3N0PB

A mutant human prolactin receptor antagonist h30a in complex with the extracellular domain of the human prolactin receptor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
206
structure length
206
Chain Sequence
MLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Independent Histidines, One in Human Prolactin and One in Its Receptor, Are Critical for pH-dependent Receptor Recognition and Activation.
pubmed doi rcsb
molecule keywords Prolactin
source organism Homo sapiens
molecule tags Hormone/hormone receptor
total genus 36
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2010-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n0pB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n0pB01
1L6XA 1IEHA 2WWKO 1YMHB 1T0NB 1VSCA 5E2JA 1XGQB 4PJDF 4KJYB 2IANE 4QXUL 1JGDB 3MPCA 2DI7A 3O3DA 1RZKL 3Q5OA 1KJ3L 3F8UB 1RJYA 2YUXA 2IH1B 5EN2B 3DNKA 2CSPA 2VXQH 4EBQL 2J3SA 1XFPA 1XR8B 4G6AC 4MQ7A 1ZANH 3BWAA 3SE3C 3RGVA 1YEHL 1U58B 1TQCB 3VGAB 4CU6A 1BWMA 2H45A 3QEQD 4JRXA 4G8GA 1CGTA 3E8UL 4C54A 1R3JB 1QRKA 1I8MB 4OCLC 4JN2B 4L4VE 1CXLA 4KROC 1R3KA 1OGTB 4X4ME 4O58L 4OV6F 4L3CA 5CP3A 2VL5B 3K4AA 3TA3C 4XCEA 1A7PL 5C07A 2R1WB 3DX8A 2AJXL 4L8BB 4OGAC 3GKWL 3ARVA 3IFLL 2IFGA 3W11D 2DYPB 5TPWL 4OZGB 1D5ZB 4U1GC 4ZS6D 1EEQA 4YPGA 3HC3L 4OIIL 1NANI 5EOCH 3U0WH 3VWJD 3NPZB 4LPCA 1U6AL 3VXTB 4P2OB 3P40A 4ZUTA 6FABL 5DDHA 4I3RH 3G08A 4AEFA 2VDRH 1U3JA 2VZSA 4Z7QE 4Y2DD 3RVUC 3QNXB 4GW5B 3CZJA 5D7JD 5ILTL 4DKEL 1XAUA 2NQCA 3A6BL 3NABH 2B7DT 4Z7WE 3Q6GL 4B53A 3BKMH 1JK8A 1NBZB 4RGMB 1CTNA 3DTXB 4E0RB 5IJVB 3T0VA 5E6ID 5B39G 2H9GB 1AGBB 3UTPD 2EKSA 5SX5H 4NGHL 4F7TA 2C4FT 3O4LD 4PJ7A 1KBGH 5ITFB 4WI8A 6CGTA 1MJ7L 1KLGA 2W0PA 2XTJD 2DN7A 3T77A 3RZCD 5FGSA 4LLVA 1CFSB 1CGSH 3CDGA 3DMMB 1PFCA 3TO4A 2HLAB 1BBDL 1OY3B 3RPKA 2ITDB 3MYJA 1WCBB 5I66B 3TESA 1I9RH 2Z91B 1CR9H 3MRPB 5IIEB 3EO9L 5L9DL 1OD7A 3ZE1E 4O2CB 3T8XB 1EJOL 4U1HB 3HMWH 5L2KD 1KN4H 3BZ4B 3SO5A 1A3QA 5DJZA 2QEJA 1FRGH 3PV7A 4M7LL 4PJ5A 5A2FA 4XP1H 3ROLB 3VFWB 2VXUL 5D72H 4AG4H 5I75C 1MWAL 1RIUH 4FQ2H 2ZCHH 5DD1L 3BUYA 5I1AA 3QIUC 3BXNA 3OJDB 4X98B 1U3HC 3DO7A 3SGEI 1RU9H 4WFED 4JJ5A 3EKCA 3OV6A 3DUSA 2Y36L 1XGUA 2X1QA 4L5FL 3WMSA 4M6NH 4BYHA 2DLGA 2AQ2A 4AL8L 3MMEA 5D96C 2Y9RT 1QFWL 3GHEH 3QRGL 4K3HA 5BOPA 5E6YA 2PYFB 4J1UA 4KUZH 5D5ME 2D3VA 2MFNA 1R24B 1U3YA 4FABL 4XNUL 4PYGA 1EK3A 3RX5A 1BQUA 1CQYA 1TVBB 1LD9B 4GRMA 1OWRM 4KMLB 4OAWB 2ARJQ 4NQXA 1OP3K 4L8CB 1BD2E 4HKBB 5BZDB 3OAZK 4YHNB 2CIKB 1DEDA 2LU7A 1N59A 3IDMB 2EYTA 5D7SL 4JEGB 3RRQA 2XTLA 3BN9C 2ICEA 3I2CH 4P4KA 4F7EB 1TJHL 4F2MB 1WQVT 3RWCB 5DD3H 3T1WA 3DYOA 5JOPD 1NUFA 1RZ8A 3BE1H 4JPIA 4EDXA 5IV2B 4TUJB 1QPPA 3MJ7A 3ARWA 1ZVHA 3PWPA 3H3KA 4PIRF 4JR9H 3L5IA 2BOCB 4ONGL 4P2QD 4DGYL 1G7IA 4D3CL 3HE7D 2FHBA 2JIXA 3Q1SL 4WO4B 3ARRA 1EHXA 2NLJB 3MUHL 1MIEL 3C6LA 1IGTB 4YXLL 3SE4A 43CAA 4K3JL 3HI5L 3MJ9A 1JPFB 5MEQA 4BK4A 3SGDI 1J8HA 3CH1B 4ODVH 2XWBB 5J13C 3WNPA 2VQTA 5HYSB 3QDJE 2A74B 1ITCA 1ZLUK 3PL6D 4BKLB 4YIQB 1RUQH 1Q9LB 1KENL 2VDML 5E9DB 3TBYA 4PRHD 4D9QD 1ZSDB 3V5KA 4IOIB 3S96A 1X4XA 5H37G 1IAOA 1JRHH 1WIUA 4MS8C 3L3JB 1FNGB 5EU3A 4I77H 3MV8A 2C7UB 2OTWB 2DMKA 1TTGA 3O3AB 3W5NA 5D2NA 4UNUA 1RUKL 1ZS8B 1S9YB 1UKSA 2F54D 2NNAA 5FCUL 3JZ7A 3FFCD 2YKLL 3QPXL 4OF8A 2XG5A 4L3ED 2IANA 4U1KA 5ETUA 2KL6A 4UOW0 1J86A 3MRKA 5EU7C 3W9DA 4NM4L 3QUMH 4BSJA 2WLYA 4QY8B 5FYLL 5A2IH 5HHQB 5GRWA 3PHQB 2HFFB 3UTSB 3OHXA 4QT5A 3N06B 3NFSL 4GQPH 3KJ6L 4F3FA 2WWMD 1G1CA 4UIMB 1F8TH 4HDIA 3I50H 3D39D 3QCTH 4XHQA 3MRCA 1S3KH 2GKIA 4FP8H 5DRNA 5HHNA 5SWZD 3FL7A 4Z8FL 4OM1H 1JN6B 3QDGB 3BP6A 4K3GA 3GGWA 4EQ3A 2GJZA 3NIGE 5H37H 3HZYB 3MUJA 3VWJC 3DX7B 4KKNA 5HGBA 4WI4A 2JCCB 4HC1A 3RBGA 1SQ2N 1NCAL 2RFXA 1C16A 4KTYA 1EPFA 4WW2F 4X4MA 1IAKA 4I9WD 2E6JA 4HEME 1JUFB 3D2UA 4K8RH 3TFKD 5TE7H 2BY0A 4OLWH 3BDYL 1DJSA 4W6YB 1KPRA 5DHVB 2CDFB 3NVQA 4U6XB 2YD5A 3MLRH 3T3MF 4LLWA 2F8XC 5T3ZH 3BQUB 5EUOB 1E4KA 1EMTL 3ULUF 1N8ZB 5DI8B 2YA0A 1WT5C 1T5WB 1A7QL 3FQXB 3GSUA 2XTJC 1G7PB 5LCVL 5J1AA 5D1XB 1OCWL 1T66D 1J0JA 1QKZL 3RZCC 3E3QC 1F4HA 5HGDA 4I18A 3JWOH 4LCWE 4TVPE 3CCHB 4OCRL 2N7BA 4LAQH 3RBSA 2D9QB 1JPTL 4X4ZA 3ES6B 1I7UA 5K9KA 4Q9RL 1J5OL 3STLB 3QCVH 4MD5B 4NHUB 2A77H 2HAZA 4WV1B 3LQMA 5GGTL 2R1YB 4J12A 4PGDA 3T0ED 2MCPH 4B7LA 3G5YB 1J1PL 3DBXB 4NZJA 4XNZC 3L3KA 1E27B 1FO0A 4R8WL 4XNQB 4HBQA 2Z9TA 5HGAA 3C5ZD 5GZNC 3VFVB 1LNUB 5C7XL 5ACMA 4IEFB 2BCKA 3HMXH 1F11A 5SWSB 4GAGL 4KRPD 4M6OH 1M71A 5EBMA 2OP4H 1B6UA 4Q6IA 5GRJL 3P11L 5I9QB 1BMGA 3CUPA 3GI8L 5E2UL 4K71C 3G5XB 5J4MA 4YHKH 4HWBL 1VESA 4A2LA 4P5TD 3SKOB 4OV5A 1X5AA 1RJZB 4JO3H 4G6KH 4XCFL 4FMFA 1T2QH 3PWLA 1PYWA 4OZGE 5BJTA 1M1SA 4JGMA 5EZLA 3ARDC 1G9MC 2Z8WC 1FV1B 5C0FB 5EO1A 4JZJC 3U1SL 4LVOB 5FDYA 1HXMA 1XCQA 2XY2A 5F1IB 3IVKB 3S3JA 2R2HB 4QHNB 3EYFA 1YQVH 4HXBL 3K3QA 4ZAKD 5IROC 3RA7H 3W2DL 3IDGB 2Y7QB 1NC2A 3AY4C 5CEYA 3CLEL 3GJFB 2E7HA 1ZKAA 2D31B 3PGFH 5C2UB 1KF9B 4M43L 5D5MA 4LGRB 4P23D 1G9NL 1DQDH 1OSPH 3IS1X 3T3PF 3HE7C 1SEQH 5GJTH 1VGEH 2QSVA 1A14L 3P9LA 1VGKA 2WP3O 4C57C 3QIWB 3MV9A 3ARYA 4EIGB 3D85A 3KPMA 3OKYA 1P7QB 3B6SB 4HXAH 4EOWL 4LMQI 3L3HB 1S9VA 5CINH 5ERWA 5EZJA 4LPWA 4YFDB 3WIFA 3N9GL 4FZEL 2WLZA 4FXLA 2APBA 4FFYH 1T21A 3Q48A 3GMNA 2KQNA 4KAQL 2ZP0T 2ZUSA 1JYVA 5T33H 2E3VA 2FD6L 5D1ZA 5F9OH 5TGBA 5DZOA 5F9AC 4KV5E 4UIKH 3PV6B 3OG4B 4ZOBA 5T1MB 4N0CC 5F21B 1HHIA 4GMTL 5EZIL 4WGVB 2OI9C 4NP4L 4Z0BH 2AGJL 3O3EA 2F74B 4M5ZH 1DLHA 2GY7B 4KK5D 5DUBB 3QG6B 3SDDA 3FB6B 2IPUG 4OCXL 2EYSA 3O6FD 4HUWA 4LLYB 3NA4A 3QDJA 1FVCA 1IKNA 4RIRA 4LEOB 2DAVA 4RAHA 4K23L 1MJ8L 1HILB 1NC4D 2DIBA 4YFLF 3BZFA 1A4JB 1NGXA 5CILL 1S5HB 1GIGH 1RHHB 4NN7B 1UZ8B 3PQYB 3F12A 3S37X 1Y0LA 1OAQL 5FHBL 1FFPB 3GZKA 4TRPL 2Z4QB 5DEZA 3ARED 43C9A 5DC4B 1D6VL 5FYJU 3MRMB 3EYSL 4DZ8B 3MRQA 1ZHBB 3DGCR 5E4IA 4J4PA 4H25B 1UZ6E 3O45B 4X4XA 4N8VG 1H3PH 3IDJA 4LMQE 1KNOB 2HJLA 2BNUA 5K9JH 1XR9A 3E6FB 5JHDA 1V7MH 2A38A 5FM8A 3UC0H 3VWKC 4E5XA 3GIZL 3CVHH 1PGRB 1NL0L 3JTTA 3TFKC 3GDBA 2A0LD 4MHHG 4A2MA 3V9FA 3U9PL 1EO5A 4LNRB 5H35B 2BK8A 5D1QA 3NN8B 1EA9C 1FZOA 3VXMB 3EYOB 3S36X 4UOW1 2BNQD 2HT2D 1JV5A 4FQ1H 3WEXB 1HHGB 1ULVA 3ZSTA 3KYMA 4UDUB 4Z6AT 4OGXH 4O5LH 5JZ7C 1R3LA 1XGRB 3WN5C 3EOAA 2XKNB 1ZV5A 1JZ3A 2E7LC 3ULVF 2CLZA 3CLFL 1Z9LA 4PGBB 4OLZH 1QQDB 5E2VL 4Q2ZB 4YH6A 3U30B 5IHZB 1TZGL 1Q9OB 4F7PA 1INEL 4HJ0C 4U3XA 5I19H 4NO5B 3MLXL 4HJJH 3RVTD 2PCPA 4PRPE 5E9DE 3OKKB 1OSZB 2FHCA 1FAKT 3O2WH 3MSPA 1XF2A 1CE1H 3BVNA 2VZUA 1YNKH 4X7TA 4YDJA 3SGJC 3T0EC 1G7JA 2NY6B 3FQTA 4J8RA 2HTKD 3QCUH 1KJVB 2FX8L 3DUHA 3V6FA 4OFYA 3RDTD 3GSXB 1UYWL 1NGZB 1JNLL 1ZXQA 4MJID 4X99A 5IFHH 5LGHL 5MERB 5BZWA 4LCWA 3EGSB 4ELMA 1YA5A 2QQKL 5TQ2L 4IRSC 5EBGA 4GO6B 3U7YL 1YMHA 1T0NA 1RVFH 5GS0C 2NX5B 4KRPC 1XGQA 4ONHB 4AZ8A 4KJYA 3W81A 5B21A 5ICZB 1NUGA 2EDWA 4KI5D 4R4ND 4O02H 5KVGH 4ZO9A 4PY8I 4F8TA 4NT6B 2Y6SC 1AXIB 2IH1A 5EN2A 3L5XH 4P5TC 3UTSE 5DRXB 2AJ3A 1XR8A 1PJ9A 2NY3D 3MRFB 4M1DH 3C8DA 3HUJB 5EO9B 4PR5B 4JO1L 2PYED 1U58A 5ABDE 4HCRL 4K9EL 1GAFL 3TBWB 3QDGE 5ACLA 1H3TA 2VDKL 1S9KC 3L7FA 1SY6H 1ZK9A 3CSPA 2NY0B 5DUPH 3ZO0A 2D0HA 3NCJH 1I8MA 2IPTL 2JCCE 2VXVL 4JN2A 5GS2H 1CICD 4ESKA 1OGTA 1R5WB 3IDIB 5KG9B 4D9RD 1WEJH 4OJFH 3TT1H 2YRPA 4NHCH 1RZKC 2LFGA 3ULUL 4WY7H 3VH8G 4Q7DA 1LEGA 5CJBA 4RRPA 3DSNA 4CU8A 1RZFH 5HDBE 2EDDA 2R1WA 2WMPA 5JIHA 4GRLD 3M1BB 4L8BA 4NQDB 3OKOB 3TLRA 4P23C 5ITBL 3NFPB 4Y4FC 3QP3A 5EUOE 5JDSB 1N0XH 2EH7H 2YR3A 4JPWH 4OFDA 4PJXB 1D5ZA 5L8LB 5C0IB 4TTDD 2X4QB 5ICXB 3ZDXE 4M02A 3PF2A 4RAVB 3TT3H 1IGML 2JF1A 3P4NB 3F62A 1BEYH 1ES0B 4P2OA 1O0VA 3V8CA 2JELH 5HDLA 3AFLA 5JIKA 5EB9A 3MFFB 2ESVB 4NJAH 5D5MF 1JJUA 2GW5A 5FYLD 4FS0A 4WI7A 1XGTB 3RVWD 3QNXA 4W4OA 4ODUB 5CZVH 4NQSB 5TQ0L 1E6JH 2KKQA 1NBZA 1HCFX 3DTXA 4E0RA 3GB7B 5IJVA 5FA4B 2AJYH 1AGBA 3FQRB 2IQ9L 1U8JB 1II4E 2X1PA 3ZHDA 3P0GB 5ITFA 1P4IH 1Q9KA 4JLRB 3QPQC 4JN1H 3ARBD 2BMKB 4PG9B 1CFSA 1U8LA 1HNFA 2XZAL 5SWSE 5F1SA 3DMMA 4NQEB 2HLAA 4EI6B 4KWUA 2ITDA 1SMOA 1WCBA 5I66A 1U8NB 5GGSB 4CMMB 4DVRH 5A1AA 3MRPA 2QLVB 3SKNB 2XNAA 4O2CA 3T8XA 4U1HA 5HJ3B 5FKAB 1FNLA 1AJ7H 2Y06L 4JQXC 4XAWH 4Z76B 1OAYL 5C0CB 4K94L 4R90H 3TA3B 1EHLH 3GO1L 2QADC 3ROLA 3VFWA 5KSAC 1F3DJ 4X80L 4CRPA 5IP4A 4WU5B 1BJ1J 3G6DL 4HUMB 3OJDA 4X98A 1Q38A 2HKFH 3WFEH 3MLWH 3TPUB 4YXHL 1QO3B 2MMXA 5DGQA 4KMTH 2A0LC 3VD4A 5IEHA 1NMCB 4LU5L 3SBWC 1FIEA 1X5LA 4R2GD 5J3HD 5EBLB 2AJZB 3ZKND 2PYFA 2VR4A 3DX9B 1R24A 2HT2C 4PTUB 1AQKL 3U4BH 1ZHKA 3RFZC 5JW3H 3UCRA 4O9HL 4DCQB 1TVBA 1LD9A 1FJ1B 4WFGD 5E8DH 3B43A 5FYJH 4L8CA 4HKBA 2IMMA 5BZDA 2C1OB 3PDGA 4YHNA 2CIKA 5DVKA 1HI6B 3IDMA 3LKOB 2OLDA 2VQ1B 4LQFL 1ADQH 1WFUA 4X6DB 1CDBA 1PLGL 3ZYIA 4F7EA 2Q8BL 1WWWX 3VFOA 4F2MA 3RWCA 2R23B 1MLBB 1DN0B 2I9TB 1T20B 2N7AA 1JZ4A 3F58L 3S34H 3MJ9L 1BF8A 3OAUH 4BUGA 4TUJA 1OTSD 2BVQB 5JW4M 1TQBB 2BSRB 4BFBD 1BZ9A 1MHHB 2BOCA 3NH7L 1Q0YL 2YHGA 5GISL 2LABA 3BHBA 5EOQH 2WBJD 4WO4A 4MZ2A 2NLJA 1IGTA 4XP6L 3WFDL 1JPFA 4PJGA 4EDWL 5LXGL 4WUUD 3CH1A 2XWBA 5HYSA 5DF0A 1ROWA 2A74A 4HGMA 1IGFL 2ADIB 3OSKA 2XZCH 2X4UA 1N2RB 4BKLA 4YIQA 3TZVD 1A7BA 1Q9LA 2Q7YB 1PG7H 2J88H 4KI5C 2CIIA 4R4NC 5E9DA 3MLUH 4HIJB 1C1EH 3EO1B 4IOIA 3PQYE 3QIUB 1U3HB 1YNTB 3L3JA 1V3MA 1FNGA 1WSST 4Y5XB 1KC5L 2C7UA 2OTWA 3K81A 1U8HA 5F89B 4ELMF 2P5WB 1ACYL 3BI9X 3O3AA 1JFQH 3KJ4C 3P77B 3HB3D 5DVMA 5BO1L 1ZS8A 4KVNH 2FIRT 1S9YA 2FEEI 4Y4HD 2CXKA 3VDAA 2DQTL 1RAMA 5CLWA 3CJJA 1BWWA 4S1SH 3MACL 4IRZH 3P4MB 4G9FD 2VLRB 2ZJSL 4QY8A 5HHQA 1KJ2H 2I5YL 1IM3B 3KXFB 1PSKL 2HFFA 3UTSA 3RWGB 1QFWM 3X11B 3MLYH 4GRLC 3MQIA 4YO0B 4ZFZA 3ZLQC 3VXME 1FLTX 1S7XB 4YK4B 5IM7B 3ULVL 2RR3A 4UIMA 2DF3A 2G2RB 3ARPA 4JREC 4TTDC 3RVXC 4LIQH 1JN6A 1LK3L 2RBLA 3QDGA 3PWUB 4I0CC 3HZYA 3HCVB 1A6PA 1WBYB 2JCCA 4XPFH 4RGOH 3BKYH 4PB9H 1OAUH 4GSDL 4ERSH 5IHBA 1ZOXA 3T4YB 4LSVL 2EEBA 4PJFB 1KCSH 2O5ZL 2BVPB 1JUFA 3OKEB 3JVGA 3T04D 3RVWC 2JK5B 4HFWB 4XB8A 1FAIH 5DHVA 2CDFA 1GHFL 4U6XA 1WBZB 2J1KA 5HHOE 2ED7A 4MD4B 5J13B 1XT5A 1F2QA 1ZHLB 1N8ZA 4GAJL 5DI8A 1ZLWK 4ZTPL 3V79C 1A7OL 4KHXL 1NLDL 2CKBH 4PS4L 1T5WA 3FQXA 2Q7NA 3X3FH 2VLKD 2NMSA 1P4BH 4DTGL 4Y16D 1KTLB 3T2NH 3KPSD 4XNMB 3A67H 2AQ3A 3D25B 3LEYL 1MVUB 3CCHA 2HT4D 2MPAL 2NX5E 4LCCB 5IWLA 1FO0L 5LGKA 1ZTXH 5IVXF 3VG0L 4HJGB 3WLWC 4TSCL 1T1XB 2C3VB 2AJUL 4P46D 3STLA 5LJYH 1JP5A 5D6DC 2Q6WB 4MD5A 3I6LD 2PXYC 4JHWH 4NHUA 4WV1A 1MCHA 5JIIA 2XKSA 4MNQB 2R1YA 4G5ZL 1RJCA 5C8JB 4QOKD 1DQMH 2UZIH 3G5YA 3HUJE 1OM3H 5E4EC 1E27A 4NC1C 4XNQA 3QBTB 2H2PD 4WFFD 4OLEA 3V0WL 3VFVA 1R0AH 1LNUA 4HQQL 1NCCH 1SEBB 5CSZB 4CKVX 4PJ9D 1KCUL 1K3IA 4I3SH 4YE4L 3QWRD 4MAYD 4LVHB 4AH2B 4UT7H 2DQJH 1RURL 4S0TD 1JRHI 3G5XA 4ALAL 3BDBA 3BP5B 4UB0L 4R2GC 4HMDA 4QTHB 4U33A 5J3HC 3SKOA 3BIAX 1RJZA 3I3BA 4PJCF 4OZ4B 4NQDE 2A83B 2OZ4A 3O41B 5AD0B 4Y5YC 2AEQL 4PJXE 3CXHK 1VACB 3O0RH 4P2RB 4GMSL 5IOPB 4AEHL 1CXHA 5GZOD 3TCLA 1FV1A 1TETL 1DQLH 4OM0L 2GFBB 4Q9BA 3K46A 4HV8B 1HSAB 5F1IA 3IVKA 2R2HA 4HIHB 1EUUA 4N0UB 4QHNA 5HI4C 3RGVD 2CO6B 5JR1L 1NAKL 4XMLL 4NRXB 1T0PB 4RMTA 4PJIF 2ESVE 1LWRA 4JRXD 1B4JH 1E4JA 4G8GD 2Y7QA 1HQ4B 1D3CA 3GJFA 1BGXH 1XCTB 2D31A 3VDBA 2D7TH 4UILH 5ECJE 4P9HH 3HLAB 2J5LC 2X10A 2ZOKB 4FMKA 5I18L 3IETA 2H32H 1KEGL 4NZTL 2WBJC 4Q9QL 5C07D 2ATPB 5GRZA 4WHTB 4LHUB 3QIWA 1KG0B 5CCKL 2XA8L 3QWOA 2HRPL 4FQPA 1XIWD 4JVWA 3L3HA 4XNZB 5CJOH 1KGCE 3HR5B 3H42L 3QEGL 1J1OL 1EGJL 4NQEE 3P3YA 3TZVC 3ULUD 4GLRH 2AVGA 5CSGA 1NCBH 2YA2A 4WIQA 3MYZA 4YX2H 3QIBB 2F53B 4NNPH 4ELKB 2BP3A 3M8OH 1DUZB 3LKNB 1G9NC 5DS8A 3PV6A 4F57H 3F7QA 4Q74A 5DHYB 3F7PC 1IE5A 1C7TA 5T1MA 4PJGF 2FLRT 5C0CE 5EIVA 2J8OA 4NN5C 2F74A 3HNSL 3PWNB 5DUBA 1I85A 3QG6A 1Z3GH 3FB6A 3H3BC 1H3WM 4NZRH 4P59L 4Y4HC 1MNUH 3QFJB 4LLYA 2CQVA 4LEOA 4DEPC 1HILA 4UQ3B 3ARDB 4MWFA 1A4JA 2G5RA 3TH2T 2FGZA 3SGKC 3LEVL 1NCWH 1S5HA 4U7MA 2E6PA 2J8HA 1RHHA 1SBBA 2PW1B 1UZ8A 3PQYA 4ZO7A 2DJSA 1FLRH 1FG9C 1FFPA 1MFBH 2Z4QA 5HPOA 3QO1B 1QBAA 3DECA 1J10A 3PHSA 3IFNH 5TF0A 2WV3A 2VZ3A 3MRMA 5KVMC 3INUL 4DZ8A 2EC9T 1ZHBA 4H25A 4TYUA 4YDVB 5MHSD 3O45A 4M7JH 3TCXA 4EEEA 2ZUQC 1KNOA 3NACH 1AE6L 4U1LB 3E6FA 2FHFA 3HC4H 4X6DE 4KY1L 3V95A 1KIUA 3CU7A 5DZLA 3ARZA 4PJ5D 4G7YL 4N0FB 1HSBB 1CFBA 2ATKB 2A6JB 4ODTL 5FHAL 4LNRA 5H35A 1E6OL 4JB9L 4RA3A 2FATH 5J57B 3NN8A 1IC4L 2PTVA 3VXMA 3EYOA 2FIKB 3WEXA 1T7WA 1HHGA 2AAVA 3UJJL 4UDUA 1IC7H 1XGRA 2AXGB 1LVEA 4R4FH 2XKNA 4KJQD 3NCFB 3FKUS 1AI1H 3S88H 3BFOA 5I1KL 2NY4B 1A8JH 2LTQC 1QQDA 4Q2ZA 5HDBF 1T04B 3EZJB 5IHZA 3FO9A 4ODHL 1Q9OA 4JFQB 2GTZB 1UVQB 3QJHB 3B83A 1F2XK 4HK3N 4HUKB 1U36A 1HIML 3ARGD 1Q9WB 4NO5A 4P46C 1YJDH 3OKKA 2M8XA 4XC3H 1OSZA 4TVPL 2W07A 4G3YH 4LASH 4P4KD 2QSQA 3UAJC 2DQEL 3CFKB 2OCFD 2FO4B 1XEDA 2DQDH 4MSWB 5I17B 3WNKA 3VMNA 1FNHA 3FB7B 1KJVA 1NMAL 5DK2B 5L7XH 2ZKHL 3RAJH 4MNGB 3GSXA 2P5WE 3ZE0E 1YEFL 4K7PH 1NGZA 3RWHB 1QBML 2V7NB 5HI5D 5MERA 1N64L 2AP2A 3EGSA 3PWPD 2VL4A 3K2MC 1YC7A 2GK0B 2EH8H 3HA0A 3ZSSA 5GSRB 2NX5A 4ONHA 2JIXD 1REIA 3RY6C 4MAYC 3GHBH 3X12B 3C6LD 4GUPB 4BM7A 4NT6A 2H26B 3H6JA 1J8HD 3HAEG 1HK6A 5DRXA 5IESH 1M6OB 4HWZB 5BOZG 4NFCA 3VWKB 3MRFA 4MA1C 1VFAB 4OLYH 5EO9A 1QRNB 2VXTH 3FQNB 4FFVD 4PR5A 1JNNH 4MXWH 5BMFL 1N6UA 5DD5L 2DLTA 1BZ7B 3TH4T 3TBWA 5D7KE 4B5EA 1V05A 2BHUA 3VXRB 4JFDB 1JZ7A 5KN5A 2R4RL 1R5WA 3MV8D 3RGVC 3GNMH 3IDIA 3HKFA 5KG9A 1FORH 3EJYD 3BSZL 4PJFE 2E27L 4PRIB 3WN5B 4LSUH 3F7VB 2UYLB 2DQIH 2HFEB 4PGCB 3H7BA 1ERNA 5E5MA 4YHZL 4XPHL 2I27N 3M1BA 2VDQH 4NQDA 3OKOA 1YUHB 4X6EB 4X4YB 3NFPA 2IAND 4OF6A 3LQZA 5JDSA 1CD1B 4L1DA 4PJXA 3ZE2F 3ORJA 2DM7A 5ALBH 5C0IA 2ZSWA 1MF2L 3IJYB 4WW2C 4K9EC 5ICXA 3IU4H 1B0RB 4IHOB 4M8QB 5CJXA 1RZ7H 3HAEH 4RAVA 4TUKH 3P4NA 5ADPH 3IF1B 2FL5B 1WZ1L 4XPTH 2BRRL 1GSMA 1XF5B 1P84J 3EYQD 1NGWB 4UQ2B 2JJWA 4NUGL 3HPLB 3O6KL 4FFZH 2VKXA 3MFFA 3QUYB 2ESVA 4NC2B 3ULUC 1WIPA 1MCCA 4X9GA 4KFZC 5HBBA 1NAMH 5FUCC 4ODUA 4NQSA 4MA7L 4L4VD 4NOBA 2YSSB 5DFTA 3UDWA 4DAGL 4IRSB 3TNMB 3GB7A 5FA4A 1AD9B 4MNQE 3QXUA 3FQRA 3KYKH 4W70A 1D5MB 3D2UD 1U8JA 1HCVA 1QNZH 4LPUA 5KTEL 2AKRB 3LKSB 3C2AL 4AQ1B 5SX5K 1PZ5B 4QRSB 4YWGH 2BMKA 3HI1B 1A3LH 4PG9A 2LU3A 4WWKD 4OD1H 5GGQL 5TF1H 3R1GH 5J6HB 3SE3A 2J4WH 5F7YC 4CDHA 4NQEA 2JKXA 4NKMB 4EI6A 1SMAA 3NZ8A 1U8NA 1JHTB 4LRNL 3SKNA 1IAMA 1W72H 2B4CL 4TVSa 5IMLB 1L4IA 1U8QB 4W6XB 5HJ3A 5FKAA 4S1RL 4Z76A 3TO4C 5FOBB 3WIHA 2I60H 5C0CA 4LSRH 1BAFH 4RX4A 1UCBL 5JORA 3QULB 5BVPH 3QUMA 1SYVB 3GMOB 4O4YL 4WCYL 3ZDYF 1KJ2B 2ORBH 3SDYH 1FGNL 3GRWH 3PWVB 4N0YL 1K6QL 4CMHC 3WFCL 4WU5A 1QYGH 4Y4FB 1RPQA 2YA1A 4PLNC 4YUEL 3FN0L 4N0UE 1WZKA 3TPUA 3GFUA 4DJMA 1QO3A 4OFIA 4GG6F 1A2YA 1H8NA 1NMBL 2PETA 3BPLC 2VITB 3CFJB 4F9LC 1WC7B 5EBLA 2G5BA 4UI2A 3E3QE 2AJZA 4KTDH 2EXYD 4PTUA 3QEHB 4N8CL 2W65B 2X9WA 2V2WB 4XVJH 4DUXA 1PQZB 1KYOK 4K94C 1ZVSB 3S4SB 4KH2A 4DCQA 4L29B 4UINL 1FJ1A 2NY2D 3IFPB 3VFUB 1P7KB 2ZZUT 3U46B 4IMLB 3QJFB 2WUCL 2C1OA 4MB4A 1A7RL 3L5WB 1HI6A 3LKOA 3WNNA 1MFCH 4UDTB 2VQ1A 3FT2B 4X6DA 2WW8A 3LKQB 3NPSB 4Z0XB 4HIIA 3QSKB 2E7BA 4FFWD 1TZHB 1MLBA 2A6IB 2R23A 1DN0A 2CUHA 1PKOA 4U49A 1T20A 2I9TA 5HSFA 3V4VL 1MRCH 2LAAA 5IW1B 4LVNB 5ADOH 2DTSA 1F58L 2F53E 2BVQA 1YYLL 2BSRA 1KTDB 4P4KC 1MHHA 4QRRB 3LVEA 2YMXH 3MBXH 2YOCA 3LHPH 5IF0B 3K8MA 1YEGH 1CQKA 1NC2D 5CGTA 3GK8L 3I3DA 3EBAA 3LMJH 5DEFB 2P47B 3Q5YA 2C3GA 5I15L 3QFJE 3OKMB 1KFAH 2ADIA 1Z6JT 1VFUA 3C6LC 2Q7YA 1BD2D 3SE4C 5ACZB 2R0WH 1J18A 2HYMA 2QADB 2VDOH 4JHAH 4GKOA 5KSAB 1VFBB 5F7LB 4WHCA 4HIJA 5E8PB 3MV9D 3D85D 3EO1A 2OYPA 2QKIB 1I9JL 2W0KA 3QIUA 3SKJL 1U3HA 1YNTA 2ENSA 2GJ6B 3SDXB 4Y5XA 3TWCL 4O2EB 5F89A 1NFDB 3I85A 4M7ZC 2P5WA 5FYKL 3ZHLA 3IRZA 5HYFA 5JOPE 4PGZA 1I4FB 1UM4L 5D1ZD 3OGCB 4P9ML 5FM5M 1B2WH 1OAZH 2BDNH 3PABB 4N0RA 1NLBL 1TTUA 1EAPB 5DVNA 3EJYC 3MRHA 2IGFL 2VLRA 3D9AH 4YZFE 2EKJA 1TNMA 3KXFA 2BHZA 5D2NC 4QYOB 1G7QB 1MWAB 3MRGB 3SDDD 1YEJH 1JF1B 3OB8A 4OSUL 3RWGA 3X11A 3E0GA 4XPGL 4S1QL 3QDJD 4YO0A 1IC5H 1T1WB 2CPCA 2R0KL 1UACH 1S7XA 5IM7A 4PRBB 1GGCL 4FQLL 5GRUH 1YC8A 2G2RA 1FSKC 1MCFA 1QFPA 1Q72L 1H3UA 4XCNB 4OFPA 3VG9C 3PWUA 1QSFB 1INDL 2O5YL 3OTTA 1IL1B 4D9QE 3HCVA 4Y8DC 3WSQL 1WBYA 3DPBA 2J8UB 3TN0A 5HYJB 1JGVH 1EJ6A 1F4WL 2KQMA 3QXDB 1MPAH 1ZLSL 3T4YA 3RY5A 2RCSL 1KACB 4PJFA 1IZJA 5E24E 2BVPA 3OKEA 1RY7B 3PE9A 4KTEL 4G8EA 5E5UB 4J4PD 2JK5A 4HFWA 4PJ8C 4ZODA 4PJXF 1FFNB 1WBZA 3MA9H 5E0QA 35C8H 4MD4A 5JHDD 4OZFG 1FE8H 3FFCE 4KVCL 3NCMA 4H88H 1AGDB 4L3EE 2FYYB 4JY5H 5CBEB 4TPRL 4X7SH 4U1MB 5ANMB 4S1DC 1LDSA 4MNGE 3VXSA 2AJVH 3BX7C 3OWEA 4G42B 2OR9L 1KTLA 1CBVL 1I9IL 1C5BL 1U41A 4FTVB 4XNMA 4GXVH 1L9NA 3D25A 1MVUA 5IVNA 3T0WA 3TIDA 2DL2A 3QHFL 3CZFB 5I1CH 4LCCA 3Q0HA 3KJ4B 1JZ5A 3O2VL 4D9LH 1T1XA 2C3VA 5IFJA 3VJ6B 1D6EB 2Q6WA 2BVYA 2I24N 4I18C 4R7DB 4NKQB 2ED8A 4MNQA 2DQHH 1CL7H 1T0MB 4N5ED 4YHMH 4KQ4H 5C8JA 4GT7A 4RWHA 3FAXA 1QRNE 1G9EA 2XIDA 3D3VB 3MNWB 2F58H 5M94B 3B5TA 1TPXC 1KXVC 2XXCB 5DHXB 2NY1B 5C0GA 1SEBA 5CSZA 2OZ4L 3C6SB 4JFDE 4LSQL 3QAZC 3DUUB 4UV4H 4Q97A 1BP3B 2DDQH 4WEMB 4OFYD 2JE8A 4PRIE 1GOHA 1OTTC 1HXYB 5DQ9B 3BP5A 3S35X 4LCWD 4QTHA 2IALA 4TVPD 4XRCB 4YPJA 3VRLF 4OZ4A 2EXYC 3H3PH 2A83A 1IGIL 4M6ML 3O41A 3PJSA 5AD0A 2DLIA 2GITB 2XY1A 4Q6IC 4EJ1C 4LSPL 3VGBA 5CZXC 1VACA 4P2RA 5IOPA 5EZOH 2X9YA 2NY2C 1V7NH 4DW2H 5GGRB 5DMGC 1QBLH 3MXWH 3GI9H 3BH9B 2EZ0D 4X5XB 1I1AC 3P2TA 4HV8A 1HSAA 2EDBA 4HIHA 4XHJC 4N0UA 3RPIB 3MRJA 1LO4L 1FHGA 1CDIA 4PBVC 4NRXA 1BX2B 2R9HD 4FFWC 4XNYH 4HG4J 4YQXL 3VXNB 1HQ4A 3EUUA 1OW0C 3WJLA 4RDQF 5FUZL 1I1FB 1UXSB 1WF5A 3KDMB 4LAJH 4TSAH 3HLAA 2V9TA 2WP3T 2ZOKA 2VXSL 1K5NB 1QLRB 4ZTOH 5KVEH 1DBAH 5HTSA 5GIRB 2AV7B 2ATPA 4GW4B 1FQ9C 2XACC 2HRLA 2PXYB 1B0GB 3TBTB 5SV4A 4WHTA 1GZQB 4LHUA 5DQDH 2PUQT 1JTPA 3MRIB 2DYPD 4QNPE 1NFKA 2R0LH 5KS9B 1JPGB 3RX7A 3T0DA 5FDWB 3HR5A 5E4EB 5DO2C 5SWQB 4Z7UB 5F6HJ 4NBYB 4BFGA 2WINB 5ID0B 2DLFH 2EDLA 5GQBA 4P2OD 3QIBA 1X3DA 2F53A 3JWNC 2VXQL 4ELKA 2CLVB 1DUZA 3LKNA 1CFVH 5DJAB 1UKTA 1ZANL 1IZKA 4PV9B 1D9KB 3HFMH 4JDZB 5DHYA 2IADB 3O6MH 1G7MB 5EU6B 4OUUA 3PWNA 1OL0A 4X6CF 2QJDA 5D1ZC 3AMLA 1NEZB 2BC4B 4Z78B 4HKZB 4QHUB 1X4YA 3QFJA 4L4TB 3N1MC 2B20A 3L6FB 3VXUB 4Y5YB 8FABB 5C0DB 1MH5B 3ARDA 1CXKA 4HBCH 5IBUB 5EIIA 2KDGA 3O3BB 4RGNB 2PW1A 1WK0A 2OR7A 5C9KA 2HT3D 2JLLA 5IB4B 1QHOA 2X9XA 1G84A 1CVRA 3DMMD 3QO1A 5IROA 2YEZB 1A6TB 5LWYH 4E41B 4M93B 2VE6B 4XPBH 5AZEH 3AY4A 5C92A 4YDVA 1NDMB 1VFMA 5EOCL 3U0WL 1T83A 4DQOH 1UJ3B 4RISH 3ZKXC 2CGRH 1NH6A 2J5LB 4U1LA 3AS1A 1FN4B 5EU5B 4I3RL 1LO5A 4LDOB 3WYRA 5DQJB 1G7HB 2VDRL 2WBJB 5T5NG 1VA9A 1X6LA 1E28B 2BY2A 1BOYA 4NKIH 4N0FA 1HSBA 2A6JA 3CDCA 3NABL 4UOJA 3BMWA 3BKML 1LO2H 2IPUK 3DO3A 4NBXB 2DM2A 4QRRE 1A3RH 5FM5O 2OBGA 5DJ6B 1GRWA 1KBGL 3NIFE 4ZSOE 4KQ3H 1DSFH 1NAMB 1GC1H 2YK1L 2FNBA 5D1QC 4CN6A 4Z7VF 4HT1H 1NGPH 4IDJH 5EUKB 1T04A 3X3GL 4JFQA 2GTZA 1CGSL 1UVQA 2FEEL 2CJUH 3QJHA 5FOJA 3V6OE 1XH3B 1OTUD 1Q9WA 3LN9A 3DARA 3OZ9H 5SX4H 3B8SA 1CR9L 1YDPB 1OT2A 1BFTA 1ED3B 1UWEH 5C0BB 4RZCB 4N5EC 3CFKA 3KLDA 3RZWA 1KN4L 2GJ6E 1QP1A 4DEPB 4F58H 2FO4A 2VH5H 3NTCL 4MSWA 4HS3B 3SDXE 5I17A 5KSUB 3FB7A 5DK2A 1FRGL 4H1LG 4MNGA 1EFQA 1NFDE 4K3DL 1MEXH 4BFIB 4XP1L 4GW1B 3RWHA 4AG4L 5D72L 2V7NA 1ETZB 1RIUL 4FQ2L 2HMID 2ZCHL 4GLRI 2GK0A 3IJHB 32C2B 5GSRA 3TNNB 1ZT7B 4JKLA 4NO3B 4WO4D 3X12A 5DWUL 1RU9L 3K80A 4GUPA 3VFRB 1RQ5A 1H3VA 4M6NL 1QUNA 3O2DH 4QRPB 2A73B 2H26A 2ZUQB 3FN3A 2EDKA 5IMKB 3GMPB 1M6OA 2V5SA 4HWZA 4UT6H 4KUZL 1EO8H 2YRZA 3VWKA 1VFAA 1QRNA 1I8LC 3IAGC 1BECA 5E9DD 1BZ7A 2R2EB 3FO0H 1UB5B 2HA1A 3PDOB 1QSFE 4QO1A 3EZ8A 1WIOA 2P45B 2EZ0C 3H9HB 1H5BC 3VXRA 2J8UE 4JFDA 5HYJE 5F9JB 4XBEH 4H1LH 2X70B 3I2CL 5FO8B 3D48R 4PRIA 3WN5A 2P44B 2GCYB 5DD3L 3F7VA 2E5EA 4KKLD 2UYLA 1PDKA 2E7LA 3MLVH 3BE1L 2F5BH 4XXCC 3LS4H 2AXJA 2HFEA 3CX2A 4PGCA 4CAGA 5FUOH 4X6EA 4X4YA 2YD3A 1YUHA 3WKMH 4OLUH 5DZNA 1KCRL 1U8KB 1CD1A 4JR9L 3T2PA 5I8EB 3BKJH 3IJYA 3SE8H 3BO8B 1B0RA 2HH0H 3MUZ1 4IHOA 4M8QA 4R96B 1LE5B 4QXGH 3UTSD 5J12B 1BZQK 3BIKB 4X7EC 3IF1A 2FL5A 5GS3A 1XF5A 4ODVL 4JHBA 1NGWA 3K0WA 4UQ2A 3HPLA 3B9KB 1KN2H 3AVEA 3QUYA 4OF3A 3QDGD 1RUQL 1Z5LB 5AZ2H 1EVTC 2ZG1A 4EUPH 1P6AB 2D2OA 1SBSH 4P2OC 2YSSA 3MFGB 4IRSA 3C09C 1JRHL 1AD9A 5JIPA 4OIBA 4HKXB 5B38B 1D5MA 4I77L 1AQDB 2AKRA 3LKSA 1KJMB 3IFLH 4NUJB 3D3VE 3H7LA 4HD9A 5FKPB 4RMRA 1PZ5A 4MQTB 4QRSA 1DP0A 4U3HA 3HI1A 2VO5A 3BQUD 4LSSH 1CFNB 1MFAL 5HHPB 4MNHB 5J6HA 2APTA 3WIHL 3EDKA 5MEPB 5ISZB 3O3DB 2V2XB 2ZPKH 2O61B 3JBG7 3LAFA 5B8CB 1HHJB 1MFEL 3QUML 5A3ID 4HAFA 5D1XD 5C6TL 1JHTA 4MQ7B 3MRLB 5IMLA 2LAGB 1U8QA 1KIRA 3R0MA 1DBBH 3DMMC 5AYUH 1CDHA 4ENED 3QWQB 5JXAH 1X5IA 1F8TL 3I50L 2YWYA 1TJIH 5CMAB 3QCTL 4UAOC 2L4OA 1S3KL 2K3TA 4FP8L 5KW9H 4OM1L 3QULA 1SYVA 1KJ2A 1JF5A 2LVEA 4YBHA 1P69B 4PJHB 3PWVA 2WK2A 1J88A 2YD4A 4NNXB 5GS1B 4PJBF 5FM4A 2AV1B 4QKXB 1RV6X 4AQOA 3UBXB 4MVBC 3TV3H 4WW2B 4K8RL 2DKSA 2EDTA 5TE7L 2VITA 3CFJA 4OLWL 4D8PB 5FB8B 1WC7A 3SJVB 2B4CC 5D93C 1BBDH 3MLRL 5T3ZL 5SWSD 4KU1A 1EZVX 4F8QA 3QEHA 2W65A 2V2WA 1PQZA 4NWUH 2D9CA 4POZC 2P8LB 3S4SA 3S98A 4L29A 4PP2A 3IFPA 3VFUA 1P7KA 3CK0H 3V6ZA 1PAMA 4IMLA 2YWZA 3QJFA 4MX7B 4ODBD 4OKVB 5E94B 3VD9A 2Q3AA 2R0ZH 4AMKH 3L5WA 3G08B 4YZFF 3WUWB 3JWOL 4UDTA 4XP9H 3FT2A 1ZGLA 2BSTB 3LKQA 4Z0XA 1JHLH 5KS9E 1BPVA 4OD2B 4KKCD 4NC1E 1TZHA 2A6IA 1KXQE 2C4FU 4Z7UE 1OTUC 1EV2E 4ORGB 3MLSH 2UY6A 5LQBH 3GBNH 5E2TH 5JO5B 2A77L 3QR2A 5J06A 1KTDA 1JWMA 1KEML 5D2LB 4F7TB 2MCPL 2FSEB 1QLFB 4GBXB 4OUOA 5IF0A 3UPRB 1IVLA 4M03A 2E7MA 1BIHA 3DI3B 3UEZA 4POYA 5EU6E 5DEFA 3FMGH 2B1AH 1FC1A 1GJIA 4RBPH 1QR4A 1EEZA 3BDXA 3HMXL 4DZBB 4L4TE 5DJ2B 2W0LA 3TO4B 3OKMA 3VXUE 3QNYB 4H0HB 4M6OL 5DTFB 4WO4C 1FPTH 1MCDA 3V6OA 3G04A 3UTQB 5C2BL 4ZUSB 5ACZA 4WFGE 2YPKB 4UTBH 1VFBA 3QIWD 4YHKL 1YEDB 5E8PA 4BH7B 4RGNE 4CMHB 1P7QD 2QKIA 2VISB 4G6KL 2GJ6A 4G6FB 3SDXA 1T2QL 1IQDB 3A6CH 3VFMB 1NFDA 4GS7C 2MKWA 4AT6B 3BPCB 3UZQA 4IDLA 4D3CH 4JFPB 1I4FA 4XP4L 2BNRB 3OGCA 4LKCB 1PY9A 5F7KC 3BXNB 1IEBA 2C26A 4NO2B 5C08B 1A6VH 1UA6H 5EBWB 4XVUC 3KYAA 1F3DH 1Z0NA 5C0EB 1NCTA 1BJ1H 1YQVL 1I3UA 4UU9B 4WWID 1MHEA 3TJHD 3RA7L 3VI4F 3REVA 1ONQB 3OKDB 4KKLC 4QYOA 1G7QA 3MRGA 1CLOH 1JF1A 3SY0B 4HS6B 4FG6D 1SYSA 4WTXA 1DQDL 2DTML 4PRBA 1OSPL 1URLA 1G6RH 3EDDA 4GRMB 2R29L 1FFOB 3QQ3B 4XCNA 1SEQL 5GJTL 1XZ0B 5GHWH 1QSFA 1VGEL 1IL1A 2PKDA 3PQYD 2BY3A 2J8UA 3DVNB 5HYJA 3U4AA 3QXDA 4HXAL 3BKCH 4WHYH 5CINL 4R0LC 4ZDHA 4FFYL 3FN9A 2OX5A 3UTZB 1N5AB 1QSEB 5T33L 1WICA 5F9OL 2XYCA 1XGYL 2VC2H 5DK3A 1PX4A 5C0BE 3EW3B 5FV2A 4KZEL 1AGDA 4UIKL 1HHKB 2FYYA 4NZUH 4G9FE 3JVGC 4U1MA 1GVIA 5ANMA 4JZNB 4Z0BL 3BJLA 1EX0A 4M5ZL 1S7WA 4JANA 3CXDH 4UMGA 4G42A 3VXMD 5D8JH 4FTVA 1WAAE 5IEKB 3QZWG 4LVEA 3CZFA 3JUZA 2ADJB 4Y5VB 4M7ZB 1DLFH 1NPUA 5A3IC 3N1PC 4HZAA 2EIBA 3VJ6A 3PXJA 1D6EA 2Y4SA 3S5LG 4QRPE 1GIGL 4R7DA 2ED9A 1H0DA 1INQB 2JB6B 4GRWH 1T0MA 4M8VA 4QHKJ 4WU7B 4XWOC 2Z35B 1BQHB 1PZUB 5IWLC 5J8OA 3O11B 3D3VA 4QNPF 3MNWA 1TVDA 5D2NB 4AIZA 4MMZC 1KB5H 2NNAB 4WV1C 4JG1L 4BQCA 5CGMA 1H3PL 1R3IH 2FGWH 4AEEA 4MXQC 3C6SA 2NY6D 2P4AB 5HY9B 1V7ML 3DUUA 4OGYH 3UC0L 4JCLA 3W9DB 2JJTA 3CVHL 1LK2B 3QI9B 4PREB 3VG9B 2MSPA 3ARQA 2DQUH 2W9DH 1HXYA 4HH8A 5DQ9A 4NPYB 2VLKE 3B2UC 1M7DB 4NSKB 4LDEB 4KKBC 5F44A 4XRCA 3N50A 1HKFA 2NX5D 3LZFH 2GITA 4FQ1L 5F1OB 2DQFB 3OBAA 3BP6B 2BSSB 4OGXL 4ZNEE 4O5LL 4KDTA 4LCYB 5GGRA 3MNZB 4N9OB 4PJ8B 1S9WB 3BH9A 3B2VH 2C1PB 4OLZL 1GOFA 3RPIA 1CLZH 4OZHF 5E5RB 1RFDH 1A9EB 1BX2A 1J1XH 4LNVA 4YGVB 5I19L 3VXNA 4LOUD 3UBXI 3GIVB 2NY0D 3MGOB 1WITA 1MHCB 4LVOC 1I1FA 3TP4A 5IQ7H 3BYTA 3P11H 3RKDD 3O2WL 4J6RH 4UT9H 1CE1L 1UXSA 3KDMA 3S7GA 3CD4A 1YNKL 3ZT7A 4WHDA 3GBLA 1QLRA 3QCUL 5GIRA 3ZZ1A 4XCFH 2AV7A 3EAKA 4GW4A 3EFDH 4LP4A 5D6DA 1K85A 2PXYA 1B0GA 1WBXB 5HGDB 3TBTA 4FQJL 5IFHL 1GZQA 2UUDH 4NQDD 3NAAH 3WHE1 3KLHD 1IKFH 3MRIA 5K33A 5KS9A 4F33B 3K74B 4YNYB 5FDWA 5ISZE 5SWQA 4Z7UA 4HLZH 1Q1JL 2WINA 4O02L 5ID0A 5KVGL 4HXBH 1AIFB 1LILA 4MJ6B 3WFBH 1BM3H 3L5XL 3VMPA 2CLVA 2VDPH 3QAZB 4PV9A 1D9KA 4JDZA 3CLEH 4M1DL 2PN5A 5E8OB 3T4AB 2CDEB 2ESVD 5EC1B 5DC9B 2IADA 5EG6C 1FZKA 1G7MA 1G0XA 5IMOB 5EU6A 25C8H 1DBMH 4DGVH 1NEZA 1SY6L 2R8SH 4Z78A 3DYMA 4HKZA 4PJHE 4QHUA 5DUPL 1RULH 3NCJL 4L4TA 3L3GA 4G43B 1ZT1B 3L6FA 4Y5YA 3L1OH 8FABA 5J7CC 3B5HA 3PP3H 1QPXA 3HPJB 4FXKB 3K1KC 5C0DA 1WEJL 1MH5A 2BXZA 4OJFL 3TJHC 3TT1L 1CT8B 1T22B 4NHCL 4NWTH 1N4XL 4WY7L 1I85C 1CL7I 4P3CH 5BW7C 4KZDH 1RZFL 3O3BA 1RUPH 4NN6B 4G6AD 1I1AB 3MZGB 5EORH 5IB4A 1A7NH 1CLCA 1B3JA 1KGCD 2ZCKH 4FG6C 4U1IB 4NQED 1N0XL 2EH7L 3O4OB 4JPWL 3T3ME 2YEZA 3HG1B 1WZLA 1A6TA 4E41A 3ULUE 4K7PY 2BXYA 3OQ3B 2VE6A 1IM9B 2DQGH 5FUCE 1NFIB 1NDMA 3D0VB 4OLXH 1CK0H 4GMTH 1BEYL 4I3GA 1UJ3A 4POUB 5EU5A 3C8KA 2JELL 1WGOA 5C0CD 1WWCA 1ZMYA 5DQJA 1G7HA 4OCXH 3TA3D 4EI5C 1NBYB 4RX4D 3ZT6A 4M7LT 3ARSA 3RX8A 3RJQB 5CZVL 1E6JL 3OMZA 1FNFA 3DSFH 3REWB 3ETBF 1U92A 2AJYL 5DJ6A 5F96H 1L6ZA 2J8UF 1OOAA 1NAMA 4JN1L 2FLBT 4YHLH 5D71L 3H8NA 4EUPB 1JE6A 1D5BB 1NGYB 1ZGLP 3RKPA 3ARFB 5EUKA 4GXUN 2D0FA 4K8RD 1JVKA 4Y2OA 3RWDB 5ESAB 4WI9A 1XH3A 4MMXC 5TGBB 3GMMB 3VXOB 1YDPA 4DVRL 4KRLB 2R2BB 1ED3A 5C0BA 1QD0A 1ZA3B 2OL3H 2VZVA 1I1YB 1KCVH 5KSUA 1AJ7L 1AGEB 2HFGH 4HS3A 4KJPC 4BQBA 2DB8A 4YR6B 4R90L 2IAMB 3SGKA 5E08H 1EHLL 4BFIA 2N4IA 4GW1A 2MCG1 3MOQA 1P7HL 1W2KT 2BNRE 1OQXA 4RIRB 1WAAA 3AS0A 5C08E 3IJHA 32C2A 1S7SB 2HKFL 3TNNA 3WFEL 4LCIH 1ZT7A 4NO3A 3MLWL 1LDPL 4KMTL 5EC2B 1TMCB 3VFRA 5K9QG 3TVMB 4NRYB 4OLVH 4Z5RA 4QRPA 1GH7A 2A73A 1JZ6A 4C83B 3P30H 5IMKA 3GMPA 1YNLH 3BPNC 1WFTA 3MV01 3UYRH 5JNYA 5L0QC 3U4BL 5JW3L 2FX9H 1Q94B 3FZUD 2R2EA 1ZLVH 4QGTA 1UB5A 5E8DL 3T3PE 3PDOA 5IB5B 5MP6H 2HJLB 5FYJL 5E7BA 5DJDB 3FQWB 4XMKH 3QIUD 5I1HH 3H9HA 1U3HD 2CMRH 3C8HA 1ADQL 3PUCA 5F9JA 3VA2C 3G6JF 4G6MH 2X70A 2Y5EA 4MAUH 4L8SC 5FO8A 4PB0H 3D6GA 2DMBA 2P5WD 4P99A 5E03A 2GCYA 5DGRA 3S34L 5I1JH 4U05A 5D1QB 3IXTB 3SCMC 5LG1A 3AM8A 1AY1L 1QSEE 3KYMB 1J12A 1U8KA 4JQVA 3KGRA 1CIUA 5I8EA 1NSNH 4ZNEA 4BK5A 2VLRD 3OXSA 5EOQL 5I8CB 3KXFD 3BO8A 1LE5A 4R96A 2CLZB 4GKZB 4PJAF 5CP3H 4KK8D 3QXWA 4P5KB 5J11C 1F3RB 3BIKA 1AR2A 4LP5A 3H0TB 4KHTH 3DWTA 3KLHC 2IH3B 3B9KA 1PD6A 2XZCL 5CJXC 5D7KD 2PCPB 4OF7A 1Z5LA 1PG7L 3ARUA 2J88L 4ZOEA 1QZ1A 2PW2B 3MRRB 1JZ8A 1G7JB 2R4SH 3IS0X 3EFFA 4J8RB 4HKXA 5B38A 5EFIB 3OJMB 2VMFA 3LPGA 5A16B 3VGFA 5JA8B 1KJMA 4NUJA 4G8IB 5FKPA 1JFQL 4ZUWB 5D2NE 5DT1H 4ELMB 4QTIH 2HG5B 4NRZB 4KVNL 1CFNA 4N68A 1CGXA 5L8JB 5HHPA 4Z7UF 4DUWA 4MNHA 5C09B 5CEXB 4HFUH 3KPOA 4F80A 5MEPA 5ISZA 4OQTA 5I2IB 4S1SL 2V2XA 1SJVA 5SX4I 4IRZL 2O61A 5B8CA 1HHJA 3W5MA 1KJ2L 3F7YA 3PG2A 2AJ3B 3MRLA 1H5BB 3BAEH 3H9SB 4MS8D 4TUOB 3U0TB 3MLYL 5T1KB 1QSZA 1DUYB 1RSFA 3KHOA 5CBAB 1JWSB 3I75A 4MYWB 5CMAA 4P3DB 1SJHB 3SDAC 5EU4B 4LIQL 3L7FB 2F8OA 4FXGB 1YN6A 3S3PA 2W9EH 4EN3C 3BRGC 2IQ9H 2XKUA 5DJYB 4PJHA 3C87A 4MNQD 3HNTL 3MLZL 4NNXA 1I8KB 1OPGH 4V1DB 5GS1A 2AV1A 4RGOL 1BFVH 3BKYL 5T3XH 4PB9L 2YD6A 2O93L 1OAUL 3ULVE 2FCBA 5H94B 4ERSL 3UBXA 1KCSL 1G6RB 1LEGB 4HCRA 1G0DA 4WW2A 3IRPX 1FP5A 5FO9B 3D18B 1U0QA 4D8PA 1DANT 1FAIL 3QH3B 5FB8A 2CRYA 3ET9F 4FQCH 5IJKC 3SJVA 2KPNA 4YHPB 5HYQB 1CF8H 1PY4A 3EJZD 5DUMH 4NKOB 4N1HB 2P8LA 2CKBL 1NMCC 4M3KB 2CD0A 5ID1B 1N3NB 2YUVA 5IFAH 4JFEB 4MX7A 5JW4R 3X3FL 4OKVA 5E94A 3T2OA 5I1IH 4JM2B 3WO4C 3WUWA 3C09B 3T2NL 1FC2D 2X4RB 3RI5K 2BSTA 3A67L 4Y2DA 1U93B 4ZFOL 4P2RD 4OD2A 4DK6A 4K8RC 1ZTXL 2NTFB 1GYAA 4ORGA 3TH3T 3B9EA 5IVXB 4JHWL 5JO5A 1YEIH 1Y18A 3FOMB 5D7IB 1CIDA 5D2LA 2FB4H 2FSEA 2UZIL 1QLFA 4O00A 4GBXA 1KPUB 4LPYA 1OM3L 1Q9KB 3UPRA 1S78C 3SKMB 4D2NA 4Y7MA 4DGIH 4ACPA 4NNYB 5HPMB 1CDGA 1U8LB 4YXKH 1R0AL 1NCCL 1TQBC 4PBWD 4R6UA 3JWOC 2P24B 4DZBA 3QO0B 4ZPVB 5DJ2A 4GRWB 3QNYA 4I3SL 1J0YA 4UAOB 1ZT4B 5DTFA 4Z7OF 4AEIH 2EEDA 3GMQA 3UTQA 4DN4H 4ZUSA 4UT7L 2DQJL 4RFNC 5J56B 2YPKA 3MCLH 3STBA 2NW2B 2CRZA 3LQAL 4LHUD 4H26A 1YEDA 4XT1C 4BH7A 2XNAB 1F3JB 2RQ8A 3NZHH 5DFWH 2VISA 3FAWA 4APQB 3MJ9H 3JV0A 1LP9B 1IQDA 4PJCB 3VFMA 4HUNB 2A1WH 3HG1E 3O0RL 3SQOL 4Y89A 3FZUC 1WAAF 5GZND 4AT6A 3BPCA 3WDHA 3H9ZA 3NH7H 4F9LA 3QIBD 1JTOA 2F53D 1UWXH 4JFPA 1HDMB 2BNRA 4LKCA 5D93B 1GGTA 4NO2A 5C08A 2CRIA 4XP6H 5EBWA 4Y5XC 3DURB 2QTEA 3GEWB 1V5JA 5C0EA 3RVVC 2HTLD 4UU9A 5IEHB 1ONQA 3OKDA 3AUVA 3ABZA 1B4JL 3U36B 1A6AB 4PJIB 1BGXL 3IDNB 5TDNB 3SY0A 3QFJD 4FN0A 2D7TL 4HS6A 3OGOE 3RL2B 3WXWH 4UILL 1NKRA 2F5AH 1ZHKB 5C0RH 2CK0H 4P9HL 3J8F7 3CSGA 3ARDD 1JPST 5HGHB 1FFOA 3QQ3A 5HVWA 3KPRB 1XZ0A 2R56H 4B50A 4WW1A 3MJ8B 4KK8C 3MV9E 2RGSA 5BV7H 3DVNA 3U48A 3TYGH 1ACYH 4YK4C 1NUDA 5GS2D 3VFOB 2LV4A 4IIQC 5CJOL 3RI5F 3RNKA 1Q8MA 3DGGB 3UP1A 1NCBL 5CKAA 2CK2A 3UTZA 1N5AA 3TN0C 4CW1A 1QSEA 5D70H 4YX2L 4NNPL 1BZ9B 1BBJB 3M8OL 5J1SC 2D0GA 5HXMA 1HHKA 4LSDA 4F57L 3BHBB 3EOYG 2DJ4A 3LV3B 5EWIH 4HC1H 4WGWB 2VDNH 1FNAA 4M62H 4JZNA 2FJFB 2AEIT 4PJGB 1A02N 4XP5H 2DMCA 2W1NA 3CMGA 5DLMH 1Z3GL 3DROB 4DVBA 1MNUL 4A6YH 4I2XB 4NQVB 1MIMH 1I3VA 2Q20A 2X42A 5E2WL 5IEKA 2X4UB 2ADJA 2IQAB 4Y5VA 4TULH 2CIIB 4GS7B 4HH9B 1VEMA 2QSTA 4G80B 3WNMA 4UV7H 1NCWL 2UZXB 2NY4D 1J11A 2JB6A 1INQA 1FLRL 2B1HH 1HE7A 4WU7A 4UBDD 2Z35A 1BQHA 4N0CD 5DC0A 1MFBL 1U8HB 4LCCC 4CJ0A 4ODSL 1NBVL 1CTOA 5ALCH 3IFNL 3O11A 3EO0B 2AXFA 2MKLC 4ZTPH 4WI3A 4KI1A 3HI6H 3BRFA 1JZ2A 1A64A 5JHDE 4MXVF 3NACL 1BFSA 5HY9A 2E9IA 5JMRA 3MGTB 3HC4L 5KANG 1LK2A 3QI9A 1X5HA 4PREA 3WD5H 4MD0B 4NPYA 2A6DB 2D03H 2V2TB 1M7DA 4LBEB 4NSKA 4ZFZB 3GSOA 2FATL 5C0JB 3HNVH 3ILPB 2R1XB 3N1FC 5DEGB 4DFHA 3EJZC 3CFBB 2DQFA 4PJHF 4LVHC 2BSSA 2NPLX 3D0LB 4R0LB 1WWAX 1IC7L 1S7QB 4LCYA 3VD3A 3MNZA 3V7AE 4PJ8A 1KPVB 3VGDA 3QEUB 1S9WA 3FO2B 1C5CH 1AI1L 2C1PA 3S88L 3VWKD 1FIGL 4H8WH 1QRND 4GQ9H 3M45A 1A9EA 1H8SA 2V9RA 3HRPA 4FQXC 4X9BA 1NCDL 4YGVA 1KCUH 4PD4J 3GIVA 1YJDL 3IAPA 4QCIB 3MGOA 1MHCA 4XC3L 5CIPH 4DN3H 2VAAB 3VXRD 4JFDD 4G3YL 4LASL 1K8DB 5I1EH 5JZ7D 4PRID 3ALPA 2DQDL 3K4ZA 2EE9A 5L7XL 3RAJL 3WJLC 3Q6FB 1A6WH 4PD4K 4OD3H 1WBXA 4I13B 2UWEF 4K7PL 2QQNH 4ELME 1TVHA 4EIZC 2DJUA 4BFEA 1TETH 2EH8L 5C09E 4F33A 2IBGA 2OL3B 3LH2H 4YNYA 4HJ0D 4RA0C 1GOGA 1PKQB 1CI5A 1IBGH 3N85H 3F65A 5D2LF 4XMLH 1AIFA 4MJ6A 4YEEA 4HPOH 1AC0A 4TSBL 3H9SE 5E00B 1LGVA 5E8OA 3T4AA 2CDEA 4OLYL 2EDRA 3QUYD 5EC1A 1P6FA 1UM6H 1JNNL 4MXWL 4X8JB 5IMOA 3E1F1 3D5OF 3QIBC 5HI3C 3QQ4B 4I1NB 4IRSD 3ZKSD 5DJXB 5GS0D 3MV7B 4JM4L 4YBLB 4G43A 1AFVH 4V1DE 1ZT1A 1SJEB 3GNML 2YPVH 1FFRA 2HTLC 3HPJA 4FXKA 1WISA 4BZ2H 2XA8H 1CT8A 1T22A 4LSUL 2HVKB 3FHAA 2Y6SD 5E8EB 2C3XA 3QEGH 2FX7H 1I1AA 2VDQL 3NOIA 3CIQA 2PR4H 3U0PB 4U1IA 3SKUD 1G1YA 2ADFH 4MCZB 3HG1A 3TCLB 3MRNB 5ALBL 4S2SB 4PBXA 1IM9A 1OW0A 3IU4L 1RZ7L 1NFIA 3D0VA 1OF2B 4NYLB 4JFEE 4XBPB 5HD8C 5ADPL 2BHYA 4XNXH 2YPLB 4XPTL 3HNSH 1BQLH 3DV6B 3MOBH 4FFZL 1NBYA 2QQLH 3TO2B 1VENA 4WNQA 2GUOB 4XVTH 3GSNH 1MY5A 5F3BB 1NAML 3CFCH 3WUZA 1T83C 5KBNC 2MNUA 4Y4FD 5IVXE 3REWA 4H20H 1TZIB 4XTRD 5JXEA 3S37H 3IETB 5D7IE 2E9WA 3P4OA 3KYKL 5F9DC 1QOKA 4L9DA 5CGYD 2BVEA 1QNZL 2FBOJ 1IFHH 3L5HA 4O2FA 5BS0B 1PG7W 3QWOB 4YWGL 3UTOA 4EUPA 1D5BA 1NGYA 1A3LL 3INUH 3LKRB 4OD1L 3ARFA 3ZKMC 1A22B 1P9MA 5TF1L 3R1GL 4N5UA 1RUML 4GRWE 2VWEC 2J4WL 1QBBA 2DQCH 3RWDA 4FHBD 5ESAA 2EE2A 3GMMA 3VXOA 3WXVH 2NY4C 2HKHH 5DS8B 3HS0B 4J3WA 2R2BA 1W72L 5CFHA 4TOYL 4UBDC 1ZA3A 1I1YA 3S36H 1CLYH 1AGEA 2EDHA 2OM5A 5IBTL 1EGJA 4PJCE 2QQQA 4YR6A 4LSRL 1IC4H 5DJ0B 2IAMA 1BAFL 3QPQD 3O6FA 4HK0B 4MDIB 2ORBL 3SDYL 4JPKH 3KR3H 3GRWL 4QRRD 5CEZH 2VUOA 4XZUB 1UB6B 1NCUA 4QF1A 1S7SA 4XMPH 1L7TH 4KDWA 4MWFB 4PG2A 1JPSL 3Q5TA 4X9FA 5EC2A 3B5GA 3TVMA 2HLFC 1CN4A 4NRYA 3QXVA 4GG6B 1UG9A 1U3ZA 2EC9U 2VLJB 4KXZH 4PJIE 4C83A 5JTWA 3FRPA 4KTDL 2B2XH 4RRPG 4XVJL 1MRFH 1OAXH 4EI5B 4UUJA 1GL4B 2X5PA 2XFXB 1Q94A 4J3SA 4NQCB 2QADD 1ODAA 5KSAD 4U6VH 4WDIB 1F45A 5IB5A 5JPMB 3KPRE 3V5DB 5DJDA 2KBGA 2XQBH 3CPLB 3FQWA 1K4CB 4XVSH 2GJ6D 2F19H 3P73B 1MFCL 1MCLA 4XX1E 1GPOH 3PDDA 1W8OA 5F1KC 3S97C 2CXGA 5DD6B 1MRCL 1M05B 3IXTA 1C7SA 5ADOL 3LSOB 1MAKA 3MJ6A 2W59A 4RSVA 3ZKQD 2YMXL 3MBXL 3LHPL 5I8CA 1YEGL 5C3LD 1I9EA 2OMBA 4GKZA 4PJGE 5I74C 3LMJL 4P5KA 4M00A 3RWIB 2C4XA 3UX9B 3H0TA 3FRUB 1KB9J 2IH3A 3WS6C 3FO9B 3QUXB 1J0HA 1A9BB 2ICWI 1H8OA 3C5JB 1KFAL 1QSFD 2R0WL 2VDOL 4JHAL 4ETQB 3VRJB 4KKAD 1FVEB 5HYJD 1E0OB 1KB9K 2PW2A 3MRRA 4LLQA 2XQYG 2WM0A 4OQTL 5EFIA 1U2CA 4JQIH 1MUJB 3QUYC 3KG5A 4P4RB 4U2ZA 4LLMA 4YDKH 5A16A 3V4PH 4G8IA 5T5FH 5IB2B 3NA9H 4ZUWA 1KULA 3F6IA 4WEUD 3KAAA 4HIXH 2HG5A 4NRZA 5T5NF 1E4WH 5D6CB 2AEPL 3KHQA 3BPNB 1B2WL 1OAZL 1MCQA 5C09A 5CEXA 2BDNL 5L0QB 1I8LA 4PLJD 5I2IA 1IQWH 2APFA 1WZ1H 4LQ1A 5FYKE 3D9AL 3VFPA 4BZ1H 4PFEA 3QDAA 4X6BB 1YEJL 1OLLA 5B39B 1H5BA 3H9SA 4TUOA 3SO3B 3U0TA 4FTVD 5T1KA 4XXDB 1DUYA 1IC5L 1W0VB 3RUGB 5CBAA 1JWSA 1UACL 4L8SB 1N7MH 2VN4A 3EOBB 5GRUL 1T89A 4P3DA 1SJHA 3WV0A 4DAGH 3IU3B 2A9MH 3V4UH 4I4WB 5EU4A 1QLEH 3MO1B 2MQCA 4FXGA 1VEOA 4XXCA 5C71A 1CICA 5DJYA 3SCMB 4K2UL 3FFDA 2VUYA 1JYNA 1I8KA 4YDIH 4V1DA 5KN5B 1QACA 1JGVL 4M5YH 2VSCA 4BELD 5H94A 1MPAL 1JTTA 4XI5C 5DVLA 1G6RA 3D3VD 2LQRA 5FO9A 4XAKE 3D18A 3K1DA 4M7KH 3T1FB 2WSKA 3H7BB 2IJ0C 1U95B 5E5MB 2NR6D 2K9UA 3QH3A 5JW4Q 4RCAA 5J11B 2NY1D 3ILQD 3MA9L 35C8L 4YHPA 3LQZB 4XTRC 5HYQA 5BV7B 1AHWA 1FE8L 5DK0B 4H88L 4PY7B 2FJHB 3RVXD 2ZSWB 4NKOA 4ZMAT 5CGYC 4JY5L 1JI2A 4KK6D 1X5YA 3EYUH 4X7SL 2AK1H 5ID1A 1N3NA 4JFEA 1W8NA 2Q86A 2AJVL 5F97E 4JM2A 4PUBH 2X4RA 4GXVL 4U0RB 1U93A 3DOSA 4U6TA 5I1CL 4JGJA 4U2YA 2DLEA 4TN9A 5I1GH 2BSED 2NTFA 3I6KB 3FN0H 4D9LL 2AI0H 4HLJA 5HYSG 5IVXA 5CD5D 5K9QI 5LGJB 1DR9A 3FOMA 2DQHL 5D7IA 1CL7L 4A6YB 3NPSC 4YHML 4KQ4L 3UO1H 3VMOA 1KPUA 1UGNA 4P5MA 3SKMA 5CP7B 3F7RA 2F58L 1FH5H 1KUMA 1RIHH 4LVNC 1F42A 5CZKA 3MV11 4NNYA 2WQ8A 5HPMA 5C0AB 1L0XA 4PJEA 2P24A 3QO0A 1MCJA 1XF3B 5FGRA 3VU2A 3MV7E 4ZPVA 1CWVA 4IMKA 4MB3A 1OGAB 2DD8H 5J9PA 1ZT4A 1KCKA 4RBPK 4UV4L 3SDAB 3WLWD 2DDQL 3TF7C 5H2BB 3NZ8B 4Z7NE 2WQRA 1JGEB 1ACZA 2PXYD 4EN3B 1FYTB 2NW2A 3BEVA 4M1CC 1F3JA 4C58B 5KAQF 4APQA 2DWDB 2RAMA 1LP9A 4PJCA 3V6OC 5IR1B 5JORB 1OAKH 3QUMB 4E42B 1V7NL 2I26N 3ZE2E 4WI6A 1QBLL 4NBZB 1HDMA 3IJSB 3MXWL 3X14A 4D0CB 3GI9L 3NMEA 4LSTH 4KK9D 1DBKH 1D9KD 3OJ2C 2W38A 2YPLE 3DURA 3CVIH 1A2YB 4BQ9A 5IHUL 5GRYA 1JWUB 2VJXA 3I9GH 1IAIH 4IOSD 5EU6D 2NY5H 3JWDH 4J7RA 4XNYL 3S5LA 3U36A 3LQAC 2NW3B 2G5BB 1A6AA 1RK1B 1P5VA 4PJIA 2VR9A 3IDNA 5TDNA 1LMKA 3WO4B 3RTQB 4L4TD 1CDCA 3RL2A 3VXUD 2FR4B 1F4XH 3MCKB 4OZIF 4WJ5A 2B8OT 4UTAH 1M7IB 2H8PB 5E95B 1ZGLM 1YY9D 5HGHA 4ZTOL 2ITCB 1DBAL 1R5VB 2Q8AH 3VD7A 4ZYKB 4G6JH 3KPRA 4RGND 4M9PA 5KJRH 5K59F 3MJ8A 1D5IL 5HI4D 4ZPTB 2ZUUA 3V8OA 1NEUA 4HIIB 2R0LL 4KPHH 4E41D 3R4DA 2B0SH 4DKAA 3DGGA 5GSVB 5CUSH 3OR7B 4LEXH 2DLFL 2MQ3A 4KKAC 2VERN 1YYML 1CGVA 1BBJA 2ZSVB 4P9HC 3ME0A 3HFML 2D7PA 3LV3A 2K7QA 1SM3H 5GRXG 1OWWA 4XPGH 2CDGB 3B3IB 3O6ML 4RFNB 1TIUA 2FJFA 4U0QB 3TYFB 9CGTA 3NIDE 2VLLB 5HVFB 3DROA 4JKWA 4JDTL 4X6CB 4I2XA 4MA8H 4NQVA 3EYVB 3ZDYE 5DHVH 1INDH 4HWEH 4GKSB 4PLJC 3L3DA 1RMFH 2IQAA 2XWJB 3WE6B 4HH9A 2Z92B 4JY4B 4G80A 2RCSH 3GM0A 3RIFK 4GG6E 1UM5L 4YDLC 1CFQB 2IPKB 4ZQKB 4RMUA 3WL9B 2XG4A 3U4EB 2HWZH 2YXMA 4RWYH 1X5FA 5KSVB 3QUZC 3EO0A 5LWYL 2BERA 4KVCH 5IQ9B 5HYEA 4NQCE 4U1JB 5AZEL 1HKLH 5L6YH 4KI5F 2R15A 2UVEA 1F6AB 5C0BD 4DQOL 3BGMB 4BA8A 4HWNA 4OF5A 4RISL 2CGRL 4GXUM 3MRHB 5TH2B 3MGTA 3F6LA 1MVFA 1NDGB 2DRUA 3FJTA 1X7QB 4NKIL 4NKDB 4MD0A 1RIVH 5F7EH 2PO6C 2A6DA 2NR6C 2V2TA 4LBEA 5A2KH 4YAQB 2NY1C 2HN7B 3ILQC 4O51B 1O7VA 2R69H 4FNLH 4PTTB 5C0JA 1MCSA 4YHYB 3ILPA 2R1XA 4IIQB 2JJTC 5DEGA 3CFBA 1A3RL 3MA7B 3S3SA 3ALWA 1X6NA 3D0LA 3QT2A 4R0LA 1C08B 4OI9A 4KK6C 1S7QA 4OCYH 4QRPD 1A1OB 5ELIA 1KPVA 3FT4A 4KQ3L 3QEUA 3GSNB 3TN0B 1QVOB 1DSFL 1GC1L 2GIYA 3FO2A 3VFGH 3H9YA 4QXTB 5D9SB 4HT1L 5KOMC 3WNLA 4IDJL 3LD8C 1EBPA 4Z7VB 4G8EB 1T1ZB 4KDTC 2CJUL 2YS4A 4Z18A 3OKNB 4NZDA 2ERJB 3AAZB 3OZ9L 1UADC 4QCIA 3VFSB 2BJMH 1AO7B 5CD5C 4QWWC 2VAAA 4HHAB 3DHMA 1UWEL 3EHBC 3KPLB 2Q87A 1MQ8A 4MQSB 1K8DA 3CFDB 4F58L 2VH5L 1EEUA 3VXSB 2F9BT 3MXVH 4JM2F 2DIAA 3C60C 3Q6FA 1MEXL 4M1GH 5JA9A 4LSPH 2XN9B 1GGBH 3TIDB 2VAJA 3GJFH 5LVEA 4HPYH 3ESVF 3O81A 2OL3A 2UUDK 4NO0B 1LHZA 1P1ZB 4FA8A 5IFJB 1PKQA 1S5IH 2X1XR 2X4OB 5D7IF 3O2DL 1YJDC 3UJTH 4PGEA 4Y8AA 1CZ8L 3UAJD 3RIFF 5E00A 4UT6L 1EO8L 4FZ8L 3B9KD 2OJZH 1M7XA 3RUGE 5FUZH 5C9JB 5MENB 4X8JA 3WCYA 4PJEF 4U7KA 5F1NB 3HRZB 2BOBB 3C08L 3FO0L 3KPQB 5EH1A 4GRWF 3AS2A 1NCNA 2P7TB 3QQ4A 4YJZL 5C0GB 4KK9C 5DJXA 3UZEA 3MV7A 5HGGS 1D9KC 5I30H 2Z31B 1AKJB 1SJEA 4BSWB 4XBEL 2DI9A 3AXLB 2UZYB 2QHRH 2HVKA 4ZOAA 3FHQA 5E8EA 2IALB 3PP3K 5CWSB 2AQ1A 1AR1C 3MLVL 2F5BL 1LP9F 4WUKL 1FL5B 1T2JA 3LS4L 1DTUA 4KGJA 12E8H 5FUOL 2J6EH 3PJSB 3WKML 2WZPD 3U0PA 2JJSC 4OLUL 5ISZD 5BVJB 4FQXB 3CVHB 4WEBH 4MCZA 1YY9C 3MRNA 5C70A 1MJJB 2DI8A 3BKJL 4DKFH 4S2SA 4W68A 3SE8L 5M7QA 2HH0L 4RGNC 2GSGB 5F7NC 4QXGL 1OF2A 4NYLA 4XBPA 1F6FB 3ZDZF 1OARH 2YPLA 3MRJB 5E1AB 2ZOLB 2ICWJ 3LN5B 1BFOB 1IC1A 1Z2KA 3DV6A 2XZQH 4FQIL 1KN2L 3TO2A 4M93C 2GUOA 4ZFGH 5HYIA 5F3BA 4HF5H 1HZHL 4UNTA 5AZ2L 4BUHA 1CGWA 1OP9A 1SBSL 1UJ3C 3HZVB 5CKGA 2ENYA 1TZIA 3AU1B 1Z0MA 4RAUB 3BD3A 1WFOA 3VFNB 1EVUA 4PLOB 5I76B 4N8VB 2IBZY 1KIQB 3VE0B 5BS0A 1XIWA 4LKXB 3SJVD 4NCC2 2E7CA 1MFDH 2QSCH 3LKPB 4LSSL 3LKRA 5C0AE 5FCSH 2XRAH 2E6QA 4R3SB 5TFSH 3QXTA 5F71A 5F8QC 1OGAE 2ZPKL 2XPGB 4C56B 4R7NB 2L0DA 5CJQH 4Q9CA 5KANI 2AABH 4YLQT 1FYTE 3AC0A 4PGJA 4U7SA 2G60H 2I07B 3HS0A 5BRZB 4LDLB 3WO3B 5EA0H 4PRDB 1DBBL 2NYYC 5AYUL 5IVZB 5FEBA 5JXAL 1MSPA 4DWHA 1TJIL 3VRLE 2AS5M 4OUUB 5DJ0A 5KW9L 4L8DB 4XGZB 2P49B 5BW7A 4HK0A 4MDIA 1TITA 1X4ZA 5E99L 2BX5A 2XA3A 4WVRA 1W0WB 3L3IB 1X44A 4XZUA 1UB6A 4YC2C 4GBXD 4R26L 2YK1H 4PJBB 1VHPA 2NXYC 2PTTB 5TJWK 1FDLH 5EIIB 3TV3L 3ULSB 5JUEH 3QG7H 4GG6A 5F72S 3TJEH 3X3GH 2FRGP 2VLJA 5EO0B 1T7YA 4Q0XH 1DQJA 4M4RA 3NCYS 3TO4D 1JL8A 2V17H 2UY7A 5IW6A 1N6QH 1FL6B 4EI5A 4NWUL 2XFXA 4NQCA 3QQ9C 1IARB 1UFUA 4PLKD 5GGVH 4WDIA 2XV6B 1RHFA 1F13A 1Z9MA 3CK0L 3C2SA 4LF3B 4ZXBC 5JPMA 2VQUA 3NTCH 3V5DA 1HYSC 4X5LA 4N90E 4OFVA 1FNSH 3KYOB 4L9LA 2R0ZL 3CPLA 4PPTA 4AMKL 1K4CA 4G6FD 5T3ZE 1ZLVK 1LO5B 4K3DH 3P73A 3QDMB 4XP9L 1FFQA 1VADB 1JHLL 3MBEC 4KUCF 1L0YA 4I0KA 3QHZH 5DD6A 2BNRD 2VABA 3MLSL 1M05A 2YXFA 5LQBL 5DWUH 3GBNL 3WKNA 5C08D 5E2TL 3L7EA 4ZFFB 3LSOA 2DKUA 2CKNA 3CFIC 2FECI 3BRDA 3VI3F 3GKZA 2WUBH 3AB0B 3RIAK 4IRJC 4FQQA 4JKMA 1DVFC 2YD7A 3SE9H 2APVA 3MREB 3RNQB 3AM8C 3FMGL 2B1AL 3RWIA 2ADGA 2PTUA 1NBQA 3FRUA 4IS6A 1QEWB 3QUXA 4X6CE 4JQVC 1A9BA 1KELL 3ARGA 3QQNA 3C5JA 3DXAB 3VH8B 1JNJA 1PEWA 3MRBB 4MCYA 1FPTL 5CAYB 1CU4H 4Y4KC 5J12C 4ETYA 4ETQA 4UTBL 3VRJA 1RZJH 4QRQB 1FVEA 2AERT 1JGLH 5CSBA 2DICA 1D5XA 3RU8H 2WNGA 3B9KC 1IEAB 2ARWA 1MUJA 2H1PH 3A6CL 4P4RA 3ZTNH 3OKLB 5IB2A 1KCRH 1FYHB 2EDXA 4YGAB 1QSED 3NCEB 1U8OB 5D6CA 1OP5H 1A6UH 5DMIH 1A6VL 1ZHNB 1EAJA 1UA6L 5F3HB 1EHNA 3CMOH 3NCCB 3LEXA 3BZEB 2VLRE 4JO4H 2P48B 1NJ9A 4JG0H 5F6HI 3KXFE 5KZCB 3K2UH 5H8DA 2P8MB 4X6BA 1CLOL 1LO0H 1VFOA 5B39A 1TENA 4XXDA 5DJCB 3WFZA 1W0VA 3RUGA 4PRPB 4L8SA 4OCNC 3EOBA 1G6RL 1TLKA 5B8CC 3IU3A 4I4WA 1ND0B 3MO1A 3P9WB 1UJTA 5GHWL 3HE6B 3SCMA 3P0YH 3V52L 4M9OA 4RDQG 4JCMA 4Z7NF 2JB5H 3BKCL 4Z7VE 1NQBA 1MFAH 3PGDB 4KXZI 3RWEB 1S9XB 3T1FA 5DD0H 5I74B 1O7SA 3WIHH 1U95A 5JHLH 3JSSA 5GS1C 3UROR 4W81A 1AO7E 3CFEB 4CVXB 2P46B 1MFEH 2VC2L 3V0AC 4U3CA 1F4YH 5DK0A 3SQBA 5C6TH 4PY7A 2FJHA 2NXZB 3QI9D 3U7WH 4AM0B 4LRIA 2IFFH 2I9LB 4NZUL 5AWNH 5C86A 3RIAF 3VXSE 3W11C 4BJLA 1YEEH 4ISVA 5MI0B 2EXWD 5TE4H 3D1MC 3I3EA 4OF0A 2ICES 1E4XH 2GAZB 2XN9E 3CXDL 4ZS6C 3BEWB 5D8JL 1MRDH 1FBIH 1NGQH 2D4FA 1YEKH 3FB5B 4CNIB 1MJUH 4L4VA 2NY7H 1DLFL 5E8NB 5KVDH 5IT2H 4PJ8D 3I6KA 1EH9A 1DE4B 1MHPH 2FBJL 1P84K 7FABH 3ULVD 5LGJA 2EIZB 2BVOB 4Y2DC 4A6YA 5D7JC 5CEZE 5K9OB 4Z9KB 4S1DD 3EOTH 4HUXB 1HWHB 5MENE 1A6ZA 5CP7A 4WWKA 5E6IC 3IGAB 1V3JA 2Y07H 5HHMB 3UJIH 4RFOL 1KB5L 1WJ3A 5C0AA 1R3IL 2FGWL 3OJVC 1XF3A 1MCPH 4NDMB 4GBXC 4OGYL 1OGAA 4XCYB 3SDAA 5I6XC 5H2BA 1UENA 1JGEA 1IGCH 3VGEA 2DQUL 2X4PB 2W9DL 4EN3A 1FYTA 3D69B 4Y19B 4MHHI 3GSWB 1F02I 3RWFA 1KIRB 1UT9A 5B4MD 5IB1B 1HYRC 3D87B 1MREH 2OR8A 1OB1B 5KSBB 2DWDA 3LZFL 1RZGB 1FGVH 3NIDF 4Z7WA 1BHGA 1FVDB 5IR1A 2GSIA 4P2RE 3PXHA 1F5WA 4MLIA 4LFHD 4PJ7F 5HDQH 4PLKC 1L7IH 4E42A 1KEMH 4HGKC 3TEUA 2G75B 4IBLT 5IJKA 2VRAA 3IJSA 4D0CA 3BPOB 2VIRB 1AXSB 3B2VL 3UYOD 7CGTA 3I6GA 1CD0A 1AP2A 1HINH 2DBJA 1UWXK 4F7CB 1CLZL 2RJMA 3AMKA 2BRQA 1RFDL 4LLDB 1JWUA 1VB9A 1OTTD 4R97C 1K4DB 4OZHB 1J1XL 4HMEA 2NW3A 1RK1A 4W4NA 3MGAA 4K3EH 1CGYA 3RTQA 5IQ7L 1A0QL 1VCAA 5C2BH 4J6RL 4UT9L 2FR4A 3TPKA 2LU4A 4OBRA 3MCKA 1N0LA 3AS3A 1M7IA 2H8PA 1JI1A 5CZXD 1EEYB 1FL3B 4DOHB 4PP2B 2ITCA 5DMGD 1R5VA 3V6ZB 3OG6B 4ZYKA 3EFDL 3SDCB 1YN7B 4EXPX 5F7WC 3U83A 1H3GA 3KVQA 3NCYP 1I1AD 3ZL4H 3BD4A 3FTGB 4XHJD 1ZGLB 3NAAL 5CIPA 4ZPTA 1MCIA 1IKFL 1QFUH 3HG1D 4XP4H 2OXHA 2HJKA 1UWGH 2CKBB 1F90H 1IM9D 1RUAH 5GSVA 4C56E 1JYWA 1BOGB 1MCKA 1JHKL 3OR7A 1D7FA 2ZG2A 1U42A 5C3TA 3WFBL 5IG7A 1BM3L 2ZSVA 1JWMB 5BRZE 3BJ91 15C8H 2VDPL 1A5FH 4ZFOB 4MJ2A 1UH2A 5SV3A 2CDGA 3B3IA 1MCNA 4U4BA 5I8OH 2DTMH 3TYFA 25C8L 1V8HA 1DBML 2VLLA 1EEZB 2R29H 4JPVH 4DGVL 2R8SL 5JXED 1FG2B 4I0PB 2O5XH 4OT1H 4X6CA 1RULL 3MX0A 5F9WC 3EYVA 1BD2A 2QBWA 4GKNA 1MCEA 3L1OL 4GKSA