3N0UA

Crystal structure of tm1821, the 8-oxoguanine dna glycosylase of thermotoga maritima
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
209
structure length
209
Chain Sequence
HHMEELLKELERIREEAKPLVEQRFEEFKRLGEEGTEEDLFCELSFCVLTANWSAEGGIRAQKEIGKGFVHLPLEELAEKLREVGHRYPQKRAEFIVENRKLLGKLKNLVKGDPFQSREFLVRNAKGIGWKEASHFLRNTGVEDLAILDKHVLRLMKRHGLIQEIPKGWSKKRYLYVEEILRKVAEAFGESPGKFDLYLWYLVKGKVDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable N-glycosylase/DNA lyase
publication title Crystal structure of Tm1821, the 8-oxoguanine DNA glycosylase of Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Hydrolase, lyase
total genus 86
structure length 209
sequence length 209
chains with identical sequence B, C
ec nomenclature ec 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.
pdb deposition date 2010-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.30 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Hypothetical protein; domain 2 3n0uA02
1.10.1670.10 Mainly Alpha Orthogonal Bundle Endonuclease Iii, domain 2 Helix-hairpin-Helix base-excision DNA repair enzymes (C-terminal) 3n0uA01
3I0WA 4HSBA 2JHJA 2NOLA 1LWWA 1WEIA 2YG8A 3FSPA 4E9HA 1KEAA 3KNTA 2XHIA 1WEFA 2NOZA 4E9FA 4YPHA 1KG5A 1YQRA 2H56A 3IHOA 1RRSA 3FHGA 1DIZA 1RRQA 1PVSA 3FHFA 1XQOA 4E9GA 4AI4A 2OFIA 3CWSA 2I5WA 4YPRA 4PIIA 5AN4A 1YQMA 1EBMA 4OFEA 4EW4A 1VRLA 2OFKA 1KG4A 4UOBA 1LMZA 1KO9A 1LWYA 4OFAA 2NOEA 1PU7A 1NGNA 5KN9A 3IH7A 4EVVA 1YQLA 1KG3A 4B21A 2ABKA 3CW7A 4OFHA 1MUYA 3F0ZA 3OGDA 1YQKA 4B22A 2NOHA 1XQPA 1ORPA 4E9EA 3N5NX 1MUDA 4UNFA 1N39A 3G0QA 4EW0A 1ORNA 1HU0A 4EA4A 3CWTA 1MPGA 5CHZA 3CVSA 1PU8A 3OH9A 1P7MA 3CWAA 1M3HA 4EJYA 3CVTA 2NOBA 4B23A 4DK9A 3CWUA 1N3AA 2YG9A 3OH6A 3S6IA 4EJZA 3D4VA 1FN7A 4AI5A 2JG6A 1MUNA 1M3QA 5DPKA 1KG6A 4YOQA 2NOIA 1KQJA 3I0XA 1PU6A 1XG7A 2NOFA 3KTUA 1NKUA 1KG2A 4AIAA 3N0UA 4EA5A 1WEGA 1LWVA 5KN8A 1KG7A 1P59A 1N3CA 2JHNA 4B24A 3F10A
chains in the Genus database with same CATH superfamily
3I0WA 4HSBA 2JHJA 2NOLA 1LWWA 1WEIA 2YG8A 4ZTJA 3FSPA 4E7HA 4E9HA 3LCNA 1KEAA 3KNTA 3OS1A 2XHIA 3S3NA 1WEFA 2NOZA 3S3OA 4E9FA 4YPHA 1KG5A 1YQRA 2H56A 3IHOA 3OYIA 1RRSA 3FHGA 1DIZA 1RRQA 3R2XC 1PVSA 3FHFA 1XQOA 4E9GA 4AI4A 2OFIA 3CWSA 2I5WA 4YPRA 4PIIA 5AN4A 1YQMA 4IKFA 1EBMA 4OFEA 4EW4A 1VRLA 2OFKA 4BE2A 4BE1A 1KG4A 4UOBA 4ZTFA 5FRNA 1LMZA 1KO9A 1LWYA 3OYLA 4OFAA 3OYFA 4BE0A 3L2WA 3OY9A 2NOEA 3S3MA 2W04A 1PU7A 4BDYA 1NGNA 5KN9A 3IH7A 3OYKA 4E7JA 4EVVA 1YQLA 1KG3A 4B21A 4BACA 2ABKA 3CW7A 4OFHA 1MUYA 3L2VA 3F0ZA 3OGDA 1YQKA 2W03A 4B22A 2NOHA 3OYNA 1XQPA 1ORPA 4E9EA 3N5NX 3OYEA 1MUDA 4UNFA 1N39A 3G0QA 4EW0A 3OS2A 4E7IA 1ORNA 1HU0A 4EA4A 3CWTA 3OYAA 1MPGA 5CHZA 3L2QA 5FRMA 3CVSA 1PU8A 3L2UA 3OYCA 3OS0A 3OH9A 1P7MA 3CWAA 1M3HA 4EJYA 3CVTA 2NOBA 4B23A 4DK9A 3CWUA 1N3AA 2YG9A 2V75A 4BDZA 3OYJA 3OH6A 3S6IA 4EJZA 5FROA 3NNQA 3D4VA 1FN7A 3OYBA 4AI5A 2JG6A 4E7KA 1MUNA 1M3QA 4NZGA 3OYGA 3L2RA 5DPKA 1KG6A 3OYHA 4YOQA 2NOIA 1KQJA 2JPSA 3I0XA 1PU6A 1XG7A 2NOFA 3VW4A 3KTUA 1NKUA 1KG2A 1U84A 4E7LA 4AIAA 3N0UA 4EA5A 1WEGA 1LWVA 5KN8A 1KG7A 3OYDA 1P59A 3OYMA 1N3CA 2JHNA 4B24A 3F10A
chains in the Genus database with same CATH topology
3I0WA 4HSBA 2JHJA 2NOLA 1LWWA 1WEIA 2YG8A 3FSPA 4E9HA 1KEAA 3KNTA 2XHIA 1WEFA 2NOZA 4E9FA 4YPHA 1KG5A 1YQRA 2H56A 3IHOA 1RRSA 3FHGA 1DIZA 1RRQA 1PVSA 3FHFA 1XQOA 4E9GA 4AI4A 2OFIA 3CWSA 2I5WA 4YPRA 4PIIA 5AN4A 1YQMA 1EBMA 4OFEA 4EW4A 1VRLA 2OFKA 1KG4A 4UOBA 1LMZA 1KO9A 1LWYA 4OFAA 2NOEA 1PU7A 1NGNA 5KN9A 3IH7A 4EVVA 1YQLA 1KG3A 4B21A 2ABKA 3CW7A 4OFHA 1MUYA 3F0ZA 3OGDA 1YQKA 4B22A 2NOHA 1XQPA 1ORPA 4E9EA 3N5NX 1MUDA 4UNFA 1N39A 3G0QA 4EW0A 1ORNA 1HU0A 4EA4A 3CWTA 1MPGA 5CHZA 3CVSA 1PU8A 3OH9A 1P7MA 3CWAA 1M3HA 4EJYA 3CVTA 2NOBA 4B23A 4DK9A 3CWUA 1N3AA 2YG9A 3OH6A 3S6IA 4EJZA 3D4VA 1FN7A 4AI5A 2JG6A 1MUNA 1M3QA 5DPKA 1KG6A 4YOQA 2NOIA 1KQJA 3I0XA 1PU6A 1XG7A 2NOFA 3KTUA 1NKUA 1KG2A 4AIAA 3N0UA 4EA5A 1WEGA 1LWVA 5KN8A 1KG7A 1P59A 1N3CA 2JHNA 4B24A 3F10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I0W A;  4HSB A;  2JHJ A;  2NOL A;  1LWW A;  1WEI A;  2YG8 A;  3FSP A;  4E9H A;  1KEA A;  3KNT A;  2XHI A;  1WEF A;  2NOZ A;  4E9F A;  4YPH A;  1KG5 A;  1YQR A;  2H56 A;  3IHO A;  1RRS A;  3FHG A;  1DIZ A;  1RRQ A;  1PVS A;  3FHF A;  1XQO A;  4E9G A;  4AI4 A;  2OFI A;  3CWS A;  2I5W A;  4YPR A;  4PII A;  5AN4 A;  1YQM A;  1EBM A;  4OFE A;  4EW4 A;  1VRL A;  2OFK A;  1KG4 A;  4UOB A;  1LMZ A;  1KO9 A;  1LWY A;  4OFA A;  2NOE A;  1PU7 A;  1NGN A;  5KN9 A;  3IH7 A;  4EVV A;  1YQL A;  1KG3 A;  4B21 A;  2ABK A;  3CW7 A;  4OFH A;  1MUY A;  3F0Z A;  3OGD A;  1YQK A;  4B22 A;  2NOH A;  1XQP A;  1ORP A;  4E9E A;  3N5N X;  1MUD A;  4UNF A;  1N39 A;  3G0Q A;  4EW0 A;  1ORN A;  1HU0 A;  4EA4 A;  3CWT A;  1MPG A;  5CHZ A;  3CVS A;  1PU8 A;  3OH9 A;  1P7M A;  3CWA A;  1M3H A;  4EJY A;  3CVT A;  2NOB A;  4B23 A;  4DK9 A;  3CWU A;  1N3A A;  2YG9 A;  3OH6 A;  3S6I A;  4EJZ A;  3D4V A;  1FN7 A;  4AI5 A;  2JG6 A;  1MUN A;  1M3Q A;  5DPK A;  1KG6 A;  4YOQ A;  2NOI A;  1KQJ A;  3I0X A;  1PU6 A;  1XG7 A;  2NOF A;  3KTU A;  1NKU A;  1KG2 A;  4AIA A;  3N0U A;  4EA5 A;  1WEG A;  1LWV A;  5KN8 A;  1KG7 A;  1P59 A;  1N3C A;  2JHN A;  4B24 A;  3F10 A; 
#chains in the Genus database with same CATH topology
 3I0W A;  4HSB A;  2JHJ A;  2NOL A;  1LWW A;  1WEI A;  2YG8 A;  4ZTJ A;  3FSP A;  4E7H A;  4E9H A;  3LCN A;  1KEA A;  3KNT A;  3OS1 A;  2XHI A;  3S3N A;  1WEF A;  2NOZ A;  3S3O A;  4E9F A;  4YPH A;  1KG5 A;  1YQR A;  2H56 A;  3IHO A;  3OYI A;  1RRS A;  3FHG A;  1DIZ A;  1RRQ A;  3R2X C;  1PVS A;  3FHF A;  1XQO A;  4E9G A;  4AI4 A;  2OFI A;  3CWS A;  2I5W A;  4YPR A;  4PII A;  5AN4 A;  1YQM A;  4IKF A;  1EBM A;  4OFE A;  4EW4 A;  1VRL A;  2OFK A;  4BE2 A;  4BE1 A;  1KG4 A;  4UOB A;  4ZTF A;  5FRN A;  1LMZ A;  1KO9 A;  1LWY A;  3OYL A;  4OFA A;  3OYF A;  4BE0 A;  3L2W A;  3OY9 A;  2NOE A;  3S3M A;  2W04 A;  1PU7 A;  4BDY A;  1NGN A;  5KN9 A;  3IH7 A;  3OYK A;  4E7J A;  4EVV A;  1YQL A;  1KG3 A;  4B21 A;  4BAC A;  2ABK A;  3CW7 A;  4OFH A;  1MUY A;  3L2V A;  3F0Z A;  3OGD A;  1YQK A;  2W03 A;  4B22 A;  2NOH A;  3OYN A;  1XQP A;  1ORP A;  4E9E A;  3N5N X;  3OYE A;  1MUD A;  4UNF A;  1N39 A;  3G0Q A;  4EW0 A;  3OS2 A;  4E7I A;  1ORN A;  1HU0 A;  4EA4 A;  3CWT A;  3OYA A;  1MPG A;  5CHZ A;  3L2Q A;  5FRM A;  3CVS A;  1PU8 A;  3L2U A;  3OYC A;  3OS0 A;  3OH9 A;  1P7M A;  3CWA A;  1M3H A;  4EJY A;  3CVT A;  2NOB A;  4B23 A;  4DK9 A;  3CWU A;  1N3A A;  2YG9 A;  2V75 A;  4BDZ A;  3OYJ A;  3OH6 A;  3S6I A;  4EJZ A;  5FRO A;  3NNQ A;  3D4V A;  1FN7 A;  3OYB A;  4AI5 A;  2JG6 A;  4E7K A;  1MUN A;  1M3Q A;  4NZG A;  3OYG A;  3L2R A;  5DPK A;  1KG6 A;  3OYH A;  4YOQ A;  2NOI A;  1KQJ A;  2JPS A;  3I0X A;  1PU6 A;  1XG7 A;  2NOF A;  3VW4 A;  3KTU A;  1NKU A;  1KG2 A;  1U84 A;  4E7L A;  4AIA A;  3N0U A;  4EA5 A;  1WEG A;  1LWV A;  5KN8 A;  1KG7 A;  3OYD A;  1P59 A;  3OYM A;  1N3C A;  2JHN A;  4B24 A;  3F10 A; 
#chains in the Genus database with same CATH homology
 3I0W A;  4HSB A;  2JHJ A;  2NOL A;  1LWW A;  1WEI A;  2YG8 A;  3FSP A;  4E9H A;  1KEA A;  3KNT A;  2XHI A;  1WEF A;  2NOZ A;  4E9F A;  4YPH A;  1KG5 A;  1YQR A;  2H56 A;  3IHO A;  1RRS A;  3FHG A;  1DIZ A;  1RRQ A;  1PVS A;  3FHF A;  1XQO A;  4E9G A;  4AI4 A;  2OFI A;  3CWS A;  2I5W A;  4YPR A;  4PII A;  5AN4 A;  1YQM A;  1EBM A;  4OFE A;  4EW4 A;  1VRL A;  2OFK A;  1KG4 A;  4UOB A;  1LMZ A;  1KO9 A;  1LWY A;  4OFA A;  2NOE A;  1PU7 A;  1NGN A;  5KN9 A;  3IH7 A;  4EVV A;  1YQL A;  1KG3 A;  4B21 A;  2ABK A;  3CW7 A;  4OFH A;  1MUY A;  3F0Z A;  3OGD A;  1YQK A;  4B22 A;  2NOH A;  1XQP A;  1ORP A;  4E9E A;  3N5N X;  1MUD A;  4UNF A;  1N39 A;  3G0Q A;  4EW0 A;  1ORN A;  1HU0 A;  4EA4 A;  3CWT A;  1MPG A;  5CHZ A;  3CVS A;  1PU8 A;  3OH9 A;  1P7M A;  3CWA A;  1M3H A;  4EJY A;  3CVT A;  2NOB A;  4B23 A;  4DK9 A;  3CWU A;  1N3A A;  2YG9 A;  3OH6 A;  3S6I A;  4EJZ A;  3D4V A;  1FN7 A;  4AI5 A;  2JG6 A;  1MUN A;  1M3Q A;  5DPK A;  1KG6 A;  4YOQ A;  2NOI A;  1KQJ A;  3I0X A;  1PU6 A;  1XG7 A;  2NOF A;  3KTU A;  1NKU A;  1KG2 A;  4AIA A;  3N0U A;  4EA5 A;  1WEG A;  1LWV A;  5KN8 A;  1KG7 A;  1P59 A;  1N3C A;  2JHN A;  4B24 A;  3F10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...