZS9A 2VIIA 3W2VA 2K9QA 5BQ5A 4M6WB 1IQRA 1R00A 1WSDA 2W4SA 2WJHA 3KCNA 1WUYA 4DSAA 1H2RS 1NVEA 5B7QA 1Y34E 4NCXA 2ZXHA 1FLIA 1B1CA 2B2NA 4XUCA 1EVYA 1J7KA 2XYVA 5IAGA 2FRHA 3VO9A 1W0JD 1ZJYA 3FF5A 4ZYDA 1GG8A 3GDWA 1IY0A 4YAUA 5L6MB 4RDCA 4UUMA 2P0WA 3SBEA 2HTJA 3UMVA 2RBKA 3OUZA 2JLBA 2PZGA 4JD5A 3BC1A 3ET5A 4YMVA 1UMQA 1X70A 3CONA 1EEXB 2BW3A 1Z4PX 2XKAA 4TQUS 1ORVA 1A9TA 1OV6A 1EP3B 2B69A 1C9MA 2XTNA 4QUHA 3CISA 1GHTA 4KGXA 1EYZA 3MVEA 4JHLA 5F0HA 4YTEA 4RENA 4CHTA 1HT0A 3NVAA 4DY4A 5F76A 3BT7A 3L1JA 3LC2O 2HPZA 1HEUA 1Z9CA 1PQWA 2L7KA 2WV7A 4HBGA 4LECA 1U0EA 4BO7A 1Z5ZA 4O08A 2RIRA 1KI6A 3ICCA 4WN9A 3WIOA 4EW2A 5LIPA 4MITA 4LWZA 2ATXA 2YNMA 3A11A 5JARA 1N78A 1EH5A 1LZKA 4YDHB 3EWAA 5ARCA 5JPDA 2X3UA 4F3RA 1SAUA 2O7SA 2ZW9A 3GEZA 4FXPA 3ILHA 4HX9A 4ESEA 1IHYA 1Z5NA 1LTQA 2HFJA 2W6OA 4FGLA 3SQMA 4B81A 1FSEA 2XUKA 3I01M 1T0JB 2FSHA 3HU5A 4W5JA 4BE4A 4DLVA 2COMA 2MINA 2HXSA 3QKSA 3UKGA 1CR6A 1SCUA 4HQKA 1DIRA 4LHWA 5JPIA 3LT1A 4AROA 5ADHA 3ZN1A 1G21B 3GFMA 4WKPA 5BV2P 1K68A 4NJOA 5HRUA 1M73E 4OUDB 1TD9A 4N8SA 1UFMA 3W2GA 3RDIA 4B5LA 5KWVA 5ESDA 1ONVA 2X4HA 4X94A 1I0IA 2FOWA 3QG1A 2DQSA 4MDYA 2AL7A 2GYYA 3COPA 3P96A 4FYKA 3DJFA 3VMMA 3M07A 4MVJP 4ANFA 3Q8MA 5IMBA 2ZUFA 1N1GA 1YSCA 2G6BA 4QOSA 1F1BA 2IXSA 4Y1RA 2FUCA 4OHVA 1DEKA 5D87A 2OFXA 3LDAA 2Z9CA 1G9TA 2D1RA 2WYWA 2KB0A 3K4KA 1L9XA 4GHWA 3CXUA 5FKKA 1Y39A 1DRUA 4MP8A 3TLZA 5LU9A 1OMIA 4O8ZA 2HBZA 2IUTA 1D2GA 4RK5A 4ERXA 3KXIA 2QI9C 3K20A 4QODA 2C7GA 4CHGA 4Q9KA 2JL1A 4D4LA 2WNHA 3WJ7A 2P3SA 2I80A 2OF7A 1BXGA 3AJ8A 1TKBA 2DUUA 2JLAA 2R68A 2WVHA 3UENA 4E88A 2HLDD 1SAXA 3MRXA 1AQJA 2EIMH 3OHMA 4OQNA 4XPIA 2EEPA 4Y6OA 3S5JA 1DKQA 4YT2A 3FXMA 3C14C 4PLFA 1VHLA 3R6LA 1SHKA 3KTDA 4ZALA 1GM5A 2GLOA 3SHFA 1S4MA 1VHJA 2ZYAA 3RBZA 2XLBA 3I73A 3O38A 3R6TA 3HJEA 4XX0B 1RZ3A 3IT3A 3F73A 2DRIA 4L9JA 1HCRA 2WG1A 5LP6B 1WI3A 3X44A 2MR5A 3OY2A 1X9HA 3FLBA 3KAQA 7ADHA 1X1AA 1K6OA 4TKUA 3AIMA 3RUAA 3VOTA 3CCMI 4E6KG 3NQOA 4WHMA 1ZCJA 1NHAA 1BG6A 2VA8A 4KSCA 4ZCLA 2QD4A 3NBQA 2H4XA 4RY2A 1E1MA 1RAFA 2FAXA 4G4GA 4R4JA 2DMRA 3EEIA 3WGZA 2ZYRA 5DCFA 4BDSA 1OHHD 5FV7A 1K78A 5D5QA 1ORHA 3MTJA 3VJMA 2VF4X 2DQ4A 2G67A 4NJEA 1YQWA 5D51S 3I0TA 1HE5A 5L3ZA 3SS9X 2O50A 2MWMA 2EZLA 2VJAA 4FEAA 1ZJZA 1P4XA 1QTIA 4PAMA 4LGYA 4UJ3A 2IZ6A 2LOOA 2X8AA 2AI1A 3KDSE 4TS3A 1EQUA 3OPXA 3ROTA 1TJ3A 1YACA 3V6MA 1IDZA 5AVKA 1JB9A 1U9IC 1Q84A 1JU4A 3EXIA 1K98A 2ZYUX 4QO8A 4US0R 2HU5A 4Q4AA 4XJXA 3TOXA 7MHTA 2ID3A 5H8LA 1DXOA 4MYHA 4WLVA 2QTHA 3A6ZA 4OHWA 3AIOA 1UP4A 4MWOA 1L3LA 5KNLA 2HMWA 1UQTA 4QEKA 5ITWA 2PKRA 4XKBA 3G5AA 5JI6A 3K1ZA 2WPNA 1GKYA 1U7TA 3F47A 3KEGA 3S28A 4EKYA 1XZBA 5EWLB 3DAPA 5FBVB 3ZKAA 2PN6A 2FA9A 1JSXA 1G2QA 5AW6A 2G9UA 5JSYA 2R86A 3R23A 3R7BA 1FRVA 1XUOA 4ILKA 3EXG1 3I9OA 1NLMA 4Y6SA 1R8JA 4BDZA 2VDLB 4IOMA 4KFTA 3WB1A 4OG2A 3EDPA 3OH8A 5E95A 2BISA 4W97A 2D2FA 3AM4A 3NETA 1PRYA 2JIMA 5FO5A 3BVPA 1MVOA 5B3JA 3LNCA 3LPLA 2XSZD 4DDUA 2YV2A 5JXIA 1NYTA 5JJKA 2V65A 2YN0A 1BC8C 3CZQA 3W8NA 3TQHA 2FXIA 2Q9CA 5SY9A 2RI6A 3MRSA 1R22A 1YR2A 3T0IA 1YW8A 2QQAA 4EJTA 2PX5A 3AB7A 1UBHS 5C4JJ 2YXDA 3VR5A 1WUIS 2VIXA 3AB3A 2MSYA 3DEKA 3VU9B 3RSLA 4AJEA 4EL5A 4D81A 1NLUA 1QH1A 3T4PA 2ZTVA 3JARB 2EOAA 2HIAA 4YR9A 1BL0A 2JDID 3A1DA 1PGOA 4BVLA 4KE7A 2WHXA 3S7ZA 2YKGA 5E7JA 2X41A 3LWDA 1Y33E 3QITA 1X8KA 1Z6TA 1UJMA 2B5VA 2ZJOA 4MV1A 3VR6A 3PUYA 1KQOA 4CM7A 4QLCU 4TUYB 2BYTA 2QYHA 3HDYA 1IBCA 1RYHA 4ZTZB 1L5KA 4YJ3B 4EJMA 1Z2OX 1ZK0A 2C2YA 3GTKJ 3G5UA 2AUMA 3AEUB 4V0LA 1G5PA 2XW6A 4M72A 4AUXA 2QI9F 4BQQA 1ZMXA 2XOXA 1VPVA 4P35A 1H8ED 2OY0A 5DWQA 2N46A 1UXIA 1VMIA 1XPUA 1XF9A 1UG0A 2NS8A 3IMGA 1QQ7A 1LNWA 2O2JA 3H3XA 4HGDA 1A5JA 1AKRA 2IVZA 5K3EA 4MS1B 1XQVA 3T99A 4JUDX 4AO8A 1G8PA 2A1UA 1OX5A 4RYDA 5A2QK 5C1DA 1TW3A 3FXOA 3GRFA 3CX6A 2VODA 3AM5A 4AVPA 2I7VA 3OCUA 2C2MA 2V6CA 1T98A 1X1EA 3EDQA 3NBXX 3DFFA 4IWNA 4QDUA 4RJLA 3D4IA 1UOEA 1WB6A 4F52A 1Y1WJ 2FPSA 3A9WA 2GTHA 3IWFA 5FPQA 4F7WA 2J3QA 2QVOA 1XLUA 3Q9LA 2E5LB 3R41A 5BOSA 1I01A 1N75A 3K0LA 1U2DC 1U8CB 3SKXA 4DLBA 3AEQB 1SFEA 3BK1A 1IHDA 4UATA 4IHYA 2ESHA 2OPTA 2CLMB 4OU5A 2ZVDA 2R7RA 4I1IA 1AHDP 2YZKA 4QO7A 1Z07A 3D1VA 4DKXA 1ORKA 1XXHE 3ONNA 4QAQA 4RVNA 3OT4A 4L28A 4RMHA 4XYMA 2B8TA 5EF6A 2RGWA 1JKRC 2EV6A 1O08A 3DGFC 5AKGA 1OF1A 1H2WA 5FT9A 4HMOA 3RKRA 4U2DA 3K53A 5BWOA 4ENNA 2FEXA 1MENA 3QPDA 1Q91A 1I3QJ 4R2XA 4WINA 3SNKA 2Z2KA 1DPFA 1UDBA 5DT2A 2TMGA 5IUNC 2WB2A 3NPAA 5LYJF 3D4NA 2FWAA 4XD7D 4PGAA 3I9V2 3CZAA 1VCHA 2CLIB 2DHCA 3LDUA 4MIMA 2RARA 4R01A 4IHKA 4UDYX 2XB2A 2BV3A 1R6RA 3ABQB 2CVOA 2GCNA 3BLYA 4NH4A 5LZ9A 4ZQIA 1BIAA 1GQOA 2HDOA 2XWJI 3A4LA 2KI5A 2I67A 1VYTA 3G3ZA 3N3BC 1O94A 2Y66A 4K2EA 1VG1A 1UMCB 2RCYA 1TWGJ 1A31A 4G3XA 4N49A 3HKXA 1AKHB 1XAJA 4HG3A 4MAMA 5ALXA 5B5SA 1X7XB 3EPHA 3AERB 3VPFA 4EM1A 4LF0A 2H9YA 4GP9A 4LSWA 1OTXA 3HIFA 1EH7A 2AFVA 3HYTA 1Y6RA 1X77A 2WU1A 5D7BA 1QF7A 1RWQA 4JYZA 4MR7A 1AHPA 2RVCA 3TP0A 3T15A 4LG3A 1E64A 1KAQA 2AOVA 2JIBA 3O3OB 3UZUA 2H6CA 1P5FA 3ZZ0A 5KQGA 1WMBA 3DWIA 4B43A 3GLUA 2ANBA 1DT5A 3KJXA 4DOZA 1GXSA 3OFJA 5GP1A 3WDLA 4BUJA 3BIJA 3O74A 1GPAA 2P79A 4OTZA 3FXUA 1Q11A 3EODA 3NHBA 5I9MA 1QF6A 2AJ8A 3RKWA 5F08A 1FP6A 3EZYA 3MW8A 2LIVA 2D1VA 1TD1A 3LFTA 5E38A 3MC1A 4J9UE 2C5HA 2IE8A 2R93J 1K4YA 1KH3A 1CRZA 1YDWA 1BFKA 1Z15A 2A6PA 2I6QA 2LVBA 3GYGA 3I9JA 3U44B 1I33A 5AKEA 3OOUA 4Q6WA 3DEYX 1G6OA 1KI7A 3HJCA 2ZI4A 3PB3A 3WZMA 4D3YA 2GWRA 3Q9VA 3DLCA 3LC0A 3QLVC 2Z5FA 3GXBA 4CQLB 5T8KA 1S0UA 2VTKA 1VJ5A 2JF0A 4BMZA 4UZEA 3GNQA 5IJ9A 1SGWA 4Y7CA 4Y6RA 4DAEA 1R9GA 3ZD6A 3WNCA 4CKZA 1YBFA 3PQ5A 3QEAZ 3A27A 3RU2A 5J4VA 1PLLA 3D1NI 2PMKA 1IN4A 1U3CA 2BCEA 2QRPA 4GZ6A 2IUEA 3V46A 4FWBA 4HQFA 7ABPA 2DBRA 3NCHA 3ASNH 1NP6A 2C5EA 4QOHA 3B1XA 4C6HA 4EUHA 4LRQA 2WF6A 3DXXA 3HUTA 2LNBA 4NVRA 3C3DA 4KSBA 3QWHA 5HG0A 2ZE5A 3G1TA 4RK7A 4NECA 5H82A 4GPD1 2UUCB 4IZTA 1XEAA 1QRTA 4R16A 5CXXA 2O2HA 3PSHA 3B6JA 3ZQFA 2GTPA 2ECBA 3UA3A 3GAMA 4LJYA 3LIIA 1QB8A 2IUFA 2WAMA 1Z3CA 3BPXA 2TYSB 4QX6A 1E0EA 2YIVX 5A7GA 2OKCA 5FUYA 3VC3A 1FVFA 2CQKA 1BEUB 3MWMA 1HKQA 1FUUA 3BGOS 4R1SA 4RJKA 1G7CA 5L4SA 2Y0EA 5JMOA 4X63A 4Z6YA 4M54A 3GXOA 3GTJJ 1LPQA 3I4MJ 1A9OA 2GSDA 3LCVB 3M49A 4QGAA 1Y1RA 4RE6A 4EGSA 5HIMA 1LNQA 2ARKA 4AZTA 1UKZA 4WBNF 1JEDA 1CVLA 1U3FA 1YE3A 2B99A 4C4SA 4PLWA 3C8HA 4WFIA 2E4AA 3BFPA 3HB4X 3TRFA 2GXSA 4L0CA 2YYZA 1C1DB 2A58A 4N6NA 2GPTA 5GADJ 4RESA 3L93A 5REQB 1NG6A 2XB6A 3GO4A 4KV9A 5K3SA 3X1JA 3BJIC 1XI2A 1KO4A 1X4PA 1QGDA 1H85A 2FCRA 3DAGA 2QUZA 1E2FA 1MUUA 3LY9A 3M4NA 4FJ0A 4LJKA 4C3ZA 2QENA 2I3AA 4Q3NA 3G0HA 1R36A 2MSNA 2J8ZA 4I9GA 2JHFA 2M2EA 1Y1SA 4MYRA 4U7JA 5IABA 1K27A 2NTNA 1C30B 1VJDA 5D8DA 4EVSA 5K20A 4EI7A 3JRXA 4BY1J 3MCAA 5BWLA 2IU6A 3DZCA 4QPDA 5SYAA 4CF7A 2X0FA 4X1IA 4PG4A 2MYPA 2X8JA 2ROQA 1CR1A 4KXVA 4DMKA 5K7ZA 1A7JA 4ZQFA 2QP4A 3KEMA 2HFKA 2IY9A 3O4FA 1BW9A 4ZOEA 3RYFA 1ODKA 3VJRA 2QLMA 4GZ3A 5IC6A 1KJ9A 1H0KA 1H4SA 3ESBA 5LZ5A 1GRCA 2Q1UA 4JDPA 3GFLA 2JFUA 4EJUA 2K7LA 2WR8A 2DOAA 4QLBA 3VO1A 5CVJA 3BULA 4OGKA 3M4YA 3CVXA 1KOFA 4K9NA 1YAJA 3RC2A 3WYFA 1U5TA 2VRWA 4D44A 1K61A 2WPDA 2OCCH 2AZ4A 1GUUA 2QEQA 3GCGA 1E8MA 1OCOH 1JFFA 2EFDB 1Y5LA 1JWAB 2ZETA 3D4BA 1C9NA 2VLIA 4RTMA 1UZCA 3BXZA 4GO1A 2ZC2A 1SFUA 4ZD6A 5ERIA 3QBEA 2UZ1B 4NC7A 4H35A 3M6UA 4I9FA 1FZQA 2EX0A 4FFLA 5BNZA 4X1OA 2JVGA 1XFDA 1XU4A 3MJVA 2H00A 1G20A 5GONA 2P3OA 1P0MA 3QP6A 1JBEA 3TR5A 4MGIR 4W5QA 3PFIA 1U2EA 1NW6A 2OR3A 3F3KA 5E0OA 1DKNA 2OFFA 5KS2A 1TTTA 2VL8A 4BXFA 3AR7A 4N5HX 4WKCA 1ZQ1A 3ABIA 5IH3A 3TNFA 3V8EA 1Z4OA 3G2PA 4LYDA 4XCXA 4HNUA 4N7BA 3EDYA 4TXLA 1ECCA 1SAYA 2PVPA 4LDZA 4IX1A 1X1DA 4RKWA 5IC5A 4DREA 1XG5A 1FYKA 2QTTA 2YS7A 3OX2A 2C4MA 3OS2A 2FFHA 3ZK9A 3QLUA 4WNCA 1RSZA 2X40A 5DYMA 2ZNYA 1AK1A 1RWKA 3GEBA 3I2KA 3I9MA 5EWLA 4WACA 3BL5A 3WYBA 3H9CA 2G6TA 1L5MA 3V7FA 3OP4A 2BEUA 2DT7B 1DTWB 4D8YA 4ZK6A 5IVDA 1IQPA 4OUKX 2FRDC 1HF0A 5ALVA 2HQRA 4XH9B 3ZRGA 1HT3A 3C1OA 2FNAA 3MXTA 1KYWA 1PJLA 5F1YA 1U1GA 3TLMA 4GXTA 4B35A 2PKQO 4EZBA 3OTGA 1Y0UA 3CPEA 2OGWA 3TOZA 1E9VA 2NXEA 2IYFA 5DHSA 2GUWA 2AG0A 2OL4A 1D8TA 1TBXA 4B6QA 1QXSA 2XWPA 3Q85A 3SXPA 2GM3A 3LP8A 4PLCA 3RVDA 4G8CA 4J94A 4F3TA 2EHJA 4K3UA 1OXVA 2GESA 2WWHA 3R0IA 4MOWA 4TLEA 2HYGD 3O2NA 4FFRA 3UH1A 1TWCJ 1OLUA 1R8SA 3JR7A 3OQ1A 1BE1A 1D3AA 2QT0A 4IGAA 5A0FA 3THSA 4BQPA 5CXUA 3LK6A 4UXIA 1LPBB 3CG0A 1KI8A 2CUJA 4QYIB 3TLYA 3KTAB 4OLHA 4GFBA 1NQVA 1SM4A 3F2VA 3IILA 3OQIB 4LXTA 3G1MA 3OURA 2AV6A 1MZBA 2UVPB 1KOJA 2C5GA 2ZU6A 2G08A 3HRSA 4RXMA 4P96A 2KM1A 4BGEA 1NVVQ 1KJZA 4DA9A 1B8PA 2DOEA 1LZLA 1TYDE 2OAGA 4KBFA 3PENA 1HOXA 4CCMA 4D92A 4JOSA 4CYDA 3U48A 1E5DA 5CW1A 5JZVA 4KW7A 5JWHA 3FK6A 2X7JA 3H9EO 5AKXA 1NXXA 4QECA 1IO2A 1V16B 4RCYA 4M0UA 4RIHA 1FX0B 2M9HA 3ZV5A 1XZNA 2RHBA 2WWXA 1TJ5A 1YVRA 2QP9X 2R2GA 3MOSA 4IZ6A 3VH2A 5JBIA 4MCHA 3B60A 5C44J 2N75A 1SR8A 2IEKA 3I5UA 1FNMA 2JS7A 1W9MA 3F0CA 3G13A 4LC1A 5HA5A 4RTRA 1F60A 1JFVA 2QW8A 1S2NA 3EUHA 3GTGJ 4JJZA 2K7ZA 1YXMA 3ADCA 1HKTA 1XKQA 2A9RA 2ZYHA 1E4EB 1SC9A 3UHOA 4HLQB 3RIGA 3HHEA 3TGPA 2J9FB 1ZTRA 1OWOA 2VK8A 4MMXB 1JKMA 4KACA 1QOZA 1QVTA 2ADFA 3HEFA 3P2EA 3CG4A 4XB2A 3OYIA 1JTFA 3N0XA 1YQ9A 4RK4A 4M3DA 1QFXA 2Z2YA 3T9EA 3VSLA 5DIZA 5DT9A 5AYVA 2LTAA 2QM7A 4OMYA 4LLGF 1SKYE 1TZCA 1GGHA 1SZPA 4NE7A 3LG2A 5CVEA 5GTIC 3A26A 1R0RE 2H1LA 2X22A 4NCJA 4XD2A 1MF7A 4S05A 3WGJA 1TAGA 3VO2A 1SXPA 3PTAA 1IVYA 2CNDA 3F6YA 2VPYA 2PTHA 1M74A 1SC1A 1WW2A 2QRGA 3O94A 4XX1A 3WGNA 3EZ9A 3F74A 5AVWA 2P9CA 1FYWA 5DI3B 3SM9A 3CO0S 1KS9A 1E1CB 1P1IA 2NU9B 5HZGA 1ZBDA 2HHJA 3NRJA 2HDCA 4M98A 4Y2VA 5EPUA 3VR3D 3ZXIA 3TF5A 3B6CA 1Z74A 1A5TA 2A30A 2AMVA 2ZRFA 5FRDA 4RTQA 4OXRA 2Z2SB 2Q45A 4KR7A 1YDFA 3VHLB 1CNMA 5L9AA 1E7RA 1EA3A 1PIWA 2XTZA 4Z53A 4Q3KA 2PWYA 1OCRH 1U6GA 3DEWA 1MN6A 3H2KA 3INRA 4N7RA 1FFCA 1GNPA 2I78A 2RJ3A 3EISA 1KDRA 1PR9A 2BFEA 3J81A 3MJ4A 4OQMA 1WQ4A 1P72A 3KZOA 2C4UA 3PG5A 3OIVA 3IP3A 3R4KA 3Q3EA 1JEYA 4IIJB 1R58A 2R5ZA 1T9ZA 2QRLA 1MDMA 3H0GJ 1M8PA 2V7GA 2PX8A 3IUBA 3OY7A 3PNSA 4PBRA 5CH5A 5CLSA 1XK6A 4KLRA 4D4GA 3U16A 5GZ3A 4Q9HA 1OZFA 3K0CA 2B8NA 1Z25A 3OVMA 4G1CA 1ZOLA 2I4MA 1UEXC 3ZXXA 5L3SA 3NBZC 1NATA 4OP2A 1R0XA 3V1TC 5JQGF 1NC1A 1JFLA 2VJPA 4AMBA 2PUJA 2XB0X 1J00A 3EVFA 1J8DA 4V2UA 3E2MA 2LZ0A 3KR0A 2QSZA 1COZA 3WHBA 4OJTA 5FOXA 2NVOA 2P4EA 4H2DA 4BMPB 1LJ8A 1V3TA 3I55I 3GZ5A 1TCVA 4O2BF 1RR8C 3SZGA 4FX5A 4L2IA 2IV2X 1ADJA 1ODSA 2E1PA 3BHJA 4YR7A 4IOCF 3NT2A 5CYGA 4DR2B 1HNZB 4UW9A 3QODA 2X2PA 5JSZA 1FMTA 4EYEA 3H4VA 2GHRA 2F6CA 3T9FA 1QOPB 1MB3A 3F5SA 4LOKA 1E2PA 4MGYR 1E2MA 1XEXB 3WZ2A 3DV0A 1E60A 3GGSA 3UMRA 3LY7A 3WL8A 4W7HA 1RQPA 3TQOA 2P2ZA 4IR7A 4LOCA 1YI0A 1B72B 4ETSA 3E3NA 3O8DA 1PFKA 4JLVA 4R6WA 4BNDA 4ZYLA 1I1GA 2HWXA 3RPQA 1VJTA 2VUHB 4M8IA 5HS6A 5IFKA 3FI0A 1DV2A 1KFEB 4E08A 2FWMX 2P8SA 4PAQA 4MQEB 1K1EA 1CEEA 5C46F 1WABA 2AC7A 5AVOA 3TJZA 4LDRA 2E6UX 3W6OA 4C4OA 4Q05A 2OV8A 5KNDH 1T0FA 2NP6A 4HGRA 1YL7A 2FG6C 5FL7D 2DPDA 3CUUA 2RHHA 1IHOA 2ZSUA 3H9UA 4FMCB 4OD0A 3V7CA 4AIDA 4PGGA 3BIXA 1RQ7A 2XGGA 1U9OA 3NAMA 3BG7A 4HFRA 5TRTA 2ACEA 1O3QA 1JR2A 3J7YJ 2Q28A 5H2FC 1MT0A 2ZS9A 3IHKA 3M6LA 1W5SA 1YDGA 5KVQA 1AQIA 1WSAA 4AZ3A 3RUFA 1U0SY 3VKFA 3R9WA 1IHPA 3CCLI 4TTQA 1CJTC 1L5LA 3WAJA 3HXPA 1DWOA 2PD3A 3NM5A 3ND8A 4GSLA 4O4LF 5KNDA 2JEZA 2D3TA 3D8RA 2NZVG 3K16A 4JUIA 5AM4A 5M29A 1PZEA 2FZKA 2GAJA 3QSGA 4LXIA 5E4YA 1OY1A 1V6AA 4HQ6A 1YU9A 2W85A 4K2HA 3P2JA 5L7YA 2J67A 2QTZA 4X6UA 5HR5A 1TNSA 3C7JA 3LLMA 4QTYA 2WINI 1UWVA 3O8BA 2VBIA 4I5GA 4KYUA 3WRXA 3VVMA 2NU8A 2VQSA 1QIKA 3B38A 1OR7C 3GYHX 2KJCA 2H9AA 3Q7PA 4PPYA 4DCNA 4ROSA 3LECA 2HJGA 4N03A 5E20A 4ME6A 1PT5A 3TIIA 4P4NA 1CV2A 3CZCA 4H7FA 1S1MA 4HRVA 4L4YA 4N9WA 5GZ1A 4EV0A 4FK8A 3H3ZA 3RM3A 3CLRD 2ZTHA 1N8TA 2PANA 3C3PA 3I5MA 3LVFO 5DS9A 1CHNA 2JD1A 4G2TA 4RLSA 4TTAA 1T0BA 3U40A 4NP6A 5C8YB 2LY9A 3BR1A 2DLNA 4TTRA 2QXTA 1JH8A 4PFKA 4PSCA 4UPEA 1G5HA 2OBBA 4DHEA 1Q1EA 1EGQA 2PMZA 2L2QA 1YI2I 1T9KA 3Q3JB 4FDAA 3REFA 3WGTA 1Y80A 3URMA 4TYPA 3KQUA 1YQXA 4IIVA 2CMDA 2Q5JA 2UKDA 3D8TA 4BFYA 5GJBA 2R5YA 2HU7A 1R4MB 2FN8A 3FROA 2FN9A 2NZUG 3IO5A 3TLKA 4N47A 1RJGA 1BRTA 1PG0A 1Y1QA 3A4IA 3BD9A 2ISSD 5EZ6B 4JI1B 1O6FA 5AWFC 4DNFA 4HTFA 4HMQA 4CKBB 3BY6A 1DI0A 1XEWX 2ZJ0A 3ILXA 1TQMA 2PT5A 2DC1A 4KN7X 2P2YA 2CGPA 2WOJA 2Y8EA 3VGPA 4MLZA 2CVZA 4KE9A 2AC2A 1KAMA 1IIBA 2C8JA 3CC7I 2OOKA 3WICA 1WXGA 1DS6A 2IPQX 1YE8A 2KSQA 3I6MA 2XNDD 4GOLD 1ISIA 3OKFA 2X9VA 1KP2A 4M0MA 1PYDA 3KB6A 2NXWA 5JHUA 1XZFA 1UDRA 3LQ4A 2JA5J 3SFVA 2EP7A 4P2GA 4KZKA 4M38A 3OJWA 2PKCA 4N4AA 2PZAA 1YFHA 3F6CA 2L0KA 3WJ1A 1EUCB 1T9GS 1GPKA 4TM8A 3WMGA 3MUOA 4AS3A 1JZSA 3TO9A 1GSAA 4QG7A 4D9KA 3GRCA 4UAJA 1EK1A 4GLJA 4HWOA 4WOBA 3HXKA 3UF0A 5C7YA 2XSJC 1B3RA 1XSVA 1TQ4A 2OESA 1RQNA 1ULBA 2PZBA 1U65A 2J09A 1MSEC 4JBIA 4B3IA 4K87A 1HX7A 3MTAA 2R84A 5FOTA 4WLEA 3JRNA 2XUDA 4CIYA 3D59A 2JAOA 4HVAA 4O5OA 3FLMA 4PG8A 3DE0X 2H29A 5BNIA 2AUTA 1VLHA 2EBHX 3TGNA 1W76A 3SHTA 5JCZA 3L7OA 1YR9A 4PPFA 1V8PA 3V3TA 2DWUA 4EP1A 4YO8A 4D3SA 4NZPA 3TFWA 1ZXBA 1RZUA 2E4UA 2QRNA 2FPUA 2Y68A 3MTGA 4IRUB 3HG7A 3TN7A 4MUGA 5HVNA 1C2TA 4HYQA 1Q1ZA 2G36A 3PL5A 2ODAA 3UTCA 1B1BA 4OQPA 1NE7A 4M74A 1U9CA 2V7VA 2KIMA 1E96A 1DKUA 1P3DA 4B76A 3WLPA 2DSNA 2OMKA 1FVHA 4H7JA 3B02A 1YBHA 1Z22A 5JAMA 5LQCA 3ENKA 1F43A 3RVNA 4M36A 5LMNB 4CYFA 5DRYA 4KREA 1QG0A 2PVCA 1GWNA 2Q6KA 3WHCA 4MJ3A 1YS2X 3WNDA 1ZI6A 4CM9D 1B43A 5BSWA 5F0FA 3FH0A 3KLNA 4FQ7A 4JZKA 3RS8A 3W1EA 2HSWA 2AE1A 1YC2A 5ALUA 4PRZA 2XXAA 1RPTA 3BMNB 4LOLA 1GUFA 2ODPA 1RWVA 2A0YA 1LC3A 4LTMA 1K06A 3AR4A 4FYWA 2ZJ2A 1X7HA 1CUEA 2GBIA 2HIMA 5JEDA 4CM8A 1ODFA 4GSYA 3NARA 3HHHA 2D3WA 4MVYA 3V8RA 3NP7A 1XU9A 2ZQYA 1B76A 3JRDA 3N97A 1D8JA 1ENYA 2ZJBA 4MH0R 1V7CA 5KHDA 2BMFA 4J0KA 5K1ZA 5JWOA 1NASA 5CA1F 3UV7A 2B8JA 3VBCA 1PZXA 2HW8A 1V48A 2FN4A 3QKRB 5FL7A 5G3YA 1UPUA 3SHWA 3AVYA 4XKWA 4IKEA 4DBLC 1DAIA 5T4HA 2WAXA 2VRCA 1DEAA 1M72A 3G1WA 3GN2A 5BW8A 4Z2YA 5CFMA 5BQOA 4LJ8A 3RUEA 1Q50A 4WUTA 1QPIA 1C0LA 1Y3BE 4IRMA 4WXDA 5AW2A 1NN0A 3WY9A 3L0IB 1HZZA 5DHFA 3ILSA 1YR3A 3UCXA 2VPLA 3WR5A 3EWSA 3KZVA 1F9AA 1FDTA 2AS0A 1SY7A 2W71A 3DMTC 3KTFA 1H4QA 2P9FA 3FFWA 1O8BA 2IIPA 2JGKA 3G8CA 3KO8A 3PQ4A 4GMDA 3OESA 1VGVA 4J7AA 4NE9A 3HSFA 1CRQA 2IYYA 4ZU6X 4HQ0A 2H8KA 5EIHA 4TZ6A 1PX2A 2IUYA 3GARA 2ZKIA 3ZYCA 2JCYA 5LM3A 1Q0ZA 3W5IA 1N5LA 4AWXA 1MEEA 2A5DA 1ZUWA 3T61A 1DOHA 4IHSA 4ACBA 4EABA 1PFQA 4URFA 4GI3A 1Q83A 1Z47A 3HCNA 3SZLA 2ANCA 3O21A 3BWGA 2NOJB 2WU3A 3NUZA 1Z4JA 5CXSA 5ICGA 1DADA 1HW1A 4A5OA 4CJXA 1DRKA 4CW7A 4DDMA 5HODA 4BLWA 2G1UA 2LRDA 2JJ1A 1RCFA 2IQ5A 3A06A 1ZKGA 4ZH4F 4QYXA 3AP2A 1FP2A 3ASZA 2IOFA 5B36A 3G02A 1TK3A 5LYYA 2AEJA 2I6TA 3DC7A 4PZZA 3OOHA 3DKIA 3PHBE 2OA4A 2XZTA 4QPNA 5LPNA 3VYUB 2PFSA 1VECA 2R7LA 1Y8QB 2X1VA 2MGQA 1SC7A 2ZXFA 3OKCA 3QEMA 4FR0A 2C20A 1S9HA 4O33A 4PAWA 3S3OA 1WDLA 4YAWA 3MOGA 4DOMA 5CUQA 1ISGA 1PUIA 5JE8A 4B3SB 1WXQA 3C43A 3ZQ7A 4TWBA 2FEWB 4BTEA 5IF9A 3AESB 1C3VA 3WRYA 1CDOA 2F3TA 3ZV6A 4H31A 4G0UA 5CQEA 1IJKA 3BAZA 5JCJA 5YASA 2MA3A 4F5DA 3C97A 5A06A 2LF8A 1J20A 3SR4A 1SCJA 5L3QB 2YJ6A 4V0OA 2QD2A 2UVDA 3AGQA 4W6QA 5TJHA 1C4XA 2CLHB 3P97A 4PIMA 4RF4A 3RKSA 3TOSA 1G8SA 1EH8A 5BNWA 3GMEA 3RUHA 1GKUB 2XX3A 4D0RA 3FD8A 3CF5F 2LPMA 4GUAA 1JFSA 2H2AA 4KQHA 4BX2A 3UPTA 1ENOA 4GG1A 4H60A 1YRLA 2HL6A 1FDIA 3O92A 3RRMA 4CLXA 1OBFO 1VGRA 2FE3A 3ZVNA 1U2QA 3W3AH 4HX7A 1CX9B 1QJ4A 3ER6A 3EXHC 3R7WB 4YLYA 3VKVA 1I3NA 1D5CA 2DQYA 1ENPA 1E9EA 3OFNA 4XYBA 4DLXA 3R76A 3EUWA 1C5KA 4L0ZB 1S6YA 3M8KA 4KQ2A 4BFTA 5GAJA 1CZLA 2Y1EA 3L4BA 5H02A 2QAGC 2ZLBA 4U6SA 1QH0A 3QPBA 2G7MC 4R9NA 3RC9A 1W96A 4QFDA 3WXBA 2FWIA 4UHKA 2CQ7A 2WAQA 3LHDA 4C0BA 3QU7A 4BX8A 4RELA 3BORA 2H4JA 3O2PE 2MJLA 4L5IA 3AXTA 1U3UA 3R5SA 5T57A 4CIWA 1Q7TA 4DZTA 2YXPX 1KQ0A 3F49S 4RTLA 3QJ5A 3KHSA 3L2WA 4RK1A 5EKUA 4WQMA 5K5QA 1JG4A 3UGQA 1U3DA 4E1BA 1U2GC 3LV8A 5ISMA 2QSFX 1XWFA 3QA9A 4BNDB 1WZNA 4BMYA 3SDZA 4EW1A 1ACJA 1P7VA 1TFUA 2HR1A 3FHLA 2Q5OA 3NWPA 3I9KA 4WWCA 1OSNA 2A57A 5TEWA 3HQ4O 2QTVB 3V2HA 1G1MA 1H2EA 1AJEA 2J7KA 4FHTA 3DZIA 2IWRA 3GJXC 1E3QA 1M8KA 3DNFA 5HKKD 1XP8A 4PHTA 3JRFA 4XR6A 5KQPA 1B8NA 2O2XA 3R4CA 3QPSA 2GVDC 5BNFA 4MW1A 3X1YA 3GLFE 1YFKA 1FRNA 1OCZH 4N0MA 3EDMA 4I98B 3GNTA 4M9XA 4BWFB 3PL1A 2ME0A 3DE6X 3HLTA 4RPKA 4WI1A 2OQGA 1KAHA 2BM9A 1MX9A 3AOGA 3G68A 1I32A 4AJNA 1K89A 2CMHA 3V6LA 3W2TA 3WTXC 1U1IA 1G8MA 3HSSA 4J6EA 4X7MA 2FU4A 3N0RA 4HLUC 1NKSA 1TQ8A 4M83A 3Q0WA 4O0LA 4EG6A 3CRW1 2WWYA 4A3GJ 2P81A 1MMFB 4L9TA 1Q77A 2E49A 3D3KA 2H3HA 4HJXA 4M60A 3ZCSA 1PD0A 1LS6A 2WAYA 4HQEA 3T7TA 4PNPA 5E2BA 1Y3DE 3HNOA 4BXXJ 2BR3A 4DUGA 5BUSA 3DTEA 5DNVA 4Y9DA 4EKEA 2X58A 5B1HA 4MUFA 3T8YA 2FEZA 3NYWA 3DKKA 4BWGA 2R751 3C7TA 3WTYC 3A2KA 2OWEA 2H1FA 4BEVA 2BELA 2IYPA 3O9MA 4I2VA 4JIMA 9ABPA 3OEHA 4TYWA 2H8GA 1RLIA 3NEUA 3O8HA 4UU0A 5EZ5A 4QXMA 4KNYA 1WQ1R 1YJAA 4Z54A 1WXIA 1Q1QA 1OFTA 1DE0A 4B40A 2DMQA 4LIPD 1C8KA 3KPUA 4P53A 2UUZA 4QOGA 4UQOA 2C5BA 3F7TA 4KQXA 4XLHA 3ZKWA 1RESA 2CHUA 2M32A 4C22A 4KLCA 2PCLA 1QHFA 2M8EA 3CSUA 1UM9A 5DKFA 3NYQA 2H2HA 2FPXA 3RJTA 2GJKA 4QFCA 4MO9A 4AP6A 1WPQA 2BEWA 1Z2AA 4MB2A 4FHZA 5K0JA 1BOFA 4RF2A 3X1KA 1XX6A 4JI3B 1J06A 1QUFA 4N8DA 4U6QA 2OTLI 4DQDA 1C2YA 3FZYA 3KKQA 1NMSA 1S8NA 4GPTA 3W2IA 2IVMA 1Y5RA 1QWOA 4NJMB 1W0JA 4KR2A 2NNNA 2KQRA 4I6GA 4CM3A 3QP5A 1AMOA 3PEVA 2G72A 1G8XA 4DCGA 3V4PB 1ZG5A 4F9FA 4JGIA 1QQTA 4Q7JB 3G82C 4X8MA 3KQLA 3B51X 4ZHQF 1XTZA 2G9ZA 3MHPA 4FFOA 5K2MA 3TX6A 5TT0A 5DM4A 4TRMA 1MNDA 2J9FA 3FMSA 1GGNA 1R0BA 2BFMA 1BE6A 4JV5B 3F6RA 3CKLA 2VYFA 3O8NA 4Q18A 4GE0A 4DCCA 2W57A 3WC4A 4DQ0A 4B6GA 1GVNB 1AY0A 3V4LA 2X4DA 3LCCA 4JOCA 3T06B 3OL4A 3DQVC 1VNDA 2XPVA 1FSGA 4PVCA 4TKVB 3W06A 3ZWWA 1NQWA 3R5FA 1YWGO 4N5IX 3GLLA 1RP1A 2KLBA 1N6HA 2NO1A 2P5YA 4QLOA 4UNQA 2HXYA 3NYRA 2ERXA 3SEFA 5JPCA 3GLHE 1R9TJ 1X0XA 3OCVA 4HNQA 4JQCA 1V16A 2UZ3A 4YP5A 4PYJA 3VSKA 1ZNQO 3D3EA 2ZREA 3K2AA 4HH4A 3ROMA 3NVMB 1Y8CA 5JASA 3D6AA 4MV4A 4E5YA 4G4JA 4F6RB 3H6HA 5IBCA 5BOXA 2HA5A 1CDZA 1Z26A 1QGUA 2C04A 3G6WA 3IPLA 4GMHA 1RPZA 4LJ6A 1U2WA 4AFNA 3AFGA 1F5TA 2DYSH 1R15A 2Z2IA 3QU4A 4EJ2A 1JTXA 3K70B 2FGJA 2QX9A 4GM1A 1FTQA 4H17A 4ID9A 2IRWA 5LC1A 1O4VA 1GCAA 2QZ8A 1RDFA 1W5AA 1QGPA 3KZYA 1G17A 1UANA 2PSJA 3A14A 3KTAA 3HCRA 3Q0TA 1FYEA 1O6ZA 2JIQA 2GCPA 1YX5A 5KVRA 1Y7IA 2QAJA 4PO3X 3INGA 4OM7A 1OXSC 1J2UA 1HZJA 3JALA 3O6VA 4A0RA 3EBOA 1GZ6A 3LF1A 4OGWA 7AT1A 1GHCA 3L1IA 2VXBA 3EZ6A 4Z0TA 4DF3A 2L4MA 1L4KA 2WIBA 3WLMA 4MKIA 4CHUA 1UADA 2R8OA 3I12A 1HFJA 3H1TA 2AZTA 2I22A 2ZTLA 3KJGA 4ZWNA 3SC3A 3WVNA 4EGQA 1NW8A 3WV4A 5C3MA 4IXTA 4YJ2B 1XZMA 2CVFA 2BH9A 3EB9A 2PPVA 3QYPA 4QUJA 1JR3A 5H83A 1TA4A 4AX8A 4M1QA 2B8EA 4F96A 3UO8B 5IJ0B 1A35A 1U3TA 1T5DX 3AX6A 2GETA 4TSKA 5CBKA 1C1XA 5IDVA 3OIGA 1CY2A 3QF7A 2OHGA 1CP3A 1EVJA 2G9RA 4M37A 3P2OA 4KVZA 5G4KB 2Y99A 2PRJA 1VSVA 2AFRA 4PZUA 2UV1A 3ZGNA 3RFVA 1S5LC 4X3PA 4FGKA 1NU8A 4Q9JA 4FNMA 3BWXA 3VC1A 4DXAA 1E1LA 1D0YA 4ZAYA 3W5AA 1FTTA 1PTJC 1DTSA 1SG9A 3VO8A 2ZT5A 4W7SA 1L4YA 3ND6A 4AL4A 3H2JA 2YMLA 3ODGA 3BZUA 2Q6VA 4DJDC 1FFBA 1F4LA 4CA0A 2DHQA 4G0YA 3QY0A 4PC1A 1I3OA 1RD4A 2ZB7A 3KJQA 4HDSB 4CE6A 4AMUA 3M4XA 4OB7A 4D46A 1I6LA 4EX6A 3P1JA 3S2UA 3UA4A 2WKWA 4G36A 1P6XA 4GGGA 4BMXA 2WBLC 1E0JA 2ZDQA 3DTYA 1WDMA 3UMCA 5CT9A 5HP4A 4TMKA 4S12A 4CTJA 1AE1A 1WJCA 1OWNA 2QJFA 2YHBA 4NYMQ 4Q00A 4YO7A 3M6VA 2H8RA 3OBBA 2PV0A 4U7BA 4XMYA 3FWPA 1JE1A 2EXXA 3HNRA 4HXEB 4UM7A 4BNYA 4LK3A 3TYXA 4BRWA 1FIUA 2B0LA 2NU6A 2M30A 4N0BA 1T8PA 3GQBA 3KNZA 4J7UA 2AX4A 2B7EA 2YX4A 1BJRE 2A3RA 2W6QA 3O31A 1TL7C 4JB8A 4F84A 2KFDA 5KAIC 2BI4A 1CVIA 2VH5R 1Q0UA 1Y3AA 2AI2A 1FXWA 3QXSA 4NABA 4L9NA 4D8VA 4MUYA 1JB1A 2JIZA 5C1IA 1RUNA 2ZYVX 4N4OB 3OSZA 4G5SA 4NCBA 3R3UA 4EO7A 2OT3B 5FJ8J 2OC4A 3AG6A 3OEHD 3OQ6A 5TF4A 3WSWA 2HMYB 2WU8A 3AAFA 4OQQA 3RRFA 4RQUA 3TQCA 2D1SA 2E55A 3PM1A 3UB4A 2QPAA 3ZDAA 1N5JA 2F4IA 3UICA 1WVMA 2A4KA 2AFHB 2DUWA 2RHLA 3E82A 4NENA 1N6IA 2LH9A 3Q0UA 1NG1A 1A96A 1CJVC 1YZTA 3LXUX 4J7CA 4OJQA 2ICWG 2ID4A 4KN5A 5LNK6 4HH3C 3MQ2A 2ZRMA 4CNBA 4HMPA 3C3KA 3A70A 4JX8A 3D8NA 2J08A 1N7IA 4JJGA 3UANA 2HHAA 1H5QA 3LFHA 1EJ6A 4FYXA 1YLFA 1JPJA 3DOHA 4MTLA 4MRMB 3KYIB 2EV9A 2W2MA 4BWYA 5A9SA 4ZIRA 5JJCA 1V8ZA 1RM5A 4QGGA 4BQNA 4JSTA 5D6OA 2DT5A 4BHBA 3L01A 4FC7A 3KU4A 5HRAA 2IU3A 2VCYA 1RI7A 3R5XA 4HQLA 3RVRA 2Y76A 2FK7A 1FU4A 2FQWA 1UMBB 2RNJA 2PR2A 4KRGA 3DAOA 4CUZA 1SWVA 1G55A 2Z57A 2L54A 1C8LA 3GJ4A 1CQJB 1EUDA 1SPXA 3OJCA 2I5PO 4PGFA 4PNHA 1CDDA 1SXJC 1LTKA 3BSWA 3O75A 1IK6A 5HS9A 3DDNA 3WLOA 2ZCWA 4YMTA 3EGDA 3FMVA 1RQLA 2Q2QA 3ZE1B 4J3FA 1LPAB 2E4WA 1HRKA 2J9XB 3BF7A 4D2IA 2XQVA 1XA3A 1GU1A 3LYAA 1C4OA 1LY1A 4O4HF 5JROA 5JFTA 3CGGA 2KRFA 3JYLA 2IDKA 4HFNA 4YH1A 4D0GA 3OYNA 3RBAA 4DZPA 3JQGB 5FROA 1LDDA 3HWWA 4MNTA 2GPWA 2VATA 3UJCA 3BDIA 2B98A 3HXQA 3ISPA 3JWPA 5H59A 2DQKA 5IANA 3K1MA 2C83A 3CCJI 5EVJA 4KRYA 4MS3A 2O8EA 1TCBA 1UINA 4HAOA 1O4WA 2WFAA 2VN8A 3N3AC 3NH9A 3EARA 4QUDA 3WWOA 4W9MC 2HA0A 4H15A 4P33A 2DE0X 3A6DA 2A6HF 4P84A 4RCVA 4AKEA 5IT9A 2BGKA 3WTZA 2R7VA 1ST3A 5CIYA 5EMMA 1ZG1A 2LY2A 2XH8A 1J99A 4BQAA 2XV4S 4OIQF 1XQ9A 2G77B 1LW6E 2HK9A 2IYOA 2W58A 1DIBA 4AZWA 5BN3B 5KYWA 2PX3A 3RIXA 5M5XJ 1BS9A 4PRLA 2LDBA 4HXYA 3P9RA 4QTTB 4F45A 2H31A 4FFDA 2M87A 1MIOB 1K6MA 2J59A 2YNMC 4C0LA 4LE2A 1F17A 5JNLA 3WHPA 1SOMA 2YRFA 1CUVA 5IT5A 3DDHA 1Q0QA 3F3SA 4XJVA 5EP3A 4CKCB 4QG3A 4MINA 4BE2A 5LR6A 2GBPA 2PUHA 3LSRA 1JWBB 1OKRA 1YA8A 5CRIA 5A4IS 7MDHA 2JPBA 2NVUB 4NU5A 3WLSA 2HTEA 1BKSB 1OC4A 2ZT8A 3NWJA 4GQBA 2DFDA 5LKRA 1BBYA 1B0ZA 4KQCA 1KZ6A 2H0RA 3S2ZA 5JDCC 4CG2A 2Z1DA 3CEPB 1FEXA 1Z33A 1ZA2A 5EJ9A 5CVUA 2A6EF 1BQ4A 2J5RA 2WOOA 4IMRA 2H4WA 3FR7A 4MUXA 5G4LA 3RYHB 3SX0A 1GUYA 4E0BA 3OX4A 3FYSA 1WKVA 2DMUA 2M0MA 4RJTA 1ADCA 3WU2C 1TA0A 1U28C 1O58A 2QU7A 3OTHA 4B73A 1FSSA 3B1WA 4K3VA 4EWLA 1F2TA 5IS2A 4PVDA 4RTKA 1DBIA 5IT0A 4LCJA 3PZRA 2PUDA 3ZGXA 5CLJA 5HK8A 2HSDA 1BMFA 2ZYDA 2ZPUA 4X6AJ 4MGKR 4E7OA 3U37A 1B6RA 3IP8A 3I04A 3ID6C 4PEVA 3KKKA 1HYQA 1TKCA 4HTAA 4XSGA 3TSOA 5GPCA 2VZ0A 3OIPA 3LA8A 4QVGA 2PRKA 5ECDA 5EJAA 4ZVOA 5LQMA 2EJWA 4UNIA 4ABYA 2PUCA 4DEXA 1L4UA 1BDHA 3T1VA 3TEMA 2WM3A 3I23A 3K1AA 4MJLA 5AVJA 2BZSA 4QRDA 2FJ1A 4AURA 4EI9A 5C4XJ 3AERA 4D0LB 1MCZA 4FYHA 4TMZA 1AGYA 2IUUA 1UPAA 1HK7A 4V0QA 3A6HA 1GAWA 1IXSB 3NKFA 3WMXA 3P9KA 2YPRA 1JT0A 2NAFA 3D7MA 2BBYA 5TDHA 4E22A 1SRRA 1EK0A 2R6FA 5CM9C 2VTBB 2V4UA 4KQWA 4F3QA 2FMFA 1JDUA 2ADUA 1YO6A 3L46A 1CUGA 1TI7A 4NAVA 4OP3A 3GVIA 3IPCA 5GIOE 1IULA 1XTPA 4MR9B 3REGA 4M7PA 4DA0A 1TW2A 1GPH1 1S4QA 1KEZA 1CIVA 1IY1A 3JAKA 3OLYA 3EXFB 1UEIA 1UBKS 5DM6F 2I76A 3BGSA 2BKEA 4XVHA 2I4IA 2FH5B 3MT8A 2TMYA 3QQ5A 1S5PA 1QYDA 1VSTA 3HYRA 1HWYA 1K3TA 1SXJA 2GEKA 2HI0A 1E9BA 2BFCB 3HUFA 3RQSA 3UUWA 4D3ZA 3U1BA 2NZXA 3T5PA 1H4TA 3Q7IA 1PYVA 2CSXA 2OMEA 1MP0A 1P73A 2C2WA 2R6DA 5DOVA 1N3IA 1GGFA 3UK7A 1J4AA 2M6RA 1NJSA 4EI8A 4F2DA 1F0PA 4N48A 3M2PA 3HH8A 2XMPA 4YXWA 6PFKA 4MGHA 1OH6A 5DYTA 3TSYA 1Z4LA 3K6RA 4CN9A 3LP6A 3WGQA 4JYMA 1PUXA 1OIWA 2YWHA 4KLAA 3UHPA 4BJ3A 1T5IA 4QEZA 2H16A 1FMJA 1DQSA 4RD1A 2Z2XA 2HRQA 4KN9S 3PNBA 4OMUA 2XZLA 1TYAE 1DG9A 4RVSA 4M8NE 1YHNA 4NKRA 4DHWA 4DPLA 4A0QA 2P5UA 3RJPA 3D64A 5HIIA 1MFPA 4V0RA 4IINA 1W46A 2I71A 2VYNA 3JQ7B 3MRTA 2JFGA 5AVVA 3L2RA 2YX7A 4JX4A 4OYYA 3ZDXB 2GHIA 4JI7B 5KHOC 3ESDA 3GZ4A 3M6WA 3RBXA 4G0ZA 3SQNA 1QFZA 3QWLA 3CTMA 3MRVA 1GL7A 3GFBA 4FHGA 4EHBA 1FE8A 2D1YA 2VQFB 1D09A 2A88A 2CJXA 3BA1A 4L0YB 5HLTA 4H3HB 3D5RC 1HW5A 1P7CA 1TCCA 2WAOA 2Z30A 2D5LA 3PDIB 3P2KA 1ZRDA 1FP4A 3IAS1 4MGZR 3ROEA 3RV3A 4DIFA 1L5RA 1P60A 3LU1A 2Z3YA 4IHTA 3W2AA 2VCEA 5AM1A 4WK2B 1LPOA 2HOAA 1W4RA 2OM2A 4O1MA 1EUZA 2G07A 2VJ4A 2XPWA 1DB3A 3JYHA 2OCLA 3CDLA 5EG5A 2Q5HA 3P5SA 4AYWA 1R16A 3BH0A 2R1TB 3OWOA 4G0QA 3PR1A 1CUUA 1Z45A 1W1WA 5AFSA 4P3NA 4RGYA 1ODDA 2M3AA 4QREA 1VKHA 1A71A 2XF2A 3BXXA 1S3JA 3L6DA 1MC1A 2QAGB 2XUHA 5E3JA 3UAXA 3M4JA 1G60A 5LB4A 3WLJA 3WHKA 1P0CA 2AH5A 3ZQQA 4UE6A 3A9RA 3D2CA 2IPNA 1RM3A 4HDOB 2HGCA 2XAQA 1RQXA 3KP3A 2X2EA 3C3CA 3VZRA 4CLOB 2W82A 4QWMA 1ULUA 3LVBA <