3N0BA

Tm0449 mutant crystals grown in loops/micromounts
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
216
structure length
216
Chain Sequence
HMKIDILDKGFVELVDVMGNDLSAVRAARVSFDMGLKDEERDRHLIEYLMKHGHETPFEHIVFTFHVKAPIFVARQWFRHRIASYNELSGRYSKLSYEFYIPSPERLEGYKTTIPPERVTEKISEIVDKAYRTYLELIESGVPREVARIVLPLNLYTRAFATVNARSLMNFLNLRADSHAQWEIQQYALAIARIFKEKCPWTFEAFLKYAYKGDIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thymidylate synthase thyX
publication title Diffraction study of protein crystals grown in cryoloops and micromounts.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transferase
total genus 74
structure length 216
sequence length 216
chains with identical sequence B, C, D
ec nomenclature ec 2.1.1.148: Thymidylate synthase (FAD).
pdb deposition date 2010-05-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02511 Thy1 Thymidylate synthase complementing protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.170 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3n0bA00
1O24A 3N0CA 2CFAA 5CHPA 5IOSA 3AH5A 4P5BA 4GTCA 1O28A 4GTEA 3G4CA 4GTLA 5IORA 1O2AA 4P5AA 4GTFA 1O2BA 4KARA 4GTAA 1KQ4A 5JFEA 4KATA 4FZBA 1O29A 3N3YA 4KASA 4GTDA 3G4AA 1O27A 5IOTA 1O25A 4GT9A 5IOQA 3N0BA 1O26A 4GTBA 2CFAB
chains in the Genus database with same CATH superfamily
4XLPA 3GTOA 4WJ3M 1Y1WK 5IP7C 1VRQC 5IYCC 4A3IC 1WQHA 1R9TA 1TWAK 3GTKA 1HQMA 1UV7A 1L0WA 4NOIA 3GTMK 4OIOA 1XZPB 3LAPA 3AQOA 5JVOA 3GTLA 5IYDC 2E2HC 4FZBA 2JA7C 1DCOA 3GTQC 3FHZA 4A3DK 1TWFC 3S2HK 3G4AA 3JSTA 2WAQD 3N0BA 2E2JK 1C0AA 4J3NA 5M5YK 3GTPC 2B63A 3H3VL 1DCPA 2CFAA 4KC6A 2ZFZA 1O28A 4OIPA 1IBAA 3S17K 2YU9K 2E2IA 3S1NK 1Y1VK 4A3JC 3G4CA 1O2FB 3M3YK 5FJ8K 5IP9K 2NVTC 2WB1L 1I3QK 4G7ZA 4KASA 1J6VA 2JA5C 2NVQC 1F7VA 4WILA 3HOXC 2ZUFA 2JA6C 1WCMA 2CFAB 3N0CA 3OREA 1TWHA 2PA8D 1TWFK 1YNJA 2XCRB 2R92C 3EQLA 4P5AA 5M5WK 3GTJC 3ADAC 3HOWC 1Y1WA 4A3CK 3AQPA 4GTAA 3HOYK 1JQWA 1VJEA 2RGRA 1TWAA 4BY1C 4ZH4A 1O25A 4A3LC 3GTMA 4MEYA 3S1RC 4MQ9A 1ZBSA 3FOFA 3V4GA 3S15C 1I50K 4KM9A 2GAGC 5FLMK 1IW7A 2O5IA 4BY7C 5C4JC 2JA5K 1B4AA 3CQZK 2FQTA 2RH6A 3AD9C 4XLNA 1USMA 4C2MC 1WIHA 4YFNA 4G0UA 3HOZK 3LAJA 3BUEA 5IYBC 1WOSA 3T02A 3L4JA 3GTGC 3S1MK 5M3FK 5TJ3A 2YU9A 1Y1VA 3K7AC 3CAGA 5C44K 3S2DC 4KB4A 1IQ0A 1SFOK 4A93K 1I3QA 2V6UA 4A3LK 2P5MA 3H0GK 4C3HK 3RZDC 3M4OK 1K83C 4MEXA 4C3JK 1TWGC 2Y3PA 3S0XA 4Q5SA 5JFEA 1TWFA 4KDDA 4KATA 3OPFA 4A3GK 4GTDA 4AYBD 2JA8K 4LQYA 3FKIC 1SMYA 4A3KK 3S16C 1G51A 2R93C 1WORA 2P8TA 1I6HK 3A8IA 3Q3QA 4P5BA 3I4NC 2XCQA 3HKZL 4A3EK 2Y0SD 4A3FC 4C3IC 1J6WA 4GTLA 2CW0A 3AD8C 1BGWA 1I50A 1BJTA 2FQOA 3ERED 3N3YA 3CQZA 1IS1A 3RZDK 3RZOK 1K83K 1TWGK 3SZZA 5IOQA 2NVYK 4A3BK 1JVIA 3FOEA 4BBSC 4M1XA 4KN4A 1EH1A 2R7ZK 3S16K 4BBRC 4GTEA 4Y52K 4KAWX 1O2AA 1F7UA 1VH2A 4BXXC 4WJ4A 1SFOA 5IP7K 3S1QC 5IYCK 4A3IK 3PO2C 1GE9A 4KMDA 3H0GA 1WSVA 1WOPA 5EGEA 1VGXA 1YCLA 2VUMC 3PO3C 5IYDK 2E2HK 2JA7K 3GTQK 4X6AC 3GEIA 3GTOC 4GTCA 5L46A 2XCOA 3VA7A 5EGHA 2EBBA 1R9TC 4A3MC 4KB2A 5C3EC 3GTKC 3WODA 3GTPK 1TWCC 4AYBL 4FM9A 3HKZD 4KN7A 2PMZD 3GTLC 2V6TA 4Y7NC 3TFHA 4A3JK 4KMHA 4BXXK 2ZUEA 2GAHC 2Y0SL 4OIRA 1J6XA 2NVTK 2B63C 1WOOA 4LR2A 1ISEA 4YFKA 3TFJA 1K83A 1YNNA 2NVQK 1TWGA 2JA6K 3HOXK 2E2IC 1X31C 3T01A 2NVYA 3BP3A 2R7ZA 4OINA 3AD7C 3GDZA 2R92K 1TWCK 3GTJK 1ZQ1C 3HOUC 3GIRA 4G0VA 1WQGA 3HOWK 5TMCA 1TWHC 4BY1K 2PHCB 3HXAA 3S1RK 1DD5A 1WSRA 3S15K 4DDQA 1ZXOA 2E2HA 2JA7A 2A68A 3GTQA 4BY7K 1BS2A 5C4JK 1Y1WC 4BKWA 1DCHA 1F93A 4C2MK 1TWAC 1EFWA 1I6VA 1INNA 3GTPA 5IYBK 4O2DA 1O24A 4YFXA 4G7HA 5CHPA 3AH5A 3GTGK 3TFIA 1RU0A 4A3DC 3K7AK 4KMAA 2PMZL 2W7VA 1V5VA 1EI6A 3S2DK 2E2JC 4GTFA 4PAAA 1XZQA 2GSOA 1KQ4A 3HOVC 4Q4ZA 2JA5A 2A6EA 4LOWA 1O27A 2YU9C 3S17C 5D4DA 2JA6A 4BLBA 3S1NC 1Y1VC 1VLOA 2GSUA 3M3YC 1YX2A 5IP9C 4ILDA 1I3QC 3LPXA 3NUHA 4XSXA 1IE0A 1PJ6A 3I4MC 3FKIK 2R92A 1TWCA 4XCHA 3GTJA 2GSNA 2R93K 1XZQB 1AB4A 3I4NK 2NVXC 1XXAA 4A3FK 4C3IK 4YG2A 4QIWL 3IPJA 3HOVK 5HL8A 4GFQA 1ZYRA 5IOSA 1PJ5A 4JK1A 4A3CC 5E68A 3HOYC 4GZYA 1BDFA 1B4BA 1EQRA 3S14C 4BBSK 3GEHA 1I50C 4P9SA 3GTGA 3I4MK 1O29A 5FLMC 4BBRK 5M5XK 1ZVUA 3TTGA 4AH6A 3CQZC 4QJVA 1PJ7A 1O26A 3HOZC 4GTBA 4RMFA 3S1QK 4C45A 3PO2K 2NVXK 5C4XC 3BP8C 4XSZA 5CJ9A 3S1MC 1EK8A 4KMUA 3L4KA 5IORA 2VUMK 3PO3K 4G0WA 1O2BA 5C44C 4KARA 4X6AK 3GTOK 4A93C 3GEEA 1SFOC 4QJVB 1XPPA 3FKIA 4BLAA 1R9TK 4A3MK 5C3EK 3S14K 5IOTA 4GT9A 3GTKK 3A8JA 3H0GC 2R93A 4C3HC 3T00A 3M4OC 2PPBA 4C3JC 2A69A 1F9NA 1JOEA 1WCMC 3GTLK 2JH3A 4Y7NK 4A3GC 4QIWD 2JA8C 3H3VD 4A3KC 5M3MK 1XXBA 4LK0A 4OIQA 2WAQL 5C4XK 2B63K 1WQFA 3OEPA 4LLGA 1I6HC 3SZYA 1J98A 2V6SA 2E2IK 4LJZA 4A3EC 1USOA 2WB1D 2KWAA 2BE5A 3GTMC 2D6FC 1IL2A 3MMLB 3RZOC 3S2HC 3HOUK 2NVYC 1WCMK 4A3BC 1TWHK 1XZPA 4LK1A 2NVXA 1XXCA 2R7ZC 2O5JA 4PABA 1HI9A 2PA8L 3A8KA 4G7OA 3GSIA 3QX3A 5TMFA 2VUMA 4KM8A 4Y52C 2A6HA 3DXJA
chains in the Genus database with same CATH topology
4KB4A 4GFQA 3GTOA 1I3QA 5IOSA 4LR2A 1WQHA 1ISEA 1R9TA 2P5MA 1K83A 3GTKA 1TWGA 2NVYA 1B4BA 3LAPA 2Y3PA 3AQOA 2R7ZA 3S0XA 5JVOA 3GTLA 5JFEA 1TWFA 4FZBA 4KDDA 4KATA 3GTGA 1O29A 3OPFA 3FHZA 1ZVUA 4GTDA 3G4AA 4LQYA 3N0BA 4J3NA 1O26A 4GTBA 4G0VA 1WQGA 2B63A 2CFAA 3Q3QA 4P5BA 2XCQA 4KC6A 2ZFZA 1O28A 5CJ9A 2E2IA 2PHCB 1EK8A 3L4KA 4C3IC 1DD5A 3G4CA 4GTLA 5IORA 1BGWA 4G0WA 1I50A 1O2BA 4DDQA 1ZXOA 2E2HA 2JA7A 4KARA 3GTQA 1BJTA 3ERED 3N3YA 4KASA 4BKWA 3CQZA 3FKIA 4BLAA 1IS1A 5IOTA 4GT9A 5IOQA 2R93A 3GTPA 4C3HC 1WCMA 3FOEA 2CFAB 1O24A 3N0CA 3OREA 4M1XA 1TWHA 4C3JC 1F9NA 1EH1A 5CHPA 3AH5A 2JH3A 4KMAA 4GTEA 2XCRB 1XXBA 4KAWX 1O2AA 4P5AA 4GTFA 1SFOA 1Y1WA 3AQPA 2GSOA 1KQ4A 4GTAA 1WQFA 3OEPA 1GE9A 4KMDA 2RGRA 2JA5A 1TWAA 1O27A 2JA6A 3H0GA 1O25A 4BLBA 3GTMA 2KWAA 1ZBSA 5EGEA 3V4GA 3FOFA 4KM9A 2GSUA 4ILDA 3LPXA 3NUHA 4GTCA 1B4AA 2XCOA 3VA7A 2RH6A 2R92A 1TWCA 5EGHA 3MMLB 4C2MC 1WIHA 4KB2A 4G0UA 3GTJA 2GSNA 3LAJA 3BUEA 4FM9A 1AB4A 2NVXA 1XXCA 3L4JA 2YU9A 5TJ3A 1XXAA 1Y1VA 4KMHA 3QX3A 3CAGA 2VUMA 4KM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O24 A;  3N0C A;  2CFA A;  5CHP A;  5IOS A;  3AH5 A;  4P5B A;  4GTC A;  1O28 A;  4GTE A;  3G4C A;  4GTL A;  5IOR A;  1O2A A;  4P5A A;  4GTF A;  1O2B A;  4KAR A;  4GTA A;  1KQ4 A;  5JFE A;  4KAT A;  4FZB A;  1O29 A;  3N3Y A;  4KAS A;  4GTD A;  3G4A A;  1O27 A;  5IOT A;  1O25 A;  4GT9 A;  5IOQ A;  3N0B A;  1O26 A;  4GTB A;  2CFA B; 
#chains in the Genus database with same CATH topology
 4XLP A;  3GTO A;  4WJ3 M;  1Y1W K;  5IP7 C;  1VRQ C;  5IYC C;  4A3I C;  1WQH A;  1R9T A;  1TWA K;  3GTK A;  1HQM A;  1UV7 A;  1L0W A;  4NOI A;  3GTM K;  4OIO A;  1XZP B;  3LAP A;  3AQO A;  5JVO A;  3GTL A;  5IYD C;  2E2H C;  4FZB A;  2JA7 C;  1DCO A;  3GTQ C;  3FHZ A;  4A3D K;  1TWF C;  3S2H K;  3G4A A;  3JST A;  2WAQ D;  3N0B A;  2E2J K;  1C0A A;  4J3N A;  5M5Y K;  3GTP C;  2B63 A;  3H3V L;  1DCP A;  2CFA A;  4KC6 A;  2ZFZ A;  1O28 A;  4OIP A;  1IBA A;  3S17 K;  2YU9 K;  2E2I A;  3S1N K;  1Y1V K;  4A3J C;  3G4C A;  1O2F B;  3M3Y K;  5FJ8 K;  5IP9 K;  2NVT C;  2WB1 L;  1I3Q K;  4G7Z A;  4KAS A;  1J6V A;  2JA5 C;  2NVQ C;  1F7V A;  4WIL A;  3HOX C;  2ZUF A;  2JA6 C;  1WCM A;  2CFA B;  3N0C A;  3ORE A;  1TWH A;  2PA8 D;  1TWF K;  1YNJ A;  2XCR B;  2R92 C;  3EQL A;  4P5A A;  5M5W K;  3GTJ C;  3ADA C;  3HOW C;  1Y1W A;  4A3C K;  3AQP A;  4GTA A;  3HOY K;  1JQW A;  1VJE A;  2RGR A;  1TWA A;  4BY1 C;  4ZH4 A;  1O25 A;  4A3L C;  3GTM A;  4MEY A;  3S1R C;  4MQ9 A;  1ZBS A;  3FOF A;  3V4G A;  3S15 C;  1I50 K;  4KM9 A;  2GAG C;  5FLM K;  1IW7 A;  2O5I A;  4BY7 C;  5C4J C;  2JA5 K;  1B4A A;  3CQZ K;  2FQT A;  2RH6 A;  3AD9 C;  4XLN A;  1USM A;  4C2M C;  1WIH A;  4YFN A;  4G0U A;  3HOZ K;  3LAJ A;  3BUE A;  5IYB C;  1WOS A;  3T02 A;  3L4J A;  3GTG C;  3S1M K;  5M3F K;  5TJ3 A;  2YU9 A;  1Y1V A;  3K7A C;  3CAG A;  5C44 K;  3S2D C;  4KB4 A;  1IQ0 A;  1SFO K;  4A93 K;  1I3Q A;  2V6U A;  4A3L K;  2P5M A;  3H0G K;  4C3H K;  3RZD C;  3M4O K;  1K83 C;  4MEX A;  4C3J K;  1TWG C;  2Y3P A;  3S0X A;  4Q5S A;  5JFE A;  1TWF A;  4KDD A;  4KAT A;  3OPF A;  4A3G K;  4GTD A;  4AYB D;  2JA8 K;  4LQY A;  3FKI C;  1SMY A;  4A3K K;  3S16 C;  1G51 A;  2R93 C;  1WOR A;  2P8T A;  1I6H K;  3A8I A;  3Q3Q A;  4P5B A;  3I4N C;  2XCQ A;  3HKZ L;  4A3E K;  2Y0S D;  4A3F C;  4C3I C;  1J6W A;  4GTL A;  2CW0 A;  3AD8 C;  1BGW A;  1I50 A;  1BJT A;  2FQO A;  3ERE D;  3N3Y A;  3CQZ A;  1IS1 A;  3RZD K;  3RZO K;  1K83 K;  1TWG K;  3SZZ A;  5IOQ A;  2NVY K;  4A3B K;  1JVI A;  3FOE A;  4BBS C;  4M1X A;  4KN4 A;  1EH1 A;  2R7Z K;  3S16 K;  4BBR C;  4GTE A;  4Y52 K;  4KAW X;  1O2A A;  1F7U A;  1VH2 A;  4BXX C;  4WJ4 A;  1SFO A;  5IP7 K;  3S1Q C;  5IYC K;  4A3I K;  3PO2 C;  1GE9 A;  4KMD A;  3H0G A;  1WSV A;  1WOP A;  5EGE A;  1VGX A;  1YCL A;  2VUM C;  3PO3 C;  5IYD K;  2E2H K;  2JA7 K;  3GTQ K;  4X6A C;  3GEI A;  3GTO C;  4GTC A;  5L46 A;  2XCO A;  3VA7 A;  5EGH A;  2EBB A;  1R9T C;  4A3M C;  4KB2 A;  5C3E C;  3GTK C;  3WOD A;  3GTP K;  1TWC C;  4AYB L;  4FM9 A;  3HKZ D;  4KN7 A;  2PMZ D;  3GTL C;  2V6T A;  4Y7N C;  3TFH A;  4A3J K;  4KMH A;  4BXX K;  2ZUE A;  2GAH C;  2Y0S L;  4OIR A;  1J6X A;  2NVT K;  2B63 C;  1WOO A;  4LR2 A;  1ISE A;  4YFK A;  3TFJ A;  1K83 A;  1YNN A;  2NVQ K;  1TWG A;  2JA6 K;  3HOX K;  2E2I C;  1X31 C;  3T01 A;  2NVY A;  3BP3 A;  2R7Z A;  4OIN A;  3AD7 C;  3GDZ A;  2R92 K;  1TWC K;  3GTJ K;  1ZQ1 C;  3HOU C;  3GIR A;  4G0V A;  1WQG A;  3HOW K;  5TMC A;  1TWH C;  4BY1 K;  2PHC B;  3HXA A;  3S1R K;  1DD5 A;  1WSR A;  3S15 K;  4DDQ A;  1ZXO A;  2E2H A;  2JA7 A;  2A68 A;  3GTQ A;  4BY7 K;  1BS2 A;  5C4J K;  1Y1W C;  4BKW A;  1DCH A;  1F93 A;  4C2M K;  1TWA C;  1EFW A;  1I6V A;  1INN A;  3GTP A;  5IYB K;  4O2D A;  1O24 A;  4YFX A;  4G7H A;  5CHP A;  3AH5 A;  3GTG K;  3TFI A;  1RU0 A;  4A3D C;  3K7A K;  4KMA A;  2PMZ L;  2W7V A;  1V5V A;  1EI6 A;  3S2D K;  2E2J C;  4GTF A;  4PAA A;  1XZQ A;  2GSO A;  1KQ4 A;  3HOV C;  4Q4Z A;  2JA5 A;  2A6E A;  4LOW A;  1O27 A;  2YU9 C;  3S17 C;  5D4D A;  2JA6 A;  4BLB A;  3S1N C;  1Y1V C;  1VLO A;  2GSU A;  3M3Y C;  1YX2 A;  5IP9 C;  4ILD A;  1I3Q C;  3LPX A;  3NUH A;  4XSX A;  1IE0 A;  1PJ6 A;  3I4M C;  3FKI K;  2R92 A;  1TWC A;  4XCH A;  3GTJ A;  2GSN A;  2R93 K;  1XZQ B;  1AB4 A;  3I4N K;  2NVX C;  1XXA A;  4A3F K;  4C3I K;  4YG2 A;  4QIW L;  3IPJ A;  3HOV K;  5HL8 A;  4GFQ A;  1ZYR A;  5IOS A;  1PJ5 A;  4JK1 A;  4A3C C;  5E68 A;  3HOY C;  4GZY A;  1BDF A;  1B4B A;  1EQR A;  3S14 C;  4BBS K;  3GEH A;  1I50 C;  4P9S A;  3GTG A;  3I4M K;  1O29 A;  5FLM C;  4BBR K;  5M5X K;  1ZVU A;  3TTG A;  4AH6 A;  3CQZ C;  4QJV A;  1PJ7 A;  1O26 A;  3HOZ C;  4GTB A;  4RMF A;  3S1Q K;  4C45 A;  3PO2 K;  2NVX K;  5C4X C;  3BP8 C;  4XSZ A;  5CJ9 A;  3S1M C;  1EK8 A;  4KMU A;  3L4K A;  5IOR A;  2VUM K;  3PO3 K;  4G0W A;  1O2B A;  5C44 C;  4KAR A;  4X6A K;  3GTO K;  4A93 C;  3GEE A;  1SFO C;  4QJV B;  1XPP A;  3FKI A;  4BLA A;  1R9T K;  4A3M K;  5C3E K;  3S14 K;  5IOT A;  4GT9 A;  3GTK K;  3A8J A;  3H0G C;  2R93 A;  4C3H C;  3T00 A;  3M4O C;  2PPB A;  4C3J C;  2A69 A;  1F9N A;  1JOE A;  1WCM C;  3GTL K;  2JH3 A;  4Y7N K;  4A3G C;  4QIW D;  2JA8 C;  3H3V D;  4A3K C;  5M3M K;  1XXB A;  4LK0 A;  4OIQ A;  2WAQ L;  5C4X K;  2B63 K;  1WQF A;  3OEP A;  4LLG A;  1I6H C;  3SZY A;  1J98 A;  2V6S A;  2E2I K;  4LJZ A;  4A3E C;  1USO A;  2WB1 D;  2KWA A;  2BE5 A;  3GTM C;  2D6F C;  1IL2 A;  3MML B;  3RZO C;  3S2H C;  3HOU K;  2NVY C;  1WCM K;  4A3B C;  1TWH K;  1XZP A;  4LK1 A;  2NVX A;  1XXC A;  2R7Z C;  2O5J A;  4PAB A;  1HI9 A;  2PA8 L;  3A8K A;  4G7O A;  3GSI A;  3QX3 A;  5TMF A;  2VUM A;  4KM8 A;  4Y52 C;  2A6H A;  3DXJ A; 
#chains in the Genus database with same CATH homology
 4KB4 A;  4GFQ A;  3GTO A;  1I3Q A;  5IOS A;  4LR2 A;  1WQH A;  1ISE A;  1R9T A;  2P5M A;  1K83 A;  3GTK A;  1TWG A;  2NVY A;  1B4B A;  3LAP A;  2Y3P A;  3AQO A;  2R7Z A;  3S0X A;  5JVO A;  3GTL A;  5JFE A;  1TWF A;  4FZB A;  4KDD A;  4KAT A;  3GTG A;  1O29 A;  3OPF A;  3FHZ A;  1ZVU A;  4GTD A;  3G4A A;  4LQY A;  3N0B A;  4J3N A;  1O26 A;  4GTB A;  4G0V A;  1WQG A;  2B63 A;  2CFA A;  3Q3Q A;  4P5B A;  2XCQ A;  4KC6 A;  2ZFZ A;  1O28 A;  5CJ9 A;  2E2I A;  2PHC B;  1EK8 A;  3L4K A;  4C3I C;  1DD5 A;  3G4C A;  4GTL A;  5IOR A;  1BGW A;  4G0W A;  1I50 A;  1O2B A;  4DDQ A;  1ZXO A;  2E2H A;  2JA7 A;  4KAR A;  3GTQ A;  1BJT A;  3ERE D;  3N3Y A;  4KAS A;  4BKW A;  3CQZ A;  3FKI A;  4BLA A;  1IS1 A;  5IOT A;  4GT9 A;  5IOQ A;  2R93 A;  3GTP A;  4C3H C;  1WCM A;  3FOE A;  2CFA B;  1O24 A;  3N0C A;  3ORE A;  4M1X A;  1TWH A;  4C3J C;  1F9N A;  1EH1 A;  5CHP A;  3AH5 A;  2JH3 A;  4KMA A;  4GTE A;  2XCR B;  1XXB A;  4KAW X;  1O2A A;  4P5A A;  4GTF A;  1SFO A;  1Y1W A;  3AQP A;  2GSO A;  1KQ4 A;  4GTA A;  1WQF A;  3OEP A;  1GE9 A;  4KMD A;  2RGR A;  2JA5 A;  1TWA A;  1O27 A;  2JA6 A;  3H0G A;  1O25 A;  4BLB A;  3GTM A;  2KWA A;  1ZBS A;  5EGE A;  3V4G A;  3FOF A;  4KM9 A;  2GSU A;  4ILD A;  3LPX A;  3NUH A;  4GTC A;  1B4A A;  2XCO A;  3VA7 A;  2RH6 A;  2R92 A;  1TWC A;  5EGH A;  3MML B;  4C2M C;  1WIH A;  4KB2 A;  4G0U A;  3GTJ A;  2GSN A;  3LAJ A;  3BUE A;  4FM9 A;  1AB4 A;  2NVX A;  1XXC A;  3L4J A;  2YU9 A;  5TJ3 A;  1XXA A;  1Y1V A;  4KMH A;  3QX3 A;  3CAG A;  2VUM A;  4KM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...