3N0PB

A mutant human prolactin receptor antagonist h30a in complex with the extracellular domain of the human prolactin receptor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
MLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolactin
publication title Two Independent Histidines, One in Human Prolactin and One in Its Receptor, Are Critical for pH-dependent Receptor Recognition and Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/hormone receptor
total genus 36
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2010-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n0pB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n0pB01
4Y1AD 1FZKB 2YD6A 1D5ZB 2VC2L 1G7IA 1ND0A 1RUKH 5KS9E 4AY0A 4MJIE 5MEPB 1U8HA 2ZSWA 3KXFD 1IC5L 3C6LA 1FLRH 4GRLC 1UGNA 4HV8B 5E2UH 4EDXA 4DKAA 4JB9H 4KZEL 2YUXA 3MRFB 3GI8H 3PQYD 2XA3A 2X4NB 3TIEB 3EKCA 3OJ2C 5E8DH 3GMMB 2NNAB 4C56B 2D4DA 2UWEB 2VITB 2W65B 2VXTL 4F15C 4QRUA 3UC0H 3F7QA 5HGHA 1LEIA 2FWOB 3CFJB 1UEMA 2WUBL 2X4RA 4QRPE 2VQ1A 3MODL 4RGNB 1T3FA 3G6JE 3B2UC 1Q9KB 2FJGA 3RIAK 4F57H 5EZJA 3AM8A 4Y89A 4F9LC 3TNNB 2HT3C 2JIXB 5F9AC 2E9IA 1KACB 1P7KA 2BVPA 3PWPE 3O3AA 3X3GL 5I19H 3HUJF 2V2WB 3F7YB 3HFMH 4MB3A 1BD2D 1KB5A 4GAJH 4N68A 1RK0A 4H1LB 3T0WA 2E7LA 1HSBA 2FBOJ 3D2UA 1CTOA 1I4FA 3MSPA 2ZOLB 1LNUA 3OKMB 4K9EC 3BZ4B 4ZS6D 1OP5K 4ODTH 5JDSA 1BZ7B 3WL9A 3RL2B 5D6CB 4FZEH 2OTWA 1K5NA 2X09A 3IKCA 2KZ1B 1DQJA 1P4BL 1X5FA 1R3IL 4L4TB 5E1HB 2X5PA 2HH0H 5JPNA 2UYLA 4IRSA 1J1PL 4FP8H 1BEYL 1CK0H 1MCBA 4NCDA 4QRTB 3EYQD 3RNQA 1KTKE 1FAIL 3DI3B 4DFHA 5I0ZA 1P84K 2AEQL 3MGTA 4WI3A 3ZKNC 3LQAL 4D0CA 1S5IH 3QHZH 1SYVA 1YEHH 3WJLC 1KBGH 2VZ1A 3CMGA 3EOTH 3L3OB 1F11A 1G9NL 1UH3A 1NAKH 1SJHB 4YBQD 5CSZA 1ZVHA 3H9HB 2XY2A 3HRPA 1Z9LA 5DQJA 3VFVA 3VFTA 4PRPD 4RMTA 5DMIH 3RJQB 4JO3L 1UVQB 3WIHA 1NMBL 1AQKL 2DD8H 4IMLB 1NLBH 5FYKD 3U0TB 1MFCH 5ISZA 5A2KH 5GQBA 1S7RB 4LLMB 1QG3A 1KB9K 3O9WD 4M43L 4UV7L 2X1WL 3RRQA 9CGTA 4N8VG 4D9LH 5ESVB 4DGIH 1W8NA 1HILB 1WISA 2BSSB 3MRJB 4PYHA 4CMMB 2C3VB 2E7MA 5JORB 2P24A 1N3NB 3LPWA 4S0SD 4UAOC 3GMNB 4HCRL 4X6CE 1KEML 3LRHA 1Z6JT 1MJ8H 1B4RA 2P4AB 5EIQA 1C7TA 4XPHH 4Q9QL 2NNAA 3K4DA 4C56A 5CFHA 4FABH 1WT5C 2VITA 3CU7A 3RGHA 1XGYL 4I1NB 5C09B 5JZ7C 1XGTB 5FGCB 15C8H 1IQWL 4CW1A 4IIQB 4Z7UE 3D3VD 2R9HD 5F8QC 3T0AA 1IRAY 3BPNB 4F8TA 5HD8C 3DURA 2BX5A 4W6XB 5F9OH 1XIWA 3WD5H 4GKSB 5C0AA 1Q9WB 3K4AA 3PWVB 4HJGA 3O6LH 4OCYH 3GSWA 3WNLA 1DLHB 5E2VL 3JXAA 2XN9E 3QWRA 2V6HA 1KPRB 3IDIA 4L8CA 3FO2B 4N90D 3F7YA 4G9DA 4MWFA 3S35X 2EDDA 1QRKA 1AGCA 1KIQA 3HC4H 5L2JA 3TCXA 3QIWC 5HHME 2Z0BA 4O02L 4M6OL 4Y1AB 3NAAL 3E8UL 4YHYC 2BNUB 3KXFB 5HHXL 3QCTL 2R2EB 1OT2A 3DUUB 4X6DF 4ELKA 2KDGA 3RL2A 1I1AA 1FPTH 5IB2A 3RNKB 4XXDB 2BHZA 2ZUWA 4N1EA 2YA0A 2R1YB 3LKQA 1FZOB 4GJTB 3PQYB 4JKKA 4LARH 4G80B 1C5DB 1KULA 2ORBL 5IGXH 2DAVA 4FHBD 4I18B 4QRTA 1LGVA 2C7UA 3HR5A 5HY9B 2ERJB 1A9BB 1N5AB 2E6PA 1NAML 4LCCC 3NIFE 3UTTB 3F7RA 3MLUH 3V79C 4XMLL 1G9NC 4J2XA 1RULH 4ONFL 3ALPA 1KPUB 4HS6B 4JJ5B 1ADQH 3FB8A 3UZVB 4ZSOB 4RMVA 1KLUB 5IJKC 5BV7B 1ETZB 2JB5H 2YA1A 2VIRA 3FB7A 5BJTA 3SE3A 3MJ7B 1XGPB 1NSNL 2DF3A 5D7KE 4K8RL 4IMLA 3U0TA 4AEFA 1DANU 3LKNB 1S7RA 1UH2A 1X4ZA 1BD2B 5D1QA 1K8DB 3EDEA 2DQDH 3N1QC 1QLRA 4JFXA 4PJEE 3W0WA 5SWSE 4PJHF 3IU3B 1SY6A 3VXPB 4XT1C 12E8H 3AVEA 4X6EA 5F7KC 3GO1L 3PE9A 4CMMA 2XZQH 2CK2A 2E7HA 1T1WA 3GMNA 2Z92B 5DHVH 5C8JA 5KS9A 2VL5A 4HK3N 5DK0B 4MJIA 5DC4B 4CU8A 3SGDI 4ZQKB 4XC1H 4Z8FL 2FZ3A 2YD1A 4H1LG 1XH3B 2NYYC 3F12B 5HGBA 1TPXC 5E6IC 1ZLUH 1K9TA 2BSRB 1DBKL 4PG9B 3O81A 4MXWL 4XNYL 3ES6B 1UZ6E 3FQWB 3LN4B 4KMTH 1HZHL 1I9JL 1WBXA 4PRIA 4PRPB 3GSOB 5F1KC 1JPGB 5DXWA 4R9HA 1SEQH 4HIXH 3NH7L 1IM9A 1AD0B 4OV6F 4U2YA 1KPRA 4G6AC 1DUZB 4IOIB 2H32A 4RMWA 3A6CL 5IMKB 2NR6D 3G6JA 2P47B 1A6WH 1U6AH 2R0LL 3GJFH 3SGKC 5EU6D 2R23A 3OSKA 4I8DA 3O9WB 3CPLA 1GSMA 1GGCH 4HEME 4X6DB 1M4KA 4FFZL 2J8UF 3PWPA 4CVXA 4PTTB 4LEXH 3H42L 5C71A 2E27H 5GRVK 5B3JE 3CSBA 1M05A 3MRIB 4HWBL 1F4WL 5GGTL 2OQJA 2VDKH 1CXKA 1MRCH 1FNSH 5AAWA 3SQBA 3LOWA 3RI5K 3PQYA 1F8TH 2VLRD 3I6GB 1IGFH 2YHGA 4WNQB 5D7IE 5EN2A 3ZKMD 1YY9D 3HCVA 5E8EB 1WJ3A 1YEKH 2CR3A 1A9BA 1S7VB 4G8EA 3IS1X 4Q74A 2EEBA 4OZ4A 1CLOL 1J8HD 3BQUB 3D3VB 3LEYH 5IK3B 5TQ0L 5K9JH 1Q9OA 1A6AB 1BF8A 5GZOC 1K85A 3QJFA 4Y88A 2Y23A 5KSUB 3I85A 1HHJB 1MHPL 4HH8A 2BSTA 4HLJA 3QEGH 1OTSC 1FBIH 1EO8L 3QUMB 4K8RC 1UEYA 3X3FL 3S37X 3UO1H 4MS8D 4YBLC 1N6QL 3QXAB 4PJHB 4L3EE 3MNWA 3Q0HA 2VB5A 2YZ8A 4APQB 3HR6A 3JV6A 1MCWM 3P30L 1WUNT 2VLRE 1AXTH 1P53A 5HI3D 1AD9B 4XVJL 1QA9B 3VXPA 5DSCB 2VXVL 3CZFB 4YHMH 1NDGA 4OD3L 4XWOD 1VFAA 2DQCH 4PUBL 2LTQC 2DM4A 2Z92A 4Z7OF 5GRUL 5C6TH 4NO5B 3P4MB 5E9DD 1J8HE 4GRWF 2V7NA 2FBJL 4P4RB 1Q0YL 5J11B 5AG8A 4WI4A 3VD9A 1PD6A 3S36L 3R06A 5D9SB 1XH3A 2I27N 1FFOB 3ARFD 4QXUH 4X6CA 4M7LL 1ZLSH 2F58H 3TA3D 3LDBC 3JBG7 4LNRA 1JPSL 5JA8B 5SWZE 4OSUH 5DJYB 1ED3A 4NWUL 3LRSB 5DK2A 4OZFA 3WS6C 2VC2H 1FN4A 3FQWA 4R97C 4P4KD 4HFWB 5F21B 1IC5H 1FO0L 4PRPA 2EKSA 1JPGA 5GHWH 3TYFB 1QBML 4CRPA 4Z7UA 3L1OL 2QBWA 1VERA 4KZEH 4LIQH 2WV3A 1XF3A 1DUZA 3U2SB 3G5XB 4PTUA 5ID1B 2J8UB 5FA4A 3EO0B 2YSSA 3PL6B 1E4XI 1MFBH 5E9DE 3UBXB 2VXTH 2VISA 3SBWC 4N8CL 4POUB 1O0VA 1T5WB 2APWA 4I0PB 5DRXB 1NGPH 4CNIB 4WWKA 4GAYA 2EIBA 3M1BB 4PRAA 3ZTNL 1KV3A 2PW1B 4R8WL 2CR6A 2H2PC 4JANB 5K9KB 1BMGA 1HKLH 3X3GH 1Q8MA 1SMOA 1XZ0A 1MCHA 3IJYA 4MXQC 1A6VH 1H3VA 3O8XD 3D3VA 5IK3A 2C1PB 1ZKAA 3D0VB 3O2DL 3OWEA 2H1PL 2VH5L 5I75B 4JY4B 3S3JA 4S1RL 4P0DA 3TH2T 2Z31D 4LPYA 5KW9L 1P4BH 3MOQA 1FGVH 3HLAB 1CDIA 4PRBA 5DZLA 5EZOH 1BEYH 5EU6B 4P5TB 3SCMB 3U0PA 3MUJA 2MQ3A 2AXGA 2AEQH 3I6KB 3S36X 1NDMA 1AD9A 1RHFA 3BX7C 1I9RH 3LQAH 5DZNA 1KPVB 3LEVH 2VWEC 3T0EB 4HBCH 2UUDH 5DJZA 1EGJA 3P4MA 5B38A 1PSKL 4PJEA 5HDBF 3ARDA 5SWSA 4YFLI 4JO3H 3WO4B 4P99A 5JOFA 3DGCR 1NMBH 1MJJB 1AQKH 2BMKA 5IFHL 1KNOA 5IW6B 2DMCA 4GW4A 3TM6A 5M95B 2J5LC 5DJYA 4M43H 5I74C 3IXAA 3BHBB 2XWJB 2JJUA 1FCGA 4LGSB 4U6YA 3VXOB 1AKJD 3QR2A 4R2GD 5EORH 4ONOA 4KXZH 3UTQB 1FIGL 1MUJA 3CH1B 3WKMH 1NFIB 4GMTH 2ADJB 1TMCB 1YN6B 2X1XR 2ZSVB 1A22B 4U31A 3QUXD 3R1GH 1P4IL 5KTEL 1FNGA 4L29A 4BKLB 1WWWX 5KSVA 1JI1A 1HYSD 1ZVSB 1KOAA 3HPLA 4JPIB 2R8SL 4W81A 4UB0L 1YMHB 4RRPA 1KB5L 4RGMC 2EYRB 4JQVC 1T5WA 5D7SL 3NFNA 5T3ZD 1R3KA 3KWWB 3M1BA 2V2TA 1T20B 5EBLA 4CMHB 1F6AB 1KJMA 5JIIA 1XR9A 3BE1L 3KYOB 5AZ2L 4X4XB 4GUPA 1JGUL 3ARFB 1AE6L 3TA3B 5F7HA 2FIKB 2OM5A 5I1LB 4O02H 2C1PA 3NAAH 2K9UA 2NPLX 1NBVL 3D0VA 2NY5L 4U2ZA 3OMZA 4PREA 5D7IA 3RIFF 4PRHD 3ULVF 5CSBA 3NPSB 1MAML 1PY9A 3MRPB 1WTGT 4JY4A 4J7RA 5HHXH 3QIBC 2GTWB 3QCTH 4U0RB 4Z77B 2IPKB 1TTUA 4WEBH 1JIBA 3O4LB 1EVUA 2EO9A 2AP2A 1MJ7L 1NC4A 5EUKB 3BSZL 2QQNL 1YMMD 1L9NA 2R29L 5E5MA 1N0XH 1JZ8A 4L9LB 4ZOEA 2VO5A 4KMLB 2PTTA 1G7PA 4L8SC 5EU6A 43CAB 4RQQB 4DKDC 1NCAL 4N0FA 1NAMH 2ATPB 4OCRL 3I6KA 1V3MA 2X9YA 2KZWA 1T89A 4HMCA 3JV0A 1IGMH 3ARSA 1NC2A 1KTDA 2LVEA 1BX2A 2BSED 5CGTA 3LSOA 3VDBA 1AFVL 1GCFA 4UQ2B 3SY0A 1U8PA 4ZXBB 4G6JL 3P4NB 3QUZB 2VLRA 3AU1A 5EZIL 1TXKA 2FEEI 1H3GA 4K23H 6FABL 1A14L 2A6DA 1NSNH 2FH8A 4AIZA 1MWAA 1DUYB 3UBXG 3GSNB 4WJ5B 2ZZUT 5C9JB 3FRPA 1J8HA 3FT3B 2FJFA 1UCBL 1GC1L 3UJTL 3G6AA 3C8KA 4WDIA 2BOBB 1BVZA 1A5FL 4LPTA 3S4SB 1NBYB 2EDRA 5IVXF 4FG6D 3UTQA 2I9LB 1PBYA 2NXYC 2Z31B 1NFIA 1YN6A 4LASH 1B6DA 1ORQA 2AKRA 3AM8C 3RWEB 3MLZL 4PJBE 5IJVB 1QOKA 3FQNA 2YD2A 4GKZA 2GITA 4HQQL 4WHCA 4S11A 5DUPL 4JPIA 3RUGF 2A77H 2SEBA 3WE6A 1DBKH 3L95B 2E7LC 3STLB 3U7YH 1R5WB 1DBAL 4XNYH 5TE6L 1C1EL 5INCA 3KWWA 4JRXB 4UOW1 5E9DA 5HYJE 4YAQB 4HIJA 3IVKA 5GS1A 1J11A 2LQRA 4WU7A 3MRDB 35C8H 2ICEB 1AGDA 2HRLA 1QNZH 2X41A 1BFSA 4H20L 3A6CH 5BMFH 4FXKA 3BZEA 3O0RH 3BPCA 3TA3A 4LSUH 1C7SA 4LCIL 5I1LA 2NY5C 4E0RB 4PPTA 1I8IA 4FFZH 4MCYA 4NO3B 2HJKA 4X7FC 1HI6B 1KIRB 4P4KA 4R2GB 4LLVA 4W6WB 4B7LA 3DRQB 2IPKA 2I9TA 3RTQD 3GSVB 4L1HA 2V5TA 1BZ9A 4HWBH 1INEL 5L8KB 1F4WH 5GGTH 5I1GL 1VENA 1J87A 4HXBH 1QR1A 2P43B 2BOCB 3MNVA 3QUXB 3C5SB 4GW1A 43CAA 1DVFD 3FRPG 4FQLL 1CYGA 1JGEA 4OLEA 2HWZL 5GGUB 1LEGA 3GK8H 5CEZL 3V6ZB 1CLOH 1EUTA 3S96A 4XVSH 5TQ0H 1M1SA 1S7XA 1GGIL 4TNVK 3MV8E 5I1EL 2JCCF 1DDHB 3EBAA 3O3EB 5IEKB 1OOAA 2IC2A 1AP2A 1MHPH 1N8ZA 5F7UA 1F00I 4M7KH 4DCQA 1EO8H 3BVNB 1TITA 3KPPA 2Q8BL 4CVZA 3EYSL 2MNUA 3INUH 4M93B 2P49B 4ACPA 2IF7A 5ESAB 3EO9L 5HXMA 1KJ3L 4F9PA 5J4MA 3O8XA 4KK5C 5IVXB 4CVUA 4HW6A 3HE6D 1T1ZB 4PRHB 3ZT5A 3TT3L 2A0LC 4GQPH 4AT6A 4FQQB 3WSQL 3FB6A 4PUBH 2VTFA 5GRUH 1XIWC 3FO9B 2Z31A 3N85L 1KN4L 1JHTA 5DDHA 1YMMB 1KCRL 3RUGB 4I3RL 3BDYH 1QRND 1F90H 3OXSA 3S36H 2UZIL 1L6XA 2Y06L 1U2CA 4PIRF 3MXWH 3NCYP 3OPZL 4FFWD 5CMAA 5T3XD 3KPTA 3PNWA 3O6MH 5IHZA 4NWUH 1I8MB 1R5WA 3TBWB 4PJAE 3DMMD 5FA3B 4N0CD 5ACZB 4BFBD 5GSRB 3CX2A 3VGAC 3ZE2F 1RJYB 5F3BB 4JCLA 3VFNB 1PLGL 1FO0H 1AQDB 3O45A 5IROA 1X6NA 4YAQA 3BWUC 2QLVB 4RISL 3KLHD 3IGAA 1N4XL 1QBMH 1I1AC 3L1OH 4KJQC 3OB0K 5EO1A 2CD0A 4TVPD 4PJCF 5I6XB 2OZ4H 3QXVA 4PYGA 3PGFL 4XMPL 1NCWL 4M03A 2Y1VA 3KPOA 5DWUL 5JOPD 3VXUD 2VDOL 3RWIA 2AJZB 1ZWIB 2ADGA 5FB8B 1RUQL 2XWTB 3M8OH 3QJHA 4DTGH 4NQDB 3HNTH 4N8CH 1AKJA 1UWXK 4OLZL 3V8OA 2WIIB 1A9EB 1AHWA 3JTSB 4G6FB 1J5OH 3VDCA 5DD0L 5JHDD 3WS3B 3ZTNH 4P5MB 2DQUL 2HT2D 4R8WH 3B9EA 3LZFL 4Y5VA 1SJEA 4YFEA 2C3GA 1S9WB 1MF2L 3DETD 5DT1L 3SE3C 1SJVA 2R2BB 2PR4H 4NYLA 4QY8B 4PJDF 1PKOA 2JCCB 1WWBX 3V6ZA 3F7PC 5D1QC 5TF0A 5C08D 4PR5B 3S4SG 3O2DH 4PD4J 2GIYA 4RBPK 4QOKD 1BP3B 5D70L 3OTTA 2VH5H 1VGKB 3NGBB 3O3EA 3VMNA 4BQ9A 3SO3B 4S1RH 5CBEB 5AD0B 5J6HB 2UWEE 4KGJA 1JZ4A 1Z2KA 5KW9H 4KI5C 4LU5H 5DEGB 2Z93A 3EOBB 1OM3H 3U4AA 1KCLA 3SE4A 2FGWL 1MREL 3QBTB 4LAQH 2CKBB 2GYSA 2QADB 1FH5H 1U95A 1T1ZA 3TBSA 5ICYB 3WLBB 5BQ7B 5FGBA 4FQQA 5HI5C 4GG6E 2CUHA 3NACH 3RTQB 3HAEB 3FO9A 3CMOL 1D3CA 1PSKH 1DP0A 1NGXB 2ZCKL 3JZ7A 4QRQA 2W07A 4KV5F 2H45A 4DN3H 5K9QI 1U8QA 4PY7B 5J6GB 1DVFB 1NKRA 3OG4B 4UIKL 4F7TB 3IDGA 5IFHH 4LRNL 1YYLH 4LLDB 4GAGL 1CGXA 5ACZA 4LSVL 3MRLB 5GSRA 5F7DA 1KT2A 2AABH 3VFNA 2W9LA 2PW2A 4RWYH 1FIGH 4GRMA 3CFBB 3PWUB 4NP4L 3MLXH 2ARJQ 2I07A 4WWID 2QKIA 1P4IH 5KTEH 1R0AH 3RVVD 3G04B 5EULV 1EFXA 3OHXA 4KRNA 4X5LA 1J12A 3DPBA 2R8SH 2O61B 3SDYL 1YPZF 4L5FH 2EDKA 3MV9B 4KKCD 3LQZA 4UI2A 1KB5H 1A9EA 4OV5A 5D7SH 4WFFE 2ZOKB 3KS0J 2G5BB 1ZT1A 2P5ED 3VXTA 4U3CA 1J0HA 2Y6SD 4XX1G 1RJZB 3BD5A 2AEIT 1QRNB 1S9WA 3AB0C 4R4FL 1QPXA 2XTJD 3BE1H 4NGHL 5AZ2H 3G6DH 1I7ZA 1U36A 2R2BA 1JGUH 1MCLA 2NTFA 1AE6H 1P7HL 1FZJA 4KK6C 1YEGH 3CXHJ 5IMMB 4XPGL 2WK2A 1NBVH 3F7VA 3DMMB 1GZPA 1F6FB 2CXKA 2OI9B 3TJEH 2CLZA 2YUVA 4ZS6C 4DW2L 2W0LA 4XTRC 2VLME 5AD0A 2IFGA 2VLKB 3GRWA 1MJ7H 3P73B 4XMKH 4D9RE 1T21B 3BSZH 1NFDE 1EGJL 2MWCA 1CFNB 5IVZB 2PYFB 1D5XB 2R29H 3VH8B 4JKLA 1KFAH 3I75A 4R3SB 4CDHA 5KANG 4FQXD 3EYQC 1NCAH 1LP9F 3IDJA 4YQXL 3RWDA 3OB8A 3HUJE 4QT5A 2EKJA 5BQ7A 2ZG2A 3QEUB 1OAXL 3LRGA 4YDKL 3DJ9A 3RTQA 2B1HL 3QAZB 4YBQC 3NN8A 5C2BL 1AFVH 5GRWA 3OR7A 1BLNB 4G6JH 1LQSR 4E5XB 1P2CA 2UY7A 5EZIH 4KC3B 1IKNA 4LCUA 2QHRL 3J7HA 4FQHA 1MOEA 2XIDA 6FABH 4DVBA 4HKJB 3HZYA 1DVFA 2R0KL 3L5XH 5IG7A 4F7TA 1MQKL 4FTVD 1OF2A 4IDLA 5C0GB 3E6HB 3L3HA 1GC1H 1UCBH 5C08B 3O6FD 3L9RA 3P9WB 1A6ZA 3UJTH 3THML 2YA2A 1A5FH 4LVHC 3DROA 5HVHC 5ETUA 4M6ML 1QBLL 3I6LD 5IT2L 3MZTA 2LFGA 3AFLA 4EIGB 3IAQA 4Z76A 4WWKC 1YQ2A 3PWUA 2IH3B 2EH8L 4PJ5D 3UTTE 1ITCA 3VFRB 3MLZH 3RKPA 4ISVA 4K55A 1YPZB 5CJOL 1NCBL 4GSDL 3HMWL 2C4FU 5F3HB 5DUPH 1LO0L 1OCWH 2O61A 3TC9A 5IB3B 3HE6A 1QSED 2IWGA 3RQ3A 3Q48A 3DVIA 3QUYD 2BNQD 4OZIA 2R9HC 3DX8B 1J0IA 4N5ED 3SKOB 4YO0B 2G5BA 3VFWA 1C1EH 1RZIB 3L7FA 1AGBB 2NTSP 3DTXA 2CLVA 4HS8H 4FQIH 1RJZA 1X5XA 4BZ2L 4O4YH 3UPCA 3RPIB 3DECA 3MFGB 1P6FA 4H20H 4X80L 2DM3A 1LK2B 4X5WB 5DQDL 2E9BA 3ZT7A 5J8OA 5C6PB 1EV2E 4LCIH 4XPBH 4DUVA 5EBWA 4BUGA 2FHCA 3HPJA 4LEOB 5CWSA 5KZCB 4PGEA 5H37G 2VXQL 3HAEG 2DKMA 2IFFL 4MHHG 4N0UB 3MPCA 3IDNA 5CBAA 3V4UL 3GEWB 4YC2B 4GXUM 1INEH 3K80A 3TO2B 4XCEB 5L0QC 5I1GH 4HK3J 4RWHA 3ULUF 1DFBL 1ZMYA 1CFNA 3BFOA 1D5XA 1LP9B 3ARDC 3KYMB 5GS2H 2AJ3A 1MH5A 4WV1A 4R3SA 1CICD 2DWDB 3FFDA 4J12A 3E3QE 1A6UL 3PP3K 1E4WL 4FQLH 2NW3B 3VXUA 4YLQT 1BHGA 5CEZH 3TYGL 3QEUA 4NRXB 4ELMB 5M94B 4G8FA 1GGIH 3ARVA 5I1EH 2OL3B 4QGTA 1PZ5A 5GZND 5JHDA 2P5EB 4NNXA 4GMSL 1U8KB 1E6JL 3PV7A 1S5HA 4DVRL 3T4AB 2Y4SA 4WUUE 3T0VA 3C8HA 1R24B 4U6XA 1U8IB 1T03L 2XTJB 4OFPA 4U33A 4X6DE 4HKJA 1WAAF 4J4PD 1WBZA 3BH8A 2Q8BH 4OM1L 4GG6A 3EYSH 4AJ0A 3SKNB 4OJFL 2ARWA 1TCRB 5T1LA 1UADC 2VR4A 4JM2F 1RUPL 3U9UB 1KJ3H 5FYJE 2IPTL 5I73C 5C0GA 2DYPD 5LGHL 3E6HA 5C08A 3C09B 1JF1A 2IMMA 5ELIA 4QOKA 2WAHA 4MAYD 2PXYD 3TT3H 4OGAC 4NSKA 1KENH 4XNXL 4JO1L 4N8PA 3EYVB 1K8IB 3BN3B 1ORSA 4OB5H 1QUNA 2MOVA 4ODUA 2IH3A 4ZFZB 1KN4H 4GAFB 3GMPB 3B6SA 2F8XC 3GNMH 3RVUD 5J3HD 4OCXL 2UZIH 4FQXB 2J3SA 1G7QB 1XF4A 1FL3B 3OX8B 3S8WA 2OLDA 4NN7B 4KHTL 1P5VA 4HUUB 3ROLB 2JF1A 4OI9A 2VDLH 4Y4HD 5DS8A 1CDBA 4JGUA 1ZHNA 2H26A 1UB6B 4Z7WE 4BH7A 3RVXD 2Q87A 1RZIA 1X44A 4CADB 1FORH 3HZKA 1PLGH 4PJHE 3KJ6L 5I9QB 3BW9A 4GS7C 4C83A 5LBSL 3MOAL 3VH8G 5EPMB 3DV6B 5E8NB 4ZUVB 2DQTH 2GY7B 3MRCB 2BJMH 5C7XL 2CLRB 1LK2A 5J0BA 1K4DA 2NR6C 4FTVB 3GM8A 3BJ91 4OFDA 3PGFH 4WHTB 4XMPH 3CDGB 4GW5A 3O6FB 4WCYH 3MV7D 1RUQH 3LB6D 4OLZH 1T89C 1FC2D 1ZA6A 2FLBT 5FKAA 4NQCD 5E99L 2D9QB 2ID5A 5DD0H 4G42B 2ED9A 2PO6D 3TO2A 4XCEA 4U1GB 1U42A 1Y0LB 2XNAA 4PJ5B 2DQUH 3DO7A 3MACL 5KSAD 4MB4A 4O2CB 2XXCB 4X7TA 4ZUUB 2WBJD 3BMWA 3WO4C 1MF2H 4XP6H 5A3ID 1QKZL 3ZKMC 1SBSH 5AWNH 2NW3A 2BVQA 3VMPA 3SGJA 2B5IB 4QYOA 3EYUL 5DYOB 1FHGA 5ALBL 4HS3A 1NFDA 4OUUA 4ZPVA 4ELMA 2Q3ZA 1UWEL 2BNQB 3DYMA 4HFUH 4KKAC 5D70H 5KANI 3TV3L 2P5EA 1KCKA 2J8UE 5FOBA 3SKJH 4OLVL 3T4AA 5C07B 1OL0A 5GGRB 3VRLE 8FABA 1R24A 1ZEAL 3HUJA 4JM2B 2PYEE 5F9JB 2EIZA 2COQA 1YZZA 3VWJD 4X98A 4KY1H 1YEEL 4JVPA 1E27B 1TCRA 5KSBA 1X5HA 2DQIH 4JO4L 2FGWH 4QRSB 1JCKA 1EO7A 2NW2A 1A7PH 5BZWB 2IANB 1QHPA 4QHKI 1CFVL 1J18A 2GCYB 4WW1B 4PB9L 5I71B 4L4VD 4ENED 3D69A 3OKOB 1U93B 4AMKH 4PJFE 1K8IA 4XWOC 4TOYL 4OT1L 4H26B 4PLKD 5HHOE 1LDSA 4ZFZA 2APTA 1KIPB 1I8KA 2Y7QB 3HZMA 1K2DB 4YGAB 1CG9B 3SE9H 1LD9B 3DX6A 4X7DC 5GS1C 1CICB 1UXWA 5KN5B 2AQ1A 1P5UA 3I3BA 4XCYB 5F6HI 1JF6A 1FL3A 1UG9A 3BKCL 4MJ5B 4J1UB 3WYRA 2W0PA 3TA3C 1JZ5A 3ROLA 4LRNH 2EC8A 2JKXA 3CU1A 1KJ2L 1UM5L 2IPUK 4GXUN 3RX5A 5DC9B 3Q6GL 1PYWB 1EA9C 5DUML 3PP4L 3PUCA 4CADA 2P44B 4P4KC 3WN5B 4JFHD 2X4QB 2W1NA 4HWUA 1S9YA 3F65A 5T5NG 3DV6A 4N9GB 4L4VE 4NT6A 4F3FA 4Z7OE 3G5VA 4FNLL 2Y5TB 2ZNWA 2CLRA 3T0EE 1CDYA 4KQ3H 2A73A 1HHIB 1T1XB 1BWWA 4GRWE 3D85A 5DFWH 3PIQB 2DYPB 4IEFB 3QI9A 2DLFH 5FAAA 3O6FA 3UTZB 3T2NL 1YY8B 4HLZG 3SDYH 4NKIL 5D2NB 1QSFD 2F8OA 1S9VB 1V05A 2PXYB 4YDJA 1YQVL 1MLCB 2GAZA 4QRRD 3O6KL 4MJ6B 1A1OA 1QLEL 3ECBA 3C9NB 2VSDA 4G8GD 4HUKB 1S9XA 3B9AA 1PX3A 4JRYB 4PJ5A 4R4BB 4ALAL 5F71A 2VABA 1UFUA 2LE9A 1SBBA 2FB4L 4MSWB 4R4FH 4NGHH 4P5KB 4TNWF 3PJSB 3N0PB 3BUYB 2EDHA 2CKNA 5EU3B 2DJSA 4IHOA 2UVFA 5DHYB 4QLRA 3QQ9C 1QSEA 4F9PC 1UKQA 3QDGB 4XPGH 2AV7A 3QUYA 1BBJB 3O8XC 2HT4D 4KDWA 4GKOA 5ENWB 4YX2H 4MLSA 5I1JL 5J7CC 1C16B 5K33A 3LPFA 4X4YB 4LFHD 1MCPL 3DYPA 1BFOB 4JDVB 4MDJA 2CDFB 2J7LA 3QEHA 5D93B 2R69L 1CGSH 4QRRE 4RFEA 4JAMA 3TVMD 1KIUA 4G8GE 5BZWA 5E95B 4WUUA 1ACYL 2VDRL 3TWCH 1XGRA 3IAPA 3MV7B 4NWTL 3QB7C 4YQXH 4IRZL 5GS3A 5HVWA 2FYYB 3DXAD 2Q76B 5C0DB 3OKOA 4NQCB 1U93A 1Q9LB 1UWGL 2EDOA 3QWOB 4N0YL 5C2BH 2PO6B 4H26A 4X9FA 3FQRB 1D5MB 4YDIH 1YA5A 3WHE0 5KSAB 5IROC 3KPSB 1GRWA 1ZT4B 1G9MH 1XMWA 2VLLB 5F7NC 2WBJB 2QHRH 1UKSA 4XB8A 1CICA 1GGUA 3SHSA 4XCYA 1TQBB 3VD7A 1MQKH 4J1UA 2VQTA 4RZCB 2AV1A 4WW2B 2ENYA 3WHXB 3CVHH 1S7WB 3AXLB 5DLMH 3THMH 1PYWA 1RZKL 3FO1A 1O7VA 1KCVH 4G8IB 3FQTB 3WN5A 3RZWA 4M6MH 2BXYA 1AHWC 2NY3D 3CLEL 5IT2H 5IFAL 3WUWA 4N9GA 3H6JA 4J4PA 2VDML 3VWJB 2HLFD 1WWCA 4Z7WA 2Y5TA 3DUHA 2MHAB 3LIZL 4Y5VC 1HXMB 2GEEA 1HHIA 1U91A 5CJOH 1AIFB 1NCBH 4OFKA 4GSDH 1XCTB 2GY5A 1PJ9A 3Q6FA 3HMWH 1HYSC 1K3ZA 1IGCL 1LO0H 1MIEL 1RZGB 3D39D 1U3JA 4MAYA 3SDAB 1FRGH 4XP9H 2PXYA 4M1DL 2DI9A 1FNEB 5C1MB 5GGVL 4C54A 1MLCA 1II4E 1JUFB 4Z0XA 5J06A 3C9NA 3HMXL 4NJAH 4LNVA 4FQ1L 4R4BA 3R4DA 1KLFA 4BZ2H 2N4IA 5DJ8A 4FFYL 1NEZB 4U1JB 3UAJD 2FR4B 3PJSA 2AEWA 4X80H 4MQ7A 5JPMB 5DQDH 5TQ2L 2HJLA 4AIOA 3SE4C 3VGHA 5ITBL 4Y4HA 3PWLA 4YXLL 4U49A 2VXQH 3HNSL 2JLLA 2IFFH 5FGBC 1HINL 1KG0A 3MREA 4J3UA 4XPAH 3V4UH 3IFOA 4E42A 1KN2L 4MGXA 2D7PA 5BCAA 1JP5A 2N1KA 1DFBH 1DBJL 3NCYS 4WU5B 1A6UH 2ICCA 4PD4K 1F02I 3KPQA 1UYWL 1EJ6A 4JRXE 1JL8A 3MV7A 1PAMA 1YEDB 3DNKA 5B22A 2PYEA 3S88L 1X7QB 1QSFB 3TYGH 5F9WC 3ARBD 5C0DA 3FOMA 4DZBB 1Q9LA 1RVFL 1CL7I 4IMKA 2PO6A 1LK3L 1E6JH 3FQRA 5I1DB 1J05A 1D5MA 4DVRH 2YEZA 1KCSH 1MSPA 1ZT4A 4G9FB 2WBJA 4HK0B 1T03H 4R96B 1ERNA 4OM1H 4PJFA 4OJFH 1CGVA 1VPOL 2BC4A 1E4XL 2F9BT 4RZCA 5I6XC 1FYTE 5HHOA 1FG9C 1K4CB 1OARL 3WFZA 4RMUA 3QHTC 3BP5A 2X89A 2Y72A 1IZJA 3RVWD 4MXVF 4JLRB 3LPGA 3NPZB 4LSTH 4JPKL 4HUVB 4F80A 4JO1H 1LO5A 3QQ4B 4HGMA 1RAMA 1ES0A 4FG6C 4C4KT 4ZUSB 2E7CA 2YKLL 3GBLA 4ODHL 3VWJA 1QBBA 5D1ZC 2V7HA 1HNGA 3TVMB 1I7TB 3FN3A 2MHAA 2KH2B 3GUTB 1Q38A 1JRHH 4GRLD 2NLJB 1HHHB 1UH4A 5F88A 2P46B 3MJ8B 1NCTA 4NUJA 1DBBL 1MCNA 3N1FC 3JUZA 2NY0B 4HX1B 3VFMB 5MI0B 3J8F7 3DXAB 4L4VA 3MRNB 5E0QA 4YXKL 3LN5B 5IMOA 5J13B 2QQKH 3C5ZD 2AI0L 5DTFB 4OTXL 5LBSH 2AK4E 3MUZ1 1NLDL 5IVXE 4LSPL 3LV3A 2FR4A 1WCBB 2DLTA 5I8EA 5C7XH 3ARYA 2OMBA 3FAWA 5GGVY 4J3WA 1RURL 3RIAF 2IADA 5GRJH 3ZE1E 4Z5RB 4DUXA 3QYCA 2FSEA 4MX7A 4F33B 3SDXF 2OP4L 1EMTH 1TNMA 2BFVH 1WFNA 3VXNA 2NY3B 3MUGA 3RTQC 4BSWB 4HPYL 5L9DH 3T04D 1DL7L 2ZG1A 5F7FA 5TH2A 3MACH 1CFBA 1RU9L 4HD9A 1RZ8B 1N2RA 1X5ZA 1IKNC 4WU5A 1XF1A 2ITDB 3U83A 4I9WD 1N0LA 1DVFC 3VFOA 2EDEA 3CXDL 1FNFA 3D39B 1M71B 1CWVA 5ALBH 4NZRL 2P8PA 5ITFB 4H25A 4PJ8D 3D0LB 3VXMB 1UWEH 4QRRA 4DZBA 3QQ3B 3TJHD 4EUPH 1DBMH 3BXNB 3WEXB 3TV3H 4AEIL 3RWJB 4G8GA 4EBQH 4OLVH 3TN0D 3X17A 1OAYL 1DN0B 1ZEAH 1IGJB 5GGSA 5EFIB 1A3QA 5EZLB 5D2LF 5EU5A 1NUFA 2C1OB 4UBDD 1YEEH 2WBKA 4NQDE 4EDWH 1EEUA 4HGKC 2GT9B 4JO4H 4OZGF 5JXED 4LSSH 4Z95L 3V4PH 1FCCA 2WM0A 4Y0GA 4PBWD 2YOCA 1CFVH 3HC3L 4PB9H 3HE6C 2XKUA 4FQ2H 5FYLE 3ZL4L 3EJZC 4I9WE 1L0QA 3ARGC 1WWAX 1LO3H 3AS2A 4TOYH 4OT1H 2WUCL 5KAQF 1NEZG 3UJIL 1CD8A 1A7OL 1QR4A 4YUEL 4KFZC 4Z7VF 3ZDYF 3VU2A 1HHHA 2PETA 3C87A 1XR8B 4QXGL 2WIMA 4JFZL 3MJ8A 2L4OA 3CLFL 3HZVA 2DS4A 1LE9B 4JPWL 4HX1A 4TQEH 2OSLB 1W72B 3BDXA 3DXAA 5BS0D 1MRFH 4FFWC 3ARBB 1KJ2H 1UM5H 5E00A 3VGFA 3G5ZB 3VE0B 4K3DL 3MUHL 3Q6GH 4KDTA 1AGEB 1N59A 5DUMH 4K94L 4N0CC 4JZJA 1QACA 3PP4H 2OI9C 5JZ7D 2EEDA 4UDUB 2OK0L 4Z7QF 3KLAB 3EYOA 3L3KA 4MA3A 5L2KD 3KLHC 2DMKA 3ZTJH 5I1AA 3F58H 4FNLH 4JFYA 3TEUA 3QDME 4F7EA 2GFBB 5B3NA 3FTGA 3W9DB 5TE4H 4WV1C 1OAUH 5IB5B 3ZYZA 3ARZA 3PHSA 4WEMB 3QSKB 1U58A 4ETQA 1NL0H 2CQVA 1UQSA 2O5YH 4PLNC 2FECI 1SM3L 5LWYL 4NKIH 4P2RE 1RHHB 4JFPA 1YQVH 1YJDL 5HHNB 3LMJL 4LIQE 2B2XH 1QLEH 2W0KA 2FHBA 4XBGB 3EUUA 1JVKA 3MFFB 2FEEL 3U48A 4ALAH 3P0VL 2HT2C 3ZE2E 1AY1L 1YNTA 2FB4H 1BOGB 4GRLB 1BVLB 5DFTA 1BIHA 2DLHA 2ITDA 3DETC 1A1MB 1G7LA 4ODBD 1XT5A 3MA7A 4BZ1L 1G7HA 2NXZD 4OD2A 5ITFA 4PJCE 2ZG3A 3I50L 1IAKA 4NIKB 3W81A 3DX7B 3FB5A 4A6YH 3MRBB 3QQ3A 4LFHG 4CGTA 3TT1L 5EUOF 5I1JH 1B3JA 1RIVL 4A2MA 1F42A 3B2VL 4X6FB 5D2LB 3SDCC 4RSVA 5J9PA 1DN0A 5TGBA 4OZGB 2YZ1A 4W4OA 3RBSA 2CUIA 4NQSB 3MV9E 3V6BR 2R69H 3SGDH 1PGRB 2FEDD 2BNRE 4X8JA 3P9LA 2AK1L 5CSGA 3OXRB 1ACYH 1X4XA 4JFDD 4I48B 4NWTH 4PJGF 1JZ3A 4IRZH 5IV2B 1TVBB 3NCJH 4PJDE 4S2SB 3EO1A 3QH3A 2F19H 2WANA 5C0BB 1FYTA 3OKKB 2XPGB 1ADQA 1YC8A 4Y19D 1O5DT 2WNGA 5FUOH 2N7BA 2YXFA 5LAXB 5SX4I 2DN7A 1RFDL 1XR8A 2VMFA 4M61B 3QFDB 2X70A 1U92B 2BVOB 3KS0H 4KJWD 4HXAH 4ZTPH 2OSLA 3KYAA 1S7QB 1DQQB 1HXYB 4PJ8B 4QEGA 2XQYG 3LD8C 3G5ZA 5DJAB 4K94C 1RZKH 5DFVD 2OTUB 1TDQA 1WV7T 4GQ9L 5E6ID 3CLEH 1H15B 4NHCL 2FX8L 1B4JL 4RMQA 5MEOB 2H41A 3L3GA 2VDMH 3ZYIA 4B50A 4UU9A 5DHVA 5MHSE 1H8NA 1U41A 5T1MA 3PG2A 4KV5E 3RVVC 2AK4A 2CDEB 5I1CL 1KSRA 1IFHL 1IGCH 5FDWB 1DCLA 1MIEH 4QCIA 3SGJC 4BYHA 3IDXH 4G3YL 5GGVH 3V52H 4C4KO 5DMKB 4MNHA 3WNPA 3KPRE 3PABB 1Q72H 3HMXH 4ZFFB 4FQ1H 3P3YA 2Y6SC 3FKUS 3GGWB 5IB1B 1BF2A 2YD4A 4WVRA 5C0CD 1KYOJ 4OLXH 2DI7A 5AG9A 1ZS8B 1BVLA 2E6QA 2XTJC 4PJXF 4UAOB 4P49A 1IZKA 1UXSA 4Y8DC 3TNMB 5EUOB 4WTZG 3TBYA 4P3DA 1CI5A 4YHIA 5BS0B 3GJFA 3RI5F 4JPVL 1WZLA 3DX7A 1XFPA 3SPVA 4U7SA 4AEHL 3MRBA 4WO4A 4YXLH 1DANT 2XG4A 2FRGP 3HNSH 5FYJU 1OTUC 3NTCL 3C5ZA 2H3NB 3T3PF 3ZE0F 1HINH 3QCUL 3IF1B 1EEYA 4OM0L 5D71H 3EOAA 2MCG1 5ACMA 4G5ZH 5ADPL 4PJ7F 1KN2H 1CIUA 2GI7A 5FYJL 2ESVB 3DRTA 1LDPL 3CFDB 5GZOD 4Z78A 4CU6A 4PJGB 4HHAA 4CKVX 3PHOA 4JY6B 3V0WL 1UYWH 5IQ7L 3RU8L 4I48A 3U36B 4K8RD 3S88H 3IFNL 1EAJA 1I1YA 5TPWL 4CVWA 1TVBA 3NIDF 4S2SA 4KROD 4NQXA 2BK8A 4QO1A 1R3JB 2EZ0D 5ESQB 3UYRL 4M1GL 1IM3A 3P0GB 4UINH 4XC3L 2DIJA 4OQTL 4YHYB 5HHQA 3HI5L 3NCFB 3H3PL 1VPOH 2BVOA 1E4XH 3KR3L 5AYQA 1FJ1A 4I2XB 1S7QA 2J2ZA 1DQQA 2ZUSA 4PJ8A 5IW3A 1OARH 3ZDZF 2F54D 3QI9C 3O6FC 2Q86A 2OTUA 5F6HJ 4JPKH 2IQ9L 4LCCB 3TN0A 1KXVC 4HUWA 3OAYK 2Z8VC 4OBSA 5ERWB 4F7MB 4QXTB 4ZAKD 4ODHH 3CCHB 1Q94A 3S5LA 2I26N 3IFLL 2X05A 1CLYL 4DZ8A 4P23D 3TBTA 2CDGA 5JXEA 5LXGL 3K81A 1MCQA 1DBBH 2B0SL 1TLKA 4O51B 3DHMA 2DL2A 4JFDB 5CJ8A 4YWGH 4C58B 2GK0A 3O4OC 5I15L 2DQHH 3QUYC 2YN5A 3V6FA 4N5EC 5IIEB 3GB7B 3MR9B 1R3LA 4IJ3C 4ORGB 4TUOB 5KG9A 3PABA 4M9PA 4JHBA 4Y19B 2AI0H 1U3HD 2PNDA 2LU7A 3CSYA 5ALCH 3REVB 1NLDH 2NY4C 5D5ME 1SJXA 1A7BA 2GQHA 3GIVB 3GSQB 3KDMB 2WBWB 3TNMA 1NGWB 5JXAL 2V5MA 1H9VA 1RURH 2J8HA 2H2PD 4PY8I 3DIFB 4V1DE 4DUWA 1D6EB 1JWUB 1T4KB 3ETBF 5KAQG 4DQOL 2W60B 3FOLB 4M7ZC 4PJ7B 1JZ2A 2OP4H 1TPXB 3JV4A 1NANI 5E6IB 3IF1A 4MXQD 3MX0A 1B6UA 2X7LA 5F70A 2HN7B 3U9PL 3JUYA 5L2KA 2XFXB 2QSQA 4PJCA 1T0NB 1MFEH 1UC6A 3P77A 4XHQA 1OGAB 1CICC 3FT4B 3VA2C 3CXDH 3NZ8A 2QJDA 4WENB 4M7LT 3U36A 2ZWLT 3SE8L 1HSAA 5H35B 1JPST 4NZRH 5JIHA 2VN4A 1OGTA 3MRKB 3ULSA 5CGYC 4H1LH 1VFUA 4AEIH 5GZNC 1MJUL 3CZJA 1HQRB 1OAYH 3QRGL 4I0CC 4NKDA 2BY0A 4JFEB 5C0CB 1NJ9B 4LGPB 1DSFL 3G9AB 1KC5H 1JWSB 4HWNA 3WFHB 3NCCB 1BZQK 4NBZB 3CK0H 4J4PC 4XH2A 2VR9A 3ULUE 4XNZC 4I2XA 3AMKA 2QR0A 2QSVA 4Z95H 4BK5A 1T0MB 4FRWA 5TE7H 4DOHB 3VFUB 4UTAH 1JNNL 5F1OB 4MAYC 2DQEH 1DR9A 4WFED 3ZL4H 2PXYC 5BRZD 3H3BC 2QQLL 3T4YB 3TCLB 3VFPB 3PGCB 5ERWA 5DMYA 1JPTL 2WUCH 4F7MA 3CCHA 5JW5A 1Q0XL 3UJIH 4W70A 1KGCD 1A7OH 2GK2A 3BEWB 5H94B 3RVUC 3QDJB 4ZNEA 3D25B 5J3HC 4QXGH 2P7TA 3RJDA 4MVBD 5JW3L 1WAAE 4JPWH 4O58H 5DD3L 5BZDB 5C07E 4DAGL 1T22B 3DHJA 4Y4HC 4YBLB 3PF2A 2BDNL 4NO0D 1FFNA 3UTSE 1DEEB 3GB7A 1I7RA 4K94H 3VA6A 3F5WB 2M26A 1J1XL 3VGBA 3G08B 4TUOA 2B4CC 3UC0L 2H8PB 4LLQB 5DJ0A 5F97E 2OK0H 4OZHA 1V3JA 1ZHKA 2IANE 4R26H 4X0KA 3ET9F 3U46A 3VRJA 3ZO0A 1A02N 4AM0A 2LTQB 5GIRB 3GSQA 3KDMA 4HSQA 3KPRA 3RY5A 4NZDA 3DIFA 3MA9L 1CLCA 5FIEA 1D6EA 1JWUA 4HWEH 2F54B 2MQ0A 3FOLA 1L0XA 3LB6C 5I19L 5IF0A 4KRMB 1YJDH 5L8LB 3LDBB 4YGVA 4AQ1B 5D8JH 3LMJH 2HN7A 3TPUB 5DJDB 5HDLA 3FMGL 4IMKC 2PO6C 1LEKB 1OAKL 3D9AL 4ZAKB 4M6AA 4YHLL 1BFVL 1T04A 2FCBA 3P0VH 4G43A 4R97B 4X83A 1T0NA 3VDAA 5JNYB 3QIBD 1X5IA 2WBJC 4P23B 4ODTL 2IBZX 5A3IC 2ICWI 3QEQE 2Z8SA 4NPYA 1B0GA 4FZEL 1CFTA 2W9EL 4XPFH 5DI8B 3ZSTA 3RWHA 3I50H 1AO7D 1IGIH 1WIUA 5C0IB 4Q6YA 2DBLL 3UP1A 1PKQB 1VEPA 3B2VH 4HZAA 5DJXA 1P6AB 1U3HB 1HQRA 4IS6B 4P57B 4S1SL 1S5IL 4WFHE 4E41D 1RJLB 5C0CA 1NJ9A 4YFDB 2XKNB 4UTBH 5DGRA 3WFHA 3QUKB 5D2NE 4WGVB 3VWJC 1NAKL 1WEJL 4D9QD 3VXSD 1TIUA 4ZUTB 2VUYA 1G7JA 2Y25A 3VRIA 3EW3B 2C3XA 3C08L 2AK1H 5CKAA 3GJEA 4JZOA 1MCDA 4OKVA 1IEBB 2IBZY 1NAMA 2HJFA 2DD8L 1MVUA 1NLBL 5EBGA 1Z5LB 4ENEC 4P2OA 2R4RL 1KELL 1AR2A 4LHJB 4QTHA 3X12B 1QFOA 4PLKC 1DQTA 5MERB 2APFA 3GM0A 3W39B 4D9LL 1NGYB 3Q5YA 4AZ8A 4XBEL 3D25A 1CDJA 5CJQL 1HDMB 1IAOA 3O11A 4OAWB 1MJ8L 5BZDA 1HNFA 4WTWA 4KTEH 4OCSL 3QPXL 1I3UA 3GSNL 1IMHC 2WINA 4XVTH 2X1OA 3ZHKA 4FABL 4GQ9H 2H8PA 4LLQA 3BESR 1CIDA 4PJIF 1LE5B 1VADA 2KBGA 1IAMA 4NHCH 1F3JA 1OAZL 5EG6C 5EO9B 2FX8H 5IOPB 3IJHB 4JZNB 1B4JH 1ZOXA 3BPLB 5I8OL 3EGSA 2X4SA 5BVJA 2OMNA 4DWHA 5H2BA 4OCYL 1M7IA 2A83B 1A3LL 5HGAA 4WTXA 5I1CH 1IFHH 4PLOB 5D5MA 4LSDA 3KPSE 5K93A 5EU4B 3MCKB 1RIUH 5BRZB 4UUJB 2EECA 1CXFA 2YPLB 3EJYC 4V1DA 4ZAKA 3V0VA 1EZVX 1BVKA 4V2CB 1FL5B 5TDNB 1Y6KR 4P23A 1D5BB 4ODWA 5E08L 4LLYA 3VGEA 4P59L 1DTUA 1CE6B 5DJ6B 3QA3B 4KAQH 5FYKH 3T77B 4JPVH 1BGXL 4NO0B 3L6FA 4AEHH 4FN0A 1MHEA 3BP7B 2DOCA 3NTCH 5ISZD 1LMKA 2P42B 3QCUH 1U3HA 4IS6A 1MCKA 3MLUL 5GGSY 5ADPH 2EDXA 4RGMB 4XP5H 1EAPB 3DVFA 3C6SA 1RULL 4HWBA 5FYJH 4XVUD 5GGTA 4BUHA 1LDPH 1E6OH 1ADQL 2NY7H 5CZXD 4LP4A 2X4OB 3PWNB 1HHGA 2JB5L 1EZVY 5IB4A 3DX9B 1FE8H 3V0WH 5IQ7H 4JY5L 3RU8H 4QF1A 4LCWD 1ZGLB 3WDJA 5TPWH 4D0DA 1J1OH 1OB1B 4YDVB 3GMOB 1V7NL 4KDTC 4KK5D 2DQDL 3IFPB 5ADOH 4JZJC 4XRCB 1ZSDB 4XC3H 3EYFA 3GMLB 5J89A 2AW2A 2CUMA 2A0LD 4OQTH 3TO4D 3QIBB 3LKOA 3QULB 3HI5H 3BRGC 2HKFL 1A6TA 3NFPA 1XIWD 4OAWA 2ADIA 2LU3A 3KR3H 5C0AD 3QUMH 2E3VA 3C60D 1CZ8L 1C08B 1KCUH 1QLFB 2CIKA 2CK0H 2GSIB 4FFVC 1GGBL 4MNGE 2Q7YB 4L8SB 1C5CL 1FG2B 1OHQA 5BOZG 1CGTA 2GSGB 5EU7C 2IQ9H 4XAKE 1LE5A 3MRQA 2NY3C 5HGDB 1UM6H 5T1MB 4UDTB 2R4SL 4JZNA 1G7IB 1VEMA 1IEAA 2F53D 3UTSA 3D87B 4KMTL 1U8HB 2ZSWB 1S7SA 5LXGH 1CLZL 2DWEA 1A3RL 5A43C 8CGTA 1SEQL 4FXGA 5DEZA 4EDXB 1I1AD 2B0SH 1I1CA 1T5XA 1BBDL 1TJGL 2X10A 4G9FE 3MGAA 5I15H 5BRZA 1CE1H 3MRHA 1SEBA 1U6AL 1CDCA 2G75A 1HQ4B 4QRUB 2H2SD 5HGHB 1LEIB 4QXWA 1FO0A 2X4RB 2VQ1B 5TDNA 2CJUH 3B43A 2E27L 1T80A 3UAJC 3K7UA 5HYIA 2V9TA 2YR3A 1LVEA 1KXTB 2NXYB 5JXAH 2FJGB 1MRCL 5GS2D 2D0HA 5EZJB 1CE6A 2OZ4A 1F8TL 4NO0A 5CP3H 4DQOH 2BVPB 3O3AB 2ADFL 3KPNA 1VFBB 1YEKL 5CEZD 3QEQA 1YEIL 4LBEB 1KB5B 1RK0B 3CFKA 5D1QD 3LEYL 2XQYK 1HSBB 2DTSA 2JELL 4K3JH 3MLSL 1BQLH 3D2UB 1MRDL 1FFPB 1I4FB 1U8JA 2PCPA 3PHQB 5IBLD 5JDSB 5FYLL 3WL9B 3KYKL 3SE8H 1K5NB 3IKCB 1XF2A 2YMXL 2QV2A 3CH8A 4F2MA 3HNVH 3TZVA 4N9OB 4MJID 1TJHL 3GMOA 3QO1A 3O2DA 2XZAL 4JKPL 3W82A 3RNQB 5DQ9A 1MJUH 5FECA 1U8OA 3FCTA 4XRCA 4ONGL 1GH7A 3GMLA 3MGTB 3MLYL 3QRGH 3KPLB 1DSFH 3BO8A 1F11B 1IGYA 1F2QA 2F5AL 5IR1A 3JTTA 4NFCA 3ARQA 5CSZB 3V7AG 1BREA 5DD1H 1JGVL 1RMFL 5DQJB 3VFVB 3MCLL 5EBMA 3VFTB 3VCLB 1ZHBA 1IM9D 1AO7A 4NRYA 4QRPD 1JNNH 1FG2A 2D03L 4HDIB 3ZLQC 5C0JA 3RVWC 2Y36L 4NKMA 2BY2A 3MJ9A 1L7IL 3HHRB 5ISZB 1ZLSL 2QQLH 4E41A 4UDTA 1JPTH 1H3TA 4GRWH 1W0WA 1AGFA 1Q0XH 3VXSA 3PWPD 3VXME 2Z91A 5HYQA 4L8DA 3CX5J 5GGQL 5AAMA 2P24B 1T6WA 5GHWL 4RX4A 3MRGA 5FO9A 5JW3H 5DD3H 1AI1L 4LIQL 4ZYKB 4DAGH 5J12B 1N26A 5I1IL 3O3DA 2BDNH 4KI5F 4WO4C 3BKYH 1KLGA 1WBYA 1A2YB 1MFBL 1J1XH 1HQ4A 5EOCL 3C5ZC 5HYSA 4MXVE 5MEQA 2ICES 2HFFA 4CW1B 3TO4B 3MLRH 3I02A 1CS6A 1NMCC 1A0QL 3QXUA 3B9DA 3DURB 3WMSA 1NGPL 2EE3A 1XIWB 5E4IA 4D94A 1NFKA 2F74B 3DGGA 4ZDHB 1QO3A 5C0AB 43C9A 1R6VA 3C60B 4KPHL 1IKFL 5C2UB 4HJGB 3MA9H 4P48A 3GSWB 5FK9A 3FZUD 3RP1A 3T2OA 4HZLB 3IDIB 1JRHI 4L8CB 1HKLL 1VFBA 3I9GL 3QZWA 4G9DB 4MWFB 1RY7B 4UT9H 1AGCB 1KIQB 1DQMH 1QFHA 1VFOA 2GUOA 5L2JB 4LBEA 2WMPA 4KK6D 5D1XD 1A6VL 2JJTA 5EDXA 3T1FB 3FMGH 1OAKH 3D9AH 4YHLH 4X7SL 3G6JF 1BFVH 2F53B 1FFPA 3VGAB 1FSKC 4BSVB 1HH9A 1RZJH 2X2YA 4XTRD 4Y5YA 3PHQA 3VGDA 3FHAA 4YHOL 4ELKB 1I1AB 2XZZA 1QP1A 5IB2B 2HFEB 3V9FA 3MNZA 2A9NH 4PB0L 3LKQB 2W9EH 2H9GA 2D7TL 1FGVL 2V17H 4PJ8C 4NKQB 3ARRA 2EYSA 5EZOL 4OF6A 3TJHC 2G60L 2C7UB 2DBLH 3HR5B 3GJFK 1RUAL 3JWOL 1TVHA 3TN0C 1I9RL 4S1SH 3SDXE 3LEVL 4TSCL 3KPLA 3PXJA 1B0RA 2P45B 4M7JL 4HBCL 1WEJH 1L7TH 4UBDC 2OJZH 3FB8B 4BH8A 1FVCA 3GMQA 3C08H 5JXEC 3VCLA 4TUJA 1FNLA 2IBBA 4EXKA 2VIRB 3FB7B 4P46D 1ULVA 5BJTB 4HDIA 4YE4L 4L3CA 1WVZA 2D7MA 5E1AA 2R4RH 5CGMA 3L5WB 4O5LL 4PGZA 5D1QB 5LQBH 3U30C 4EJ1C 1KELH 2DICA 1QLRB 3B5HA 4JFXB 4BELD 5KVEH 3W0WB 5T1KD 4MNGA 2XN9D 1FAKT 2VN7A 4X6EB 1FL6B 5EORL 3KGRA 4XBEH 2NY1D 1A6PA 5ANME 5CJQH 1T1WB 1I3RA 4WWKD 5HHMD 2R1XB 5JQ6H 3WKML 5DZOA 5D2LE 4ZTOL 2E9JA 2P8MB 4GMTL 4LCWA 2VAJA 5KVDL 4ZYKA 5C8JB 3W11C 4OCSH 3QPXH 5KS9B 2VL5B 3R1GL 3GSNH 4MJIB 5JW4R 1H3WM 3IXTA 1A2YA 1NGQL 3KLDA 2FZ3B 4X9BA 1QYGL 4U6HB 4PV9A 2A6KB 5HGBB 5EWIL 1MAKA 1DQLL 4HKBB 3IAGC 3TO4A 1OAZH 2DLIA 2NX5E 5I8OH 2JK5A 5ICXB 1JNHA 1ZVYA 4X6CF 5JR1L 2F74A 4ZDHA 3RAJL 1WBXB 1S3KL 4QWWD 4U1NA 3C60A 4PRIB 2VSCA 4GLRH 5C0BE 3ZDYE 4Z7VE 1A3LH 1MIMH 1IM9B 3RX7A 1RK1A 4HZLA 1T7VA 4JG0L 4LLAA 4NN6C 5JIKA 3BWAA 2YWZA 5JOEA 2W91A 2H32B 1JZ6A 3G6JB 1CL7L 2WLYA 3FT2A 2R23B 3CAFA 5AUMA 2HMID 1FZMB 3T1FA 2CO6B 3CPLB 1I7UA 4H88H 2F53A 3PWPB 4BSVA 1X5JA 4CVXB 5D7KD 4Z7QE 5I2IA 4KQ4L 4MQTB 4WEBL 5E08H 3MYJA 4IRJD 4P9HL 1M05B 4NRZB 5DJ2A 2HFEA 4Y2DD 2OQJB 4LPCA 4P59H 4MJ4A 5DC0A 5I16A 3ARDD 2NXZC 5SWSD 3HS0A 1BGXH 1JFQL 1N0XL 3QNYA 5EN2B 3ULVH 5E5UB 2ZNXA 3HCVB 4CUCA 3SKUD 2AXHA 2GJZA 5F7LB 2GJ6E 3X13A 4G8EB 3U4EB 3LQAC 1X6LA 4OZ4B 3QFJE 3I2CL 1IGML 1A4JB 3ALXA 1Q9OB 1MFDL 3WO3B 3QJFB 3K3QA 5IHLB 3RKDD 2FEDC 5EOQL 4ZFOA 3DLQR 5FO7A 2BSTB 3AB0B 3G9VA 4K23L 4JY5H 4F7PA 1LILA 4M8QA 4EI5A 2W0FA 5IESH 3MZGB 1YDPB 3MBXL 2VNCA 3MNWB 3L5WA 5D1XB 2R0ZH 1V7NH 3DBXA 3JV6B 3L5JA 5FUCE 2D31A 5T3ZH 2OL3L 4LKXA 4OGAD 5I1KL 1LHZA 1FL6A 4EI6A 3Q1SL 4DEPC 2HKFH 5F9DC 4Y16D 2FO1A 3WNKA 1NDGB 2M1KA 1VFAB 2R1XA 4GH7B 4JDTH 4JVUA 2P8MA 4KJWC 3GSXB 1CZ8H 2V7NB 4LASL 3BZFA 3IU4L 3K46A 1OW0A 1GGBH 3U0WH 2DI8A 1C5CH 3B3IA 3R06B 2FJHA 2X4PA 5DFVC 4PJEF 4LCYA 4PJGE 4U6HA 2ARJB 5A2JH 4YHNA 2A6KA 2A77L 4X6CB 2CMRL 4HKBA 4LNRB 3T8XA 2FATL 4TUKL 1ED3B 2R4SH 1Z9SA 4BSJA 1GYAA 5DK2B 4OZFB 3U7YL 5ICXA 5I18L 4KKBC 1FN4B 5F6IC 1K6QL 4J23A 2NY2D 2PN5A 2UUDK 1CLZH 2EKSB 1A3RH 4R6UA 4NHUB 4K07A 1HWGB 3R0MA 4PRNA 1NC4D 1OPGL 3QISA 4QRPA 4Z7UB 4ZPTA 3GHBH 4WFGE 1BBDH 35C8L 1TJGH 1XF3B 1QNZL 4PTUB 5BMFL 4U7MA 3O0RL 1E28A 1U8NA 4NC0B 5FA4B 2YSSB 4LSUL 4RAVA 4NDMA 1FZMA 3BGAA 4UOW0 4UNTA 2VISB 2A6IA 5T1KB 3VW3L 2ICWA 2XN9B 4V2BA 4HUXA 4LVHB 3T08A 5HVHB 3E2HC 1NC2D 1JMZA 4L3ED 4WWKB 4NRZA 4Q7DA 3UDWA 4GAYB 1CXIA 3QHFH 4PRAB 2F8VA 3VWKD 4HXBL 1HOCB 1WQVT 2DLEA 1F13A 4XHJD 2IAMD 3P4LA 2ICWJ 2ADFH 2G9HA 1YEIH 1XZ0B 3U4EA 4P2OC 3GK8L 3IJYB 5A16A 4XVSL 4KKAD 3ULUL 2JELH 3CSGA 3MLSH 1MRDH 1A4JA 2EYTA 4GBXA 3X11A 4F7CA 5K9OB 3BUTA 1A64A 1PG7L 1ZTXH 2CSPA 1GZQB 2HLAB 3N9GH 2YN3A 1GHFH 1TZGH 4MZ2A 5FYLH 5D7IF 3LKPA 4NQEE 3KYKH 4M7KL 2VLJE 5SWZD 4PJXE 1UKTA 5F96L 4GOSA 4MB5A 3AGVA 5B4MD 2YMXH 1YDPA 1X5YA 3N06B 3U1SL 3INUL 4QHNA 4F58L 4OF7A 4KROC 4PRBB 1TJHH 5FM4A 5D1XA 2EZ0C 2XZAH 4JKPH 2IG2L 4DGYH 1FDLL 1AXSA 2BXZA 3U0PB 4ONGH 5J1AA 5FO8B 2AXGB 5IKCA 4D0BB 1NDMB 3MLYH 3T3PE 3ZE0E 3MJ6A 1G9EA 4XNQA 2OJEB 4JREC 2F5AH 4PJ7E 4N1CA 4JHZA 1MLBA 2VDQH 5L0QB 5DJZB 1JGVH 4Y2DB 1RMFH 1TZHA 5B38B 3KHOA 1VHPA 3MCLH 3GSXA 4PJEB 3ARDB 5SWSB 2FECL 4H0GA 3BDYL 3FRUB 5E2WH 4IM8A 1F90L 5CP7A 4O2EB 5JOFB 2D03H 4ZUWA 2UVEA 1G0XA 2Y36H 4GKNA 2FGZA 2BMKB 4OCLC 1CD0A 2CKBH 1L7IH 2ARJA 1KNOB 1OGAE 3MXWL 4GW4B 2VZ3A 4RGOH 1OLZA 4S0TD 3NIDE 4X4ME 3C5JA 3O6ML 1T2QH 3IXAB 4ZAKC 3T0BA 2EDQA 4HKZA 4U6YB 3DVNA 3HAEH 1EUUA 5GGQH 4NC2B 4P23C 3HI6L 5F1NA 4NHUA 1MUJB 5ILTL 3DARA 5EH1A 4P46A 4KTYA 1OTTD 2C5DC 2NX5A 1AI1H 5IWLC 4JFEE 3OF6D 5I1IH 2E6JA 4MNQE 3OKNA 4NZTL 2VKXA 2OZ4L 5I73B 1FNGB 4L29B 5DJCA 4HT1H 5KSVB 3MRMA 4YHZH 4Z7VA 3HPLB 5EOCH 2P5WE 5T1KA 3M8OL 2XN9A 1U3HC 1OSZA 4WY7L 4DTGL 3HE7A 3HNTL 4CAGA 2YBRA 2NZIA 2R56L 4DOHE 1A0QH 3EZ8A 4Y16B 1J5OL 3NFNB 3MCG1 5FV1L 2O5XL 1R3KB 4XAWH 4RFOL 5EC2A 1KB9J 2V2TB 4KPHH 1IKFH 5EBLB 4NJ9L 1HOCA 2FL5B 1KJMB 1XR9B 3TP4A 1CVSC 4GUPB 1SYSB 3I9GH 4POZD 2EXWD 4XCNB 2PR4L 3QQ9D 4IOSD 3QDJE 5KBNC 3MLTA 4Z7NF 4X7SH 5K9OA 3WDHA 4PREB 5D7IB 5F1IA 4O2FA 3CC5A 1EXUA 2HLAA 1GZQA 4GS7B 2Z35A 5AYUL 4DKEH 5F7MC 2NY6C 4YHOH 1NC4B 3QFJA 4PB0H 4LU5L 1UZ8B 5C0RL 3WBDA 2EDJA 2D7TH 3RY6A 5E5MB 1OM3L 3DSFL 5B39B 4JM4L 2PTTB 1B9ZA 1G7PB 3KPMA 2G60H 4LAQL 4XZUB 1RUAH 3JWOH 5FO8A 4N0FB 4OZFG 3NBNA 1FH5L 4D0BA 3MJ9L 4K3EL 4UNVA 4TSCH 5E6ZA 2IQAA 3VD5A 3MO1A 3HG1E 4M7JH 2OJEA 3BPLC 4X9GA 1NC2B 1KTDB 3NACL 3WXWH 4L3EB 4IRJA 1BX2B 3LSOB 4Y2DA 2QHLA 3SY0B 4YZFF 1U8PB 3ZKQD 3H7BA 3VWKB 3DO3A 3BKJL 4MD4A 2VLRB 3AU1B 4TVPH 3V4VL 3FRUA 4I13B 2VZVA 4DN3L 1MCCA 2IAMB 4O2EA 2A6DB 4UILL 5CLTA 3H9YA 5E8OB 3VXRE 1CFSA 1BQHA 3HKFA 4YE4H 1MWAB 5H8DA 4AIZB 3AUVA 4X6BA 5HJ3B 2HFTA 1RJCA 5SV4A 4O5LH 1YYLL 1J8HB 5GGRY 2FJFB 3OZ9L 3DI2B 2BRRL 3G6AB 3C8KB 4WDIB 3PV6A 1ACZA 4P9ML 5TDPA 2AABL 3T65B 4U0QB 2I60H 4RWYL 5FCSH 1V5JA 2C9AA 3QXWA 3SDDA 2GHWB 4ZTOH 4MVBC 1QPPA 3T2PA 3MLXL 5KVDH 2Q7NA 4I3GA 4ZOCA 1ORQB 2AKRB 1TZIB 2K7PA 1XF5A 4EVNA 3CVHA 3JSSA 2PUQT 1R0AL 2EDWA 1NGQH 2JJSA 3FQNB 3WFDL 5HYFA 4D3CH 4EKXA 4GKZB 2GITB 3BI9X 1QYGH 4DN4H 5EWIH 5CEYA 2SEBB 3MMEA 1DQLH 4L5FL 4WHDA 3WE6B 5C86A 3VG0L 5D7LE 3ZDXE 3IETB 4CL7A 4Y16A 3PWJA 5JR1H 1JK8B 4BQ6A 5INCB 3RAJH 1S3KH 4JFFE 5E9DB 3U82B 3RZCD 2FL5A 4HIJB 3IVKB 5GS1B 4WU7B 4OIBA 3RWGA 3M17A 4JG0H 3NOIA 3G6DL 4OD1H 1AGDB 1SYSA 4GFTB 5BVPL 4FXKB 4XCNA 3BZEB 3BPCB 3PGDA 1CL7H 3TZVC 4YR6A 2HTKD 1YEGL 5KVFH 1X5KA 4U7KA 1UM4H 3B9KD 1PEWA 2ZKHL 1I8IB 4MCYB 3QG7H 2HJKB 1M7XA 2EE2A 3TJEL 4P4KB 4L8BB 4LLVB 4NKOA 3NCEB 3FFCE 5B38G 4KQ4H 3R8BB 2O26U 2I9TB 3G5YA 1N64L 4P9HH 1BZ9B 4XMKL 1YYML 5K59F 2P8LA 5F1SA 1UZ8A 1QR1B 1CU4H 3AC0A 3RGVA 5DRWA 2VWEE 3BEVB 5B39A 1JFQH 1KFAL 3MNVB 5DUBA 1EHLL 3CDCA 4XZUA 2YXMA 4GW1B 3VGGA 1FQ9C 1IL1A 1W0YT 1JGEB 2RR3A 2OX5A 4NQEA 2VLJA 1LEGB 3H8NA 4HKXA 1VKXA 3S96B 3I2CH 5DRZA 4EN3A 1S7XB 1YUHA 4H5SA 4R0LA 4L3EA 4JKWA 4JN2A 3A67L 1MFDH 4U1LA 3AY4A 5HPOA 3VWKA 1FP5A 1AP2B 2ZCLL 5EOQH 4P2YA 5I1HL 3P4OB 1N8ZB 2YPLE 3TH3T 1RZFL 2IAMA 1UJTA 3H9SD 4HUNB 4DCQB 3KPPB 1A21A 1MCEA 5E8OA 4AENA 3S9DB 3L5XL 4JHAL 4CVZB 3MBXH 1ZLWK 3CFEB 1RIHL 5HJ3A 4TULH 5HYJD 1EFXD 3O8XB 1B88A 1JTTA 4RRPG 1XGQA 4HLZH 3NA9H 1YC7A 3OKEA 2OL3H 5B21A 3OR6B 5I1KH 3Q1SH 3T65A 4AT6B 5HDOA 3CUPA 1KJVA 4RIRA 1CFQA 3F62A 3FB6B 5SWZA 3RFZC 3I3EA 5D1ZD 2NMSA 2PTUA 1JHTB 5HVGB 5DDHB 1TZIA 4KI1A 3IU4H 1WFOA 2FO4A 2X44D 3OXSB 3DYOA 3NVQA 1OCWL 5CILL 1MFNA 2CMRH 3SJVE 1GIGL 2FATH 5CMAB 4TUKH 3H9SE 2A2QT 2JJTC 1FVEA 3BP6A 3PNWB 5IHZB 3IETA 1RPQA 2OXGA 5I18H 1JK8A 4NC1E 1TENA 1K6QH 4Z6AT 1QFPA 3CJJA 1W0VA 3O45B 4HS8L 4FQIL 5KJRH 4TYUA 4Y5YC 3IGAB 2E5EA 1OPGH 2ITCA 1VACA 4O4YL 5B39G 3R8QA 3NFSL 5EO1B 3MV8D 1IC1A 1C12A 4JGMA 4BM7A 4XPBL 1F58L 3KPOB 3STZA 1UB5B 3LS4L 3RWIB 2ADGB 4JE4B 3GKWL 3QJHB 3VW3H 2FLRT 3GIZL 4LKCA 1AKJB 4L8BA 2RFXB 3GMRA 4I0KA 4PJIE 2RBLA 1AHWB 3QNXB 2W92A 3LH2H 4HC1A 2IALB 4KK8D 1RUML 5GS0L 1EEZA 5HHPA 3DVGA 4Y5XA 4PGDB 3BEVA 5DMJB 3OF6A 1SJEB 4Y5VB 5C3TA 2OYPA 2I5YH 2IPUG 4HIIA 5D7JA 4ZFOL 5DRNB 2BCKB 4XNMA 1BIIA 4Q97A 1VB9A 5IBUB 5FHBL 1G6RA 4NYLB 1ZE3C 2AGJL 5A2FA 3TH4T 1MI5E 4PGBA 3ULUH 2HVJB 5E2TL 4JO2L 5IEHB 3ZMRA 4XVUC 3B8YA 1ZA3B 4HMDA 5CZXC 1F4HA 1PG7H 5JLZA 4G7VL 3RZCB 4U1MA 3P4OA 4PBVC 5GSVB 1UA6L 5DGQA 5F96H 4P2QE 3HG1A 1INDL 5JUEH 3U1SH 2Z93B 3CFEA 1VEOA 5DA4A 5J12C 2EDBA 4F58H 3HRZA 4XGZA 3IKKA 5GXBB 1GC1C 4LOUC 1HIML 4EUPA 2IG2H 4LHUD 1F2XK 1FDLH 1A4KA 1U95B 5CINH 3TBSB 3OR6A 3EDDA 3EJZD 3TO4C 3VXRA 3ARGD 1KENL 2APBA 5SX5H 1FVDA 2A6JA 4OB5L 3OAZH 4LF3A 2YWYA 1CCZA 1FGNL 3C60C 1N6VA 3TIDA 4QRQB 4R7NA 1AC0A 3GNML 1V7ML 1U8QB 5IW1A 2BVEA 5MEND 4WI7A 5ID0B 3WJJA 3IDGB 5DD6A 2ZUQC 5F9WB 2VDLL 4BQBA 4KHXH 3OKYA 2LABA 1K3IA 4PJBB 4HH9B 3SKMA 5FDYA 4R90L 5F7DB 1KT2B 3HI1A 1FORL 4I5BA 3HI6H 2PW2B 4MZ3A 4MA7L 4GRMB 5DVMA 5ILTH 5D7LA 3VG9B 5LVEA 2DQTL 3FN9A 1JV5A 5HDQL 5INDA 2BJML 2I07B 4YXHL 2QKIB 4C55A 4NZTH 4M02A 1KJ2A 1X5GA 1EFXB 3FHQA 3OHXB 3VD3A 1L4IA 1UB5A 5F44A 4WCYL 1NBZA 3NCBB 3BYYA 4MD5A 4UMGA 3ZKSD 2H2SC 4NCC1 4WY7H 3V95A 5JDJA 1BFTA 2RFXA 3LQZB 2R56H 4OV5B 3QNXA 4KKNA 4RGND 5MENE 2D7OA 1ZHLB 2IALA 1EDQA 2O5XH 4JFQA 4RFOH 1ZT1B 3BPOC 3VXTB 4OFYD 5D1ZB 4WI9A 4OZIF 4PGDA 4NJ9H 4QGYA 4B5EA 2JIXD 5DRNA 4XP6L 2BCKA 1SBSL 3FFCA 4LVEA 5AWNL 2FD6L 1I7ZB 4EI5C 3U6RA 5ICZA 5T1LD 4WEUD 2NTFB 3V5HB 1U3ZA 1DEDA 1FZJB 3K1DA 3QXDA 2Y5EA 2HVJA 4HFUL 5IEHA 5SWQA 3F7VB 1GZPB 5JQHC 3BP4A 1R5VA 1ZANL 5SX4H 1ZA3A 3SDCD 2CLZB 1O7SA 3SKJL 3RZCA 2DKUA 5AYUH 5IBLC 1CDUA 3UMTA 4C56E 3O41A 4KWUA 1P7QA 5GSVA 1JNJA 4KY1L 4NO2A 5C0RH 1IARB 3W9EB 2DQIL 4RGNE 3DSFH 4TVSa 4KTDL 1OW0C 4YEEA 5D96C 3I75B 3H0TA 4JM4H 5B8CA 1A7PL 2DQFA 4A6YA 3BRDA 3B9KA 3T0XA 3PXHA 1V3LA 3IDJB 3RWDB 4X5XA 1QEWA 3EFFB 3MJ9H 4LLUA 4QT5B 5FM5O 5D6DA 4K3EH 3LKRB 3RVTD 2AXFB 3UBXI 4AMKL 4QHLA 3NN8B 3OR7B 3QNZA 2VE6B 3BKJH 3LHPL 1P2CB 3SE9L 3V4VH 4LCUB 1V8HA 1CD9B 3D18A 4FQHB 4H0IA 4OUOA 2DDQL 4DVBB 4KUCD 4UILH 3HZYB 4WFFD 3K0WA 5IG7B 4BFIA 3SO5A 5ID0A 4Q58C 3UTPE 1BOYA 1OF2B 3OZ9H 2UY6A 3L3HB 3L9RB 2BRRH 4PJBA 1A6ZB 3PDDA 2J4WH 4HH9A 4Q6IA 4Q2ZA 4L4TE 3ZTJG 3PDGA 4P9MH 3DROB 4XBPA 1A7NL 5ETUB 2BP3A 1U8LB 3D6GA 3UYPA 3SJVA 4Z76B 4K7FA 4YPGA 3H9SA 3UCRA 3UDWC 4URTB 2WP3T 1ZGLP 3ARWA 5IBUG 1I9IL 3VFSA 4PJAB 1JWMA 3KVQA 3D48R 4KQ3L 4ISVB 1T1YA 4LVNC 4WUKH 5C0FA 5HYJA 3WFDH 2VLMD 4LHUB 2DLFL 3HE6B 4D9RD 1S8DA 3VG0H 2J88H 3ARGB 4OZIB 2DQJL 2ZPKL 4U1KA 1ZHLA 3VFWB 5L88L 4GBXC 5GRYA 2XA8H 3L7FB 4KRPC 5D1ZA 3DTXB 3JWDH 2CLVB 3L7EB 1G7MA 3F8UB 3MQIA 2OXHA 4EEEA 2VUOA 1WIPA 3FZUC 3V5KA 3W0WE 3B83A 4YJZL 2V5SA 5CIPH 5BVPH 2XYCA 1J0ZA 2C4XA 2AQ3A 1A7QL 3V5HA 3P11L 1LO4L 1D9KA 2DM2A 3P0YH 5D1XC 5EBWB 1P4LA 3HPJB 5DD5H 4XCCL 4KVNL 5CWSB 1JJUA 1CD1A 4KI5E 3VXQA 4PGEB 2ZKHH 4YX2L 3HMXA 1OTUD 3HN3A 1IGTB 1MCIA 4AL8L 3IDNB 5CBAB 4MLIA 1N64H 2D4FA 1MI5A 3GSRA 1YYMH 1D6VL 2G5RA 4HIEA 5AZEH 5C09E 4LHQB 5FGCE 3OKLB 3MV8A 4OIAA 1HCVA 4K2UH 1JYWA 1CGSL 3W9EA 1UT9A 2AJ3B 1MH5B 4WV1B 2HVKA 1EHLH 2KL6A 3FFDB 3RDTD 2Z8RA 3VXUB 4OF5A 5T5NF 3TWCL 4PRIE 3EFFA 4P2QA 3LKRA 2BZDA 3UTTD 4G8FB 2AXFA 2J6EH 3E6FA 3FQUA 3W2DL 5EIIA 2JB6A 1PZ5B 3A67H 5JHDB 4ZODA 4N8VA 4NNXB 1NFDF 4KVCH 1U8MA 4X99A 4ELMF 1S5HB 2VE6A 4YDIL 2ZCLH 5I1HH 1J86A 3MUY1 1G9ML 4Y1AE 4MD0A 1JGDA 1RZFH 4U6XB 4NZJA 1F6LL 4P46C 4QHUB 2VOTA 4M1CC 1WBZB 3BH8B 1BECA 5E03A 3GHEH 3LEXB 4JHAH 4GG6B 1OD7A 5T1LB 3KXFE 1RIHH 1TNNA 2VQUA 5L6YL 3D85D 3CVHL 3NZHH 3DUSB 3LKSB 3BH9A 3QI9D 4H8WL 5KSBF 1I75A 1JF1B 5DLML 4QOKB 4AG4L 3WFCL 1KCVL 3PQYE 5LGJA 4D8PA 3SDCB 3HE7C 4NSKB 4XPTH 1JTPA 2NY1C 1U8LA 1ORSB 1GGTA 5BW7A 3BGMA 4ODUB 3S35L 3HC0A 2A9ML 3TBVA 1IQDB 4M8VA 3OGCA 4PJAA 3B6SB 4KKLD 3ABZA 2VERN 5CD5C 3OBAA 1NANH 1XF4B 4LHUA 4ZSOE 1PZUB 3H2WA 5CILH 5JO5A 1FRGL 1GIGH 2YUZA 4XP9L 1NCUA 5DS8B 1QFUL 3P40A 1EK3A 3ARGA 1ZHNB 2H26B 4ZOAA 3QDHA 4BH7B 3BISA 2ZCHL 3H7LA 4AYFA 4K7PL 3HZKB 4NJAL 4QWWC 1BD2E 3BW9B 3L7EA 4C83B 1Y18A 4NZUL 2NY4D 4EQ3A 3NFSH 1T7WA 5D4QA 3RL1A 3AAZA 4TN9A 5MENA 1YNLL 2D0GA 5DVOA 1K4DB 1EH9A 3RY6C 2GTZA 1F58H 4GW5B 3LD8B 4WUUD 3V5DB 1KEGL 3LS4H 2HMIC 1FZKA 3GKWH 1D5ZA 4JR9L 3GIZH 4RMRA 5FKAB 5MEPA 1ZA6B 5J1SC 1IGTA 3AS0A 5GRVL 3AMLA 4XPAL 5EC1B 1NCCL 1RUMH 5GS0H 5FYJD 4IRJC 1F4YL 2J8OA 4HV8A 4Y2DC 2XNAB 1QSVA 1JF5A 3DO7B 1N7ML 1EHNA 3OKLA 5FUCC 4X7TB 3MRFA 1P69B 3K2UH 2X4NA 4MA1C 3TIEA 5FHBH 4GLRI 2DTMH 2BVQB 2DB8A 3GMMA 2LU4A 2UWEA 4QYOB 2W65A 3KYNB 2AGJH 4PRPE 4HS3B 1NFDB 1VDGA 2FWOA 4OUUB 3CFJA 4ZPVB 1PQZB 3BQUD 5E2TH 3R0NA 4JO2H 4PBXA 5CGYD 5FYKE 4OFYA 5CEXB 2EO1A 2N56A 3EDFA 5FOBB 3RKDC 1Q9KA 4G7VH 1G9MC 2ZJSH 4J3VA 1KCSL 8FABB 3VD4A 3SDDC 3HUJB 3TNNA 1UA6H 2EIZB 2JIXA 4QHUA 4X98B 1INDH 1PFCA 3LEXA 5KSBB 3CNKA 4LHUG 2V2WA 4N5UA 1P9MA 3ME0A 2NW2B 1HIMH 4H8WC 3DUSA 3LKSA 2JJSC 4H1LA 4APQD 1GJIA 4EXPX 3LQMA 4ODXB 4LSTL 2XWBB 2ZOLA 3SDCA 3D69B 3OKMA 3BZ4A 2QTEA 3K1KC 4Y16C 4F37F 2YD3A 1T7ZA 3T2QA 1BZ7A 5GJTL 5D6CA 1W8OA 1I8KB 1IQDA 1FGNH 3HZMB 4LPXA 3IDUA 1B2WL 4S1QL 3D3VE 4L4TA 3DX6B 1JRHL 1LO2L 4K7PX 1V7MH 1HH6B 1UXWB 3RDTB 1L9MA 4ONHB 4ZD3L 2MMXA 5FCUL 3L3OA 4HMEA 4N90E 4PV8B 2QQKL 4R90H 1SJHA 2AJYL 4P3CL 2NY2C 3H9HA 3AROA 4MA7H 1S9YB 4JRWA 3W5NA 4HC1L 5HDQH 4NT6B 1UVQA 4F3FB 3G5VB 4YXHH 2C26A 3RGVC 2NQCA 5CZVH 2OR8A 2A73B 4OIIL 1W72H 3D85B 4LLMA 3GZKA 3PL6D 4Z7WF 1DLFL 3IRZA 3V5DA 5GRJL 3QI9B 2M2DA 2PYED 4K7PY 1P1ZB 2XICA 5DVLA 1G6RL 4YDJB 2RQ8A 4KJPD 1EMTL 3X14B 2BFVL 5ESVA 4EN3C 1HILA 2GAZB 2BSSA 3MRJA 2C3VA 3C2AL 2EC9T 3TLRA 4R0LC 5EC1A 5JORA 4I0PD 1N3NA 1A1OB 3Q2CA 3ECBB 2WP3O 5L9DL 1S9XB 3AY4C 3S37L 3VWKC 1IT9H 4J6RL 5TFSL 2VABB 4XHJC 2IAMC 1FV1B 2FD6H 2OCFD 4IHOB 2Z8WC 3KYNA 4M5YH 1OSPL 4KGLA 1C8PA 1QSEB 2IEPA 4KK9D 3O4OB 5HHOD 1XGTA 5C09A 2AV7B 3QUYB 3ISWA 1PQZA 4IIQA 2X89D 1DBML 4IJ3B 1ZANH 5C0ND 1OP5H 5CEXA 4EBQL 4GKSA 1SHMA 2NZ9D 1OD9A 2FX7L 1Q9WA 3PWVA 4MDJB 2NY4B 5IVNA 3QEHB 3BGFC 1DLHA 4X9HA 5EA0H 3FO2A 4EDWL 5B4MC 4RFEB 4JAMB 3FONB 1U3YA 5JMOC 4KTDH 1OP3K 4LSSL 1F45A 4JHWL 5JIPA 4HPOL 4WUUB 3V4PL 3S3PA 4FA8A 5JHLL 4Y1AA 1XGRB 4P5TD 1DE4B 3SCMD 4M7ZB 4ODXA 1H0DB 4CN6A 4HG4J 2XWBA 4FQ2L 1CXEA 4PP1D 3VRLF 2BNUA 3KXFA 3T0ED 4Q9RH 2R2EA 1LO3L 3DUUA 3CVIH 3RNKA 4XXDA 1Q1JL 4NQTA 1IVLA 3LHPH 2R1YA 3ARXA 2DKSA 1FZOA 4DFIA 4G80A 3JVGA 3UJJL 1N5YH 2DDQH 1C5DA 1HH6A 3RDTA 3NABL 4I18A 5HY9A 1SQ2N 1N5AA 2E8ZA 4ONHA 4TQEL 2AV1B 4HULB 3FJTA 1JBJA 1MRFL 3UTTA 4PJFF 4NCC2 3FO1B 2OTPA 4PV8A 4WW2F 1KPUA 3FQXB 6CGTA 4HS6A 4JJ5A 1A7NH 4ZSOA 1KLUA 3EOYG 1ETZA 4K9EH 5EU6E 4XNUL 3WUWB 5A2LH 1IAIH 5CZKA 4Y5XC 1OTTC 3F58L 3RHWK 4Z7WB 1I9IH 3MJ7A 1XGPA 3LCYA 2MCPL 4XNZB 1TCMA 5D7JC 1U91B 5TE4L