3N05A

Crystal structure of nh3-dependent nad+ synthetase from streptomyces avermitilis
Total Genus 188
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
188
sequence length
584
structure length
568
Chain Sequence
b'SLQLRLALNQIDSTVGDIAGNAEAILRWTRHSAEQGAHLVAFPEMALTGYPVEDLALRSSFVEASRTALRELAARLAEEGFGELPVLVGYLDRSESAQPKYGQPAGAPRNAAAVLHRGRVALTFAKHHLPNYGVFDEFRYFVPGDTMPIVRLHGVDIALAICEDLWQDGGRVPAARSAGAGLLLSVNASPYERDKDDTRLELVRKRAQEAGCTTAYLAMIGGQDELVFDGDSIVVDRDGEVVARAPQFSEGCVVLDLDLPAAEAEPPTGVVDDGLRIDRLVISEEPLPAYEAELAGGYADRLDADEEVYSALVVGLRAYVAKNGFRSVLIGLSGGIDSALVAAIACDALGAQNVYGVSMPSKYSSDHSKGDAAELARRTGLNFRTVSIEPMFDAYMASLGLTGLAEENLQSRLRGTTLMAISNQEGHIVLAPGNKSELAVGYSTLYGDSVGAYGPIKDVYKTSIFRLAEWRNRAAAERGQTPPIPEASITKPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRMVDTAEYKRRQYPPGTKISAKGFGKDRRLPITNRWREGH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NH(3)-dependent NAD(+) synthetase
publication title Crystal Structure of Nh3-Dependent Nad+ Synthetase from Streptomyces Avermitilis
rcsb
source organism Streptomyces avermitilis
molecule tags Ligase
total genus 188
structure length 568
sequence length 584
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00795 CN_hydrolase Carbon-nitrogen hydrolase
A PF02540 NAD_synthase NAD synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1510 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3n05A03
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3n05A02
3.60.110.10 Alpha Beta 4-Layer Sandwich Nitrilase/N-carbamoyl-D-aminoacid amidohydrolase Carbon-nitrogen hydrolase 3n05A01
1WJGA 4MUNA 2J09A 1YIAA 2OV4A 2QJFA 4MUEA 4ZCQA 4CYFA 2VTBA 4R0NA 3IW3A 3PNVA 1COZA 1X6VA 2D13A 3CLTC 1NYLA 2WQ7A 3N9IA 1N2EA 3I05A 1F7UA 4E1AA 1B6TA 1TYBE 2A86A 1NURA 4DE5A 3ZJVA 1H3EA 1Q77A 1J1UA 4CYGA 2J5BA 3FG9A 4MWDA 1KQOA 1JIJA 1JIKA 3CVXA 2O5RA 1FYDA 1FO6A 1MB9A 4EG8A 1WY5A 2YWBA 1TEZA 3C8ZA 4NDAA 2A7XA 4KPUA 4K0RA 1UF4A 1R6UA 2YWCA 3H9BA 4Q16A 5AHWA 3P52A 3RFFA 5FO0A 4MVYA 3SEQA 4H5UA 1G8HA 1VLHA 4OUDA 3UMVA 3ZGZA 1ZUNA 1U7DA 3ELBA 1K4KA 1WQ4A 1N78A 1T6XA 1KQNA 2B7LA 2CYCA 4MW2A 2CV0A 1KAQA 1T6ZA 3CVYA 3Q12A 3HZRA 4U7JA 3RK1A 2EJCA 2X1LA 3IDFA 2C5SA 3NBKA 4PBRA 3CLRD 4ARCA 2BTEA 1NP7A 1GZUA 1WXEA 2A1TR 3FDXA 1OD6A 3UC5A 2GGLA 5KWVA 1XNGA 1O97C 1WXIA 3CVWA 1KP2A 3AL0C 4ZT7A 1U3CA 4P2BA 1MAUA 1PG2A 1IHOA 1O0CA 2CYBA 2PFSA 3KLCA 2CUZA 5TEWA 1QRUA 3KT0A 3AKZA 1QRTA 2VTBB 3FETA 1YUMA 3TNJA 3FHJA 3IOCA 3FNRA 3WUYA 2BYTA 2WSIA 1BS2A 5LM3A 3CVVA 1EUYA 4MVCA 5F23A 2E18A 3IODA 2DYUA 4EFKA 1J70A 1NZJA 1V47A 1WQ3A 1KP3A 1TQ8A 2OQ2A 4DDHA 1DNPA 1N75A 1O94D 1XNHA 1H3FA 1P7PA 5K0TA 2GM3A 2X3FA 1M8GA 4XFDA 1H1TA 4DDMA 1UFVA 1TYCA 3CLSD 5DK4A 1TYDE 3IMEA 4R2LA 2ZP1A 4X0EA 3E27A 2ZUEA 4G6ZA 1N1DA 2QUIA 4ZCRA 2PXHA 1EE1A 3RHSA 1JGTA 4IZWA 4JXXA 3G6KA 4KPUB 4MW0A 4ZT3A 5BNZA 4Q93A 4YP7A 3IVGA 3OP1A 1ZJWA 1JIIA 4U8HA 5JBNA 2WQ6A 2YXNA 4NAHA 4MLPA 2QUKA 2DERA 4OUDB 2CYAA 1PFYA 1N3LA 1QNFA 4MULA 2V0CA 1M8FA 4K03A 3SEZA 1WXFA 2XRYA 1N2GA 4MUHA 1PG0A 2VHHA 4I6JA 3CLUD 2JAXA 1OWPA 1NUSA 2X1MA 3DPIA 3JXEA 1J1ZA 2H2AA 2DUMA 2E2LA 3VGJA 1YIDA 2TS1A 3DV2A 1EXDA 4RUKA 1K92A 5TS2A 1F9AA 3COZA 2HMAA 1N2JA 1G8FA 3H9CA 5J59A 2A1UA 3GLVA 2PLQA 4EG4A 1CT9A 1MRZA 1JEDA 1ILEA 1UF7A 3P0HA 3COWA 2RE8A 1MB2A 1KR2A 3HL4A 3FIUA 4NX2A 5FNZA 1OWLA 4HG3A 2QJOA 3P0JA 3K9WA 4H3SA 2D5BA 2QUHA 3ND7A 2I1LA 2G36A 1Y42X 1WKBA 1J31A 4MAFA 3A05A 2J08A 3M5WA 2XRZA 1J20A 4MUJA 3N2YA 2D54A 1EUQA 1FFYA 4MUIA 4EGAA 1OWNA 1YULA 3IOBA 4PBTA 3ILVA 3IVCA 3SYTA 4ZCTA 2VXOA 3ISJA 2W1VA 1O96A 4L2IA 2EL7A 5KHAA 2O8VA 4KR7A 4HK4A 1IRXA 4CDNA 1LI5A 4BWVA 4KZFA 1IVSA 1KH3A 1KQPA 5H7XA 3RK0A 1WXHA 3H97A 1T9GS 3NBAA 2J07A 1VBNA 1R6XA 1XNJA 1M83A 3DO8A 5JQNA 2PIDA 3GMIA 3HV0A 4DNXA 4MUGA 3IOEA 1GTRA 4YP5A 3AFHA 4MWBA 4MVXA 4GYLA 3A4IA 2A88A 1QRSA 2DPLA 4MW7A 1GLNA 5DASA 3DLAA 1EMSA 4IZUA 4CDMA 3NV7A 4EG3A 2JANA 3H99A 1G59A 5DEOA 1QU3A 1J21A 3IMCA 1UF8A 1O5TA 3TS1A 3RBAA 3ZXSA 1T6YA 4A91A 4KR9A 1VBKA 1S4MA 1F7VA 4JZYA 3HMQA 4ND7A 5LFAA 4AQ7A 3UY4A 4MW6A 3AIIA 3P8KA 2V0GA 4XFJA 3LOQA 3BL5A 3ZXIA 4UZEA 1O97D 4IZVA 4KKVA 5IJXA 2A1UB 2GOYA 1YUNA 4MW5A 2DETA 4CT0A 1KH2A 1KORA 1O95C 1OBCA 1IFXA 1WOYA 1RQGA 1JZQA 1NUPA 1O6BA 2R5WA 3L92A 5HG0A 3HKXA 5H8IA 4YMIA 1J09A 4ZT2A 1SURA 4WSOA 3ZJTA 1U0BB 2PZBA 4I6EA 5KCMA 4EG7A 2PZAA 2E2KA 3KFLA 2E11A 1M8KA 3PXUA 1IQUA 3FH0A 4IZSA 1JILA 1KKUA 2UXYA 3ND6A 1MC1A 3L93A 3FWKA 2A84A 4HJRA 4ARIA 2DLCX 5TEVA 3KT3A 3ZIUA 1O96B 4L2IB 2QJTA 2GGKA 2Z09A 3MXTA 2QTNA 2IJGX 4DDKA 4EG1A 1F89A 1N2HA 2A1TS 3QTTA 3LCJA 5K0SA 3UOWA 4ZT4A 1U7XA 5H8KA 1N77A 2HZ7A 1I6KA 3COYA 4S1OA 1JEEA 3FI0A 1NI5A 1JECA 2AG6A 5TGTA 1I6MA 4G5FA 5IHXA 4FZJA 3D6VA 2IP1A 2H29A 5DB4A 1M1ZA 4GRIA 3S3TA 3QTBA 2WB2A 5LLTA 4JYZA 2QTRA 1MOPA 2JA2A 3X1JA 2QUJA 5HUJA 3ZJUA 4J75A 3PNYA 1D2RA 3A2KA 3IVZA 3FOCA 3CVUA 2CV1A 4WNYA 1N2OA 1EFVA 3N8HA 4G5YA 4XSVA 3TQIA 1TYAE 3CLTD 5EKDA 1G8GA 4MUKA 1XJQA 4NZPA 3ZUGA 1LI7A 1QTQA 5J5AA 3IUBA 4MQ6A 3LE8A 3FY4A 1QJCA 3TZLA 1IQ0A 4HGDA 1EFPA 1PFUA 2QTMA 3RJZA 1PFVA 3Q4GA 2A4MA 3SP1A 3COVA 3CR8A 3SZ3A 1GN8A 4F4HA 1NUUA 5H8JA 5H16A 4TS1A 2YY5A 2CT8A 3MLAA 1I6LA 1EJ2A 3IVXA 1PFWA 1ULHA 3IH5A 1MBZA 1TFUA 4MWCA 4UZFA 3KT6A 1NUTA 3CLRC 3SDBA 3IMGA 4LF0A 2CSXA 1M8PA 3A04A 3HGMA 4EG6A 2NZ2A 3SZGA 1JZSA 3KI8A 3TQOA 4IZTA 1HYBA 3AG5A 2X0KA 4I6GA 4MW1A 1LW7A 1R6TA 5J58A 3X1KA 1MJHA 3GUZA 3MUEA 3Q10A 4PBSA 2GKSA 4R2MA 4YBRA 2ZUFA 4JXZA 4GU5A 5H8LA 4PY2A 3CA8A 2HGZA 4MUFA 2CFOA 3KT8A 3OTWA 1A8HA 3G59A 4HPWA 1O94C 4MWEA 1N2IA 1H3NA 1OWMA 4KR6A 3D6UA 1OBHA 1GAXA 4QRDA 4ZCPA 4EF6A 3CLSC 1VL2A 1MAWA 1JHDA 4MW4A 2E21A 1U3DA 4CQNA 3X1MA 2E89A 1Q19A 2CV2A 1M8JA 1V8FA 1Q15A 4DJAA 4QREA 4AS1A 2E0IA 4OJMX 2J4DA 4JFAA 4CYYA 1NSYA 4ZCSA 3MMXA 1EFVB 2RD2A 1O0BA 1ERZA 1I2DA 3K32A 4NAUA 1UF5A 2NSYA 1ZH0A 3QE4A 2DXIA 2DR2A 4F3RA 3PRHA 3P0IA 1IH8A 4ZT5A 1K4MA 1GTSA 4J76A 4U63A 2Z3VA 2DEUA 1QQTA 1WZ2A 5FO1A 1OWOA 3ND5A 4HJXA 1EFPB 2Z08A 4NATA 4DLPA 1K97A 4QBTA 1N2BA 4ND6A 3U1VA 4MW9A 3TZEA 1KAMA 1O95D 1IQRA 1NUQA 1JMVA 2PG3A 4EG5A 4RPIA 2AZXA 1X8XA 1YI8A 1F4LA 3INNA 3CLUC 3IUEA 3PNBA 4HG5A 3H05A 1VBMA 2IELA 1GPMA 1Q11A 3UK2A 3VU8A 3VRHA 5HUHA 2DYVA 1ZH6A 2AKEA 1QU2A 4MVWA 4GYNA 2VHIA 1T9GR 3N05A 4ZT6A 1KH1A 3AG6A 3MLBA 3F3MA 1WXGA 2PZ8A 3G5AA 4YP6A 3HFJA
chains in the Genus database with same CATH superfamily
4XIJA 4ND3A 4R0NA 1NBAA 4JASB 5BT8A 1E1RA 1FC3A 2H57A 1M1NA 1YDGA 4BBJA 4HMPA 3E3LA 1MC4A 2INGX 3Q0IA 3ENKA 5FTMA 4E46A 3IKVA 4FJ2A 3Q11A 3U4QB 3MWKA 4NABA 3W5HA 3GRVA 3CRVA 4BEHB 4H0NA 3N2KA 1R5GA 1F2UB 3U2QA 1S2LA 3R7NA 3QXSA 3HR4A 3KSRA 3EIFA 4H3VA 2PGNA 1V4NA 3AW8A 1ZG5A 3BIOA 4QVIA 3QBDA 2O1EA 1VPWA 2W8ZA 2BZSA 3E9RA 3NHMA 2ADUA 1A31A 4KBFA 5HKKA 1Z6GA 4QX6A 4X5OA 3I5AA 3B2QA 2JD2A 4IX7A 2KX7A 3TJMA 1WL8A 3MMSA 2KZVA 4RXMA 1F5TA 5GOTA 1I36A 4NUBA 1N4DA 3G5LA 1T5HX 3ZNNA 1JJFA 2IEDA 5D7NA 4XQGA 1M0TA 4R9RA 1L7AA 2LDUA 3UIEA 3RREA 1PQPA 3DMDA 1LA2A 1PK8A 2ZI4A 3PNPA 2XCTB 3BG9A 1E8MA 3IBCA 1HW5A 2FMKA 4RAZA 3UYLA 2P6OA 5JPIA 5B53A 1G6NA 3NYQA 3MEXA 1PGPA 2QNBA 1SNYA 4DLAA 2H51A 2DT6A 2OV6A 3CO5A 3JQ8A 1T1JA 1JW9B 2AYYA 3FXKA 2QVGA 3WB1A 2O8FB 2LF8A 5M3BA 3RIYA 1XMOB 4LOIA 4DYHA 4OQ4A 1VLQA 2PD6A 3U17A 5CW1A 5DD8A 3AVYA 2R7QA 3E2PA 3O8NA 2GD0A 3WWCA 3DC2A 1OFCX 4CDMA 5L40A 3ZMVA 2XASA 1PL7A 1D4ZA 5LIRA 1XGOA 4HDUA 1X77A 2BGCA 1GDHA 2WILA 4FNMA 4OL0A 1DIRA 2PBLA 3SCZA 1HURA 3ZJYA 5BWLA 2VZ0A 2FP3A 4CCSA 1WOYA 3KHUA 4HRYA 5DXFA 3VOSA 4RBOA 4QYIB 1YR8A 3OMYA 3GJZA 2QS9A 1WVIA 2MYNA 3FW1A 1I7LA 4OX9Y 2DBQA 5FKOA 4RM3A 1EWRA 2V6IA 4RZXA 4DNFA 1X7ZA 4E51A 1H1LA 5C3EJ 3K9TA 5H9WA 5J8CA 1V5IA 3S2YA 4MCAA 3I9MA 4NU6A 2V54A 1EVEA 5EWLA 1JDBB 2DT7B 2DUJA 3L4EA 5C1PA 3HJUA 2WZQA 3SM9A 5C81A 2QGFA 1M9NA 4OU0A 3ZZ0A 4JKYA 2XRNA 3H8SA 5JDCC 2ZXHA 5BUZA 3FOFC 4HADA 1R5BA 1T8RA 2Z9DA 3QPLA 2VJJA 5CURA 4KGXA 3BMXA 1SRRA 5DMHA 4XORA 2VN8A 1F2VA 4PIMA 4X62B 1NI3A 2BY1A 2Q8NA 4MFDA 1Y33E 2J9FA 3E9YA 1BBYA 2ORWA 3EZNA 2QZ8A 1JHXA 2VLBA 4RA6B 4JOSA 2OORA 3BAZA 1YB6A 3MS7A 1SD7A 5LBQA 1GKLA 5JSZB 5REQA 3I2YX 4LKOA 3LW7A 1IC8A 1SK8A 4BHPA 4ZVVA 3KEOA 1KAGA 1XKTA 1ZA1A 2ES4A 3DDHA 3PBKA 1XHLA 2CBGA 4V1CB 1Q0UA 1D6JA 1WJAA 3TKAA 5ITWA 2ZLBA 3FPKA 1KYYA 3ND5A 5I4BA 4GBED 4GR5A 4EFNA 3LRTA 1T9BA 2R7KA 4B74A 4UDNA 1AA9A 1Z3XA 5HKLA 1GILA 5TVGA 3R4CA 2PMBA 1K8ZB 1EESA 3H05A 1GGNA 1AS3A 5F2EA 3L5OA 2IBDA 2ZBKA 1IEXA 5ENVA 4FUTA 1T0IA 3CO7C 3RNLA 4OLJA 3SLGA 4NH4A 4MUNA 4F2PA 5D5PA 2VI5A 1P80A 2I4TA 1YWGO 1YRWA 4H18A 3JCZA 5CM8B 4R4JA 1XZJA 1A1SA 3NOVA 1FFDA 4H4DA 3RS8A 1Y39A 1ZHHA 2FPGA 3OPMA 3QLVA 4OM7A 1JE1A 3LOUA 1ETVA 2O8BA 1LVHA 2P6RA 3PUWA 2HUNA 1L4BA 1TTHA 2WP0A 5SYMA 1P6QA 2IV7A 2H08A 2QY6A 1E7YA 1RJEA 1ZK2A 1Z5GA 4BE9A 2EG5A 2F1OA 3BA6A 1R6AA 2OBYA 1XPUA 1T6XA 1ITYA 4AUXA 2CV0A 1PL6A 1JHPA 1NP7A 4UD6A 2AJBA 1A36A 4JQSA 3WAJA 3HWX1 1WUKS 4I5EA 3CUVA 4KSBA 4X91A 3CPJB 1JFFB 1RACA 3T5GA 3QU7A 1E3LA 1SQ0A 1T1SA 4HQLA 2JQ7A 2UXNA 3IOCA 4F11A 2HXIA 2NN3C 2WYOA 3VC3A 5J1UA 5E9WA 2R7TA 2COKA 4G4IA 2E7WA 2K85A 3EQZA 2IU6A 4ZVUA 1XRNA 4KXFB 3L0IB 2YIVX 4YAUA 1BC8C 3K53A 4HQ6A 2QTHA 4L3OA 3LYLA 2ISSD 4I8XA 4MULA 4NOMA 3N2IA 5HJ2A 3TRIA 5H02A 1L3BA 2WA2A 1J1ZA 1F1JA 2VPIA 4PJ0C 3URMA 1Q2XA 2QMOA 4YG2F 1ILEA 3PFGA 1T5OA 3P1JA 4CV1A 4A7PA 4BRZA 4AG6A 2W25A 3SFZA 3LX4A 2QJRA 2PHZA 4WJZA 2JIZD 2NZUG 1J0DA 1CBUA 2FMUA 4AC9A 2OF7A 2Z30A 4CF6A 1T2FA 3CEPB 2JEOA 4MPRA 3A2LA 1R5OA 1FFHA 3D0SA 4Y1EA 3FM5A 3OYAA 1B4DA 2Q2WA 1DG3A 5BYKA 4X6UA 3UF0A 3JS5A 3PI7A 4D0LB 5B4VA 1IV8A 4D9EA 4Q12A 1QZYA 5F1PA 4A2PA 4EJOA 1M2VA 5DHAA 3M4XA 4CETA 4JSTA 1Q44A 2JJ7A 3ONFA 3DPSA 1Z21A 3W3AA 2DJNA 3RKQA 2AT1A 4EGFA 3TW7A 5LA6B 2VUHB 4R9SA 2JVGA 1U0BB 1TB4A 3JQPA 1SOMA 2VDRB 3HVUA 4V38A 2A9FA 3IAS1 1WHUA 2XKPA 1U81A 2I5PO 4EX6A 2IH5A 2JHAA 5EINA 4O6JA 4QE3A 1AQJA 4J0GA 1DAOA 4B84A 3RVRA 2O8NA 1F8YA 4P4SB 3FZVA 1P18A 4BXOA 2EX1A 4N0PA 1A5TA 1K6MA 4C29A 1Z6RA 1G8YA 1C0IA 3QKRA 1G3WA 3VTFA 2C3YA 4BN0A 1VRVA 3CCLI 4MK4A 1C5KA 3E82A 1JRLA 3FCXA 4NONA 4JIMA 1TRHA 4A0ZA 5IOZA 2FN7A 2XE7A 4CQMB 3W1WA 4D26A 4MS3A 4TS1A 1ORRA 4FGKA 1XZIA 1TK3A 1T2EA 2P6UA 4JX4A 5EJAA 4LPKA 3K9BA 1M34E 3DMNA 1Z45A 1RAHA 4DDTA 1LW7A 3KR9A 4GGMX 2ZULA 1R0YA 4TWAA 2J9ZB 2B21A 4F0JA 2PMWB 4ZZ2A 2AS0A 5NULA 3IEVA 4DMMA 3D0KA 1B2LA 2JIOA 3TZ6A 1KFKB 1LVKA 3CLSC 4M6VA 3RTRA 5IBCA 4UFPA 1HMYA 1DXOA 4ZVKA 1SXQA 1HNZB 1WMEA 3U4QA 2OLKA 1WCV1 3UM9A 2G4VA 4HI0E 2J5OA 3T3NA 2YXDA 1F2UA 4TQ9A 5K3AA 2R8PA 3KWLA 1UOPA 2RGUA 1IN4A 1SUBA 1IXKA 5AVWA 2L9NA 2RK6A 3ABLH 2C00A 4QDTA 1PWEA 3DE0X 3TO5A 2H4YA 3WXMA 4DILA 4L76A 1VBFA 2MJLA 1CEXA 2CJFA 2LH9A 2QV0A 5IN5A 3RTAA 3ZCQA 3K5IA 4O2AB 3LA6A 3PQ3A 4RD0A 1N5LA 2UUPA 5JYEA 4UB6C 1KQOA 2MYUA 4H2DA 4NFLA 2ZPUA 1JIQA 1U3TA 4XW2A 1T6BY 4P0TA 3TQHA 2VNHA 5I3CA 2K7LA 3L82B 1R6UA 4RJ2A 3MT9A 2IT0A 1BD4A 5JO0A 1TM7E 5AW3A 5K0EA 4J0HA 1RD4A 1V6SA 4F5WA 4HS4A 3BFVA 5ER6A 4S24A 4D80A 3NDJA 5LUAA 3IOYA 1M7BA 2CUFA 2OC6A 3R5HA 1CJKC 1X1BA 3ENVA 2YBEA 3A1WA 2FOIA 1IHYA 1GCAA 1XYGA 1VYTA 4KDFA 5EEAA 2HA0A 4C3HJ 1BJTA 3OY2A 3H7AA 3OIVA 3KEQA 4EJSC 3MG9A 5EG0B 2P2LA 5LM3A 3THWB 3IODA 1MQSA 3U1BA 2HT6A 2O8FA 4LYEA 1JR3A 5A7FA 3QI7A 2ABWA 1OAAA 2JLWA 2HQNA 2BDEA 3E4DA 3U62A 1YR9A 2R7MA 1EDEA 3SQMA 1FTSA 4BJ3A 2OGZA 5F4ZA 5IUKC 5KVCA 1OTXA 2KIFA 4H77A 1HE4A 2R85A 1EK1A 3CT4A 4CNBA 3IDAA 2ZFWA 5CDUA 1QQBA 1UKZA 1FFWA 2VYCA 4D8UA 1BSVA 2RGRA 1TAHA 5FQNA 1L7MA 2H2AA 3AIKA 2E2LA 1QGYA 3DFMA 4QG3A 1NVXQ 5IXSA 1P75A 3KHTA 3OWOA 3HXLA 1UWLA 4XEUA 3DZCA 3EVGA 1JJAA 1CR2A 2K9LA 2Z43A 1FSSA 4HN2A 2Z1MA 3NAQA 5H70A 1BMQA 4BU2A 1UANA 5A62A 1AGXA 4IH4A 3LJKA 1CUSA 4DUGA 1GL6A 4QYIA 1L5WA 1CF4A 4L0DA 7GPBA 4ND2A 3FX3A 2HFJA 1HH4A 4OHCA 1ZFNA 4GVXA 1KZ9A 4EHHA 2B1JA 3GVHA 5CFLA 2WSYB 2HEGA 1PS0A 3GFLA 2VRCD 2IXBA 4BPBA 2IHBA 3BJRA 1T9CA 2FUKA 3CT6A 3QE0A 3DD5A 2O0KA 4RDIA 1HC8A 1F17A 1RHJA 2HN9A 4QNRA 3OIWA 1GN9A 3OYFA 1MAHA 2OZPA 3KJEA 2FWJA 3W7AA 4YROA 1E4YA 3RO7A 3IOMA 1X1AA 3FFAA 2D5LA 2V9VA 3QOPA 4X97A 3AM4A 1JI3A 5CT4A 1USUA 3WI7A 2R7LA 5BWNA 1OBCA 4IZHA 3FCAA 1W7AA 1U8CB 3ZMTA 1YFJA 2W9XA 2A9VA 2PLNA 2PZBA 4A3IJ 1O9BA 3SNKA 2VXYA 4ECAA 5IT9K 1E9SA 2G76A 4YMLA 4RA6A 2YVQA 4UBIA 2Q2NA 1MO2A 5JSZA 5KQLA 2FPWA 5K01A 4N5HX 2QE6A 4ZIRB 2L3DA 3RVDA 1TW2A 4CDRA 3ADKA 2Q6TA 2LF7A 2OZLB 3DBRB 4V1CA 1YAHA 2R8EA 4IJ6A 1HSZA 2WFAA 4BDTA 1AS0A 3ICOA 5L8VA 4WZBB 1FL9A 3QYEA 3KOZA 2F5CA 3BHIA 1YO6A 2TRSB 4HQFA 2WLSA 2BUCA 1Z4OA 4UM9B 3OOWA 2O54A 2HR3A 2IF2A 2OFOA 4PICA 3ONVA 2H1RA 3IDQA 1N6KA 2XNSA 1L3LA 4W1PA 4LVCA 3VU1A 2WUEA 3E22B 2EQAA 1S6LA 3LRXA 1PL8A 1E6WA 3BFKA 1W1WA 3CPHA 5C52B 3LK6A 5AK4A 5IT3A 1V9SA 4F55A 1JHDA 1L7BA 2D1VA 4GBGA 2H9YA 1JG4A 4S12A 3MMXA 4AIIA 1CY2A 1KERA 2F4IA 1ERZA 4NPHA 1YMVA 2LTPA 2WQZA 5JS7A 5J40A 1JNXX 2ZVDA 3GLFB 2FF7A 1QQTA 2XHKA 3L49A 4TV9B 3ZE2B 1IQRA 2HOTA 1ORWA 2DY1A 1Q11A 2BEOA 2AZMA 4KGDA 1WH5A 1S2GA 2XWJI 4PAQA 4QLBA 1WXGA 3SHOA 1Y9AA 4MZDA 3LDGA 1JFFA 1G3MA 1RI3A 3G89A 3WL3A 1W8DA 1AS2A 1P5ZB 1NRXA 1TZ2A 2B4QA 2OHGA 5KTMA 4ZU1X 4CYGA 1CJVC 1L8OA 2F67A 3AGQA 1EDOA 4LXUA 4MA0A 1IYZA 3NAUA 3D8SA 1X1TA 4FINA 4DCMA 1VIAA 4JR2A 3KNZA 4M4SA 1Y1LA 1QR2A 2YWCA 3PQ4A 2P9BA 5I48A 2POQX 5D5QA 5BRNA 5AM1A 1W4BA 4N5LA 1SZCA 4PHTA 2QBYB 3KEFA 2BKVA 1H6AA 1R36A 1SD1A 1ZCAA 4YRNA 3AL3A 3K70B 1N6IA 1WTCA 2JN6A 3CO6C 2BOLA 3K3PA 4E3ZA 1MW7A 1XALA 3PVCA 4G37A 3PWZA 4TXNA 1KOGA 4B6FA 2VDLB 1TQ8A 4TS4A 4YLYA 1Z5VA 2JK0A 1IN5A 2B8TA 3VO1A 1G6OA 1HCRA 2ASVA 1PJCA 3CLSD 1QK4A 1TQPA 4PN3A 3JRNA 4GW3A 3VNAA 4PAMA 5KQMA 4KYWA 3OPYB 3W6ZA 1ZJ6A 4RPGA 1DINA 3BRQA 4UUMA 1O3SA 1WMSA 4ARAA 1O0SA 3C2BA 3RU3A 2A9JA 3DEJA 2JK1A 3M83A 1CQIB 1SBYA 3W5CA 2Y1FA 4E7OA 1SIUA 2AE1A 1OXVA 4ZK2A 1PT6A 1DL5A 4R3NA 4UHTA 5HNKA 2G5GX 2ZYSA 3RVQA 5K7ZA 3NKVA 3G9QA 1RZRD 5ICMA 3K0HA 2J32A 3MIZA 5TR9A 2QDXA 5LA6A 2GM4A 1PR9A 2BFNA 4WK2B 1X9GA 5G02A 2J0EA 3II6X 3T34A 4OIFA 3PXEA 3DF9A 4DIKA 3WQBA 2VE9A 4XYEA 2EL7A 1VE6A 2DECA 5F2NA 1GFSA 1MC5A 3IOEA 1E5XA 4P4SA 4Y6OA 5HDNA 2IH4A 3GLLA 4P9FA 2NVQJ 1X3SA 1QIHA 1YR3A 1Y3IA 3VFZA 2MCFA 2VXZA 2J41A 2ECCA 2IWHA 4J1QA 5HIIA 5DX1A 4P83A 1XZKA 1OIWA 2IYQA 3SVLA 4CQMA 4IDNA 3TLCA 2CO5A 1O6BA 3E2MA 5FA8A 1P2GA 5B1YA 5FQOA 1LPBB 2E11A 3QOFA 3D3KA 1Z2PX 4FGJA 5FTJA 2JJ1A 3QNWA 2JVKA 2EWWA 5KVAA 1L5ZA 2G3YA 2JZNA 1U7XA 1Z1DA 2GPJA 2CXSA 4R1OA 2X9LA 3AUKA 1WCIB 4EGCB 3P71T 3OOEA 1CV2A 3VHXA 1XA4A 5EKDA 3WZ2A 1J59A 5FTLA 4B6EA 3EXG1 3RJZA 4IF6A 2H2GA 3D54D 3ZCOA 4M8SA 1C7ZA 2ZIZA 4MPTA 2XZTA 2Y9YA 4B3AA 2D4HA 4RK0A 4KYIB 3CKMA 4L9WA 1Z8DA 2HGSA 2FZWA 3MJRA 1NX6A 4ARBA 5ABPA 3H2ZA 3EWSA 1QK5A 1ZD1A 1I1SA 1C81A 1LRKA 2EZ8A 2I4NA 2V8BA 4Q3KA 3EGWA 3WXBA 1WQ2A 4WZAB 1B7GO 5AK3A 2KJBA 4IFEA 4O2AA 5D87A 5P21A 2ZE8A 2KKOA 4M6YA 4GX2A 4KUEA 1GLGA 2QRZA 3H1FA 2B8EA 3ZS9A 2RD2A 1R2QA 4GMKA 2DFKB 2PKCA 4N0EA 1DJNA 2QW1A 3MWEB 5F7OA 2OCAA 4G6QA 3KE9A 4BUJA 2PG3A 5HXAA 4FYKA 1NATA 1YI8A 4FX5A 1TO6A 4CF4A 5C46F 1OY1A 3P96A 1YQXA 4AMYA 1XIVA 3VYUB 4LYHA 5BSVA 2QQBA 1SC4A 3OJEA 2P9HA 3O3KA 3HFJA 1CX9B 5EG0A 3M07A 5GZ3A 5EJCA 3KR1A 2W82A 2QX4A 4PYIA 1W0KA 1BGWA 2X48A 4Q7EA 1YMUA 3ZQJA 5CCDA 3PUHA 1NX9A 2TRTA 4LOKA 2QQ8A 3M9LA 4JP0A 3H3UA 2CCJA 1CS4C 1GQ2A 3TLKA 1KIMA 2QYTA 3A1UA 3BOQA 4KDCA 4GUDA 4H60A 2RBGA 5JFGA 4B82A 1XP5A 4IYJA 1NA5A 3GJSA 1P5HA 2DQYA 2WKQA 1J0EA 4K88A 1TL8A 1G8AA 4BU1A 4NHOA 4W6ZA 3QVLA 2STTA 4AO8A 2EH3A 1QUFA 3EVAA 3KQVA 4I7EA 1R0LA 5GADl 4U39A 3CZCA 1E58A 3QXXA 4TRJA 5GPBA 2R44A 3VSDA 5EGOB 721PA 3F3SA 4ZVPA 2JGRA 2YJ4A 1L7VC 3ESBA 1Z6QA 1VE3A 3DUFB 4WV3A 1RUNA 1E9CA 2WUWE 3E27A 5PGMA 5ESWA 2C88A 4WNIA 1JZTA 2YMPA 1MVLA 5AM2A 4P32A 1CYEA 2OENG 4Q4CA 1FTQA 2X4LA 3G2JA 6AT1A 3HR8A 4XLEA 3SC4A 2QKMB 5F3WB 4KN9S 1IF1A 1Y8CA 1JT0A 4DF3A 3HGGA 4K03A 4KVAA 1B6AA 3ZD6A 4QAQA 2J1LA 1UMQA 2NOGA 3DXXA 4PGGA 1U0EA 4MP3A 4DYQA 4LMBA 3H13A 2XV4S 3ZCXA 3FA2A 1YB1A 2RARA 2YC2C 5KDOA 1OI2A 1TTPB 2XPUA 3TPCA 3P0JA 2V0NA 4YMHA 3MMYB 3GUVA 5CYPA 3NONA 1AO3A 3UWOA 3TXYA 3VR2D 1XHFA 3QZUA 4Y2QA 4H1UA 5FLEX 4C1BA 4TT3A 4YCDA 4HK4A 1UB9A 3H1CA 3FX2A 4YVFA 2E5LB 2ILTA 2JGEA 4U02A 4BRSA 3VPHA 1SXJC 3OCZA 4ZIRA 2H6EA 3WBJA 3OIFA 2OZLA 3DBRA 3ON5A 4ZAGA 4HAMA 2ISQA 3H9UA 1R6BX 1KYVA 2JA7J 3LLCA 2MSNA 4WZBA 1DKRA 3H3FA 4LG1A 13PKA 1EWVA 1GQQA 1GUYA 1TIPA 4M89A 3AC0A 2B1GA 4BQFA 2IQIA 3ROGA 3V7FA 3W7BA 1MC1A 4ARIA 2EIHA 4ZXFA 1Y7LA 1STOA 4LFCB 4LHEA 4PSAA 3R0IA 3I4FA 2Z09A 1BGXT 4ZYDA 2A3SA 1Q17A 3E22A 3LBHA 1FSPA 2H54A 2RFLA 1HYEA 1C80A 2BGJA 4UMVA 1NQ5A 3MQ2A 4BRUA 4G5FA 2IP1A 3PQJA 1L6RA 5GAHJ 1KI7A 1JN0A 3RRYA 3DW3X 4EJ2A 5NLLA 2AEEA 1U0FA 4HV5A 1R7JA 4G5SA 1W7PD 2Z8XA 4LCEA 4NBNA 2XAJA 3GLFA 2XRMA 1G5FA 4NZYA 1R0SA 5A4KA 4TV9A 3ZY2A 4K5QA 2IYEA 2OXRA 2NVWA 3ICQB 4U2DA 2OU2A 3V1YA 3ICPA 1GAWA 3NQOA 3BK7A 5E9JA 3QMVA 3ENWA 4H6WA 1NHGA 4YP1A 3CCBA 3NHYA 2CL5A 4M76B 1XQXA 4QGAA 4L5AA 1UEIA 4OHKA 1NOIA 4EF6A 3B13B 3EOAI 2HU9A 3W1VA 1Q19A 3GVPA 4DY6A 2UYHA 3P0FA 2DJ5A 3ZD9A 4TQGA 1RYBA 1T24A 2X76A 1OR7C 1UF5A 3U61B 4UCFA 4XD7A 4B6QA 3G8AA 4NLLA 2A5DA 2YIMA 1QM5A 3G6EI 1VGRA 2QBYA 3OJXA 4WOBA 2OR3A 2HCRA 4ANJA 5CGQB 4G1VA 4YIHA 3AK4A 1ODFA 1A72A 1FTWA 1WVGA 5F5XA 3I59B 4MNTA 1WULS 1F4KA 4JLSA 4YTEA 5EE9A 2BV6A 5EKUA 1CYDA 1CFZA 1WSAA 3C39A 4XWAA 1EGMB 4U9UA 4N9HA 4UU7A 1BC7C 1W4CA 2A86A 2I1VB 2GX6A 4TYWA 2C4NA 5IM4A 2ZJ7A 2BCGY 3UBTA 4HYQA 4RESA 1W36B 3OPYA 2YH2A 1Z75A 4X3OA 4BMCA 2OBNA 2H0RA 1CQIA 4MLZA 1D2CA 1DC4A 4LNAA 3S6JA 2OCKA 5JCZA 1VP9A 3CXUA 5IULC 1MVOA 4AICA 4A0HA 1U7TA 1IZYA 2YVLA 1ON1A 2H48A 1UT6A 4ZT7A 1T8PA 4KFTA 4PLCA 5A9TA 4WKCA 1MNQA 5HMMA 3AEQB 2O0YA 4U7FA 2R60A 1POXA 1Y8ZA 5AKLA 5A1TA 1W46A 3HYTA 4D8WA 1GZ6A 2NZJA 5CLJA 2ID8A 2KJQA 1EHIA 2XCQA 3FOWA 4DDMA 3WLRA 2OEPA 1SVOA 4ZOCA 4BV8A 2BRUC 4OY3A 4ZCRA 5CDHA 4G5OA 3LHFA 1X19A 5GIOE 3C8UA 3E3VA 2GJAA 2OAGA 4P1ZA 2NP7A 3A14A 1TQ2A 2QZZA 2CXHA 3I04M 1N7JA 2EWMA 4J94A 4WWCA 1FWZA 1RABA 4MA5A 2UYGA 2QQ0A 4DOZA 1BFUA 3WIDA 2RGNC 3L8ZA 3HRMA 2TS1A 2WUDA 1G8SA 4KPYA 3O2NA 1YASA 4YAFA 4RTRA 3T9DA 3G5UA 5I8PA 2JRCA 2X0DA 3HP4A 5M34A 1GTMA 1IBRA 2D5BA 1UPUA 1O94A 4RQAA 3BQNB 4J7XA 3W6JB 1RQ2A 3QEBZ 3O8QB 4QPPA 4Q1AA 4C5BA 3GJQA 4ZTZB 4UB8C 4BKRA 2Y1LA 3HDJA 1VQ5I 1XEAA 4QYMA 2GWRA 3T95A 1IRXA 5HOOA 4Q3AA 4DGSA 5IX8A 1AXRA 3SJUA 3RK0A 4EA7A 2P6NA 1TZLA 3H17A 3VBEA 1TP4A 3KL4A 5DUKA 2EKBA 4F7WA 4ZMBA 1EM6A 1NE2A 2ZW9A 1NZDA 2ISZA 2EBUA 1WCIA 1FRZA 4K7JA 1VFPA 1VBKA 3IAEA 3JSOA 2BFMA 1X15A 2Z5GA 3BD7A 1PDWA 3WDMA 3KZMA 1VYVA 3EZ7A 3L2CA 2A6EF 4AC0A 2QLLA 3OYMA 4JS0A 1WI9A 2IVZA 1KH2A 3F47A 2P9QA 1JZQA 4NMMA 2YS6A 2QE7D 1NXWA 4G07A 1VA4A 3U7EB 4YJHB 3ZH9B 4I6EA 5KCMA 5FOSA 4O5VA 1CQWA 3GK3A 1BHSA 2GLOA 3IPYA 4KXVA 3W5DA 1F1ZA 3KOMA 4F21A 2Q3FA 3I4CA 2QTNA 1H4VB 4EG1A 1B74A 2FAXA 3EWIA 4WZAA 1HXDA 1HWYA 3V8JA 4W4TA 3AKYA 4HG2A 4WBNB 4ZI7F 2VPTA 3LFHA 2VPWA 1KSJA 2IEIA 2QK4A 4KAXA 4MI9A 3MWEA 1K5HA 5EMNA 2MOKA 3GLHB 1DV1A 5JE8A 4TQUS 4P7FA 3QKWA 2HF9A 4MHGA 2QD2A 3GPLA 2VFAA 4PC6A 2FSHA 1H0KA 1E3QA 1K7YA 3GVIA 5B1HA 3V9PA 2I54A 3RD5A 1HYBA 3HVJA 4O8ZA 1YACA 1WNTA 2YV4A 1GT6A 3WU2C 1MJHA 3TGPA 4R8HA 3OECA 5LMCA 1RPTA 2P1DA 3R0JA 4XR4A 3LT1A 5JHFA 3HQ4O 1KI6B 1SXJD 3VNUA 4O4JA 2HHCA 2OHIA 1FY2A 1E9EA 2EILH 3JVEA 1K2VN 4LK2A 2XUGA 4BVFA 1DDOA 2EFJA 3IHLA 1Q0ZA 4X7BA 3I56I 3QU2A 3BCUA 4IUDS 2L9SA 5A04A 2OHOA 2CZCA 3TSAA 3PRYA 3BTLA 2PUAA 1F4LA 1HDRA 2RG1A 1GPMA 3GIWA 3TN7A 5IYZB 4MGEA 3MUNA 3DAYA 2DB3A 1A95A 2HWXA 1EQUA 1H22A 4XGRA 1VQ6I 2Q4OA 2BV3A 4UVBA 2QTCA 5EGOA 4P0PB 1QGAA 2FSGA 2OSVA 4ZQCB 3GGDA 3R76A 4W82A 2MSCB 2F7SA 1AA7A 3DUFA 5HCIA 4FHEA 1W4RA 4FWBA 4G5XA 4ENSA 3S2SA 3ZCSA 2YWBA 1T5LA 4HQMA 3GLRA 4G12A 2PLRA 4PSDA 3NC1C 1KRHA 1LSOA 1L1EA 2QM7A 3QBEA 4XSGA 1H69A 3ZGZA 4C2BA 1EM8B 1O95A 2GNAA 3CG0A 4CMGA 3G5TA 4ZVLA 4GNRA 3VM6A 1YRLA 2F6CA 3L01A 4DQVA 1Z4PX 3K5HA 4DADA 1SQSA 1TQDA 1GZSA 1NN0A 1ID8A 5HE9A 1LPMA 3VZSA 3E8XA 3C6XA 1BMFA 1MQ8B 1D3AA 1WF6A 2GBCA 4K9PA 1F9EA 4LBWA 4BO1A 2BW3B 2WSIA 3PR1A 3CWZA 4IPTA 4L07A 1YO5C 2VOEA 4L18B 2V6CA 2VHXA 1UPBA 2R7DA 2HDHA 3OYLA 1B8OA 5DM6F 4UUVA 4YK7A 4FQ5A 5B2FA 3OP1A 1CE8B 2XB2A 1YHQI 1TK9A 4PPNA 1ML4A 1AURA 1XLTA 1DWUA 1T0HB 4KMUX 2PSJA 2HZBA 4MRPA 1N2XA 4OHPA 4GX1A 3K5PA 2QZJA 3R3WA 1VRWA 3B12A 3BD8A 1H0HA 3JVDA 4LWPA 2D45A 4CTOA 1UMDB 3MNFA 3R0AA 3RYPA 2OD5A 4B4CA 2BHNA 1XFDA 4R1QA 2ZAYA 4XUEA 1KS2A 2M98A 5TMEA 1UDWA 5HRUA 1VTNC 1QBKC 5EE1A 5IAGA 4IGAA 2JCBA 4DNCA 4EI9A 2GCIA 3EDOA 5EE5B 4FD3A 5SZIA 3LXXA 3MJSA 1S2NA 4RMHA 3LX5A 4URWR 2P3OA 5DS9A 3CC4I 2PT6A 2KT0A 4IINA 3GC6A 1DAHA 2XCOA 4KQEA 4G36A 3U1DA 1SHZA 2IUUA 1JTVA 4KUHA 4JP1A 4Q00A 1J2YA 3V4LA 3L77A 2I9PA 4WLFA 4YP9A 3KV1A 4D7AA 3G4SI 3W6VA 2ZDHA 2JL1A 4KV9A 1H9GA 4DEVA 3L7AA 1KKUA 1BWQA 3L0OA 4BFUA 3H9QA 4RVNA 3K0EA 1SC3A 3SU8A 3SYLA 1QWOA 1KY4A 2Q5LA 5B3JC 4O4LF 4N40A 5J1YA 3NKLA 5HUQA 1SVWA 3MELA 3RAPR 1V5FA 1K27A 3BDIA 1XMIA 5KSWB 1PNTA 1VCNA 3CU5A 4RZ3A 3RS7A 1Y7TA 4HWKA 1I2CA 3SICE 2UUOA 4ZHQB 4FMPA 4TX1A 4XLLA 4WECA 1GYPA 2QTMA 4BMVA 2LKSA 3P9XA 2XKKA 4LSZA 2WM9B 1X1EA 2HDDA 2V7GA 1ULHA 5HNHA 2BM0A 2PJRB 1HE1C 3JAMZ 1N32B 3LAWA 3C8DA 3I59A 3FZGA 3D6FA 2I4LA 3RTCA 1E1YA 5TLSA 3DV9A 1X39A 4Y33A 2GIZA 3BFPA 3ZX5A 2ZYIA 4ER0A 1TVKB 2JGDA 5CA1B 3I1YA 1NRJB 3AU8A 1E17A 3Q7TA 4GMHA 2EP8A 5JCOC 3LX8A 4M1QA 2J46A 4JLWA 4C4XA 3ZHXA 4B6RA 3MRSA 1I3LA 1VQ9I 2A92A 4QOFA 1GTJ1 3CQZJ 1AE1A 1Z0ZA 4EKDA 5AKXA 3SSAA 4RLSA 2PWPA 4CA0A 5CB8A 4I9GA 2REOA 4ZCLA 3LDFA 3H5VA 3LYHA 1V35A 2EBFX 2DH6A 4Q15A 2PEYA 4CU2A 2QU8A 1SFXA 3OWTA 3AEQA 4D99A 1M6NA 4LF5B 3NHAA 4A8JC 3LQ4A 3WTYC 1FJXA 2GN4A 1Y5IA 1R1TA 1WDWB 4HWPA 2XE4A 3G8YA 3LFUA 1KA9H 2A7XA 2A5JA 1KRWA 4IVPA 3CQ9A 2R7FA 1BE0A 3KZKA 4MVYA 3P0EA 1L4KA 1TZMA 1DXHA 2WY2D 2N1MA 4JQFA 2JFZA 1MUUA 2CMPA 1SBIA 2OD9A 1Y7IA 4JZKA 3H8JA 2I76A 4Y2GA 3DJYA 1XT6A 2WZCA 2O9LA 4LF4B 2G7UA 3WRXA 1DP7P 2GHIA 4JD5A 3W05A 1OJ7A 1G55A 1SBNE 4JH0A 1SAYA 3CSSA 2HIGA 2GTPA 9ANTA 5TEWA 2YJZA 3WB0A 2O6LA 2XGJA 4EB0A 5F23A 4R8SA 1WHTB 1YS2X 2RIPA 3O8QA 4TROA 2MSDB 2XSDC 4ZEXA 3TZBA 3CRW1 3D0RA 1GNRA 3EXIB 4EHAA 5I7UA 4KPFC 2RV8A 1JGTA 4D41A 3LVRE 3WFZA 5D4SA 2DH5A 2G08A 1PJSA 2LREA 1VZ2A 1W75A 3H2IA 1W4LA 1QYIA 4LOAA 1BIBA 3KJFA 1GG9A 2RGCA 2C3PA 4F3YA 4UNNA 3UJPA 3T7RA 4G8JA 3T54A 4IR7A 3K10A 1E3DA 4HN4B 2VSXA 8GPBA 5IF9A 5J59A 4AP5A 3A26A 1QNTA 3TSCA 1A8UA 4LV5B 2YKGA 2Q28A 4IRGA 4H7KA 5TIIA 1A3CA 4GSYA 2YRWA 4YJHA 4HEJA 1G42A 2JIQA 1PSDA 2X9QA 3HXKA 1G8MA 5C8DA 2E4YA 2O8VA 1G9XA 4CDNA 3LNQA 4HAOA 2I2AA 1FLVA 2IUTA 2J7PA 4C03A 1RRVA 4PCQA 3IX7A 3SQXA 1U7WA 2PR7A 3EWNA 4MWBA 1E5TA 4GL2A 3LQ2A 2LVSA 3DLAA 5CGZA 4WBNA 4MPPA 1KJNA 5E20A 3G49A 4RAGA 2CVOA 1KZGB 4RZ2A 4XFJA 3HDQA 3WTXC 3WLSA 1TIBA 4OJTA 3PJDA 2DGDA 1M2WA 3GLHA 3QFSA 1Z2DA 1NSTA 1K3UB 1OT5A 3D1VA 3BH0A 4YRDA 1WZCA 2YS7A 1HL7A 1SFRA 1RHMA 2CXPA 1XMPA 1S3GA 2X41A 4JX8A 2P68A 2QM8A 2NO1A 3RJ9A 5FUVA 2X5OA 4FI3C 2QNRA 1LDJA 2UYOA 2LTAA 4UTXA 1UFMA 4MRVA 3ZOZA 1HLVA 1GR0A 4C7XA 3JAMA 4MCJA 1KI6A 1QVTA 4H15A 4O63O 1AC5A 2XXBA 3UCFA 5KO2A 4UPVA 4L5YA 2EV9A 1I2BA 3S99A 2ZANA 4BWFB 1G8GA 2I62A 1A7AA 4DC0A 2H65A 2OBPA 1OB5A 2EZLA 3OY9A 4Q6BA 2GSWA 1R5ID 3KKLA 3HXMA 3KKMA 5IYZA 1MGPA 3T7JA 4YONB 3RS9A 2IVMA 1W6UA 3LLSA 3HHHA 4DABA 4IIFA 2WNHA 3ZOBA 4EYEA 1HBXG 4LV8B 2IYXA 4XUDA 1DEAA 3GUYA 3QXJA 2F9FA 4K9KA 3RZDJ 3IP7A 4ZOLF 2KIQA 4YO8A 2G7ZA 1P91A 2YWXA 1DBIA 4LYDA 1EF4A 1XAGA 1EGVB 5HIJA 2PH5A 3PM1A 1MB3A 3PTZA 2DXIA 4GLOA 4F3RA 4RLQA 1JDUA 3V8LA 4MGZR 2LDXA 1EM8A 5GTDA 2WPDA 1DFGA 3ASYA 1TC2A 2L42A 3I2KA 5FFZA 4ZZ3A 4A8TA 4IG4A 1Y5LA 1QNLA 1RS0A 3VOEA 4DMRA 2GYWA 1AB6A 3DMHA 5D1NA 1G4DA 4RU1A 2BW3A 2Y71A 3EIQA 3K1TA 4ZRMA 2BWJA 3W4KA 3B6EA 3BSSA 4DYDA 1GDDA 1KAOA 1DZ3A 1N4AA 3OZGA 3H6HA 4DR5B 3PIIA 4CVNA 3WL4A 1NZFA 1GL7A 4UTVA 3UW1A 4QDZA 4WASA 3IV5A 1CE8A 3PNLA 3ROMA 1SR8A 1RE0A 1VLHA 4UQOA 4DBLC 2LCQA 4E22A 1JSZA 2J4FA 5BSEA 2X2OA 1C3VA 2G9WA 1B93A 2PSSA 2CMDA 4LRTB 3TK1A 4O4IF 3VH3A 5GP9A 3N6XA 3WE2A 3E6AA 1UMDA 5BN5B 4ACBA 4GMGA 5A2QK 3LO8A 5SZJA 1YUMA 2ZTHA 1DHRA 5EIBC 1SCDA 2E4XA 1KI8A 2ERXA 3MF4A 2P9GA 4MDHA 3PS9A 1ODKA 5KAMA 3K4HA 1U99A 2OORC 4ROTA 3CZ6A 3F0CA 3DM9B 3HTSB 3DEZA 2O5CA 3L1UA 2OMEA 3RLFA 1EEHA 1J5YA 1Z3YA 1KXZA 2V1UA 2VNSA 2HW8A 1W0CA 5IJZA 3EQ6A 2QTLA 3UYKA 4ZTFA 2ZVJA 3PZRA 2D1SA 1VQMI 3NALA 4HUTA 3BG7A 1TGYA 2G0AA 3ITDA 1ZPDA 2I6FA 3A28A 1VGQA 2HMUA 4EKGA 2HK6A 3CS3A 2IPQX 1OFVA 4EW1A 2CHVA 1DFHA 2Z9BA 1PR1A 2V74B 4MAFA 2Q21A 4LHSA 2O6HA 5FO5A 4MMZB 2F1RA 3DKPA 4KZFA 2OFWA 2DSNA 4UC0A 1OAOC 2YQZA 5L3BA 4ITVA 5FV4A 3QG1A 2WAFA 4D5EA 1NBWB 4MR8B 4QDJA 5FUXA 4Y6SA 1OTYA 4JLKA 3M1CA 2HADA 1LUJB 4FX0A 1T6YA 3QLVC 3WWZA 4KR9A 3HMQA 3V46A 4ZHQA 1Y1QA 1BO6A 1OU4A 1NHAA 2V0GA 3CINA 5HKAA 3U60B 3HFSA 1M66A 2HXSA 5F0HA 5LHIA 1LQ1A 2O3FA 4E7PA 1C3EA 2YU3A 1NUPA 3DOFA 3O21A 3Q87B 5IT4A 1PVDA 4B7ZA 4KYUA 4B46A 4JK1X 4GOJA 5DI9A 5J4VA 4PANA 1S3FA 4J2TA 2PJRA 3FTPA 2VSQA 1RPNA 3I6MA 2C9YA 4BEHA 1U11A 5FTNA 4YFKF 1JVNA 4GOND 4QXMA 3QA3E 2FRXA 2FE3A 1ETUA 3RYRA 3M9WA 5H8KA 2CD7A 4B40A 2W2NA 1K86A 4S1OA 1LLUA 3P9YA 1QP4A 1TVKA 3E0QA 3BK1A 4PZCA 1SCKA 5CA1A 3MKLA 1XTZA 2QD4A 2HGCA 4MZXA 5FJJA 1JUSA 2XXAB 2EARA 4XM1A 2PZKA 2JHCA 3KQQA 4PPFA 3CLTD 1M7HA 3NAGA 1PYDA 5ED0A 4ZI5A 3IO3A 4B6JA 1VE7A 4OGWA 4Q21A 5JLXA 3PLAE 3IWZA 5D8LB 5HRCA 1E6CA 5IDWA 5HP4A 1GV5A 2GXQA 5B2EA 4BFSA 3HZJA 3I04A 5DDIP 3G2KA 6REQB 2OBXA 1M0WA 3CE6A 1FVXA 3VJMA 2X22A 4U6SA 3JQBA 5JVGF 4OHZA 1ECGA 2C8VA 3OTWA 3N2LA 1E1RD 3NIDB 1Q5PA 5UKDA 2QMHA 4QFMA 4KHPB 4ZO6A 1XMXA 2JD1A 2JI9A 2FBIA 3WZLA 2XAUA 1E59A 4TKLA 3KZXA 4HV4A 2W22A 3HO6A 2Z98A 3RRZA 1BA3A 1DCFA 3K31A 3HEMA 2IS1A 3NGLA 3HPGA 1ZM4A 2FQYA 1QP7A 2BAGA 3WB2A 5ALPA 3P2KA 3B6MA 3PEYA 2XGXA 5IVKA 4PG5A 4TWRA 4BVLA 2CW8A 2RK4A 3EMKA 4PNHA 3FF4A 2MGQA 2JW5A 4FB5A 1KO7A 1SUDA 3NUGA 4U2KA 4ZT3A 3TX6A 3OFNA 3JD4A 4EJ0A 2C98A 2XAGA 5JMPA 3U1KA 5HKKD 3PJGA 4D4LA 1JLLB 1BDHA 3CNEA 2H4WA 2QMUA 2JFNA 4TRRA 2CMKA 5HYVA 4Z8YA 4NICA 3ZDAA 2BZ0A 3FLMA 3EXIA 4QOEA 1BJZA 3KE2A 5FHQA 2RHRA 2GA8A 5HDGA 2HV9A 3HC7A 2ENUA 1FRFS 2VIIA 1G1AA 2EZIA 4ZAWA 2AO9A 4DAEA 2W2QA 2XUFA 5F64A 1DIOB 4TV7A 4FHZA 4BCCA 3OVMA 5EZYB 5IJAA 4F96A 2C7BA 3EC1A 1J7KA 2WIDA 5FRNA 3UC5A 1NQXA 2YC4C 1UXJA 1VQLI 3FNBA 1PYGA 4JB2A 3PQEA 3G73A 1ODJA 2MH9A 3DA8A 4D74A 4HH1A 3U3XA 1PFQA 3ZQFA 5EQFA 1O5OA 1QIDA 4U0VA 3OZ7A 2G82A 4GRAA 3TTXA 2XF7A 5DNWA 4MKRA 3EVEA 3GRFA 3PHIA 1O6GA 5B55A 3ROZA 5ARCA 3N3BC 3W8EA 1EH7A 3FF5A 5EKXA 1QP0A 5E38A 5T7BA 1YJXA 8ADHA 5F52A 3MM4A 4F7ZA 2GXUA 1SFOJ 1IQPA 3GFIA 4JEMA 2BY2A 4Q9LA 5IVIA 5FYDA 4JJFA 4FT8A 1T6NA 1R9GA 5LD2B 2YV3A 1L8LA 2X40A 3JWPA 5K5QA 2HR1A 3OSFA 2AUMA 1VXRA 3LY9A 4XDZA 3T5PA 1K6YA 4AX4A 4P80A 3ORHA 3F2IA 2W58A 4P34A 4D98A 2DU9A 3P0HA 2DFEA 3S1QJ 1KYTA 4B17A 2EFNA 3DBLB 1EUZA 2G0NA 2FR0A 2HQSA 2G36A 3H0GJ 4U2GA 4Z9BA 4YRRA 4GYJA 2J48A 4S0HB 2B92A 4PG4A 2BFOA 2QXUA 3PPWA 4QXAA 3ZV5A 2QTTA 2E37A 1DX4A 3A7EA 1GTRA 2V96A 1CF7B 2JB9A 3KLMX 1XVVA 1VL6A 3ND8A 1G291 2LCFA 4IXAA 1O03A 3K1JA 4WF2A 2OBLA 4MQFB 3JPYA 1YR6A 2VJ5A 2G80A 4LY6A 1Y89A 3PF8A 4FOOA 3O75A 4MW5A 3F7MA 5ERXA 1R0KA 3J7YJ 2ZFUA 4W1QA 5JS1A 5EIBD 5A5DA 5B3SH 1D0VA 1T8YA 2QR3A 3EBPA 4XKCA 1YDHA 4OCZA 2JZOA 5TEVA 3D59A 4B31A 2E1CA 4Y1GA 3CC2I 2YUSA 3S14J 2XYQA 2DRIA 4WXEA 2NVUB 2PANA 1ZYRF 1UG0A 3ZG6A 1TL7C 5TQ2B 3ETDA 3FNEA 1SXHA 2JAQA 4G5YA 4D4IA 3OBBA 3FOAA 2PRIA 4LGMA 4KZPA 3DZKA 2ZIUB 1BX3A 1DBPA 1KZ7B 3RH0A 1OQAA 5HM6A 3LL4A 3K0CA 1P9QC 1G98A 3L9XA 1LQTA 5IJ0B 4OHOA 3S2FA 2GDJA 1KOLA 4EG6A 3MT8A 1R5NA 1ITZA 1L5HB 3QVOA 3ZDYB 2IIQA 1VQ8I 2M0CA 4KHZA 5BURA 1MX3A 3PE6A 1R4ZA 2HA5A 2FZEA 3PNOA 1LD3A 3BXXA 4LYFA 4Z4GA 4D3XA 2CFOA 3EA5A 4B9EA 3G59A 3AGPA 5LEKA 1FBUA 3OM9A 4MPJA 3TGWA 1CK4A 1MAWA 1NC3A 1P1BA 5JS6A 4K6GA 3EASA 1XQVA 3K32A 4G4SO 1O77A 5FDFA 4AXBA 1S89A 4DCJA 4JJ6A 2HC9A 2MDTA 5JSUA 3U1VA 1JDBC 4YCLA 4HQKA 3PNBA 4EAAA 5ARDA 1VI2A 1OH7A 2ZSKA 1Z6TA 2EJTA 4OX9B 1SKYB 1VCHA 1VZ0A 4EL0A 2QI9C 2XA2A 1EWTA 5BN5A 5DZSA 4DKJA 5GTIC 4BFTA 5K7SA 4EHKA 2O2CA 1UDCA 1GFWA 1D2AA 4D0NA 2YZGA 3LTEA 1DIGA 3JYOA 3HABA 3QWLA 4Y2SA 3BR0A 5KCZA 2PGLA 4HPQA 2Q5HA 4LTNA 1WETA 1FZQA 4KR3A 1JE0A 1HMPA 2JLVA 4IXNA 2M87A 3L79A 3VKWA 3D9QX 2P0WA 5FO0A 2HQAA 2OCXA 4U9IS 3LPLA 4M3GA 4I1UA 2A0FA 2ZJRF 4C0KA 2H06A 4HZGA 4WK8F 5CEJA 4UUPA 1KU0A 1AKUA 1NPYA 2NRAC 2EKZA 2WF8A 5KUTA 4L9JA 2FOLA 1P7IA 5FNVF 1OD6A 5HLTA 4CL0A 4RKWA 5D3KA 1WP4A 1MAUA 2WB1N 4TXJA 2C2BA 4Z9AA 3EZXA 2HCBA 5H6RA 3EBLA 4YIKA 1ZIYA 1J9GA 1I4OA 2QIOA 1MGOA 2BHRA 4XLPF 1OBFO 1YL7A 4C3ZA 4JIGA 3IP4B 3L3BA 2SNIE 2QN6A 1FBSA 3SJZA 2QL6A 1SCBA 4EZIA 3C14C 3BL6A 4C20A 5AKKA 5EZ5A 3K05A 1Y6GA 4WKBA 3ZXYA 4X7MA 1GGFA 3W2GA 2JVHA 4G24A 3DCYA 4MR8A 3SJ7A 4OOIA 3IPLA 3OT4A 2RH4A 2ZSEA 3S2ZA 2MA3A 3ZE0B 4QELA 2BSAA 4NR0A 1NR1A 4WLEA 1WKCA 3DOCA 3LPAA 2ZRLA 4U5XA 3WL6A 1DLIA 3W3AD 3SKVA 3HA3A 5JSFA 1VJ5A 1DG9A 3K2IA 4BQAA 1JHHA 1QYVA 3LF1A 5EDNA 3D4IA 4RKEA 2XLCA 1E4VA 2DWPA 1CLEA 4AJ2A 1NOKA 2QRMA 4RVOA 4TMYA 1UBOS 4F5EA 3L7CA 5B1SA 2HA2A 3H0EA 1GQFA 2RN7A 3GH1A 4AMZA 3JTEA 3DVQX 3O4JA 1N7GA 2XXAA 4UHEA 2FDCA 1JLRA 1Z15A 1EFAA 3C7KA 4O02B 1X3WB 2BL4A 2M7AA 1QOZA 4B6SA 3TBIA 4YY3B 3AR4A 2GD1O 4MIOA 4MYDA 1XG1A 3I4LA 1IM2A 1XI2A 4ZREA 3U80A 5DHTA 1LC3A 1JI0A 3DSRA 3ZHQA 1W581 2PJZA 1DQRA 3JD3A 2Z2XA 2VYFA 3FWPA 1X3UA 1Q7TA 4JCCA 1RC1A 3IS3A 2B4YA 3LFKA 4MIKA 3PIDA 2POCA 4GXOA 1N92A 3QX3A 4KQKA 4N6OA 3PCTA 2QG6A 2ECOA 5EP3A 1BE8A 2A5LA 4ZTBA 4OMYA 3THWA 4CTMA 3N8HA 3KPUA 4YRAA 4MEJA 4ZYLA 4AF7A 1A5JA 4J29A 5LB2A 3IUBA 1BOBA 2UUZA 4HFNA 1JYEA 2HTEA 4TV8B 4PR3A 2I78A 3AHHA 3PFIA 3X2FA 3GOHA 4PONA 4TTIA 5I5GA 3RKRA 3BPXA 3K4CA 3OE1A 2CFTA 3BJEA 4X1OA 3ABKH 5JANA 2O0JA 3EUEA 1OREA 4KX3A 1GDTA 5EESA 3ANTA 1EB9A 1JLLA 1KMHB 2NIPA 4HRXA 2EX0A 5LLDA 1H0RA 2KM1A 3HUGB 4FOTA 4DSTA 4OJMX 4G4JA 3FCSB 5BWMA 3LHSA 3REQB 3SZUA 4YMWA 2DR2A 3S2UA 3ZI7A 4RFLA 2ATXA 4YDSA 4GLFA 5IS2A 1JEOA 1C1XB 4NCKA 4UHJA 1NUQA 1FNBA 4PG8A 1DV2A 3FM3A 5HK9A 5EZYA 5J2UB 2X6TA 3EEBA 2DQSA 3GDGA 4UVDA 1KH1A 3IIIA 5DNVA 4K28A 4RABA 2OJED 4P9UA 4ON9A 1TQIA 3HDVA 4EY8A 3ZBPA 1LBEA 5JD6A 2YQ5A 5T64A 2YJ3A 2WJ6A 3X0DA 1XGNA 1JR3D 1IJFA 4C07A 4MIEA 1GVDA 2PMDA 4LK3A 2A9QA 4HX2A 4MROA 1SKAA 1NLMA 1ZMXA 3GBVA 4KV7A 2ZJAA 3T52A 2Y99A 3EZLA 1XGMA 2VB6A 2OV1A 3SSMA 2IHJA 3B78A 3O84A 4CUZA 4FOSA 1YW9A 3A9SA 5JXIA 4UOZA 3VNVA 2HFHA 5F35A 3QF4B 4OQYA 3BKWA 4MVJH 1RYNA 3IJ5A 3K8OE 4CWAA 3OEWA 4IJQA 1YVDA 4P2BA 3U7HB 2VAVA 5A4IS 2NXEA 5FBQB 3DBLA 4XRMA 5G0WA 4NPAA 2P0YA 3SYMA 4BZZA 2FEKA 3WKCA 1GRQA 4IHJF 3U44B 1H5NA 1NVDA 4XCXA 4I3GA 5IY5H 4A3FJ 2V7VA 4E3WA 3TGNA 1E3OC 3GRYA 2HWYA 3DZDA 3FCYA 4RBNA 5C0OE 4OFBA 3OT5A 4AVPA 1CF7A 4X45A 1T43A 3S70A 3CUUA 5JJBA 5LXTB 3B9RA 3DL4A 4O2BF 2VBXA 3UEOA 3ZWKA 4MQFA 1FSHA 2QLTA 5KOHB 3D2AA 4KR0A 1ETYA 2V7BA 3H5AA 5AJTA 1CKEA 3COWA 4CV3A 3WNCA 3QSYA 3EUWA 2QUHA 4KI0A 2MMCA 3Q5DA 1UBMS 3F90A 3H1BA 3K4MA 2BHYA 2BH9A 2A14A 4EW6A 2W42A 3TOSA 4QYXA 1JA0A 1NASA 2ZYAA 2CMGA 5CM2Z 4HKTA 5IP9J 2IIPA 2PIDA 2J3JA 3HCRA 2ZQYA 2K4JA 2CJWB 2NVUA 1J9ZA 2IZOA 3DHYA 5C31A 4V03A 4Q01A 3NV7A 4XWWA 1Y1VJ 5TQ2A 3PDIB 4HDRB 4M0EA 4NEHB 4IO1A 3L2QA 5G1OA 4XASA 2A0KA 2O9JA 1POWA 2K27A 4JBWA 1WJEA 3U81A 4MW6A 4TMTA 1XCPA 5KQRA 5ITZB 2DPXA 4FZVA 3BZ6A 5IJ0A 4LF8B 1U98A 3HCDA 3MJFA 2P4QA 3OMWA 2G70A 2X6XA 1L5HA 1YTYA 3JTHA 1SD6A 1QVAA 1KF0A 3M5PA 2Q4RA 3BMQB 4II2A 3HY3A 4QASA 2JFUA 2H5JA 2F8TA 5BSKA 4U7GA 4NRDA 2O2IA 2FWPA 2WYHA 3RM3A 4B76A 2N8GA 2ACJA 4OFXA 1QVRA 3K8YA 4LECA 3ZJUA 2QSUA 1AG9A 5KHLB 3I12A 3VNRA 3HHEA 4F06A 3RVMA 1O3QA 1WWXA 2PSEA 3OYGA 3IP1A 1KZHA 1OJLA 3EUFA 2FZ5A 3BROA 3JW8A 4IV0A 1IOVA 1IUYA 2LK2A 4RDXA 2JIBA 1T95A 1RAAA 4P38A 4BQOA 5F12A 1RWVA 3D5TA 2XLBA 2WB1A 1FB5A 3BLYA 1RZUA 2M7BA 4LJ7A 4WCFC 4L73A 4UVEA 1OCPA 5AI9A 2WJAA 2D2VA 2CLEB 5CXXA 1NOJA 3BN3A 2QQAA 1TU3A 5EPOA 4D9KA 3V1LA 1T0FA 2HA4A 5LCXA 2VBZA 4A03A 5JS8A 2X58A 1ZMTA 3BC8A 3DWLE 3KP4A 4TRNA 4XWYA 4YRTA 2JA8J 2MU1A 2J9RA 3WHPA 4FCCA 3W3CA 5BYBA 3SOZA 4KT6A 1PYOA 3M3PA 1L5RA 3GFVA 3EGCA 5EJFA 4NATA 3PD0A 3M6AA 1Z5NA 4W63A 1C9KA 1Q14A 1U0GA 5JQWA 4Y15A 5JCPA 2WJHA 3H65A 2SECE 3U6KA 1BFKA 3EDYA 4M86A 1WW3A 3V2IA 2OV4A 4E2FA 1LKXA 3LWZA 2LBFB 5LZ7A 4BNUA 5GAEJ 3ZPXA 1PSWA 1XGKA 1MCZA 4OSPA 1F7UA 5EUCA 4PK4A 1K89A 4XOIA 1O6ZA 1ZMRA 4W5JA 3CVXA 1GQSA 4NBQA 3U48A 1WUTA 2AMLA 1BRMA 1U6JA 4MGIR 2XAFA 3OF3A 1KMMA 1KI4A 1L5VA 4IV8A 1Q84A 4MKZA 1LE8B 4HNQA 2I66A 4G5GA 3LC1O 4UXHA 3IJRA 3ZKWB 3CVYA 3I76A 1OGYA 5JI6A 4UNIA 3F8BA 1BAPA 2OKGA 1FW8A 2VPXA 3PQ5A 3B85A 2WG2A 4M72A 3CH7A 5DTMA 3JCUC 3QMPA 5K0CA 1BI2A 3SC6A 1II0A 4X3PA 2EGGA 4A6PA 4B3RB 2VDVE 3IELA 3ZPLA 3CR7A 3Q15C 1QKIA 3T35A 1KMNA 1ZICA 1LQ2A 3QXGA 5FPYA 4Z1OA 4BJTA 1YITI 3RYTC 2LVBA 3C1DA 1ISPA 3V8EA 1G3IA 3UHFA 5TRTA 1PFYA 3BVPA 5CNIA 1E2HA 2BELA 3O8OB 3WK8A 2F1KA 3MHTA 1M6HA 2EXXA 1ABBA 5K3OA 2B6NA 2FDXA 4WXMA 1MOSA 1CUWA 1L7XA 1LJLA 4GDFA 2XT9A 4Q3DA 3ZVKA 4OYYA 2Q6KA 3UA3A 2QN8A 5JXGA 2Q29A 3OIUA 4CQMD 2QKYA 1YBAA 4PJJA 4AYBN 4GQBA 2JMWA 4JP5A 3RPUA 1S2OA 3T9EA 4IRUB 2W2KB 3K70C 5DEQA 4RV9A 2NUTB 2YUTA 3K4QA 2XNCA 3ZR4B 1HNNA 2WD8A 4AKTA 1JDZA 3GFMA 5K0LA 3IH3A 4F2HA 4FZ5A 4MVJP 3GEMA 4MUGA 2X6RA 4MW7A 5BSFA 5I8ZA 2FFHA 1P2DA 4KIWA 3UK0A 4NOLA 1Z7EA 3P2JA 4HNHA 1ZD4A 2P5SA 2WHYA 3JWJA 2CDBA 4JV5B 4P3NA 3AFNA 5A9SB 4TV8A 1PJAA 1E79A 1R66A 1Z17A 3ZWCA 1KE2A 3GW2A 2Q45A 2AW5A 1QS0B 1JIVA 4JODA 2IOHA 1N0UA 5LNK1 2C20A 2Y0BA 3FMRA 1WGXA 4G23A 5WRFA 5A4MS 2R62A 3G88A 2W6NA 3R3SA 1KMHA 4KITB 2IHNA 4LF7B 4FZ3A 1Q57A 3LA2A 4G1UC 4IHVA 5ICEA 1PKEA 4B4UA 2A5GA 4LBZA 1B6RA 2ACKA 2I1QA 2WB2A 2W43A 3P2OA 2CW0F 3HUGA 5M5BA 3I6YA 2ARKA 2CV1A 3REQA 5E1WA 8LDHA 3A1VA 3MRTA 3VHLB 3V3KA 2XYRA 1DMRA 2IH2A 1XRJA 2HRCA 5DTQA 3S8EA 4RZUA 2DN0A 1C1XA 3QSGA 3GEGA 5KZMB 4AF8A 5T41A 4XOPA 2Y1DA 1FOEB 2V4UA 3KT6A 3EZGA 3SG0A 4F1KA 1PR5A 2CFSA 2COBA 4G1MB 2X8WA 1FQKA 4DSAA 1ULUA 2X9GA 5H8LA 1W0KD 5EXEA 3KCCA 1G7RA 1WEHA 1O94C 3ZY5A 2HVQA 3DV8A 1B16A 4HR7A 5LMZA 2DM6A 5AJWA 4A10A 2X51A 4PFKA 4ZO7A 2XPWA 2PVSA 1CVRA 2AXQA 4CMEA 2X23A 3FCUB 4ZK6A 2IW5A 2R86A 3HOWJ 4RGVA 4LWOA 3PFCA 4TPKA 4TYMA 3HJNA 3GV0A 1V9LA 2M1XA 3QF4A 2QVCA 3MMZA 4AJKA 3K15A 2OV8A 1JIXA 3X1YA 1PGJA 3MGCA 1FMTA 2PKQP 1TMOA 3FKIJ 4FETA 2EGHA 1RC9A 3LGSA 1JYFA 4IGKA 3I05A 3U44A 3OLQA 2JIMA 2X7HA 4LYYA 4MHTA 2PRZA 3UT5B 3L0YA 4R5HA 2QAGB 3DYIA 4WXDA 3MRVA 3FYUB 3A4TA 2JIRA 4QUGA 2H7XA 4Q48A 1P1HA 4QAJA 3DQZA 1E2GA 2Y31A 1U0SY 2PVCA 5LXTA 1ZO8A 4AROA 2GA9A 1O6CA 3L4KA 4BP9A 1H8EA 5KOHA 1UL1X 1DEHA 4TTQA 4HVLA 3BY6A 1JLHA 2C0PA 1VM6A 2ONZA 5FI0B 4NQZA 3CGWA 3MSCA 4R2WA 4EIWA 1FVHA 3FHJA 4WEOA 3KP5A 3F8MA 1QLHA 1A9ZA 5CBPB 1KDZA 5EL0A 1U9CA 1LVUA 3G3ZA 2GXSA 3IC5A 1R15A 1TYDE 5KTRA 2BSQA 4LJ5A 4NOKA 4I09A 4TT3D 4XWOA 4FNOA 3F78A 1KEKA 5KJCA 2HRZA 2JUCA 1Z37A 2DDAA 2QP3A 4EZEA 2Q62A 2XUQA 1MEJA 1HOMA 3PDIA 2XD9A 4D42A 2WIJA 4HDRA 4M49A 4ISCA 1I01A 1PG0A 2Z2ZA 6YASA 1EBFA 1W8IA 4UE6A 1C7QA 1LDGA 3KDSE 4OQZA 1HQKA 1FUIA 1TQHA 5FLYA 4RL6A 1EU1A 5ITZA 2NO4A 2FBHA 1G3TA 4UM9D 4F38A 1NDUA 4M99A 3O6VA 3VVLA 3DMTA 3PFNA 2JGMA 5KX5B 3GLKA 3QPHA 2F90A 3KSZO 1YVRA 3IMFA 3BMQA 5DM7F 5KAFC 2CNWA 2H4FA 4ESVA 5D5WB 4OEHA 1VYHA 3P20A 2RHHA 4PRLA 4IOLA 2PXCA 3G8BA 4RMIA 5CPFA 5FKJA 3ZVRA 3EG9B 5I7RA 1WH7A 3SHTA 1S8AA 1QU3A 3FYCA 4X8HA 4BNYA 2O1SA 1QCYA 4K2EA 1R74A 2JTVA 4UJ5A 3PC6A 3GAMA 3VU0A 3S44A 1IU9A 1EV7A 5TRDA 4A6EA 1O95C 1QE5A 2RGDA 4Q02A 1A9SA 1FXSA 5LZ8A 1W1IA 4W8HA 1L8AA 1OFGA 1XRLA 2GH1A 4HQRA 4BVAA 1JILA 4ZPJA 1U2SA 4RQTA 2P4HX 1IDOA 4ID9A 2A9OA 3HUDA 1KKMA 5IH3A 1P0QA 1A35A 1N2HA 2A1TS 3OEEA 5FV7A 4LX0A 3WQHA 4XDYA 1LKZA 2VT7A 3MIIA 2CCKA 2VE8A 4WHMA 4QUEA 4M38A 3PSFA 4IH1A 4JT9A 3KO8A 2VJLA 1DWQA 5D85A 3BT9A 4Q9IA 5DN9A 4IP0A 4XYBA 4JLDA 3K6RA 4XD7D 3PGJA 3R7AA 3VR3A 1FUEA 4Y1FA 1ESCA 3WGYA 2ZCVA 2Z1DA 1E96A 3I9KA 3TH5A 3LSKA 1XLTC 5K1ZA 3KC2A 4HF7A 4GLJA 3KJGA 2WTMA 3K70D 3SZGA 2ZE6A 5DX0A 5EYRA 3I83A 1Y4ZA 2LP4Y 2OZUA 2Q3LA 5CXUA 4H7FA 1I1HA 4W1UA 5KTTA 2LBFA 4J43A 3SJBA 1JDVA 4K9QA 4HQ0A 4G0MA 1IRIA 1Z05A 3MFQA 1L0OC 3ERMA 2HSEA 3AI2A 1V43A 3GARA 3UMSA 4HXGA 2H2WA 1OFUX 5B12A 4BO5A 3SFVA 4PYLA 5GMOA 4S1TA 4S1PA 1F6WA 1QH0A 2XDYA 2C5EA 4DJ5X 4EYOA 1P1CA 1XJ0A 1XZNA 1XD9A 2DR0A 3UN1A 1LE8A 1S01A 4LMYA 5LOVF 3ZKWA 4DUPA 1MO4A 3A3NA 5AW4A 3T8RA 1SD4A 4OIQF 4GH5A 3JRWA 1SBZA 3OQBA 5KNLA 5U1PA 5TQJA 3ZJ4A 3G9TA 3UMCA 5AXDA 3OOSA 4OLBA 4AYBA 3CLTC 2Y05A 3I42A 4XWKA 2VUTA 2Z33A 3OF2A 5JS2A 3EGDB 3RKXA 3VPAA 5DHUA 5EJ9A 4ZAVA 4AUNA 3PDWA 2QENA 3G17A 3UV7A 3RARA 5FAXA 1BDMA 3VKVA 4NC9A 1DARA 4AY6A 2C97A 3IQFA 2VC1A 4BV2A 4L51A 2GOXB 4NYIR 3W2HA 2ZMEB 4NU5A 4X71A 4OXQA 1DPFA 3O8OA 2BI8A 3KSAC 2XB8A 4AQYB 2D6FA 2XA1A 3FLEA 1KQFA 5DNDA 4JLNA 2RCYA 3L0BA 1BEZA 2O7RA 5GOZA 5FWDA 5BW8A 4DV5B 1RWPA 3FFTA 3OY7A 4HWGA 2QP4A 1SMTA 1JMYA 5JLAA 4MV6A 2QYSA 4Q7JB 1O94D 2OUMA 3KX2A 1RWKA 2DKOA 2NUTA 4E2YA 1DJPA 2Q1YA 3M8JA 4XLHA 5TSDA 3QVGB 1T4BA 4A3DJ 2WWXA 3QJ5A 3WLFA 3SLRA 3DHNA 1WXFA 3UPUA 3LGXA 1YVUA 2FU4A 5DWVA 3AX6A 2JPCA 5BOSB 2VJOA 2XUHA 1H2FA 5IC6A 1PZEA 5A9SA 1C4XA 3QJGA 4NBLA 4AO6A 5FD8A 1M1YB 2I1LA 1QS0A 3ZVMA 3PD1A 4H0CA 4D9BA 2VHWA 1FFYA 3NT2A 1YR7A 3OS1A 3BP8A 3GLGE 3R6SA 2ZZMA 1APLC 3HP1A 2PJDA 2YWGA 4QO8A 4QUAA 3MCZA 4PR0A 3F8NA 4Y2UA 3PC3A 4FONA 4BX9A 2B63J 1OA1A 5EJ5A 5GV8A 4BNZA 2OE2A 2Z4SA 4H08A 1Z2NX 3QVTA 3KFWX 4IDAA 2QF7A 1OROA 3NZEA 4PTLA 5GPAA 3L07A 2E9SA 3ROUA 5CLSA 1UF8A 1WXQA 3EEFA 3JZMA 1RYEA 2MT9A 2FJUA 2PYDA 3B1YA 3JRGA 3WK7A 2XVZA 4C3IJ 1LNQA 1JPVA 2H2IA 5DBHX 4IZVA 1OFIA 3HJEA 4HS9A 1MW9X 5A6SB 5IPFA 2WSLA 4MQ4A 2ODTX 1DJMA 3JD0A 2YS9A 2PLWA 3HOZJ 2FA9A 4ZV4A 1T1GA 5I9TA 1K0UA 2JLSA 2HMTA 3L43A 1G2OA 1O96B 1SCUB 2FMXA 3AG2H 2RBEA 1W35A 2HU2A 5JY1A 1PL0A 3FPSA 4J03A 1K75A 2FPSA 3CLOA 5ICSA 2YWDA 4LSWA 4REQB 2PNJA 3PDJA 5EJGA 2VHZA 2XB9A 4UTZA 5A7HA 3O94A 2JFGA 1XTBA 3KPJA 1VG1A 5EJ8A 2CJYA 3KQKA 3TOZA 3B1KA 2YW2A 1TWHJ 5DM4A 1LBHA 2DLNA 5KSYA 3BORA 4M3NA 3ABUA 3V33A 2PQ0A 4CIYA 2JGJA 2QR2A 1T9AA 1WW8A 4D97A 1HX7A 4B3JA 1TYEB 2D0IA 2G9RA 4N3AA 1ZQ3P 3TP0A 4JFRA 2VHVA 3CRRA 1NNEA 4TZTA 3UGKA 4YRZA 2HFKA 1DJLA 5IAAA 2C0QA 1BOFA 1UXKA 4R2MA 1QH8B 4LMPA 3HVHA 5HSGA 2BBYA 3KSMA 4HMQA 1T1RA 2Q3MA 3NWPA 3D6UA 1J8QA 4IWYA 1EP2B 5H20A 3WISA 4DMCA 5HIAA 2BUBA 1ZQ1A 3R3ZA 4MB2A 1FRNA 3UT5A 2C5AA 2OM2A 2QAGA 3SWWA 3QTLA 4BNVA 1PUIA 4V0NA 1ECPA 2R8RA 3FYUA 4OHRA 3TLJA 4U3JB 2MSEB 1O95D 1T25A 1Q21A 2DA4A 3AJRA 2VWGA 1W30A 5KMGB 4PRKA 1RHKA 3RQIA 1ENPA 4EY6A 1EP9A 1WD7A 2E48A 3BT7A 5K6TA 1FDVA 4PQYA 4LXXA 1Y98A 1D4AA 2E36A 4U88A 1KU7A 1BMFD 4UOEA 3QP6A 1UOQA 5I9IA 5HR5A 4M1ZA 2D5AA 1WKMA 3MHPA 3PG5A 4NECA 2ZSJA 5CBPA 1Q50A 1QVUA 2VG8A 1TCCA 3NCTA 3BK2A 2HYJA 1U7ZA 3U3MA 1J0RA 3STHA 1EG7A 2ZS9A 4URFA 1FNSA 1RRFA 1C2TA 3AR8A 5EE3A 1KQGA 1YAJA 2R751 4YA6A 2G9NA 3T1QA 3WLLA 3T5AA 1T6ZA 1J0CA 2NVOA 1WXXA 1ZVVA 5T4HA 5AW8A 4TS3A 1AWCA 5H83A 2LLKA 1T8TA 4IJKA 1GFIA 3FDJA 1QCZA 3N0XA 4D25A 3KLNA 3QWBA 3DMYA 3ASZA 3AKZA 3RHTA 2JWTA 1Y3CE 1UJCA 5KX5A 4W1SA 3AZOA 5ERGB 1UDAA 1AM4D 2C7PA 5DK4A 3IT1A 2ZP1A 3PCRB 3Q8MA 2ZR7A 3GVXA 2AFHE 3ONEA 1GUBA 4AQDA 3IMKA 5DM60 4BX8A 2UVPB 5T4FA 1YFKA 3EG9A 4CIBA 2VJIA 3OCJA 1RRKA 2BKUA 3DL0A 2OTCA 2K3FA 2ZM5A 5K45A 5FL3A 1SBQA 2G83A 1ZREA 1PW5A 1UFKA 2M5WA 5FPPA 1YA4A 3TOXA 1Z34A 3L8DA 1HRKA 4B79A 2IDJA 3OCCA 4S05A 5DGIA 2C7OA 3M4JA 3NIBA 4OJYA 4PG7A 3U4AA 3EX7C 2VF2A 4KNYA 3PFWO 4IHXA 5T67A 2V7TA 3ZP5A 2XEXA 4X63A 1ZKDA 3H86A 1VOTA 1UM9B 3AM3A 4UE3S 3QVWA 1M83A 2IV2X 3BTIA 5KNBA 4KH1A 2DHQA 3IIMA 1IXYA 2EWNA 4YLGA 2BPOA 4YRMA 3LPNA 4UKDA 3HN2A 2F64A 4CV2A 3THXB 2CNOA 3F4LA 4OHWA 4WA7A 4OFZA 3V3TA 4D81A 4RAYA 1ULTA 3VYWA 6ABPA 3FB1A 2HX1A 1ZUIA 5DFAA 2R5WA 1ODSA 4IIHA 2GZSA 5GVSA 3CP2A 3RFXA 2W4SA 2VBIA 5CCEA 3WZMA 1TF7A 1RDFA 3GEDA 3FBGA 4ZRNA 1EWKA 3BTCA 4DV3B 3IVMA 4LQDA 4FUQA 2V9PA 5L3RA 4HPJB 4RB1A 1OU0A 1TJYA 1UZCA 3WLMA 1EEXB 3H42B 3DEFA 1P4AA 2PH3A 3EGOA 1V71A 3TW6A 1N5IA 4YEDA 1WHTA 2I2XB 3AUTA 4AM8A 2B35A 3FY4A 3NPAA 2WWYA 5K3DA 4DSZA 3RS3A 1SEVA 2PSDA 3COVA 4PTYA 4IXTA 4MLDA 3DTYA 2HTSA 3IVXA 4JYCA 4FP9A 3D7RA 1GKKA 2X8AA 5E1DA 1ORTA 4DLUA 3H0KA 5EGNA 1GO2A 3HGYA 4CLEA 1U9IA 4GAEA 2ZSUA 5JMOA 1WB6A 5CEEA 1BU5A 1IY0A 2BF4A 4Q1VA 2FG6C 2VKQA 5IC4A 5BQTA 4MNUA 4P1WA 1USSA 4PPQA 3EGDA 3FPBA 1DHTA 1R3UA 1W87A 2CF6A 3CVJA 2OPTA 3BE8A 2ZBQA 2CVFA 3DM5A 4BE2A 5HGXA 1O0BA 3CG4A 2B1QA 2ZMEA 5BW6B 1Q6YA 1BI0A 3CJNA 3C48A 4JJIA 3ZD8A 3RRFA 2K7ZA 2ORIA 3NIWA 3CLUC 2YZ7A 1W5BA 1QQ5A 1Y34E 1J06A 3MJHA 1IUOA 5TDHA 1P7CA 1G8XA 3RC9A 2CQNA 1XL0A 5AI8A 3DBHB 1FTZA 4C0WA 3ER9A 1WJFA 4EYSA 3KPWA 4IDCA 4G01B 2VP0A 3AONB 2HRRA 4IHWA 3HSRA 3H5LA 1IZ8A 4L9RA 4W5RA 4FHCA 1SQGA 3T1NA 3QVGA 3MT0A 1AHPA 4V3BA 2HKXA 4XVQA 4JYPA 1IO2A 1K08A 4P9NA 4YAEA 3FTCA 1XJWA 4PCAA 3HUEA 3WLTA 4AK9A 2WJVA 5BOSA 1WXEA 4DLTA 3E7XA 4MCHA 4GXRA 3ASOH 4A4DA 2JGLA 1G9SA 2P8JA 2WY8Q 4CHUA 5FWYB 1ZJJA 3FTQA 1DOAA 1M1YA 1WV1A 3E9ZA 5ELLA 4ZC1A 4FISA 3MAJA 1XN7A 1W73A 1ZGHA 5FBHA 5ED4A 3F9CA 4X24A 1C3XA 2GZ2A 4F5YA 2WLTA 3JQBC 5C1DA 1HLDA 4BS9A 2J7PD 5JBNA 3AR9A 4K2AA 2O59A 4YPVA 2BEWB 4IDGA 4NYIQ 1SHUX 1FYVA 2PTGA 4G0QA 4OP3A 5K3EA 5EJ4A 3ZCVA 1ENOA 5DBOA 4J0KA 1Z82A 3HRHA 3GXOA 1VE1A 3TG2A 1JEDA 3NBYC 4YUXA 5A6SA 4K2HA 4HZUB 4ZYTA 1AN0A 3QE2A 4JROA 3CESA 5IAOA 4MUMA 2JH8A 2GCPA 5EKTA 1O96A 1SCUA 1XAHA 2X5JO 3SM3A 2BIFA 4TYNA 2VJQA 4FR0A 3LLMA 3PQFA 3NWSA 1CCWA 3MPOA 5IOYA 1WPGA 4REQA 4PXSA 1P7JA 4RD3A 3PCXA 3OPXA 2GPAA 2F5DA 1FBTA 2QLFA 3H0DA 3CF2A 1U8ZA 7YASA 2YU9J 5FGMA 4LE1A 3GRKA 3U3ZA 5HZGA 4ALNA 1GCUA 3E61A 3CP8A 4TM7A 3CB4A 5EJEA 2EV0A 2DA7A 3FR8A 1HYHA 3FBTA 4G41A 4X6AJ 1G7TA 1RC0A 3F3YA 1JT6A 1YE5A 4QXRA 5K0JA 5G53C 1UBGA 1B41A 4O25A 3M8FA 4DC9A 1QH8A 3AYZB 5EI5A 3U7JA 4AMBA 2IV3A 1E0AA 3ZWDA 1QQ6A 4HCJA 3A9RA 1BDBA 5LPNA 3DZHA 3S3TA 1JL3A 3NYRA 1K6JA 5MFPA 1V7CA 5CJ9A 4W9MC 1Q0TA 4CM1A 4A3CJ 3E3MA