3N0UA

Crystal structure of tm1821, the 8-oxoguanine dna glycosylase of thermotoga maritima
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
209
structure length
209
Chain Sequence
HHMEELLKELERIREEAKPLVEQRFEEFKRLGEEGTEEDLFCELSFCVLTANWSAEGGIRAQKEIGKGFVHLPLEELAEKLREVGHRYPQKRAEFIVENRKLLGKLKNLVKGDPFQSREFLVRNAKGIGWKEASHFLRNTGVEDLAILDKHVLRLMKRHGLIQEIPKGWSKKRYLYVEEILRKVAEAFGESPGKFDLYLWYLVKGKVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable N-glycosylase/DNA lyase
publication title Crystal structure of Tm1821, the 8-oxoguanine DNA glycosylase of Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase, lyase
total genus 86
structure length 209
sequence length 209
chains with identical sequence B, C
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2010-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3n0uA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3n0uA01
3IH7A 1KG4A 1MPGA 2NOHA 4EA4A 4PIIA 5DPKA 3G0QA 2OFIA 4B21A 1ORNA 3S6IA 1DIZA 4EVVA 1XQPA 1WEFA 1XQOA 5CHZA 5KN9A 4B23A 4EW0A 1KEAA 1YQKA 4B24A 4YPRA 2JG6A 4EW4A 4E9HA 2YG8A 3FHGA 1PU7A 5AN4A 3CWAA 1N3AA 3CW7A 3CVSA 4YPHA 1YQMA 4AI5A 1NKUA 3CWUA 3OGDA 3I0XA 1XG7A 4UOBA 3OH9A 1KQJA 4E9FA 4OFAA 4EJYA 1M3QA 4EA5A 1M3HA 1PU6A 1LWWA 1FN7A 2JHJA 3N5NX 1LWVA 1KO9A 1YQLA 2I5WA 3D4VA 4UNFA 2OFKA 4YOQA 1LMZA 4E9EA 1VRLA 2ABKA 4AIAA 3CWTA 2NOIA 1RRQA 4OFHA 4OFEA 1LWYA 1MUDA 1KG5A 3FHFA 3KTUA 3IHOA 3I0WA 2H56A 2NOEA 4B22A 1YQRA 2XHIA 1N39A 1PVSA 2YG9A 3F10A 1MUYA 1PU8A 1WEIA 4EJZA 5KN8A 4E9GA 2NOFA 3N0UA 1WEGA 3FSPA 1P59A 3CVTA 1NGNA 1KG7A 3F0ZA 3KNTA 1P7MA 1KG2A 1KG3A 2NOLA 1RRSA 2NOZA 4DK9A 1HU0A 4AI4A 1EBMA 3CWSA 1N3CA 2NOBA 1ORPA 1MUNA 2JHNA 3OH6A 4HSBA 1KG6A
chains in the Genus database with same CATH superfamily
3IH7A 4E7IA 1KG4A 1MPGA 2NOHA 3OYJA 4EA4A 3OS0A 3L2UA 4PIIA 5DPKA 3G0QA 2OFIA 4B21A 1ORNA 3S6IA 1DIZA 4EVVA 4E7LA 1XQPA 1WEFA 1XQOA 5CHZA 3NNQA 5KN9A 4B23A 4EW0A 1KEAA 3LCNA 4BE1A 3L2RA 4E7HA 5FRNA 1YQKA 3OYFA 4BE0A 3OYMA 4B24A 4YPRA 2JG6A 4EW4A 4E9HA 2YG8A 3FHGA 4ZTJA 1PU7A 5AN4A 3OYKA 3CWAA 1N3AA 3CW7A 3OYNA 3CVSA 4YPHA 1YQMA 3OYGA 4AI5A 1NKUA 3OS1A 4BDYA 3CWUA 3OGDA 3I0XA 1XG7A 4UOBA 3OH9A 1KQJA 4E9FA 4OFAA 4EJYA 1M3QA 4EA5A 1M3HA 3OYIA 1PU6A 1LWWA 3OYDA 1FN7A 4IKFA 3OYLA 3VW4A 4BACA 2JHJA 3N5NX 1LWVA 1KO9A 1YQLA 2I5WA 3D4VA 4UNFA 2OFKA 1U84A 4BE2A 4YOQA 5FRMA 1LMZA 4E9EA 1VRLA 2ABKA 4AIAA 3S3NA 3CWTA 4NZGA 2NOIA 3OY9A 4ZTFA 4OFHA 1RRQA 4OFEA 1LWYA 2W03A 1MUDA 1KG5A 4E7JA 3FHFA 3KTUA 3L2VA 3IHOA 3OYEA 3I0WA 2H56A 2NOEA 4B22A 1YQRA 2XHIA 3OYAA 1PVSA 2YG9A 3F10A 1N39A 1MUYA 1PU8A 1WEIA 4EJZA 5KN8A 3S3OA 3OS2A 4E9GA 2NOFA 3S3MA 3OYHA 3N0UA 3L2QA 1WEGA 3FSPA 4E7KA 1P59A 3CVTA 1NGNA 1KG7A 3OYBA 3F0ZA 3KNTA 1P7MA 1KG2A 3R2XC 2JPSA 1KG3A 2NOLA 1RRSA 2NOZA 4DK9A 3L2WA 1HU0A 4AI4A 1EBMA 3CWSA 1N3CA 2NOBA 1ORPA 2V75A 1MUNA 4BDZA 2JHNA 3OYCA 3OH6A 4HSBA 1KG6A 5FROA 2W04A
chains in the Genus database with same CATH topology
3IH7A 1KG4A 1MPGA 2NOHA 4EA4A 4PIIA 5DPKA 3G0QA 2OFIA 4B21A 1ORNA 3S6IA 1DIZA 4EVVA 1XQPA 1WEFA 1XQOA 5CHZA 5KN9A 4B23A 4EW0A 1KEAA 1YQKA 4B24A 4YPRA 2JG6A 4EW4A 4E9HA 2YG8A 3FHGA 1PU7A 5AN4A 3CWAA 1N3AA 3CW7A 3CVSA 4YPHA 1YQMA 4AI5A 1NKUA 3CWUA 3OGDA 3I0XA 1XG7A 4UOBA 3OH9A 1KQJA 4E9FA 4OFAA 4EJYA 1M3QA 4EA5A 1M3HA 1PU6A 1LWWA 1FN7A 2JHJA 3N5NX 1LWVA 1KO9A 1YQLA 2I5WA 3D4VA 4UNFA 2OFKA 4YOQA 1LMZA 4E9EA 1VRLA 2ABKA 4AIAA 3CWTA 2NOIA 1RRQA 4OFHA 4OFEA 1LWYA 1MUDA 1KG5A 3FHFA 3KTUA 3IHOA 3I0WA 2H56A 2NOEA 4B22A 1YQRA 2XHIA 1N39A 1PVSA 2YG9A 3F10A 1MUYA 1PU8A 1WEIA 4EJZA 5KN8A 4E9GA 2NOFA 3N0UA 1WEGA 3FSPA 1P59A 3CVTA 1NGNA 1KG7A 3F0ZA 3KNTA 1P7MA 1KG2A 1KG3A 2NOLA 1RRSA 2NOZA 4DK9A 1HU0A 4AI4A 1EBMA 3CWSA 1N3CA 2NOBA 1ORPA 1MUNA 2JHNA 3OH6A 4HSBA 1KG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH7 A;  1KG4 A;  1MPG A;  2NOH A;  4EA4 A;  4PII A;  5DPK A;  3G0Q A;  2OFI A;  4B21 A;  1ORN A;  3S6I A;  1DIZ A;  4EVV A;  1XQP A;  1WEF A;  1XQO A;  5CHZ A;  5KN9 A;  4B23 A;  4EW0 A;  1KEA A;  1YQK A;  4B24 A;  4YPR A;  2JG6 A;  4EW4 A;  4E9H A;  2YG8 A;  3FHG A;  1PU7 A;  5AN4 A;  3CWA A;  1N3A A;  3CW7 A;  3CVS A;  4YPH A;  1YQM A;  4AI5 A;  1NKU A;  3CWU A;  3OGD A;  3I0X A;  1XG7 A;  4UOB A;  3OH9 A;  1KQJ A;  4E9F A;  4OFA A;  4EJY A;  1M3Q A;  4EA5 A;  1M3H A;  1PU6 A;  1LWW A;  1FN7 A;  2JHJ A;  3N5N X;  1LWV A;  1KO9 A;  1YQL A;  2I5W A;  3D4V A;  4UNF A;  2OFK A;  4YOQ A;  1LMZ A;  4E9E A;  1VRL A;  2ABK A;  4AIA A;  3CWT A;  2NOI A;  1RRQ A;  4OFH A;  4OFE A;  1LWY A;  1MUD A;  1KG5 A;  3FHF A;  3KTU A;  3IHO A;  3I0W A;  2H56 A;  2NOE A;  4B22 A;  1YQR A;  2XHI A;  1N39 A;  1PVS A;  2YG9 A;  3F10 A;  1MUY A;  1PU8 A;  1WEI A;  4EJZ A;  5KN8 A;  4E9G A;  2NOF A;  3N0U A;  1WEG A;  3FSP A;  1P59 A;  3CVT A;  1NGN A;  1KG7 A;  3F0Z A;  3KNT A;  1P7M A;  1KG2 A;  1KG3 A;  2NOL A;  1RRS A;  2NOZ A;  4DK9 A;  1HU0 A;  4AI4 A;  1EBM A;  3CWS A;  1N3C A;  2NOB A;  1ORP A;  1MUN A;  2JHN A;  3OH6 A;  4HSB A;  1KG6 A; 
#chains in the Genus database with same CATH topology
 3IH7 A;  4E7I A;  1KG4 A;  1MPG A;  2NOH A;  3OYJ A;  4EA4 A;  3OS0 A;  3L2U A;  4PII A;  5DPK A;  3G0Q A;  2OFI A;  4B21 A;  1ORN A;  3S6I A;  1DIZ A;  4EVV A;  4E7L A;  1XQP A;  1WEF A;  1XQO A;  5CHZ A;  3NNQ A;  5KN9 A;  4B23 A;  4EW0 A;  1KEA A;  3LCN A;  4BE1 A;  3L2R A;  4E7H A;  5FRN A;  1YQK A;  3OYF A;  4BE0 A;  3OYM A;  4B24 A;  4YPR A;  2JG6 A;  4EW4 A;  4E9H A;  2YG8 A;  3FHG A;  4ZTJ A;  1PU7 A;  5AN4 A;  3OYK A;  3CWA A;  1N3A A;  3CW7 A;  3OYN A;  3CVS A;  4YPH A;  1YQM A;  3OYG A;  4AI5 A;  1NKU A;  3OS1 A;  4BDY A;  3CWU A;  3OGD A;  3I0X A;  1XG7 A;  4UOB A;  3OH9 A;  1KQJ A;  4E9F A;  4OFA A;  4EJY A;  1M3Q A;  4EA5 A;  1M3H A;  3OYI A;  1PU6 A;  1LWW A;  3OYD A;  1FN7 A;  4IKF A;  3OYL A;  3VW4 A;  4BAC A;  2JHJ A;  3N5N X;  1LWV A;  1KO9 A;  1YQL A;  2I5W A;  3D4V A;  4UNF A;  2OFK A;  1U84 A;  4BE2 A;  4YOQ A;  5FRM A;  1LMZ A;  4E9E A;  1VRL A;  2ABK A;  4AIA A;  3S3N A;  3CWT A;  4NZG A;  2NOI A;  3OY9 A;  4ZTF A;  4OFH A;  1RRQ A;  4OFE A;  1LWY A;  2W03 A;  1MUD A;  1KG5 A;  4E7J A;  3FHF A;  3KTU A;  3L2V A;  3IHO A;  3OYE A;  3I0W A;  2H56 A;  2NOE A;  4B22 A;  1YQR A;  2XHI A;  3OYA A;  1PVS A;  2YG9 A;  3F10 A;  1N39 A;  1MUY A;  1PU8 A;  1WEI A;  4EJZ A;  5KN8 A;  3S3O A;  3OS2 A;  4E9G A;  2NOF A;  3S3M A;  3OYH A;  3N0U A;  3L2Q A;  1WEG A;  3FSP A;  4E7K A;  1P59 A;  3CVT A;  1NGN A;  1KG7 A;  3OYB A;  3F0Z A;  3KNT A;  1P7M A;  1KG2 A;  3R2X C;  2JPS A;  1KG3 A;  2NOL A;  1RRS A;  2NOZ A;  4DK9 A;  3L2W A;  1HU0 A;  4AI4 A;  1EBM A;  3CWS A;  1N3C A;  2NOB A;  1ORP A;  2V75 A;  1MUN A;  4BDZ A;  2JHN A;  3OYC A;  3OH6 A;  4HSB A;  1KG6 A;  5FRO A;  2W04 A; 
#chains in the Genus database with same CATH homology
 3IH7 A;  1KG4 A;  1MPG A;  2NOH A;  4EA4 A;  4PII A;  5DPK A;  3G0Q A;  2OFI A;  4B21 A;  1ORN A;  3S6I A;  1DIZ A;  4EVV A;  1XQP A;  1WEF A;  1XQO A;  5CHZ A;  5KN9 A;  4B23 A;  4EW0 A;  1KEA A;  1YQK A;  4B24 A;  4YPR A;  2JG6 A;  4EW4 A;  4E9H A;  2YG8 A;  3FHG A;  1PU7 A;  5AN4 A;  3CWA A;  1N3A A;  3CW7 A;  3CVS A;  4YPH A;  1YQM A;  4AI5 A;  1NKU A;  3CWU A;  3OGD A;  3I0X A;  1XG7 A;  4UOB A;  3OH9 A;  1KQJ A;  4E9F A;  4OFA A;  4EJY A;  1M3Q A;  4EA5 A;  1M3H A;  1PU6 A;  1LWW A;  1FN7 A;  2JHJ A;  3N5N X;  1LWV A;  1KO9 A;  1YQL A;  2I5W A;  3D4V A;  4UNF A;  2OFK A;  4YOQ A;  1LMZ A;  4E9E A;  1VRL A;  2ABK A;  4AIA A;  3CWT A;  2NOI A;  1RRQ A;  4OFH A;  4OFE A;  1LWY A;  1MUD A;  1KG5 A;  3FHF A;  3KTU A;  3IHO A;  3I0W A;  2H56 A;  2NOE A;  4B22 A;  1YQR A;  2XHI A;  1N39 A;  1PVS A;  2YG9 A;  3F10 A;  1MUY A;  1PU8 A;  1WEI A;  4EJZ A;  5KN8 A;  4E9G A;  2NOF A;  3N0U A;  1WEG A;  3FSP A;  1P59 A;  3CVT A;  1NGN A;  1KG7 A;  3F0Z A;  3KNT A;  1P7M A;  1KG2 A;  1KG3 A;  2NOL A;  1RRS A;  2NOZ A;  4DK9 A;  1HU0 A;  4AI4 A;  1EBM A;  3CWS A;  1N3C A;  2NOB A;  1ORP A;  1MUN A;  2JHN A;  3OH6 A;  4HSB A;  1KG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...