3N0BA

Tm0449 mutant crystals grown in loops/micromounts
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
216
structure length
216
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRAFATVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Diffraction study of protein crystals grown in cryoloops and micromounts.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 74
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3n0bA00
3N0BA 4GTDA 1KQ4A 3AH5A 3N3YA 4FZBA 1O24A 4GTBA 4GTAA 5CHPA 4KATA 4GTFA 5IORA 4GTLA 5IOQA 4GT9A 2CFAA 4GTEA 4GTCA 1O29A 2CFAB 1O2BA 5IOTA 4P5BA 5JFEA 4KARA 1O25A 1O28A 1O26A 5IOSA 3G4CA 4P5AA 3N0CA 3G4AA 1O2AA 1O27A 4KASA
chains in the Genus database with same CATH superfamily
2VUMC 4Y7NK 3AH5A 3AQPA 1C0AA 3HOVK 3HOZK 4GTFA 5IORA 5C4JC 4GFQA 3GTJC 2WB1D 4C2MC 3GTQA 3BP3A 5M3FK 4KMHA 4P5BA 4ILDA 1YX2A 3TTGA 2JA7A 4C3HC 1VJEA 4P5AA 1J6XA 3S1RC 1O27A 3CAGA 2PMZL 4C3JC 2E2IK 2V6UA 3T00A 1HI9A 4A3GC 5TMFA 3S1RK 4Y52C 3M3YC 1F7UA 3S2DK 1F7VA 4YG2A 5FLMK 3HOUC 4KM8A 2ZUEA 3RZDC 3GTLC 4OIPA 1DD5A 2NVYA 4O2DA 2Y3PA 3GTLK 1TWGA 1I6VA 4BY1C 2NVTC 1IE0A 2R7ZK 3CQZC 1WQGA 3GTPA 5TJ3A 1YCLA 2PA8L 3S16C 2PHCB 3MMLB 4A3KC 2JA6A 3TFJA 1Y1VC 5IP7C 5M5XK 3GTKK 4YFXA 5IYCC 1DCOA 4AH6A 1WORA 3RZOC 3FHZA 5FJ8K 1WCMK 4A3MK 3RZOK 1PJ5A 1F93A 3GEHA 4KB4A 4A3DC 4XSZA 5CJ9A 4G0VA 2NVXC 1WSVA 4FM9A 1TWAK 2B63C 1O2FB 4BY7K 1BDFA 1Y1WK 3S2HC 2P5MA 1B4AA 5IP9C 4C45A 1WOOA 1EFWA 3M4OC 3HOWC 3I4NK 3HOWK 3GTGA 3GTQC 2YU9K 4PAAA 4X6AK 3T02A 4BBRK 1IW7A 2GSNA 2GAHC 2E2IA 1O28A 1XZQA 2E2HC 1TWCK 3GEIA 3K7AK 4Q4ZA 3HXAA 4KMDA 4LR2A 2E2HK 4XSXA 4BLBA 5C44K 1EI6A 4A3JK 3N3YA 4AYBD 1ZXOA 3FKIK 1K83C 3SZZA 4OINA 5JVOA 3GTOC 4C3IK 4WJ3M 4M1XA 3HOYK 2R7ZA 3GTOK 1HQMA 2NVYC 2WAQD 5C3EC 1I3QK 4GT9A 1TWGC 1J6WA 4LK1A 4BBSC 3VA7A 5JFEA 3GTPC 1F9NA 1O25A 1SMYA 2NVQC 2P8TA 1R9TK 3ADAC 1VRQC 4A93C 1BGWA 3S1MK 3LAPA 3N0BA 3S17C 4GZYA 1WCMA 2VUMK 4MQ9A 2R93A 4GTLA 4LOWA 1XXCA 3AQOA 4QJVA 4YFNA 1USOA 5EGHA 5C4JK 1TWAA 1XXBA 5IYDC 3GTJK 3H3VD 1Y1WA 4C2MK 4KM9A 1TWHC 1DCPA 1XZPB 2XCOA 3HOXC 3N0CA 4G0WA 3S0XA 4C3HK 3QX3A 1XPPA 3TFIA 1JVIA 1I6HC 4C3JK 1O24A 5CHPA 3S1NC 2JA5A 4A3GK 1TWFC 1X31C 2YU9A 4Y52K 3M3YK 3AD7C 1WQFA 3HOUK 4A3IC 3A8KA 2ZFZA 3RZDK 3GTGC 3GTMC 4GTEA 1TWCA 1O29A 1I50C 4LK0A 2KWAA 4KB2A 1I50K 4BY1K 2NVTK 3HKZD 2FQTA 3CQZK 4LJZA 3PO2C 3FKIA 4OIRA 3S16K 4XLPA 2FQOA 1JQWA 2Y0SD 4A3KK 3S1QC 3AD8C 1Y1VK 5IP7K 3IPJA 1I3QA 3A8IA 1IQ0A 5IYCK 5IYBC 2CW0A 1ZQ1C 4KMAA 1R9TA 2GSOA 4QIWL 2R92C 5IOTA 4KMUA 4PABA 1IBAA 2A68A 4A3DK 1SFOC 3H0GC 2NVXK 2VUMA 3L4KA 4A3FC 2B63K 3H0GK 2O5IA 4GTBA 4OIOA 4KATA 3S2HK 2A69A 5IP9K 3M4OK 3GEEA 3ERED 2R93C 4NOIA 2PMZD 2CFAA 1WOPA 3LPXA 3SZYA 1ZYRA 2JA7C 4WJ4A 3GTQK 3G4CA 3TFHA 5L46A 3G4AA 4A3EC 1J98A 2WB1L 4A3EK 1EH1A 2XCQA 2JA5C 3GTLA 2PA8D 1IS1A 2PPBA 2D6FC 1K83K 1ZBSA 2V6SA 3Q3QA 1L0WA 4XCHA 2CFAB 3JSTA 2NVYK 2V6TA 1YNJA 5C3EK 3GTKA 1TWGK 4BBSK 3BUEA 2O5JA 1XZQB 3GTPK 2NVQK 4A3CC 2JA6C 3S14C 2JA8C 1WQHA 4A93K 4A3LC 4FZBA 1G51A 3I4MC 4BXXC 1PJ7A 1VGXA 3S17K 4KN4A 3EQLA 3AD9C 3S15C 4LQYA 1EQRA 4RMFA 4A3BC 5M5YK 3FOEA 2NVXA 4P9SA 2B63A 4Y7NC 5IYDK 1EK8A 1TWHK 4KDDA 2XCRB 2E2JC 2EBBA 3HOXK 3HOVC 3HOZC 2E2JK 1BS2A 2RH6A 1VH2A 1I6HK 3GDZA 2BE5A 2A6HA 3S1NK 4XLNA 1TWFK 1J6VA 4BKWA 4QJVB 1XXAA 4A3IK 1O2BA 4KARA 1V5VA 3GTGK 2E2IC 2E2HA 3GTMK 4KN7A 4Q5SA 3S2DC 5FLMC 3OEPA 4G7OA 3PO2K 4G7HA 1K83A 3GIRA 3GTOA 4OIQA 5EGEA 3S1QK 5TMCA 2R7ZC 1WIHA 5IOQA 4MEXA 4G7ZA 3L4JA 4AYBL 5IYBK 3PO3C 1USMA 3LAJA 3BP8C 4BLAA 3DXJA 3NUHA 3PO3K 3GTKC 2R92K 3A8JA 5HL8A 2WAQL 4G0UA 4KASA 4DDQA 4GTDA 5M5WK 2ZUFA 1DCHA 1VLOA 2GSUA 1SFOK 1B4BA 1WCMC 4A3FK 4A3MC 3GSIA 1GE9A 2W7VA 3GTJA 5D4DA 4MEYA 2R93K 4LLGA 1TWAC 4ZH4A 1TWHA 4BY7C 4J3NA 1O26A 1Y1WC 4KAWX 3T01A 3V4GA 4YFKA 2JA7K 3OPFA 4JK1A 1KQ4A 3H3VL 1ZVUA 3I4NC 1TWFA 4GTAA 1PJ6A 2GAGC 2YU9C 2JA5K 4X6AC 4BBRC 1WSRA 1AB4A 3GTMA 4KC6A 1WOSA 1I50A 5C4XC 3CQZA 1TWCC 2JH3A 3K7AC 4WILA 5C4XK 5C44C 1JOEA 4A3JC 2A6EA 3FKIC 1RU0A 1Y1VA 4C3IC 1UV7A 3HOYC 5E68A 1INNA 4QIWD 4A3CK 2JA6K 3S14K 2JA8K 3HKZL 2RGRA 1I3QC 4A3LK 3I4MK 4BXXK 2Y0SL 3FOFA 2R92A 3WODA 4GTCA 1R9TC 1IL2A 3S15K 1XZPA 1ISEA 3OREA 5M3MK 3S1MC 5IOSA 1YNNA 4A3BK 1SFOA 1BJTA 1O2AA 3H0GA
chains in the Genus database with same CATH topology
3L4KA 3AH5A 3N3YA 1K83A 1ZXOA 3GTOA 4GTBA 3AQPA 5EGEA 5JVOA 4KATA 4GTFA 4M1XA 5IORA 2R7ZA 3ERED 4GFQA 1WIHA 5IOQA 3L4JA 4C2MC 4GT9A 3GTQA 2CFAA 3LPXA 3VA7A 3LAJA 4KMHA 4P5BA 4ILDA 4BLAA 5JFEA 2JA7A 4C3HC 1O25A 1F9NA 3NUHA 3G4CA 4P5AA 3G4AA 1O27A 3CAGA 4C3JC 1BGWA 4G0UA 4KASA 4DDQA 3LAPA 3N0BA 4GTDA 1EH1A 2GSUA 2XCQA 1WCMA 1B4BA 4KM8A 3GTLA 1GE9A 1IS1A 2R93A 4GTLA 1ZBSA 1XXCA 1DD5A 3AQOA 2NVYA 3Q3QA 3GTJA 2Y3PA 5EGHA 1TWGA 1TWAA 1XXBA 2CFAB 1WQGA 1TWHA 3GTPA 1Y1WA 4KM9A 5TJ3A 4J3NA 1O26A 3GTKA 3BUEA 2XCOA 4KAWX 2PHCB 3N0CA 3MMLB 4G0WA 3V4GA 3S0XA 2JA6A 3QX3A 3OPFA 1KQ4A 1WQHA 4BLBA 1ZVUA 4FZBA 1O24A 1TWFA 4GTAA 5CHPA 2JA5A 2YU9A 1WQFA 3FHZA 2ZFZA 1AB4A 4LQYA 3GTMA 4KC6A 1I50A 4GTEA 1TWCA 1O29A 3CQZA 2JH3A 4KB4A 3FOEA 2NVXA 5CJ9A 2KWAA 4G0VA 4KB2A 2B63A 4FM9A 3FKIA 1EK8A 1Y1VA 4KDDA 2XCRB 4C3IC 2P5MA 1B4AA 2RH6A 1I3QA 2RGRA 4KMAA 4BKWA 3GTGA 3FOFA 1R9TA 2R92A 2GSOA 1XXAA 4GTCA 1O2BA 5IOTA 2GSNA 2E2IA 4KARA 1ISEA 3OREA 2E2HA 1O28A 5IOSA 1SFOA 1BJTA 1O2AA 3H0GA 4KMDA 4LR2A 2VUMA 3OEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N0B A;  4GTD A;  1KQ4 A;  3AH5 A;  3N3Y A;  4FZB A;  1O24 A;  4GTB A;  4GTA A;  5CHP A;  4KAT A;  4GTF A;  5IOR A;  4GTL A;  5IOQ A;  4GT9 A;  2CFA A;  4GTE A;  4GTC A;  1O29 A;  2CFA B;  1O2B A;  5IOT A;  4P5B A;  5JFE A;  4KAR A;  1O25 A;  1O28 A;  1O26 A;  5IOS A;  3G4C A;  4P5A A;  3N0C A;  3G4A A;  1O2A A;  1O27 A;  4KAS A; 
#chains in the Genus database with same CATH topology
 2VUM C;  4Y7N K;  3AH5 A;  3AQP A;  1C0A A;  3HOV K;  3HOZ K;  4GTF A;  5IOR A;  5C4J C;  4GFQ A;  3GTJ C;  2WB1 D;  4C2M C;  3GTQ A;  3BP3 A;  5M3F K;  4KMH A;  4P5B A;  4ILD A;  1YX2 A;  3TTG A;  2JA7 A;  4C3H C;  1VJE A;  4P5A A;  1J6X A;  3S1R C;  1O27 A;  3CAG A;  2PMZ L;  4C3J C;  2E2I K;  2V6U A;  3T00 A;  1HI9 A;  4A3G C;  5TMF A;  3S1R K;  4Y52 C;  3M3Y C;  1F7U A;  3S2D K;  1F7V A;  4YG2 A;  5FLM K;  3HOU C;  4KM8 A;  2ZUE A;  3RZD C;  3GTL C;  4OIP A;  1DD5 A;  2NVY A;  4O2D A;  2Y3P A;  3GTL K;  1TWG A;  1I6V A;  4BY1 C;  2NVT C;  1IE0 A;  2R7Z K;  3CQZ C;  1WQG A;  3GTP A;  5TJ3 A;  1YCL A;  2PA8 L;  3S16 C;  2PHC B;  3MML B;  4A3K C;  2JA6 A;  3TFJ A;  1Y1V C;  5IP7 C;  5M5X K;  3GTK K;  4YFX A;  5IYC C;  1DCO A;  4AH6 A;  1WOR A;  3RZO C;  3FHZ A;  5FJ8 K;  1WCM K;  4A3M K;  3RZO K;  1PJ5 A;  1F93 A;  3GEH A;  4KB4 A;  4A3D C;  4XSZ A;  5CJ9 A;  4G0V A;  2NVX C;  1WSV A;  4FM9 A;  1TWA K;  2B63 C;  1O2F B;  4BY7 K;  1BDF A;  1Y1W K;  3S2H C;  2P5M A;  1B4A A;  5IP9 C;  4C45 A;  1WOO A;  1EFW A;  3M4O C;  3HOW C;  3I4N K;  3HOW K;  3GTG A;  3GTQ C;  2YU9 K;  4PAA A;  4X6A K;  3T02 A;  4BBR K;  1IW7 A;  2GSN A;  2GAH C;  2E2I A;  1O28 A;  1XZQ A;  2E2H C;  1TWC K;  3GEI A;  3K7A K;  4Q4Z A;  3HXA A;  4KMD A;  4LR2 A;  2E2H K;  4XSX A;  4BLB A;  5C44 K;  1EI6 A;  4A3J K;  3N3Y A;  4AYB D;  1ZXO A;  3FKI K;  1K83 C;  3SZZ A;  4OIN A;  5JVO A;  3GTO C;  4C3I K;  4WJ3 M;  4M1X A;  3HOY K;  2R7Z A;  3GTO K;  1HQM A;  2NVY C;  2WAQ D;  5C3E C;  1I3Q K;  4GT9 A;  1TWG C;  1J6W A;  4LK1 A;  4BBS C;  3VA7 A;  5JFE A;  3GTP C;  1F9N A;  1O25 A;  1SMY A;  2NVQ C;  2P8T A;  1R9T K;  3ADA C;  1VRQ C;  4A93 C;  1BGW A;  3S1M K;  3LAP A;  3N0B A;  3S17 C;  4GZY A;  1WCM A;  2VUM K;  4MQ9 A;  2R93 A;  4GTL A;  4LOW A;  1XXC A;  3AQO A;  4QJV A;  4YFN A;  1USO A;  5EGH A;  5C4J K;  1TWA A;  1XXB A;  5IYD C;  3GTJ K;  3H3V D;  1Y1W A;  4C2M K;  4KM9 A;  1TWH C;  1DCP A;  1XZP B;  2XCO A;  3HOX C;  3N0C A;  4G0W A;  3S0X A;  4C3H K;  3QX3 A;  1XPP A;  3TFI A;  1JVI A;  1I6H C;  4C3J K;  1O24 A;  5CHP A;  3S1N C;  2JA5 A;  4A3G K;  1TWF C;  1X31 C;  2YU9 A;  4Y52 K;  3M3Y K;  3AD7 C;  1WQF A;  3HOU K;  4A3I C;  3A8K A;  2ZFZ A;  3RZD K;  3GTG C;  3GTM C;  4GTE A;  1TWC A;  1O29 A;  1I50 C;  4LK0 A;  2KWA A;  4KB2 A;  1I50 K;  4BY1 K;  2NVT K;  3HKZ D;  2FQT A;  3CQZ K;  4LJZ A;  3PO2 C;  3FKI A;  4OIR A;  3S16 K;  4XLP A;  2FQO A;  1JQW A;  2Y0S D;  4A3K K;  3S1Q C;  3AD8 C;  1Y1V K;  5IP7 K;  3IPJ A;  1I3Q A;  3A8I A;  1IQ0 A;  5IYC K;  5IYB C;  2CW0 A;  1ZQ1 C;  4KMA A;  1R9T A;  2GSO A;  4QIW L;  2R92 C;  5IOT A;  4KMU A;  4PAB A;  1IBA A;  2A68 A;  4A3D K;  1SFO C;  3H0G C;  2NVX K;  2VUM A;  3L4K A;  4A3F C;  2B63 K;  3H0G K;  2O5I A;  4GTB A;  4OIO A;  4KAT A;  3S2H K;  2A69 A;  5IP9 K;  3M4O K;  3GEE A;  3ERE D;  2R93 C;  4NOI A;  2PMZ D;  2CFA A;  1WOP A;  3LPX A;  3SZY A;  1ZYR A;  2JA7 C;  4WJ4 A;  3GTQ K;  3G4C A;  3TFH A;  5L46 A;  3G4A A;  4A3E C;  1J98 A;  2WB1 L;  4A3E K;  1EH1 A;  2XCQ A;  2JA5 C;  3GTL A;  2PA8 D;  1IS1 A;  2PPB A;  2D6F C;  1K83 K;  1ZBS A;  2V6S A;  3Q3Q A;  1L0W A;  4XCH A;  2CFA B;  3JST A;  2NVY K;  2V6T A;  1YNJ A;  5C3E K;  3GTK A;  1TWG K;  4BBS K;  3BUE A;  2O5J A;  1XZQ B;  3GTP K;  2NVQ K;  4A3C C;  2JA6 C;  3S14 C;  2JA8 C;  1WQH A;  4A93 K;  4A3L C;  4FZB A;  1G51 A;  3I4M C;  4BXX C;  1PJ7 A;  1VGX A;  3S17 K;  4KN4 A;  3EQL A;  3AD9 C;  3S15 C;  4LQY A;  1EQR A;  4RMF A;  4A3B C;  5M5Y K;  3FOE A;  2NVX A;  4P9S A;  2B63 A;  4Y7N C;  5IYD K;  1EK8 A;  1TWH K;  4KDD A;  2XCR B;  2E2J C;  2EBB A;  3HOX K;  3HOV C;  3HOZ C;  2E2J K;  1BS2 A;  2RH6 A;  1VH2 A;  1I6H K;  3GDZ A;  2BE5 A;  2A6H A;  3S1N K;  4XLN A;  1TWF K;  1J6V A;  4BKW A;  4QJV B;  1XXA A;  4A3I K;  1O2B A;  4KAR A;  1V5V A;  3GTG K;  2E2I C;  2E2H A;  3GTM K;  4KN7 A;  4Q5S A;  3S2D C;  5FLM C;  3OEP A;  4G7O A;  3PO2 K;  4G7H A;  1K83 A;  3GIR A;  3GTO A;  4OIQ A;  5EGE A;  3S1Q K;  5TMC A;  2R7Z C;  1WIH A;  5IOQ A;  4MEX A;  4G7Z A;  3L4J A;  4AYB L;  5IYB K;  3PO3 C;  1USM A;  3LAJ A;  3BP8 C;  4BLA A;  3DXJ A;  3NUH A;  3PO3 K;  3GTK C;  2R92 K;  3A8J A;  5HL8 A;  2WAQ L;  4G0U A;  4KAS A;  4DDQ A;  4GTD A;  5M5W K;  2ZUF A;  1DCH A;  1VLO A;  2GSU A;  1SFO K;  1B4B A;  1WCM C;  4A3F K;  4A3M C;  3GSI A;  1GE9 A;  2W7V A;  3GTJ A;  5D4D A;  4MEY A;  2R93 K;  4LLG A;  1TWA C;  4ZH4 A;  1TWH A;  4BY7 C;  4J3N A;  1O26 A;  1Y1W C;  4KAW X;  3T01 A;  3V4G A;  4YFK A;  2JA7 K;  3OPF A;  4JK1 A;  1KQ4 A;  3H3V L;  1ZVU A;  3I4N C;  1TWF A;  4GTA A;  1PJ6 A;  2GAG C;  2YU9 C;  2JA5 K;  4X6A C;  4BBR C;  1WSR A;  1AB4 A;  3GTM A;  4KC6 A;  1WOS A;  1I50 A;  5C4X C;  3CQZ A;  1TWC C;  2JH3 A;  3K7A C;  4WIL A;  5C4X K;  5C44 C;  1JOE A;  4A3J C;  2A6E A;  3FKI C;  1RU0 A;  1Y1V A;  4C3I C;  1UV7 A;  3HOY C;  5E68 A;  1INN A;  4QIW D;  4A3C K;  2JA6 K;  3S14 K;  2JA8 K;  3HKZ L;  2RGR A;  1I3Q C;  4A3L K;  3I4M K;  4BXX K;  2Y0S L;  3FOF A;  2R92 A;  3WOD A;  4GTC A;  1R9T C;  1IL2 A;  3S15 K;  1XZP A;  1ISE A;  3ORE A;  5M3M K;  3S1M C;  5IOS A;  1YNN A;  4A3B K;  1SFO A;  1BJT A;  1O2A A;  3H0G A; 
#chains in the Genus database with same CATH homology
 3L4K A;  3AH5 A;  3N3Y A;  1K83 A;  1ZXO A;  3GTO A;  4GTB A;  3AQP A;  5EGE A;  5JVO A;  4KAT A;  4GTF A;  4M1X A;  5IOR A;  2R7Z A;  3ERE D;  4GFQ A;  1WIH A;  5IOQ A;  3L4J A;  4C2M C;  4GT9 A;  3GTQ A;  2CFA A;  3LPX A;  3VA7 A;  3LAJ A;  4KMH A;  4P5B A;  4ILD A;  4BLA A;  5JFE A;  2JA7 A;  4C3H C;  1O25 A;  1F9N A;  3NUH A;  3G4C A;  4P5A A;  3G4A A;  1O27 A;  3CAG A;  4C3J C;  1BGW A;  4G0U A;  4KAS A;  4DDQ A;  3LAP A;  3N0B A;  4GTD A;  1EH1 A;  2GSU A;  2XCQ A;  1WCM A;  1B4B A;  4KM8 A;  3GTL A;  1GE9 A;  1IS1 A;  2R93 A;  4GTL A;  1ZBS A;  1XXC A;  1DD5 A;  3AQO A;  2NVY A;  3Q3Q A;  3GTJ A;  2Y3P A;  5EGH A;  1TWG A;  1TWA A;  1XXB A;  2CFA B;  1WQG A;  1TWH A;  3GTP A;  1Y1W A;  4KM9 A;  5TJ3 A;  4J3N A;  1O26 A;  3GTK A;  3BUE A;  2XCO A;  4KAW X;  2PHC B;  3N0C A;  3MML B;  4G0W A;  3V4G A;  3S0X A;  2JA6 A;  3QX3 A;  3OPF A;  1KQ4 A;  1WQH A;  4BLB A;  1ZVU A;  4FZB A;  1O24 A;  1TWF A;  4GTA A;  5CHP A;  2JA5 A;  2YU9 A;  1WQF A;  3FHZ A;  2ZFZ A;  1AB4 A;  4LQY A;  3GTM A;  4KC6 A;  1I50 A;  4GTE A;  1TWC A;  1O29 A;  3CQZ A;  2JH3 A;  4KB4 A;  3FOE A;  2NVX A;  5CJ9 A;  2KWA A;  4G0V A;  4KB2 A;  2B63 A;  4FM9 A;  3FKI A;  1EK8 A;  1Y1V A;  4KDD A;  2XCR B;  4C3I C;  2P5M A;  1B4A A;  2RH6 A;  1I3Q A;  2RGR A;  4KMA A;  4BKW A;  3GTG A;  3FOF A;  1R9T A;  2R92 A;  2GSO A;  1XXA A;  4GTC A;  1O2B A;  5IOT A;  2GSN A;  2E2I A;  4KAR A;  1ISE A;  3ORE A;  2E2H A;  1O28 A;  5IOS A;  1SFO A;  1BJT A;  1O2A A;  3H0G A;  4KMD A;  4LR2 A;  2VUM A;  3OEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...