3N0VA

Crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
280
structure length
280
Chain Sequence
DTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDRQSGRFFIRVEFRQPDDFDEAGFRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHCLNDLLYRQRIGQLGMDVVAVVSNHPDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQVIEETGAELVILARYMQVLSPELCRRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATAHYINNDLDEGPIIAQGVEVVDHSHYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a formyltetrahydrofolate deformylase (PP_0327) from PSEUDOMONAS PUTIDA KT2440 at 2.25 A resolution
rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Formyltetrahydrofolate deformylase
total genus 76
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3n0vA01
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 3n0vA02
1SC6A 1UJ6A 2QMXA 3Q0IA 4ZYYA 2DT9A 3L7OA 5IS2A 2FGCA 3DHXA 2I9SA 2PC6A 3AV3A 4IQFA 3AB4B 2CFIA 1RBQA 1C3EA 1Y7PA 4ZYVA 3W7BA 3R8XA 2FMTA 3CEDA 3P96A 3KCQA 2J0WA 3P9XA 3TUJC 2BW0A 4YFVA 4ZYWA 2CDQA 2RQKA 3N0VA 4DS3A 2P9GA 3U7JA 4X84A 3IXQA 3LOUA 2ZHOA 2LQJA 2PA3A 2JHEA 4ZYUA 1XTZA 3DA8A 1CDDA 4EW2A 5J63A 1RBMA 3DHWC 4LUBA 3DC2A 3UW1A 5T41A 1PSDA 1ZLXA 2J0XA 4ZYXA 4NV1A 5J9FA 1O8BA 2RE1A 1MEOA 4PZUA 1C2TA 3DCJA 4EW3A 4R8VA 3HHEA 3LUYA 3OFHA 1FMTA 1MEJA 1RC0A 4ZZ2A 4ZYTA 3ENQA 1YRWA 2RQMA 4YFYA 2F1FA 3O1LA 2F8MA 4PWUA 1RWUA 1CDEA 5JJBA 4QPDA 2NYIA 2GARA 2LVWA 3MWBA 4QPCA 3TQQA 3ENVA 1LK7A 4GO7X 4ZZ3A 2DTJA 5CJJA 3ENWA 4ZZ1A 4EW1A 2BLNA 4TT8A 1LKZA 2H9ZA 1LK5A 1M0SA 1RBZA 3OFFA 4GO5X 1GRCA 2QMWA 3IBWA 1MENA 3TQRA 4NMLA 4ZYZA 1GARA 4IO1A 4TTSA 3TUZC 2KO1A 5IT0A 3OFEA 3OFGA 1UJ5A 4Q12A 1KS2A 2P9EA 4GMKA 1JKXA 1S3IA 1YBAA 4S1NA 3OBIA 3TUIC 4ZZ0A 1UJ4A 3AB2B 2MDAA 1U8SA 5IT4A 4M8LA 1YGYA 5FIIA 3NRBA 3GARA 3AAWB 1ZGHA 2YWRA 3AUFA 4TS4A 3KWMA 2JOQA 2QRRA 3MTJA 1NJSA 3DDNA 1RC1A 1ZLYA 1ZPVA 1RBYA 3K5PA 3S1TA 2QSWA 3MAHA 2P9CA
chains in the Genus database with same CATH superfamily
3NATA 2WNIA 3T9NA 5GAGI 1P29A 2DGSA 3AB4B 5B4TA 4KO1S 3WGOA 3OEYA 2J3LA 4N1AA 1WU7A 2D74B 2R4TA 5AMXA 1C4AA 5FYDA 1Z2NX 3CLSD 4EJSA 1EAYC 1S0MA 2JIZA 3IMEA 3H5SA 3PW4A 3FROA 2ZYVX 4L08A 4TU9A 3OLAA 3LT4A 4JEIA 4HX2A 3R5BA 2Y1IA 1TK2A 3GIRA 4CZCA 2XIQA 2VJMA 2J67A 2YBDA 1M34B 1PDWA 3COVA 5FL3A 3D8HA 2ZTHA 4IR9A 2RBKA 2A6PA 5HSGA 4LE1A 4GC6A 3H5RA 2VJBA 3KUKA 1HTBA 4C87A 1Q3HA 4LTNA 4RPLA 2XMWA 1U1IA 3GX1A 1NQUA 3MT8A 3K57A 1UEKA 5FUWA 5TS2A 2O1WA 1MPTA 4PUOA 4ZVMA 2AZXA 3W9HA 2FG7C 4CYMA 3R0XA 1OOEA 1OPIA 1DJLA 4WLFA 4ZMSA 2BEFA 2V45A 3WX4A 5L51A 2IUYA 1N36F 1LTQA 2BAGA 1H1DA 1DAMA 3LQQA 1DJ0A 5BMVA 4QYTA 5AM0A 5DJ5A 1UKYA 2YQ5A 3PT9A 2A0XA 4IQ4A 1SKBA 5B36A 1FMLA 1E5TA 4EHBA 1GUFA 4CLUA 4FKYA 4IYQA 1M83A 3RRNA 4BVLA 3EM1A 4G89A 2AIRB 3N4WA 1X94A 4Y6LA 4QRDA 1HWLA 4BLQA 3F9IA 2IOHA 1KHHA 4XB1A 1SKWA 2XZOA 1TYDE 1JAXA 3ICLA 2FPXA 4LVOP 3ACBA 1WZNA 2FSVA 5I6DA 2MMGA 3UUFA 3CF4A 1U6KA 3TPZA 5F0WA 3CUKA 2JJ4D 1GNPA 2RH3A 3JQBC 1T9KA 2HSWA 5HFNA 4V19J 1AGXA 1RHKA 2PEBA 5K0ZA 3EVBA 1Y6JA 1AY0A 1IPHA 2LMIA 3KELA 2CVPA 1BX1A 4H0FA 2JCSA 1H5QA 3TMAA 5JXHA 4JBCA 4FGUA 3WTBA 5H8WA 3L84A 5IABA 1ULZA 4HI1A 3OLCX 2EG5A 2WAAA 1DDIA 3A6PC 2NIPA 3QUTA 3FI0A 2VDKB 2POQX 3U56A 3RVJA 2IHKA 2WF5A 4CBVA 3WGNA 1JLCA 1SUEA 5KOXA 3K0FA 4BN5A 4HDGA 1YOVA 2AGOA 4IIEA 1GITA 4M37A 1P1BA 3BSYA 3I6MA 4OQJA 2QF7A 3LDHA 4DDFA 3SDBA 3I32A 1Y7TA 4RULA 2QTCA 4GP7A 2D9PA 4TV9F 4RTMA 4FVCA 1R0AB 4EMDA 4Y2KA 1MAVA 2D5LA 4KQJA 4V0KA 5CCLA 5ETSA 3IDFA 1GXSB 2HQOA 1NRXA 1YQ9A 3ULKA 1A88A 4H4OB 2GZSA 4BRUA 1QX4A 3BPDA 5A4KA 2P6NA 3I58A 3LWBA 1CUEA 4RYLA 1YZNA 5K4GA 1AZTA 1GLGA 3V5NA 3UIEA 4YALA 5KHLB 2EZ8A 1C1HA 3BV8A 4BNHA 4KPUB 3H5TA 1QVAA 4AF7A 3FEYB 3NETA 2OVFA 1Y3IA 2KB0A 2E21A 5ALHA 3UWPA 3LL7A 5GGYA 2GHVC 1TIPA 4ILMA 1O1YA 4J49A 2FWMX 3EIFA 4AMUA 5IAJA 3T1YB 5D0RA 1OQ3A 4MW7A 1X7XA 1TZKA 2WTXA 4QPDA 4ZVQB 2IA5A 4LJSA 4QDZA 3IP6A 1ZM7A 4F1KA 4WP8A 3TOZA 2YKMB 4A92A 1U2RA 5G0RA 3O6QA 2HZVA 5EOVA 1C1CB 2GAIA 3CLRD 1LLCA 2AOXA 5CTJA 2Y8YA 1L3KA 4ARCA 1N5SA 1FSGA 3CIFA 3ICVA 2PDAA 3O8OB 2PS9A 3M8PB 3C3WA 3PJRA 2QAIA 4ZRMA 4CI0B 1C4WA 1A7JA 5HWSA 3R9XA 3DMDA 3CC7S 4MVCA 3V4OA 2YCLA 5KYYB 4CV2A 3F8TA 1UP1A 3D4PA 2CNWD 5AP9A 4WJLA 4LY9A 3ZUPA 5DIZA 2DT9A 2DNRA 4K4YA 4FDTA 1E1DA 2FC8A 4O4HA 5LP6B 3FCUB 4BO6A 2WE8A 3EQ7A 4QOEA 4BU0A 3T1VA 1V9LA 2HBQA 1MO2A 3FOFC 3GDHA 3WRXC 3GILA 3CB2A 3BFJA 5DHRA 1TKBA 3QWHA 1J49A 1Y5NA 3FFAA 2A86A 4LCEA 2B0JA 4A48A 4BFSA 5BWOA 2GA9A 4P98A 4M9CA 2QRUA 3ZDQA 3PUKA 4GU5A 3BX1A 2Z4TA 3KOZA 4QFCA 3G17A 1Q78A 1XNQF 3H6GA 4LJLA 1VRTA 3CDAA 3G0IA 4A8JB 4H7JA 4UE6A 2DVIA 3PKJA 4UM7A 1U3UA 4FDLA 1OLUB 3F7OA 4LYJA 1EXWA 1K5HA 2ALZA 1VPVA 2CQ0A 4OGGA 1C8BA 5DRYA 1YWGO 2XC9A 3BXPA 4JGGA 4AX8A 4N0QA 3F0NA 2OEMA 4L1KA 3H18A 5BSFA 3GJ6A 4PSUA 3NB0A 4H4DA 3FDZA 1U0OC 1ZAXA 4JXZA 3ZTWA 1TT7A 4XAKA 2ZT6A 3CJRA 3PGVA 3TVKA 1BY9A 2BI8A 2ZS9A 3JS9A 2MTBA 3STTA 3QM1A 4JWKA 3REGA 2GZ1A 1Y4SA 2HYIC 3M4XA 4KC5A 3OFKA 1T35A 4BX0A 3H8WA 4QQNA 3UYLA 1T8UA 4X66J 3S28A 2Z4RA 4NU6A 2HR1A 2J0XA 2M52A 1N77A 1ABEA 4PO8A 1G18A 3QIAA 1KFEB 4ED0A 4NCGA 1U0GA 2QR3A 3GDGA 5C5CA 2VOEA 3VTZA 1TL1A 3LQ1A 1D03A 3KK1B 2GTIA 3IOYA 4GICA 2PSJA 5LT5A 3KSDO 2J30A 1JXVA 5DN9A 3IERA 3GUVA 1PTJA 4LAFA 4D4GA 4WESB 2GIQA 1A6LA 1PGOA 2AUTA 1TL3A 2GASA 3SEZA 4RA6B 1CQMA 5AI9A 5KFKA 2BVZA 2VPTA 2V69A 3TAXA 4LEIA 1GUAA 1CG6A 1LPSA 2DXIA 1YZ6A 4FB4A 2O14A 1XDBA 2FV8A 3E5MA 4XDZA 2FP4A 1RC1A 2GVNA 1G6KA 4DJBA 4IFBA 4MW6A 1J99A 1R5OA 1RRVA 2KM8B 4WI1A 4Z99A 2ZI4A 1XUOA 2FMTA 1BOFA 4ND4A 4EY7A 3E9ZA 3MM7A 2JFXA 2JKYA 4RVSA 1HNXF 3CEAA 3HXLA 5F33A 4AMVA 4UEQA 1Q0QA 2Q45A 4YDXA 2GCIA 3PZBA 4R2JA 1AGYA 1S7GA 2XS7A 3GUHA 1ZITA 1UFWA 5EZYB 4MH8A 4GL4A 3BXEA 2JFBA 4D0LB 3G87A 5I8WA 1KE2A 1RVV1 1PGZA 1TEVA 3JCZA 5IWAJ 1KFDA 4FNMA 4JSTA 1ESMA 2PKEA 4BTLA 2H17A 4M8NE 2RB4A 1S12A 5SZJA 3I9FA 1WETA 3ZDBA 4GMKA 2ZXUA 5CIYA 4QBGB 1FCAA 1S6PB 4LGMA 3EIQA 4C0KA 4RKEA 3I6YA 4HXEB 1E2JA 2EG1A 4M95A 2EWMA 1JYSA 4NNOA 2QSWA 3ASUA 3ONVA 3KUEA 4DNFA 5MGNA 5CD4A 1YR3A 4N9WA 3EBOA 1T9GR 1E4VA 3P2KA 4YT8A 2YKPA 2XA1A 1WP9A 4HEJA 5ELXA 1QGZA 4P80A 4B40A 1FRNA 3R7WB 1HRKA 5KWSA 2WMNB 2H4ZA 3TOXA 1AQUA 4M76B 5BN3A 3SQOP 3M8YA 1EJ2A 3L5KA 1CVLA 3CUUA 4L72A 1A9QA 4IEEA 1JZQA 1YVUA 2Y1KA 1GG9A 3RS4A 3NG8A 4QCLA 1OYOA 4RY8A 1Y80A 2B1QA 2FX5A 4XUEA 2QLFB 1PEKE 3DQQA 4W5NA 3ILVA 2GD6A 4YMTA 2REOA 2HFSA 3ZVLA 4DB2A 3G0CA 2NVBA 1QKJA 5H9EK 5ICSA 3R9WA 1U9JA 4J9SA 3PDNA 5TQ2A 2R8RA 3G2PA 1RT2B 4F96A 3TNLA 4XIYA 3GOQA 3HSYA 1QS0A 2HCFA 1U1QA 3N2ZB 3AM1A 1VE1A 4AL7A 3NMAA 3K8WA 4PYOA 3LPMA 3Q3CA 1JUDA 4AG5A 4AJJA 1AIPA 4YB6A 3SVZA 2O2SA 1IHDA 1JPNA 2FLLA 1CQIA 3AEUA 4I4NA 2NSDA 1NSKL 1P0PA 2P65A 3B85A 1EX9A 3SYNA 4B80A 4Z0TA 2EHDA 1Q1NA 4FYYA 2EDCA 2PO4A 3D7RA 3KJZA 5A3QA 1KI7A 3GLIA 1QTMA 5C24A 1RTKA 1N2BA 5IK2A 1YBUA 4CM9A 5FAXA 5CB6A 4QIWD 2E4ZA 5E9JA 1NOIA 1VTKA 2Z9DA 4XJXA 2FSIA 1P4HA 3AJAA 4D46A 1N8KA 1DTTB 4P0TA 5IT0A 3VC7A 3R7NA 1IN6A 5K0BA 1V2HE 1WEZA 1B41A 3AF4A 3PDIB 5KYKA 3OUZA 5JZOA 4HN9A 3I9V6 4M8KA 3G9TA 4XTCS 2YVAA 1RJ9A 2WIFA 2BGMA 3TL3A 4WT7A 4OKIA 3MWDA 4R1UA 1AXQA 2UUPA 4YC7A 3W8PA 2E4AA 2OFXA 1VCOA 2OC9A 4O4JF 1QFMA 2H54A 2GBIA 4P3OA 4RKRA 3NOXA 4H2DA 5ALQA 3I9OA 4EO8A 2Q9BA 4ND7A 4QHYA 3NBMA 2C54A 4ZQIA 1FFYA 3M2TA 2VFUA 1GKYA 1O95D 3F71A 5LIRA 2RUSA 4GKKJ 1TFWA 2P4HX 1CQJB 4UQPA 4WK0B 1NJYA 3SFVA 2B51A 2GCNA 2BEUB 3KLGA 2V94A 2YIVX 4HGYA 4QPCA 4H6VA 5CLHA 2M7SA 2ZT5A 5EHNA 4DLVA 2RH4A 4GD3Q 3QLHA 5M29A 2V9WA 5CLGA 5CBKA 4R51A 3H13A 1L9KA 4KNWA 1N0HA 1RAEA 2RHDA 4F8EA 3FSGD 2X5XA 5ENVA 1GA6A 2J87A 4BMOB 2QD1A 3U3MA 1G3MA 2W4PA 3LFTA 1ESEA 2QN2A 3B89A 4QOGA 1W36C 2ZOGA 3Q8UA 1J2JA 1CY8A 3H83A 4WY8A 1LWEA 3ZIAD 1JQKA 3L0IB 1U0HA 1PYDA 3ZWNA 4XCQA 1RZRA 1KOGA 3P49B 3RU0A 4QG7A 3C8UA 5EWMB 2VL7A 4B7ZA 3N7UA 3DOLB 2JBAB 3N70A 5LXTB 1FX0A 4JHLA 4MHSA 3M83A 4FFOA 5DNAA 3OO0A 1EP2B 2AFRA 4RJKA 4ONEA 4JB3A 3HP1A 2B9EA 5ALZA 3CVUA 5ALSA 2ZRJA 1U0RA 1YDFA 5DGCA 1F0YA 1S8FA 4DLRA 2F9DA 1ZUWA 4DG9A 3NGLA 4QAQA 4P3NA 3EGXA 5FUYA 1DKQA 5KFGA 4NHOA 4ETWA 1JMTA 4IRDA 4LBYA 3KQYA 1PJLA 2QMZA 5JVDF 2GEDA 2AI2A 3HKBA 1CRPA 3SC2B 1SH7A 1XOIA 2WT4A 3D54A 3QUBA 4KFBB 5CFMA 1NHVA 1AKRA 2XMGA 5HS4A 1FJGF 3DVAB 4AC9A 3SOPA 4KGDA 1ZBQA 2WR8A 4TV8B 1QAQA 4BMSA 1I51B 5G4LA 1K8AT 3RYFA 4L78A 1QHEA 1W35A 4FHDA 4OTZA 5E8JA 3I01A 4MV1A 2O8BA 1Y1LA 3KG0A 1YR7A 4CR6A 3WI7A 3W2TA 1NVDA 1CUIA 4HCJA 4R2MA 1HE5A 3CBGA 4OHBA 2UZ1A 3GWGA 5C8YB 5EE0A 1JWAB 4KWEA 5HK4A 5KFLA 5C8DA 4YR3A 2HVEA 1YJBA 4RNHA 1R88A 3DC7A 3E5RA 4WK1A 1DHTA 5JQGF 3B6EA 1XTIA 4B3OB 4QIHA 2G1JA 4QPZA 4IICA 1V5EA 3K0KA 1ORTA 1JG7A 1M8GA 1O87A 2P2ZA 2IVMA 3ZK7A 1YQUA 3UC9A 2FGJA 2RAPA 5FD8A 5DCLA 1IKYA 3WDSA 3RHTA 5CVUA 2IOFA 4GWLA 5M2RA 1G7CB 8LDHA 5K5EA 5KQMA 3AOEC 1YO6A 1QQAA 4Y6PA 4DWJA 3I9NA 3DYAB 2IUSA 5KKAA 4DPXA 2FXVA 2BMAA 1ZZFA 3ZHQA 5LU8A 3GLRA 3OQNA 5BUZA 1RM3A 1TKZB 4YRSA 4B75A 1JHPA 3ZJVA 2QTZA 1J1IA 2PUCA 4IIJF 4F2HA 3B6IA 1IBSA 3OX4A 3K4QA 2HS0A 1NVFA 4K2HA 5IVDA 2PYIA 3VA7A 3U02A 3SMZA 1O6BA 1N33J 4ZKAA 1RT3A 3A9TA 1HO3A 2DGWA 2ODQA 4RSRA 1TT5A 1H6DA 4U6SA 5CEJA 9MHTA 1V11A 3RB0A 1VQSA 4PHGA 2GQ0A 1YA8A 4MFBA 1UKVY 3MYYA 1ZM9A 1UJMA 3MGJA 3R27A 2XCUA 4B4KA 2W2KB 1WACA 1JEJA 2HF2A 4GMFA 3R75A 4ARUA 3FYTA 1TIKA 3C3PA 2CWDA 5A5DA 2I7XA 3CURA 4JEUA 3AHHA 4DDHA 4KVFA 4WE1B 5CA1A 3AERA 1PWEA 3EMKA 5MLCV 1IBRA 4HGRA 2X9NA 3W9YA 2NXWA 2KZMA 2MTLA 3R5XA 2HMVA 2CLFB 4OH7A 1U5BA 5BN5A 3C16A 2R7AA 3LF0A 2NU9A 4X1KA 2R85A 1MROB 4BE9A 2XXAB 1FDUA 2HJSA 1TFUA 2QUZA 1YHNA 2H4YA 1HY3A 2Q5FA 3OPYA 4I9UA 3NNDA 4FKMA 4H3SA 4Y9DA 3UKOA 3LTEA 4BBZA 3HZHA 2BRUC 3HULA 4RWXA 4DPUA 4C3LA 5D8HB 3EW9A 4NKRA 1YJVA 5A3RA 4Z6KA 2MKHA 3IR5A 2M6SA 3OJOA 3NWGA 1KFSA 2C2WA 4ZTBA 1K86A 1U2GA 3KB2A 1SIZA 3P5SA 3VH2A 3O2SB 1GQSA 3LYHA 3T5PA 3IHTA 5KYWA 5SICE 4HUJA 2B4UA 4RBVA 4IR1A 3ZNOA 5KNDH 1L3UA 1ZVMA 4QR0A 1SC4A 3B8HA 4FS3A 2LVBA 1V25A 3O8QB 4E3WA 1MGPA 4LFCF 5G02A 1LPMA 3IA2A 1XKTA 3KLFA 5EEHA 1Z4LA 2R6GA 3MRTA 5AW9A 1E2GA 3RB3A 1XZDA 1UMKA 2SXLA 3V4IA 4IILA 1RAIA 1MOZA 4NYIQ 3GZNB 4E14A 1RCXB 2I9SA 4PRLA 1TD9A 5KPDA 2YUIA 4QHSA 3FCHA 5TMBA 2I6QA 2X2FA 3OLVA 4KX3A 5AQEA 4DR1J 4MHOA 5CVTA 5EJAA 4I14A 1YKFA 3L0OA 1XPOA 1G21E 5C1BA 4W1SA 5ALEA 5AM4A 3MUFA 1TU0B 4PAAA 4CDIA 5F8MA 1QK5A 4CIDA 4RD0A 1UC4B 4X1IA 5TPZA 3OR2A 1DV1A 3QXJA 5CHYA 1LS6A 2ZRKA 2OO5C 5KX5F 1YSCA 1Z8FA 3LK6A 3WIBA 2HK3A 3H19A 4FKZA 4RHUA 3KXKA 3VOTA 2Y1OA 1S0NA 2K5UA 1IJFB 3Q3IA 2J5XA 1GL3A 1FFXB 2XMTA 3BGDA 3CSSA 3W5VA 3G89A 4WGFA 3QLEA 4X8OA 3E5NA 1X7HA 2YVUA 2P8IA 1KDPA 2HA0A 4I6GA 1HYGA 2EG2A 3PX2A 2AV6A 2JJ2D 4QWCA 1NBEB 3DEJA 5A02A 4ZEWA 3DB2A 1EA5A 1CUAA 4KHZA 1DWQA 5AK6A 4TYBA 3VV2A 1Q1BA 2C5LA 1OXTA 3COWA 1PQPA 4H1TA 1K4KA 3EZ9A 4DIBA 4HDSA 1BWSA 4QNRA 4I5EA 3BIWA 1U7XA 1VRWA 1YC2A 3KB8A 4BX9A 3PIIA 4M22A 3D6MA 3VNAA 1K68A 2ZYAA 4PWYA 3DXYA 3ZBQA 4LV5B 3FMVA 4QJ3A 2HNZA 2QAJA 1EVKA 1B15A 2JVRA 3DGPB 3N2GA 4CMIA 3FBBA 1OR8A 2CXNA 1QFYA 3L07A 2Q6LA 1E7QA 2BX6A 3NBAA 3DWEX 5JEDA 3FYUC 2HYDA 3V3KA 1ORIA 1KS9A 1IOLA 4DG1A 3EDCA 2WU1A 2YQ0A 4ZVOA 1WZ2A 3W2FA 3ILOA 3O38A 5CEEA 5EP4A 4HSEA 2QP3A 5FNVF 2ASJA 4CF7A 1VQPS 1PBAA 3NAIA 2RARA 4DL4A 1HE2A 1JR2A 2P9TA 4CUJA 2QLJB 1Q86T 2PEZA 4PQGA 4MQFB 3RRMA 2F1OA 1IM4A 5FYQA 1NU4A 4R9NA 1G4AE 5EKDA 2PSEA 3MHPA 1E5XA 1GCUA 3KQHA 4QJBA 2GZ3A 3H8SA 1WD7A 4X8LA 4MVJM 4NONA 3VGVA 1SEPA 4J2HA 3AF0A 2AD9A 1OYYA 5AKXA 3UWSA 5G4DA 3GQBB 2FIUA 1DCFA 5T8KA 5AH0A 2JLWA 3A4IA 3HKWA 2HJGA 4G0OA 5DH9A 3FCAA 5LL6P 1K0VA 4ZICA 5AM3A 1AK1A 2XNDA 2Z8YA 1M1GA 3RRFA 1G8HA 3WMXA 2HDHA 3BK1A 2VPWB 6NULA 1GCGA 1A72A 5A8WB 1A1VA 3ONQA 5AHRA 3KUUA 4MR8B 3A9CA 3FWNA 4WCEQ 1OJ7A 1KJZA 1B76A 4UNIA 2ES4A 4LBZA 2NAFA 1BEUB 3OFGA 2QORA 3TXXA 4R3WA 4LMRA 1Z5ZA 3BJZA 3DI6A 1XIQA 5JAHA 1EFDN 4BQPA 3P5BA 1N1MA 3DZDA 1IUOA 2RIPA 5CR9A 1ZI9A 1KKHA 4L8VA 2XNHA 3UJPA 3LP2A 2O5EA 3I0NA 5LPNA 1KJ9A 1OQ6A 4ZCRA 3DBRA 5D1NA 1QRRA 3TBKA 2VONA 3JQEA 3QELA 1X0FA 2WY2D 5IYZB 3K0EA 2DNGA 3HVHA 1VCIA 1A5ZA 1BAPA 4LJKA 2XUGA 3ITHA 2FLNA 4U5QA 3VR4A 4LF8F 2G77B 4BO2A 4OX8A 5EHIA 3PVSA 5K9ZA 3D5TA 1CEXA 2C2HA 3ELDA 4EJMA 3ESDA 4JYBA 4OQFA 1OGYA 3HJBA 1OXKB 2HNYB 1LOUA 1TO1E 5DCUA 2YMMA 5AHKA 5HJ2A 3UCXA 3QTLA 4UE2A 3BQ1A 3SXUB 2EL7A 4BC7A 3TRGA 3TNYA 2AG5A 3IN5A 2C04A 3QA3E 3L7BA 2IX9A 2QSZA 5D5QA 5EJ6A 2DLNA 3PIOQ 4IL5A 1N0VC 1JXOA 1T6NA 2KTQA 3KTDA 3OVAA 4BP3A 5BOSB 1XLUA 1TZ2A 1FTWA 4JKIA 4B4WA 4RTKA 1CC7A 1QGDA 4OMUA 4ZT5A 1IN7A 1NH8A 3EICA 3N5CA 3IE0A 4E5VA 2L0XA 4CKXA 2JHPA 3CJ0A 4RW6A 2M2IA 4O0MA 1VE9A 4PS1A 4H6WA 3TZ6A 2QSFA 3FZEA 5GVSA 3LBAA 2HWYA 5JWRA 1XTSA 3EWNA 4EY3A 1ZH8A 2CJXB 2PCJA 2HIAA 1KQGA 4D9IA 1TM2A 4NOMA 1WXXA 4LECA 1QDUB 3L8MA 2LXFA 5DBEX 3UT5A 1VFJA 3G68A 3EG5A 2AJCA 4WX2B 1LX7A 2WM2A 3RSQA 2P3QA 3BB4A 2JI9A 4XCXA 4JXKA 1Y1RA 1EDZA 1T0UA 3RJ5A 2PT5A 1ZWLA 3L0ZA 2FEPA 4M53A 1LCIA 3FBTA 2ZIEA 4IZOA 3CCES 4M38A 5GONB 3AUSA 4INAA 3W5UA 5IUNC 3EQ2A 2BGTA 2GPSA 1J70A 3RU9A 2AZ1A 2JC1A 3ML1A 1USKA 2NLWA 2PXHA 3T5AA 3WHLA 2KLBA 1KYVA 3W2VA 3E2MA 3N75A 1GTG1 4PXEA 4F3QA 2PLNA 5EKTA 3SYTA 3WFZA 2YTCA 2G1KA 4EWLA 2UUCB 1ZSNA 3EZXA 4RFSB 2ZTSA 3NYIA 3JQDA 1CUXA 3GVPA 4G0ZA 5LP1A 1PWHA 2OMOA 5B2FA 5E1BA 4BKOA 3GIJA 1L7DA 5B53A 1G66A 3DEKA 1Z7GA 2MQPA 3VPSA 3GCZA 5AKLA 2R84A 2ZE6A 2RQMA 4RPIA 2DPMA 3BFKA 3E2EA 2QVZX 2PFKA 4RIHA 1GTZA 4KRYA 1R8XA 2HZAA 3L0YA 1IKXA 1IPFA 4EP1A 4P4UA 3JZFA 3ISZA 3ZWPA 2KW5A 3F1LA 4V1CA 4N0MA 1SU6A 5KFCA 3W34A 1A9OA 2G9QA 3KKFA 5DFAA 1IRXA 1AZWA 2WP8J 3KLIA 3IMGA 2P4QA 4OAQA 3LQYA 2W2MA 4UEJA 3ZDFA 4AZSA 3AVVA 3M1IA 5HJYA 3UWTA 1QIIA 1S3SA 3R6LA 3CSUA 3OIVA 2XGJA 2ZH7A 2I03A 3UUEA 2VOPA 3WWYA 5K8PA 4KQXA 3IE1A 4DSUA 4DCPB 2FSPA 4UATA 3UCZP 1YT5A 2XMJA 3PEYA 3COYA 3GGDA 2D8MA 1FVOA 1YCGA 1SCQA 1Z6AA 4J3NA 3HHLD 3QGHA 1I0ZA 1XRNA 3BSSA 3GRKA 4PRYA 2CL6X 1CJKB 2DWPA 4PG4A 2IZOA 4Q00A 3KKOA 4D4HA 2DY9A 2Y3YA 2VKTA 3TNFA 2ZUSA 5BXIA 2ZRIA 4TVBA 2W0SA 3LIIA 2QAGA 4P34A 4ZPCA 2XZLA 1QIFA 1K6MA 4HNSA 3VPGA 2HVZA 4NL5A 2DHSA 2G0AA 4OFBA 1MO3A 3KZOA 3ST7A 1R12A 4ED7A 3RWBA 4JI7B 3JQJA 2G4LA 5HQJA 2C3YA 4A73A 4WGGA 3TRJA 2HREA 4QR2A 2UXCJ 2NVUB 4WCVA 4BZPA 2JKZA 3LF2A 3DV2A 5MN4A 4HRYA 2L69A 1RRPA 4G25A 3FVQA 3LUKA 3FM9A 2QMEA 4IKAA 1AZSB 2F3QA 1R27B 4TWJA 3QLUC 1I1GA 1XU9A 2OBXA 2PANA 4M0LA 1B4SA 3OZAA 4CLXA 4Q0MA 3BXFA 4XI9A 2Q9AA 1L5HA 1ZAWA 1FF9A 4JQCA 2QX4A 3ILYA 4EEYA 4B9LA 4LN1A 3HVRA 1LRKA 3QVMA 3JWIA 2ONYA 4KQCA 4O4LA 1ONOA 2IUUA 5DM2A 4FD2A 3MAAC 5IDXA 4PXCA 5DCWA 4D8VA 1DTWA 5MGBA 1UP6A 1PV1A 4P74A 4JI5J 2HSDA 2R5FA 3GEMA 2RI6A 4WF9Q 2JWNA 4LF8J 2KQUA 3GLVA 1E3LA 1VG1A 1H2EA 1HNWB 3HPRA 1GV1A 4K05A 4PS0A 3INYA 4ANEA 3AF2A 3W0LB 3KNZA 2VSXA 2QYTA 5AK5A 1KMHB 1K8QA 5AOCA 4DN9A 2EBHX 2BH2A 4FHFA 1GSHA 4FT4A 1N5YA 1SJFA 1K88A 5A5VA 4PICA 4F4WA 4L7QA 4U9HS 5CVEA 3KQMA 2VJPA 4RJVA 3ZTYA 3ELHA 3HJVA 5H70A 3QRQA 4E07A 2VJCA 4YP0A 3MT7A 2ZE5A 2RJZA 1YLXA 2AK2A 2IKQA 3N0WA 3JQKA 2IY7A 5CM9C 2G4BA 1JQBA 2P4UA 1B1AA 1P7ZA 5JAPA 2IODA 3T5JA 3M9MB 4BDTA 1KN6A 1JH9A 3I6PA 3V2GA 3MDFA 2V6JA 4HH0A 3WLHA 4NLRA 2GMLA 3FHLA 3KTFA 4G1QA 4XJVA 2E9RX 4QG3A 1FYFA 4TKMA 4EI9A 2Z09A 5EHHA 1H0HB 3U3DA 4ZKDA 2LEAA 3M30A 4EX6A 1NXSA 3N01A 3AR7A 5JH7B 3HN7A 4JENA 3PW2A 4AQDA 2YHSA 2GBPA 1FTSA 1YRXA 1RT9A 1RQ0A 4WFQA 2JAUA 1OJLA 4YB5A 4XB6B 2UXCB 3GLQA 2C8KA 2L19A 2P68A 1JLSA 5LYJA 2G7ZA 3CTPA 3JSYA 4NZ6A 3PRYA 1Q16B 1XMPA 2GBLA 3P19A 5K8CA 1PZGA 1P2DA 1OILA 2SKDA 2VV5A 4BFUA 1FTNA 3LJKA 3MJDA 4TZTA 1TTHB 4WLEA 3DGVA 5G0VA 5IKMA 3L1HA 3GPIA 1KR4A 1N6NA 3DA8A 1PK9A 2LXNA 1RBAA 4RV5A 3MJFA 1JQJC 1FU7A 1JKMA 4HDMA 2XGQA 2E48A 1ZRMA 5HO4A 3I87A 1Y5MA 3MZ0A 2P1DA 2Q66A 3GCWA 1C4CA 4NYIR 3H5AA 3OEEA 1OLXA 2ORYA 3V9AA 4EKDA 4HGOA 1MUUA 4J9OA 2E5LB 2WPNA 3N2IA 3R8YA 4KR6A 1NUQA 4RJ2A 4DB4A 4LSZB 1K1QA 4KUEA 3S6EA 5EMJA 1JLEB 2R7SA 2C7GA 4KQGA 4I7FA 4F8YA 2RGNC 5JHGB 2OMLA 1X1QA 2RK4A 2P6PA 3G5MA 3ZUGA 3UK7A 4UTRA 1NXPA 3HVIA 2B82A 4FYMA 3WO0A 3P45A 2XOEA 5EG5A 3B5IA 3QVVA 3ZGOA 3VPAA 4NXMB 4ZA1A 1WEXA 2XJ4A 4U4AA 3JXEA 1RAGA 3EGNA 3QU9A 1LW0A 4YJFA 3EZ2A 2YWFA 1PJAA 5KFXA 4B8ZA 3E4CA 1KO8A 3OPKA 5CPFA 4KHPB 2GVZB 4M1EA 3J7YI 2C84A 4ZVNA 3TDMA 1YBHA 1ZONA 4ZJLA 5I7SA 2CT8A 1J8FA 3FKBA 2J9FB 5B12A 3RG8A 1NW9B 2K2WA 3AEXA 3UGKA 3U62A 5JADA 4JYMA 2MQNA 3GPLA 2HFVA 1EM6A 4URXR 5I5EA 4ZZ1A 2FWAA 1VL1A 3DDCA 3CZ9A 1LKZA 1UMDA 1QVZA 3AH8A 2Z8QA 2PPLA 2YHBA 1ZD8A 1GQYA 1EESA 4B79A 3MVEA 1RKQA 2B21A 4FHZA 1I5OB 4NZOA 1FFGA 5I01A 3RUHA 4RUHA 5MFPA 4W9RA 4L9WA 5B7WA 3T7RA 1K47A 1RJEA 2PRZA 1ULTA 5FTKA 4IYJA 2DB3A 4L95C 4LF6J 1COWD 1A7AA 3VTFA 1VI2A 4CG1A 4F93B 2H1CA 3NH6A 2QR2A 3FFIA 2V3WA 4IH7A 3TUJC 2IPMA 3IAUA 4FFWA 1XBTA 3K0AB 4AP9A 1NSAA 1U1FA 2V5VA 4DR3B 1XK7A 2HCJB 1Z0AA 5C2GA 1QF7A 4E5MA 1K7YA 1GA4A 2G8NA 2FZVA 4R2HA 2ST1A 3L77A 1LV8A 4RV9A 5CRIA 1MJGM 2R1ZA 2MKJA 2NNLD 2A1UB 5EL0A 5J2MB 2WB4A 4I50B 3SZ2A 4OA5A 4Q4JA 2IS6A 3L8FA 1HLWA 4ZPBA 1R4NB 2PRYA 2PHZA 2QM8A 2CXXA 3FYUA 3OH8A 1X42A 1E0SA 2HFZA 2H48B 2F6RA 4KV9A 4URZR 4IRUB 4DL6A 2WA2A 1J42A 5KREA 3V80A 4QXQA 1Z9BA 4A27A 3W6PA 3F44A 4NENB 3WP0A 3N8GA 1EKSA 4ZDJA 2ZAIA 4CEJA 2HSGA 4C3MA 3TIVA 3TZQA 4UHBA 2NTNA 3BXZA 4NPHA 4EVRA 3TZWA 4N8EA 3CE8A 3FOCA 4NZ0A 1ZXXA 3G79A 4AS1A 1GRNA 1GPYA 2JJ1D 4MV6A 2K4MA 3AL0C 5KFDA 2H29A 2CVFA 4P4GA 1QH1B 3CX4A 1RYDA 3ZQUA 4BV8A 5BV0A 1WMSA 4A6PA 4G2TA 4NAUA 2D41A 4MRMA 1P2SA 4UHCA 3KT8A 2BJWA 1Q5PA 2P5SA 4RCZA 3D8UA 4BNXA 1FFCA 2RAVA 5E9AA 2DHDA 1FF2A 3IGNA 4P2GA 1S89A 3DMJA 4X92A 4R1MA 2AXEA 2PVPA 3BTSA 2UU9F 5KWIA 1U6IA 2YYZA 2QE6A 1DV2A 1CPYA 1RYRA 1HHTP 4DM3A 1XWFA 1O8CA 1U99A 3FTDA 4MDHA 4HS4A 4WOJA 1ILEA 3AIKA 3P9NA 3MQFA 3NRBA 2X7HA 3BD9A 2JVIA 3QBVA 3CX8A 2CVIA 4O4GA 2ZSIA 1UWVA 2O3QA 1MIOB 4NLXA 3LUFA 4EHHA 4WU3A 3FOZA 4PLYA 4JI8J 1ZS9A 1CUHA 4ENVA 3ISTA 2R7TA 3MWEA 2LU2A 3QKTA 1UUFA 9ABPA 3D7KA 2PD3A 3GO4A 2HHHF 1VZ3A 4LR9A 1ZJJA 1D8TA 2JFKA 3VGSA 1YULA 3BWCA 3PFHA 2ID8A 3IQWA 2X4DA 3G2NA 2V7TA 1CJCA 2OZEA 1P2UA 3BH7A 1H3FA 3AW9A 4F3OA 1KR5A 3OFVA 3A6DA 1JLLA 3C70A 3K0SA 2DK2A 4I1YA 1VYHA 1ZGZA 3L7YA 4FOOA 1XMSA 2XSZD 1S77D 4DMZA 1LQUA 1RRGA 4XSVA 1SKUB 3TQSA 4QYMA 5ETKA 4NCJA 1J5EF 1IKWB 1JIQA 2ZIUB 1QCCA 4D26A 5HVHA 5FH9A 3NAZA 1H4VB 2VWPA 5TMDA 3QVXA 1AQYA 4Y1GA 1FTGA 2XYRA 5EINA 3K92A 3JSAA 2HOQA 1X74A 1FFEA 1OY9A 3O3LA 3O83A 2VHYA 1QFZA 5BN4B 3DHEA 4OM7A 1A50B 5KFWA 2P7HA 1Z4IA 3DLKA 2BCJQ 5CDHA 4YLGA 3HJTA 1PGNA 3E9DA 1H0KA 1A7UA 4YP6A 1RPAA 2IMWP 3DWGA 1BJRE 2Q6IA 2ZBVA 3EEFA 4OFXA 1OD6A 3ZS8A 4XR4A 1PL0A 5EE3A 1GT91 3S2FA 1BA3A 4YJ2F 5CCDA 4A8FA 4BNVA 4TL8A 1FNCA 1YZGA 2ON6A 1WTBA 2VG7B 1GL6A 3MPOA 4WXHA 3SJZA 3CNHA 4PCLA 4CF3A 4RQAA 4F2PA 1TMOA 2VPZA 3MCTA 2FSVC 1FOEB 5FIUA 3VO2A 2VP5A 1WKKA 4RADA 1ATIA 2AMYA 4LDAA 1QK3A 1GNLA 4WEOA 3DTTA 2YMLA 3IDOA 4TOIA 1WEYA 4AY4A 5J1PA 3QPDA 3PA6A 1L7VC 4MSUA 3KOXA 2XSJA 3UD4P 4CMAA 3AT1B 2YY7A 2Q1LA 2OESA 3O3MB 5DSTA 1NLFA 5HMLA 1Q15A 3AD7C 4DR2F 2EVWX 5L40A 3ID6C 3BRSA 2IXFA 4FNIA 4D8TA 5EWEA 4MH0R 3F6CA 5CPBA 2GJAA 3QOXA 2IYFA 4BMZA 4FBTA 3ILXA 1X6VA 2Z1MA 5G4KB 5A0TA 4L76A 1CBKA 1C80A 2PUGA 4KKOA 4PO3X 1LDEA 3R3XA 2KZZA 3NYRA 1F5CA 2REBA 3CRW1 3IIEA 2ORWA 4MS4B 1TKDA 4YRIA 1E2IA 3EG9B 2ZWMA 5GZ6A 4E5SA 2G2ZA 3GVIA 3K09A 1AO3A 2NU7B 1NR7A 3ITNA 2SECE 2GEFA 3WGJA 1MX9A 5KYVA 3TINA 2BUCA 3HCDA 3DBOB 1A8IA 2P2SA 4UMFA 3EGCA 4BQIA 3KWLA 1UBFA 3HA5A 3IH5A 1O9BA 3MRSA 4BNJA 3O9ZA 1KSGA 4X4TA 2R6HA 4DI6A 1Q53A 3KDOA 3E51A 4BKUA 4HNRA 5HRCA 1PGJA 1EAYA 2WYVA 3KT0A 1ZD4A 4HAXA 2O8EA 4K6OA 4BVEA 4WQMA 4F4ZA 1P4JA 2ZUEA 1EZZB 2ERXA 3U4CA 1OWNA 2WDZA 3V6JA 2RUGA 1CIVA 2YN2A 2GGPB 4FYIA 4OFZA 2FB0A 1B6TA 2CJAA 1KO4A 3TCNA 4HB0A 4L5BA 2F63A 3QEMB 3IULA 3BIOA 1NJ2A 2YICA 3B7WA 4D8YA 3D0KA 1WXIA 2YBEA 3F6EX 1M5TA 2VDWB 1Z4NA 3P52A 4ES2A 3KJNA 2QU8A 3RVQA 4A4JA 1M7HA 1U9ZA 3BL6A 3F5MA 2PLFA 4MAMA 3L3CA 3OCZA 3ABZA 2EW1A 1P4RA 2HBRB 4LRTB 4Q6WA 4EM6A 4P1ZA 4FF1A 4CMCA 1NUSA 4PKDB 3VOAA 1DTQB 3IBGA 3LS2A 1FPMA 4N7BA 1WMBA 2W98A 3G2QA 1MO4A 1ZVQA 2BM9A 3TRFA 1RT5A 3K8ZA 1ZRSA 5JANA 3MTEA 3VKGA 3QMMA 5E9WA 1FS5A 3WNZA 3IGFA 5F23A 1T24A 1F4VA 2GN9A 2E37A 4K6MA 1PR2A 5LQJA 1VL6A 3TFOA 1TPZA 1BE6A 4NZNA 4LXIA 1Q5VA 1U04A 1YCHA 3H0KA 1ZJ6A 4RVHA 1Z6ZA 4UJ3A 2V8OA 1JEYA 2WJ3A 4CTKA 5JLAA 1U7HA 2A6OA 1QMPA 2UUBF 1XJQA 4NFLA 1KPGA 3A05A 1XZPA 2R8PA 2F55A 4CFYA 4LDPA 2C2ZA 4KQHA 2ZYSA 3MRXA 2BEVA 1YCFA 4ZP8A 5IANA 1IJEA 3G2OA 3NS7A 2ZSDA 3UB4A 2QDXA 5GAHU 3GFQA 4LY3A 2VYCA 2CNKA 4R40A 4OHYA 1JKIA 3MUVP 4O5AA 2JFYA 2YJZA 2XRYA 3GR6A 5HKOA 2B9WA 4XUDA 1R15A 4BWVA 2XO7A 3TSOA 2ZUFA 1I8TA 1KI4A 2I33A 2AYEA 4KY3A 3C8YA 2E1MC 3AHJA 5LLTA 3KDSE 5DLGA 2A2CA 4A36A 1DCMA 4GXTA 4BDSA 4UQGA 3E1GA 2X1VA 1D6JA 2W6ZA 4KB7A 4M88A 1IG3A 4BN0A 2W2PP 1HDEA 3VO8A 1NPYA 4BQEA 3GHYA 2SNIE 2XYPA 4BFXA 1Z5GA 2WKSA 4E5PA 3WJ7A 4I6EA 1N5QA 5AW0A 3STHA 1WG5A 3ZWBA 1P6QA 3O8WA 5CYMB 1G38A 4UVDA 1EFRA 3PFEA 4LSLA 4CNZA 3IP0A 5AXMA 1W5SA 3H5YA 2FWJA 4AN4A 1XB2A 3A4YA 4FXVA 4A8YA 4L4UA 4IDAA 4ENSA 3NEJA 4DFJA 2DNKA 2ZBDA 4C30A 3QLVA 2QU7A 2WKWA 2ZVDA 1C9NA 3R3YA 3VYTB 1UJCA 3A1TA 3SSNA 3V8BA 2AN9A 4LGCA 3BGWA 4FUQA 1F1BA 2NO6A 2H2HA 1HDRA 3QJJA 1FA0A 2CXTA 4IOMA 2FPIA 2IPOA 3G4SS 2QTNA 3IB3A 3T7CA 5I4IA 1XF1A 1R0WA 4HYTA 3VAHA 3TUIC 4QUHA 5KTYA 1KZ1A 4HDCA 1NHKL 3PUYA 2IYPA 2C28A 2N47A 3A0RB 1QKKA 4I6AA 4DV5F 3MMSA 2PD4A 4JMPA 1ZW6A 4DV2F 4B44A 4L15A 4UNSA 1MMFB 2VJYA 3Q85A 1CTQA 5D7NA 3IT1A 1M1YA 1NI4A 2VYVD 4P86A 4JYZA 3THTA 1YK0A 2J9DE 2OE2A 4OYPA 3QAUA 1X38A 4PYMA 1H8HD 3CXCR 5C1OA 1LBIA 2JLEA 3L41A 4FCCA 4FHCA 2FRDC 2GS8A 5ALDA 4ED4A 3P9SA 5K01A 2I3DA 4DL7A 4MKAA 2PX2A 2ORVA 1E4OA 2ABYA 1AHIA 2X7XA 2VQEF 5HF8A 1XZNA 3PXUA 2EARA 4MVJE 3VYWA 3CLRC 1LDBA 2EX0A 4KVAA 1FRIA 4MW0A 2H07A 5BO5A 3NBXX 1SELA 1XL0A 1XBWA 2HMIA 1FNNA 3CZMA 2Z5LA 3TI9A 4MYSA 2GEBA 1GYRA 1UJ6A 1SHLA 4Z7JA 3ZKAA 2JDJA 3EDQB 1IZ0A 4BASA 1PYTA 1P91A 3WOVA 2NO9A 5GMEA 4YAGA 1KKUA 1NVVQ 2LUOA 2ICAA 2XVAA 1C0PA 2Z2IA 3MGGA 1HYEA 5EGSA 5A76A 3ZHBA 4ARZB 1EJ6A 221PA 3SBXA 2R7QA 2XUIA 4ZVSA 1ADGA 2A0YA 3HYTA 4YCLA 4CUKA 4DPTA 2XUAA 3RRJA 4ZVHA 2A1TS 1JEQB 4AJNA 2VUHB 3F5SA 1GTHA 1EWVA 2EQBA 1XLWA 2XOKA 1T0TV 2EFYA 2RHBA 4P0QB 2R8XA 4PANA 1AGNA 4UOHA 2I6GA 3TFQA 2AX0A 3IKJA 3U4QA 3OV7A 4DSLA 1T4CB 2ZIGA 3W6UA 2BE2A 1YQDA 4NNJA 5AJ3F 2R8BA 4PSAA 3L7JA 1O03A 3WRXA 3HB7A 4RPJA 2NWQA 2O2CA 2ZDHA 2VDMB 2B9VA 2JIRA 5EHXA 2WHPB 4TVSA 4POAA 1HGXA 2J0WA 1XZEA 4B4OA 2VDQB 1U7PA 2RF2B 4IIGA 4ERDA 1YRTA 1U28C 1XMQF 1SHUX 4W1PA 3HWWA 4J3FA 4E5YA 1WC1A 1JHDA 3DZGA 2NTJA 5ES4B 3R1HA 4YACA 2ZWAA 3K5MA 4RKWA 3M6AA 5C53B 4D4IA 4G1FA 3AUJB 1K8RA 2WSLA 1O3YA 1Y7IA 2VWGA 3X1KA 4EB8A 1TGVA 5ELLA 1G5IA 5L3RA 4LYDA 2HGLA 3A25A 4REQA 1CT9A 2V4RA 2D5AA 5KCZA 5DM1A 1JLFB 4R8LA 5MFZA 4X24A 2BH9A 5CNIA 1EJ0A 4BKRA 1VXRA 5L3QB 1OFIA 5D3GB 2DSNA 4YV0A 1QP0A 4XLLA 3T5TA 2D62A 1UT8A 2EIHA 2JFDA 1Y6RA 2ATCB 3PY8A 3C0KA 4WRRA 4NCIA 3OQIA 5IN4A 4M1OA 5BYSA 3T7JA 4LRAA 3I9MA 4GKJB 2H9IA 3MF5A 5CG2A 5ESXA 1TL7A 3PDHA 4BCAA 5KSWB 4PXAA 1Q0HA 2HNDB 4F72A 1I33A 5C0OE 3TAMB 1G7SA 3QBDA 5TVGA 2CFIA 3AXMA 2BR5A 4LKOA 1QTNB 1V95A 2C94A 4FYKA 3BE6A 2V2ZA 2H06A 3MBKA 3AY7A 4PCAA 3LTNC 1K2WA 3QFCA 4C0AC 4NE9C 1ZMRA 1HBMB 3IG1B 1MVLA 3PGJA 1HL6A 3FRJA 4UF4A 3EIEA 2YX7A 3KD3A 3SP1A 1XTVA 3HM9A 1IQUA 1VI6A 4XYEA 5IPFA 4HN4B 1E1QD 1ID1A 2GPNA 1DMRA 5F5LA 1ODKA 5AVTA 5D5PA 1EB9A 4U67Q 5T3UA 4GKBA 4XARA 2ZHBA 4MYRA 2HSZA 2FZEA 3OQHA 1U0JA 2GLTA 2ZITA 1YAHA 3UV7A 1ZUNB 5D84A 3S81A 2DUMA 3CNQP 3OFFA 3RYHB 2R7OA 3RODA 2EFVA 3HCRA 2PBRA 1BEEA 4G3XA 2NVOA 3FPBA 1JB9A 4F25A 3AHPA 1THGA 2FQXA 3OVMA 4K1LA 3CMAS 4JQYA 4K28A 1Q95G 2BKPA 1CJMA 1NJIT 3Q89A 3GBVA 4IDFA 3CZCA 1WMAA 4O4JA 3UB3A 1EK0A 4BNUA 4GDMA 1LPNA 4ILRA 4FPXA 1VIMA 1GDHA 2DUWA 4OYYA 4YPVA 1NDQA 2WTAA 2OC4A 1ZOLA 4KYUA 3UH0A 2O8DA 2DH8A 3L9ZA 3JSMB 2SICE 1RZMA 4YRCA 2BKVA 2LNDA 3FWZA 3E8MA 2NOAA 1TO2E 3M6WA 3TTWA 4IJVA 3PX0A 4N8SA 2W6PA 4J37A 3OZWA 5FO0A 2DNMA 4W1RA 2Q1XA 2UP1A 1NMYA 5B7NA 5KFFA 4NV1A 1QUPA 1RYSA 3DCIA 5JPIA 1B3BA 3LUYA 5ILOA 3UCUP 3KAKA 7GPBA 1RAAA 1PGPA 4EEKA 3ZGYA 4IHKA 4LF4J 4JC5A 1Z5NA 2VFTA 4F3KA 2ZUAA 4BJ3A 3U4IA 4UTPA 1IEXA 1HOTA 3POTA 4BV3A 3N0XA 5B57C 3MUTP 3OSPA 3TA0A 4EEXA 3LC1O 4I9HA 4RPCA 4WTOB 4CTAA 5K3DA 3DH0A 1XTPA 2QS9A 4CO5A 1G1XA 1ARZA 4LE0A 4FOLA 1UBMS 3S1AA 4X20B 2VXYA 3FEZA 1ZJYA 3CG0A 2JHAA 3F5DA 1A69A 5CAEB 1XA4A 3WRYC 4O3FA 1WZIA 2AYXA 1DRJA 4DDTA 1J09A 3RB6A 1H74A 2B7BA 3WK6A 2O01C 3FVRA 5JVDA 4ZJOA 4RVCA 2P2NA 4DN6A 3KHSA 3C6MA 1WUIS 4FGZA 4YBRA 3E9QA 4K9LA 2WRMA 1AS3A 1KQPA 5KJFA 4S35A 4NJMB 4NZ9A 1LLQA 2AZDA 4HH3C 4U2EA 4AKEA 3L1IA 2GWHA 3H25A 3UF0A 2JRCA 3H1BA 2JRSA 1RWPA 1U0EA 1L3SA 2H1YA 2A0FA 3KHGA 1S2OA 1WUYA 3A2KA 4JI8B 3E6AA 2J9ZB 1MDFA 2J3DA 2IJGX 4L3VA 1SUWA 2HK6A 1KQFB 2MSTA 2C8JA 2FFQA 4YT4A 2O7NA 4D81A 5CH8A 3QLVC 3MEGA 3GEGA 1CDZA 5GAHI 3STVA 4EI2A 3TI0A 3COSA 3ACDA 1NR1A 4P3PA 4C6AA 4HAYA 2CQHA 3PYGA 5JH7F 3DWFA 1U4BA 4MNTA 3MK31 1BGVA 5EYPB 2VP6A 1P7WA 3P2MA 4GDFA 3NXZA 4M1QA 3BAFA 3OWXA 1TUVA 3NXKA 3RSSA 3ROFA 2GI4A 1ND5A 1T03B 4MWEA 1E63A 1NKBA 3DPSA 4LBHA 2CXRA 1Y4ZA 1JNRB 3LUDA 2XMMA 1Y1TA 2XQCA 2CPJA 1NLUA 3K0CA 4TQ9A 4XX1A 1XNQB 1MEOA 3Q8MA 4LVCA 4MJKA 1JPJA 2WF6A 5EMLA 4LFBJ 2DETA 2Q6TA 4DCJA 4QICA 4MPPA 3DDSA 1UPFA 3PRHA 2W7TA 5FLKA 1PR6A 5FWYA 1QHGA 1N6OA 1PAUB 2K1RB 2IXTA 3BMXA 1V5WA 3PWTA 2PI4A 2X8JA 4AKHA 4H31A 1ZOTA 1SK8A 2Y4NA 2E4XA 4IIJA 1M2NA 4DEVA 1S7CA 3VU9A 4ZDKA 2EATA 4JA0A 3K9CA 1JEEA 3UMRA 1SCIA 1RQXA 4K87A 3A8EA 3KUGA 4IFYB 4FZ3A 3J81A 4IUCS 3QSGA 2WIAA 3BN3A 4YQFA 2OECA 1P33A 2XE8A 4CLSA 3D5EA 2HMWA 5G40A 2CNOB 5B1DA 1BO6A 2BJEA 2WPDD 3QPAA 4L8FA 4WZAB 2YJNA 2MYFA 3C6TA 1QGUA 4MYDA 2PGNA 4FR0A 3PGMA 3BZQA 1R8CA 3QG5A 2J9YB 3MXOA 1AF4A 3DVLA 3ND7A 5LR6A 2FJDB 3H2HA 5TVKA 3TIFA 4QZVA 4EYEA 4BY9E 1UPXA 4GVBA 1KTVA 5M2PA 1ETHA 1UWAA 4F2SA 2AGQA 5EDWA 3WKEA 3U7IA 3OW2R 1H23A 3I5MA 4AY3A 4OXQA 5ETOA 4Y2TA 3J7AN 4DLTA 2RONA 5HVGA 2H2IA 5AW5A 4H7PA 1XEFA 5DM6Q 3BRWD 1Z8DA 4IZIA 4F97A 2DPYA 4XPIB 2A92A 4QQRA 1W2WB 1UVIA 1BH6A 1Z4PX 3ULHA 3A36A 2DJIA 3VMMA 1E3QA 3OEED 5IASA 1HSZA 4IFTA 4YUDA 5IG2A 4B17A 2C95A 3CU5A 5LZ7A 2OLKA 1T05B 3O8NA 4LCBA 4EUVA 4LDQA 4AUNA 3FHCB 3OUUA 2QE5A 2VBFA 4DQKA 4CN8A 3WLLA 4WBNB 2Z1DA 4J03A 2CKWA 3ORHA 3EVCA 2PUEA 1WV0A 2I9PA 3KB6A 3KSBC 2GUWA 2GA8A 1WVMA 2WBLC 4C7OA 4H6PA 4II7A 3QV2A 2CUNA 4B6JA 1UK7A 3QFWA 5HZKA 3EYZA 3VHLB 1PFGA 3GL9A 3KJQA 4C7VA 3PPWA 4Q5VA 1Z34A 1DADA 5J2TF 4UTNA 1I3CA 3QEBZ 4DR5J 4DT1B 4MGYR 3M8RA 3ICEA 2H5EA 4YHBA 5FI1B 1MAAA 2IW1A 4IMJB 4WLVA 3IUQA 3SNKA 1P1JA 4JI4B 3JVDA 2Z30A 5GIPE 2NZCA 1CLFA 3L4SO 2AV5A 3V42A 3HVUA 4JD5A 1V39A 5ALNA 4RGVA 2M1ZA 1MTOA 1IK6A 5LB2A 3WGYA 2VRNA 2DWUA 4RE5A 4IOBA 3FNEA 3THWB 4OJHA 4CL0A 3RRZA 4MUGA 2HJ9A 3MAAB 1MMDA 3MUNA 2NN3C 2NUPA 4BATA 3LCUA 5J63A 2C78A 4BNFA 1UWBB 1Y9DA 2Z2YB 5AQ1A 1TCAA 4CHTA 5BSTA 3RYIA 2WWRA 2PE8A 2PKQP 1HT1E 2XVXA 2XT9A 1P17A 3V97A 2V98A 1HBOB 3L3BA 5C42A 2Z08A 3WQSB 4GQBA 1LBHA 1NATA 4IRMA 4QATA 4UY85 2VP2A 3E1SA 2EWHA 3LOPA 4ZCLA 1OX5A 1JEAA 4UTOA 1NA5A 1LJ8A 4HFMA 1QIKA 2OD7A 1R0LA 1ZD3A 3RVSA 5DTEA 3LLUA 4F04B 1N2JA 4L51A 2G5TA 2YNFA 2VDNB 4MUIA 2HA6A 4B81A 3JPWA 4LX8A 1THZA 1QYCA 3WDMA 3AMVA 3JTOA 1P5JA 3LKDA 5IKEA 4ZTUB 4S1PA 4YAJA 2IZZA 4XGRA 2R5WA 2LCQA 3CR8A 1OIAA 3K5NA 3PWSA 1CIPA 3AFNA 1KI1A 5ETVA 3AY0A 1A7KA 4G5GA 4KN8A 4HWSA 3WIUA 2CNLA 3GJXC 4BO4A 2VN8A 2GXSA 1T36A 1RC0A 2VLIA 2A10A 1JXAA 3IMCA 5K8OA 3X3UA 3O5AA 4I0WB 2R7RA 3G88A 3GP5A 4PSVA 5CBPA 3AI7A 4ZV7A 3OKAA 5J4HA 2EI5A 4PCUA 2YNIB 3TSWA 1YVDA 3OZBA 2FUG1 5C3UA 2GBCA 4IPTA 1P2GA 1OAOA 3VGTA 4I56A 5LQSA 4U8HA 1IC6A 3WYBA 1JJ7A 2IEAA 2YJ4A 1S1VB 1SCKA 1HEIA 1JH8A 2NZ4A 1ZCFA 4K9MA 3L7UA 1O5OA 1Q17A 1E6VB 2WWFA 4AUMA 1UK8A 1E9AA 1RBQA 4WBFA 4FDUA 4C11A 1IZZA 5J1NA 4BNDA 4IUFA 4Z8XA 2R0QC 3CJ4A 4TKLA 3VTKA 4GPTA 4NE9A 2QX0A 4E98A 1DO8A 2WTBA 4JBGA 4FBUA 1M0EA 1N9ZA 5HMZA 3ZX4A 1OS5A 4GVPA 3DHVA 2BABA 1Z75A 3GRCA 4TN1A 5DM60 2ZYTX 4J94A 4GWGA 3HI4A 2EKZA 4C48A 5EPEA 1T95A 2VF8A 3F9RA 3BC1A 5B4VA 1BJKA 3RWMB 2YN0A 4NYJR 3HJHA 4XJSA 2R2AA 1R5JA 5KB3A 4DIFA 4IOAQ 4ROTA 2I2CA 3NHUA 4U8GA 3SLKA 3EQZA 5CJPA 1LW6E 2CKDA 5I48A 1NAHA 3AFIA 1YU6A 2X77A 1IK4A 3I34X 4N0EA 4G8JA 4ZO4A 2GV1A 1J7KA 1TQDA 2I3ZA 2JL1A 1JYEA 1Z0UA 2HHXA 1JIKA 2WM8A 3GF4A 3NGKA 4Y18A 1KC3A 5SYMA 2JI7A 3JD2A 2KG0A 3GLTA 4FGJA 3SFUA 2AEJA 1F60A 1OAKA 2ZJZA 1GY8A 1EBBA 2I34A 4L8LA 1NWHA 4NESA 2JFHA 3FW1A 5IJ9A 3BYZA 3ZLUA 4ECXA 4UREA 4G4JA 3P26A 3GMTA 3HB4X 3O0DA 1YUBA 3DAOA 1W49A 3EBLA 2HRRA 1MQSA 4J4TA 2Z5GA 3QVGA 1YIOA 3PQ4A 4R5PB 2FF5A 3GT4A 4AN0A 3HH8A 1FJGB 2B3DA 3H04A 4KYTA 3TTVA 1IL0A 4FVTA 4XTTA 5JV5A 3H9UA 4YNBA 4FE3A 4HDQB 1JGTA 1RBOB 4GI3A 3ER8A 4ZTZB 1KMIY 4WKRA 2BXJA 5KFEA 2H4HA 3C6UB 3VSDA 2XY5A 4KH0A 1I80A 2PL9A 1XD8A 3VISA 4HPJB 3L0PA 5KOJB 2GCOB 3QEOA 5HE9A 3RUPA 3FE2A 2QTBA 1ODFA 4MMOA 4JBIA 4JAVC 4DF8A 1WKBA 1WQ1R 3H2KA 3HFZB 3AHCA 1SCBA 5HVFA 3JQ6A 1HD1A 5ALIA 3ADCA 8MHTA 1BCRA 5H80A 3BPSP 3PYEA 4LVNP 2RQCA 1SD1A 4KXXA 5HIIA 2BKEA 1N7GA 1JDPA 2JBWA 1AFJA 1GAEO 3KKQA 3EQ9A 3LRXA 2HQIA 3K0HA 5DGBA 2XS2A 3OT1B 4GQIA 2BYTA 3D4NA 4G0NA 5K9FA 4AJEA 1BQ3A 1Q7YT 4CF5A 1OH8A 1X4CA 3QTBA 1GX6A 4OLFA 3C7TA 2GCPA 4QU7A 4B84A 2PE5A 2XGOA 3JQAD 3DNFA 1Z5PA 4JFAA 5FDLA 1M1YE 3T9ZA 5CABA 2R8KA 4ABYA 2QTTA 4RF3A 2Q2NA 1ZUIA 1CV2A 4NABA 2ZM6J 1GAXA 3EVDA 3UFXB 3L46A 4IH5A 2JIDA 2KDOA 2PX3A 5CVVA 4JKYA 5E8RA 5IM4F 2R8GA 1CLUA 2ONCA 1O6CA 4ZCSA 4YQEA 4QAJA 5DI3A 2A5DA 2J3IA 1HR0B 4LBIA 1U6ZA 1PL7A 4UDYX 4YP9A 1W0JA 2BFEA 2VA8A 1GQEA 3KK2B 1Z15A 4DV7B 1O4WA 2QMQA 1DFGA 4Z4EA 2C9OA 1K1EA 2PA3A 4O3OA 2HWTA 1GQFA 1MG5A 3UWKA 1UBJS 3S27A 2ZB4A 2V50A 2EZUA 3EUWA 2O4CA 4OYAA 5KWEA 2AUNA 5D01A 1XMIA 2OCIA 2O48X 1VCMA 1YRBA 4OBXA 1BN6A 1QAIA 1NK6A 2BW7A 4HBGA 1WHSB 2LLZA 5PNTA 4Z7OB 2WIJA 2NS1B 4PPQA 2VUIB 3ZE0B 2RRAA 2UUAB 1LWFA 1HFEL 3NOVA 3W63A 3RKUA 4TY9A 2HLHA 3ZU5A 1NUUA 1U6JA 5FOXA 3PD1A 3GC6A 4ZKEA 1G21A 1Z47A 5AI5A 2ZVQX 4P2FA 1SH0A 2DFDA 3BKFA 3LW7A 1XNJA 1MB2A 2F90A 2H08A 2WA1A 2NPOA 2QUKA 4G07A 4QGSA 1NWCA 2FJEB 3P5TL 3PYMA 3MWGA 3B9RA 1Z4OA 2Y1XA 1FYDA 3NFYA 5ES3A 1P27B 3COZA 4CIBA 4V0RA 1QFSA 3AIIA 4IXNA 3UEOA 5FRDA 1KSJA 2GRJA 1GFZA 1HYSA 3TQHA 3HKEB 1J6UA 4UM8B 2DEUA 4PG8A 4MINA 6LDHA 3GEEA 8ATCA 2JFGA 2JHGA 1E2NA 5A8RA 1CHDA 3TQOA 3KYCA 4BB9A 4Q4CA 5G1PA 3COJA 1EUCA 5C5DA 1WD6A 3QF7A 4CCHA 2ZBGA 1D4AA 4NBKA 1EBFA 2CMFA 3LQVA 3QP9A 3I31A 3PPVA 3RJMA 1O5JA 3JR7A 1EQAA 3IMFA 5ERYA 4MYHA 2Z3WA 1J8QA 1VBNA 3GIKA 3I2FA 1TA9A 4J9PA 2EKDA 1UJ5A 1Q79A 3NLCA 3RFCA 2MZRA 3HY3A 1P4SA 1NP6A 5L3SB 1HZZC 5LQMA 2LKCA 1XU4A 3QVUA 4DPMA 2XTJA 1Y8RA 1WTFA 1IHOA 4G8BA 3ZDAA 1HQCA 5M5BA 1REGX 3TARA 2VNKA 3REQB 4YR2A 3I0SA 4FHGA 1XEWX 3BHMA 3ANYB 4KGKA 3LANA 1CY7A 2XDQB 5BWBA 3FVTA 2RGYA 1REVA 1QIDA 3ETOA 5K8MA 1XJWA 2Q1UA 2IIPA 4EGAA 4HZUA 2QMUA 2WHOA 1RLUA 3GBSA 2XB2A 5KX5B 4DR6J 1KOOA 1U8TA 1LNZA 5CAAA 1VJ0A 1TM1E 3CPSA 4I55B 2J45A 3CJ5A 4MT1A 4ZO9A 4HLUC 1BXRA 1WUTA 4MRAA 1W2GA 4JL5A 5CCMA 5K8TA 2B5VA 3SOZA 3TG2A 2GDZA 1NUAA 3V2HA 3QT7A 2A33A 1WHWA 2A7QA 2FN9A 4R6XA 4DM7A 2BQUA 3AO0B 2ZQZA 4HQRA 3FWKA 3HFSA 2A67A 1DU4A 2ZOFA 4ND8B 1PTJC 4K5RA 2YJ5A 3NBYC 3HCCA 3QE4A 1WPRA 4JBWA 1H0SA 2PSHA 1WF1A 4ER8A 2U2FA 3EWAA 5FPTA 2KYZA 4KV8B 3RJZA 4K9QA 2ZWOA 1M2FA 4URQU 1QF6A 1KHTA 2Z56A 3PNVA 2B2XA 3K17A 5ELMA 1N2SA 4HJXA 3PFIA 1Q0TA 2RI1A 1RTHB 3M9LA 1YRQA 3NM4A 1VCHA 2R79A 4EZ9A 4L0QA 3VV3A 1G1MA 4QWBA 3SNHA 1RWBA 2CE7A 2BL4A 1IWGA 3N0TA 2HIHA 2HLDA 2Q3EA 3RRKA 4YP5A 3LDAA 2X1HA 4L9RA 3WR5A 3RVPA 2BBSA 4PZUA 2GJFA 3PQ5A 1GU1A 3BDIA 1D7OA 3GJ3A 4E4TA 4XD7A 1DLOA 2FFJA 2AGVA 1JDBC 5JJBA 4DV3F 4Q3NA 2QD2A 1YS1X 2XMUA 5EZYF 1VB3A 2BJ9A 1PFUA 1YWXA 4QPTA 3EDRA 4WU2A 4QDOA 3FK4A 3SBDA 4ZPDA 4M5IA 3FN4A 5TDHA 3PYDA 2WWIA 3M6XA 3EE3A 5C52B 3E70C 3G2LA 5HUHA 5D4NA 3TQRA 4PU0A 4AL4A 4DJEC 3IELA 1O77A 4LFAB 3B78A 3QUCA 4ZT2A 1P0FA 1QE5A 2WW4A 5B09A 3CJQA 4A1OA 3PUHA 5DGAA 2ZUWA 3AHEA 3THPA 2ARKA 2CYBA 9ATCA 1KEVA 1SVMA 1TL5A 1ZMXA 1QC5A 4E51A 1RLDA 4NFYA 4E6PA 5FR1A 3ZZRA 4GI5A 1W36B 3NP5A 3QAEA 4LR7A 2E4WA 5I3UB 3VZHA 3HBNA 4DR1F 3I56S 2KT5A 1KEEA 3DBHA 1YJ5A 2HDNB 3FF4A 1NPTO 3RC3A 1LQ2A 1MEJA 3C6YA 5L46A 3F4BA 1DLJA 3NNHA 2YXLA 1AO0A 5HK8A 1AQLA 2P2YA 3RAJA 4FFDA 4CT8A 1XMQB 1QHHB 4BVHA 2D6FA 4PZCA 2K7FA 3ANNA 5EIXA 2J9DA 1JG4A 3K8YA 3EPKA 4WFYA 4R2XA 4KAIA 3M3HA 3WWPA 5JDIC 1ODCA 5LQCA 1I94B 3K1AB 4ZJZA 4E3ZA 1UP4A 3GG1A 5HE8A 2WAMA 4AZ3B 3WBZA 3GNSA 5LXYA 1PYOA 2OOKA 1TZ0A 1GZVA 2O3UA 3C15C 1FX1A 3NM6B 5GAJA 2AMLA 2QD3A 4X93A 3ZIAA 1ZIPA 2BEWA 2Z2XA 2E4YA 2WW8A 1W5FA 1X80A 3TSYA 4N77A 1H1LB 3RAQA 3SZOA 1LI7A 2AG6A 1EYZA 1E9FA 2BCEA 3MJCA 2DOKA 3HM2A 4Y6GB 3LNCA 1RPNA 4YRMA 421PA 2WAYA 4OI0A 3ESYA 3TOCA 4BV9A 4EENA 2AQHA 2ZJFA 3EA0A 4HFRA 3UA4A 1C1DB 1C0LA 3MB5A 3ORRA 2MJNA 5I9BA 3PA8A 3I53A 3PW0A 4RHFA 2AHOB 4AG3A 4F8JA 4UM9B 1AMUA 5L1IA 1YZUA 3WP1B 1GPMA 4O2BB 3TQQA 2FPMA 4DLKA 3NYQA 2OG1A 5ABPA 3RAXA 3K9LA 5GTDA 2R8ZA 2OXRA 5I7OA 4DVGA 2B1JA 4URYR 1E1KA 3O3CA 2XMQA 3IC1A 2N1BA 2HHHB 3EX7C 1BDMA 2GYYA 4ECZA 2B69A 1RCOB 2CLDX 3JAKB 2I67A 3HUEA 8ADHA 1V1RB 3OVSA 2ZH1A 3RBDA 4D56A 1OX4B 1AX9A 1ZH0A 2OGWA 1KVJA 3EOZA 1QHSA 4EEZA 1ZBTA 3MWLA 1JIVA 3A58B 2FFHA 4OZLA 2X41A 3NWPA 3UXHA 3RIYA 2XQFA 4QU6A 2VG6B 3X43A 2O1XA 1QQ7A 2GETA 4LBVA 3V6DB 3MCNA 1L8XA 2EJVA 3Q0AA 1RWXA 2OKGA 2XTAA 4P5DA 4JQSA 4QIFA 4N8DA 4WXMA 4KKVA 5KNDA 1JQ5A 2PMDA 1LPBB 1SR8A 1ZH6A 5H3LA 2W9XA 2G6TA 2GAOA 4JU9A 4KAXA 3KXLA 1WORA 4J9MA 1WF6A 1I1NA 2JCBA 5C25B 4PCQA 2CLIB 4XFKA 2XVYA 4Q45A 4XIJA 2Y1FA 3OX1A 4CYUB 2HW3A 1WBBA 1O9GA 2OD4A 1PO7A 4GW3A 4HGZA 3STWA 2B5WA 4F5DA 2IJFA 1UM9A 2AQ8A 5AW3A 4D5GA 5EC8A 1DKPA 4PQUA 2VUSA 4F9FA 5FX2A 5JPDA 1G19A 4JI1J 3N3BC 4MKIA 4QBHA 2B37A 3RS3A 5KYUB 1V9CA 5HN0A 1NUHA 4HT7A 1X60A 3ILLA 2W5UA 2I2XB 2YZMA 1OFUA 2W83A 3M8SA 1RADB 3S70A 4Y65A 1H9BA 4UTZA 3DE0X 2W4DA 2QN6B 4K6FA 4C97A 2F1FA 3BMCB 1RHUB 3FAZA 3BQ9A 3WLKX 3H9EO 4NXMJ 5F3RA 2MQMA 1J9GA 1QYRA 1H2XA 2RGUA 1BVHA 3EMTA 4DIKA 3OM9A 2X3UA 1X39A 4P35A 1SBYA 2B6AB 4TMVA 1WNTA 4IMIB 2ZWPA 1JJ4A 1X9SA 1V47A 3QMPA 1JBQA 3CLTC 4WK6A 3PW5A 2WVCA 4QYXA 3NAHA 2Z0MA 1HX7A 5DASA 3TB4A 1PK8A 5DJBA 1ZGAA 4M0UA 4GMHA 2Z8XA 1PJ5A 1LLFA 4KVGA 5FTLA 4JI8F 2JGFA 3HGTA 1Q12A 3R7LA 3KWMA 2QZ9A 4ZQCB 2M32A 1LDYA 2YWBA 4P38A 4P93A 3MMBB 4G8CA 2H9YA 1HPZA 4MO2A 4UBOA 4A0QA 3L05A 3I1FA 5LZ2A 2ETXA 3Q6MA 3C5VA 2FRXA 2FVPA 1N0IA 2AG1A 2HQRA 4RNMA 3VVBA 4BU1A 2YFQA 4AJ1A 4MHTA 4DSZA 4DREA 5DS7A 3JQMA 4INPA 5JQGB 3W60A 1R4ZA 4KPGA 4HV4A 2LU1A 1YJAA 3VGUA 3DMFA 2IV3A 1IKVB 3N2YA 5KTSA 2W25A 2PRSA 4QUIA 2OHOA 4WUTA 1QV7A 2VEOA 2XF8A 5F2NA 3L9XA 3UOGA 3DU6A 2IH4A 2AJ2A 4XZ3A 1XMOF 5F7XA 2WB2A 3B51X 3JD3A 1JJ2R 2ZRQA 2HK7A 3ZNJ1 2Q62A 4U2GA 5I4CA 5FOTA 3KRTA 3U6KA 2DGXA 1R8YA 3U3ZA 2RGEA 1M6NA 2RGAA 1SBQA 3B1VA 1CQWA 2YHIB 4R2IA 2W24A 1KJJA 1ZH2A 1UBCA 2P3OA 2ZQ5A 4PYQA 3V3TA 5I9LA 1MW8X 1Z2LA 4HMPA 8AT1B 2YYSA 2PC6A 3W5CA 4H35A 2TYSB 2F1HA 2PNJA 2Y0SD 4DR5B 4PFQA 4CM4B 4P9NA 1E6CA 1E5QA 4RW9B 1RBMA 1U7WA 4MVJD 4M4SA 2DBRA 2H5JA 3S0JA 1YJ8A 2RHWA 3G8SA 2GBFA 4W5HA 4RC9A 1F2UB 2FPGA 3CLVA 4R2KA 3OJLA 1MA3A 4FWTA 2OKCA 3TR0A 1WSRA 2F7VA 4C8LA 4CCYA 1QLWA 3LK7A 4P92A 4YREA 2W6NA 4ASUD 4FK8A 3NLLA 5DBGA 4PC3A 2QA4G 3D2LA 4I4IA 2Z57A 3C97A 4B3RJ 5C4IA 1MLDA 1L4MA 2I65A 4CUZA 5I7HA 4Q3LA 5LC1A 5T7LA 1W4LA 3JTNA 3LTOA 2C07A 4BAGA 5B0AA 1RAJA 1U3CA 3E84A 2FZ5A 1MQAA 4QBKA 2QT0A 1UANA 2NQ2C 4PG7A 3KM0A 3NEKA 3HCXA 2DE0X 4JQOA 3LGXA 3MJVA 4KQZA 5GJVC 3KR1A 4G67A 3G1WA 3HB5X 2P3LA 2D1FA 3H9QA 3OIYA 5F78A 1FNSA 2ZTVA 1TO6A 3VZCA 1RSCA 3EFOB 3G82A 2IEIA 4UAUA 2H1SA 1RKJA 3AJRA 2AT1A 1WEHA 2NCKL 3CKMA 2O8CB 4WZZA 1Y34E 3TA2A 1V4NA 1Z2AA 2QI9F 4JVLA 3QWIA 4ZI7A 2FW1A 3D54D 2CHEA 1SBTA 2YRWA 1NF9A 2RGDA 1HI1A 1VQ4S 2H2FA 1VG9B 2YTZA 2Q7OE 3UN2A 4M5NA 1CC8A 2XB6A 2RBGA 4PAQA 2WFZA 3EXHA 4B73A 3W78A 7FDRA 1YU9A 1D07A 2LPMA 3IR7B 1R8QA 5EHZA 2O7SA 4TLAA 5EVCA 5SZHB 2TMKA 3NCQA 3KCNA 2P1RA 4IIUA 4PRFA 2BFCA 4NBNA 3QBTA 4YRRA 2QOEA 1CY4A 3HB0A 4WOKA 5F1KA 1LFDB 3OAAA 5CW2A 5E7JA 1L7QA 4K5SA 3MAJA 3ZXWA 2FX2A 2F3RA 4HDNA 2GYVA 2O54A 1BLUA 1MXHA 4LZPA 1MOQA 2HG4A 1OYVA 4B6RA 2WUEA 1GCOA 1F5BA 1PC5A 2IWRA 2Q46A 1CSJA 5KO2A 3OD1A 1TAHA 3PFFA 1KQOA 2CXSA 3NJ4A 2B3TA 1X7YA 4ZYUA 3GV5B 2DFNA 1HD0A 2WSIA 4IG3B 4TTRA 2I6SA 4ZHRB 1QUFA 2GESA 1MT3A 4XFDA 2PGXA 2WMOB 2FZWA 2Y6UA 3OCCA 2VHXA 3ESZA 1QUVA 2PGCA 3CNNA 1E4EB 4DV2B 4ICLB 2JJQA 3W6ZA 1FW6A 5BVHA 2NYUA 3S8MA 4DWWA 2G1AA 1PNVA 1V16A 1LFPA 1U2CA 2B1IA 2E9SA 3SDEB 2FHJA 5BWNA 2N3OA 4F4JA 3K2QA 1ZG3A 3HS3A 3H7AA 4CDMA 4ME6A 1VOTA 3ANMA 5CA1F 5CB4B 1VLZA 2GW8A 4BMCA 5CFNA 2HD4A 1QORA 1XYVA 4KR0A 3PCXA 2ZUTA 4I1PA 4TNOA 4KHPF 4Y2GA 2W6QA 4DUZF 1GFWB 4XM0A 4UHDA 3C1UA 2R4QA 3WK4A 5IDYA 4H4KA 5K8JB 4K0KF 5AM2A 3ZGZA 2DNHA 5A03A 1NYRA 2YIJA 1A8PA 3DD1A 3OPQA 4K40A 2HBZA 2W6ID 3FSRA 3DJFA 4H3HB 4F60A 3R5HA 2B4AA 3M7VA 4P71A 4PZZA 4D9BA 3VXKA 2HY7A 3DCJA 2HVHA 4EKEA 4FVMA 4MQMA 3PXCX 4TSRA 4GKKB 3AY6A 3H2YA 5K99A 2RJ3A 2ZI3A 4HB3A 3R0VA 3WMRA 3NVKI 3WLQA 4HWKA 2F8EX 1MX1A 1V6HA 1JKHA 1CUBA 1R0YA 2XXJA 2CDRA 4B3DA 1OZGA 3JQ7B 2F62A 4S1OA 1ZMBA 3KYDA 1P2BA 1NSYA 2JEZA 1C0UA 4MUNA 1D8AA 4EAQA 5I3CA 4ZVUA 5KQSA 4Q12A 1DIRA 4QJ4A 3S2GA 1R0KA 1IM6A 1P81A 2QQ5A 2MB0B 5BQ3A 3AXSA 3GXOA 3X1WA 1A3CA 3IR6A 4MV0A 3EWIA 1ISRA 1SQGA 2AW5A 4NX2A 1I7QB 1NNI1 4LVNA 4MS3A 3IBTA 4EGLA 3C8HA 1NZJA 1ZGCA 1JKJB 4XFJA 5JZ9A 1G5TA 2CVHA 4CTOA 4WJBA 3SAJA 1SUIA 5DTJA 4FCTA 2JVOA 3LSTA 3FUUA 5JE8A 2NSBA 3PP8A 4TXNA 2WFLA 4QOIA 1WMFA 4TZKA 4S0XA 3NP7A 4TTIA 1L7XA 2LD4A 2PUHA 1S6YA 4JDUA 5KDOA 2DFKB 2DGUA 3WHIA 4I2QA 2BQ3A 2HB6A 2HO4A 4LIPD 2CW5A 4ED6A 3EYWA 4A03A 2O7QA 3AETB 4X85A 2IFTA 3CR7A 1KZYC 4NBUA 3VR4H 4S24A 4Q7AA 1XMOJ 5KTMA 5EY5B 3MQ2A 4IXDA 5DNWA 2OPRB 2GQQA 4OY3A 3HHDA 3KE8A 4MVJP 2H5LA 4DLUA 5J1TB 4BS9A 4PVCA 1HWYA 1EIYB 1Z2EA 1CJSA 1F2GA 4OHFA 2MHCA 2Q5HA 1TYBE 1XJCA 3F73A 4KXFB 3JW8A 5FI3A 3QFHA 2J8AA 3M4JA 3C7DB 1XQYA 5E2AA 2X5NA 2RQ4A 2O1EA 4UEOA 1NT2A 1NY6A 5JS2A 3ESAA 5D86A 2ZRBA 1TPYA 3B53X 1U0NA 1HT2E 1Z12A 5D4PA 1O4VA 1IBLF 1VRUA 5FF9A 3IT0A 3CLUC 2Q8PA 1AG9A 1L5WA 4U7HA 4O1MA 4WKPA 5J9FA 1W73A 2EFJA 1C0EA 3GDOA 3KTAB 5DDIP 4DCOA 5JSUA 2G17A 1WSAA 3B3JA 2XRFA 3UDVA 2GD1O 1X4GA 2CJWB 1FIUA 2P35A 1BGXT 1FESA 2W48A 2I78A 4YXWA 1Y7HA 1HI9A 1SU7A 1ZUD1 1M2KA 3EGWB 1CS4C 3WSWA 1TADA 3M33A 1N9GB 4JOQA 4Z2XA 1N5RA 3FBFA 1VPDA 5CYFA 1NGSA 4OXIA 3HJAA 3OWOA 2GJ4A 5FNVA 2Z58A 3ZN2A 1WW3A 1S1TB 2V97A 1UDXA 2OSVA 4CNYA 5GVRA 3CTMA 2AFHE 2W1BA 1AKUA 2XKJE 2B8TA 2JAPA 3ROGA 2KRRA 2XGGA 2QMXA 2KJQA 4M9ZA 5DX0A 4YONB 5T4EA 1V1MA 3UAXA 4DSEA 1O97D 4P3YA 1JFLA 5AXDA 3IP9A 2P9HA 4QVKA 2ZVJA 4HL6A 4JI3F 4AT1B 5L7TA 3RVRA 3O9VA 4WTYA 4PLCA 1D9DA 4CKEB 3QYAA 3B70A 2W6JA 1CJUA 2MIIA 3ZNQA 4R3NA 4M3NA 1KGSA 4X44A 3Q3HA 1ZEMA 2HJHA 4ELVA 2C29D 4J0IA 2Y27A 3TN7A 4RM2A 2IBKA 1EWKA 2DGTA 4X4SA 5DTIA 4DPOA 5AW7A 1KI2A 2HU2A 4HL9A 1E9DA 3A6HA 2VQ6A 4AJ4A 4K26A 3I5YA 3RI3A 1CRZA 3D0GE 3DT8A 1JFSA 3GJSB 3M82A 3T6BA 3DM9B 3RHFA 3U3XA 2W6CX 3KK3B 1JJFA 2IXBA 3G7NA 1UMBB 1BHO1 3M2UA 3VQSA 2RHQB 1D1TA 2HLPA 3HA2A 2PBZA 2GPAA 3WVNA 5LMCA 1Z4MA 4TLQA 4X00A 4DLPA 1RE1A 1T34A 3LPAA 4V2IA 3ADOA 2C2OA 3IHLA 3F9CA 2WM3A 1SJRA 1LBTA 2XT6A 4QUJA 3KZNA 5J2UB 4KIGA 3TLZA 1X7ZA 2BGGA 1IRIA 4CQLA 1JL3A 4EQZA 1IFXA 4B02A 1ZN2A 3W4JA 3U19A 3RQSA 1G3RA 2OFWA 5FLXA 2ZZTA 1JB0C 1NFQA 2DBVO 3EDYA 3P9QA 4WACA 5BW8A 1MVOA 2ZBQA 5FWXB 4QBUA 1P5RA 1OBFO 3C5HA 2XB2D 2CK3D 4A2CA 1HNIA 2QLMA 1C9MA 5DETA 5IJXA 1ZAKA 1HLPA 3ASVA 1XEXA 1RWNA 5FP0A 5FA6A 3AJ8A 5ITZB 3T3HA 3NBFA 3WL3A 121PA 2J0QA 1GZ6A 3QMWA 4MKYA 4QPXA 1HTWA 5COAA 1ULBA 4C2AA 1RU1A 3VSEA 3LA0A 1L7EA 5E5NA 3MR6A 4LI3X 1N3LA 5C18A 2C5FA 4ZN3A 2G1DA 3QE2A 4MS1A 3NBZC 1PYGA 1PBNA 3TIXB 6AT1A 3ZFVA 1GZHB 3STYA 3WYDA 2AFIA 2C2BA 3ENVA 4MVXA 3M1LA 4ZAZA 5E3RA 2QTVB 1SZCA 4EIWA 2MR6A 3ZCRA 1YI8A 4NU0A 2GYWA 2PXCA 3DTNA 3QENA 1ZHOA 1P9NA 2FUG6 4BUJA 4DABA 3JAMU 2LDIA 1VS3A 4NX9A 5K8UA 5FCDA 4DU7A 1E9VA 2QL5A 2F67A 3Q7RA 2XNQA 2WDPA 4E2FA 3K96A 4WXWA 3P32A 4FI3F 4NLQA 4LXYA 4BCDA 2HWHA 3ELYA 4I5DA 3FLEA 1RE0A 4PX2A 1PSWA 3WHPA 1G3OA 2BMDA 3N2LA 4IZ6A 4JEHA 2V4QA 1CWUA 4DR7B 3CIZA 5A6SA 2TSYB 3N58A 2AN5A 4IDNA 3LP1B 5H0IA 2A7XA 1VLMA 2IC3A 4QRHA 2PGJA 2QXUA 2H4FA 3A37A 2WYHA 2AE1A 3NDJA 1MX3A 2DR3A 1T9WA 3PR4A 5IBRA 5HMWA 1Y9OA 4CHGA 5HJ7A 4NLOA 3KYLA 5IAKA 2BFWA 4D4LA 4KPYA 2X0IA 4KPUA 4ZYLA 1IBCB 3R7BB 4ITVA 5HM8A 4MRRA 2ZBPA 4D80A 3OCJA 5DSZA 1JSZA 2J48A 5AJ3J 2I62A 4K5QA 3IA0A 2PBFA 4RAQA 4RTPA 2AZMA 3C3YA 1YFLA 3CCQS 5A9RA 4EO9A 1HBUA 3DB1A 2VSOA 2JA2A 2MSLA 4FNHA 5IXUA 3PVXA 1NF8A 4FZVA 3ECAA 4IRXA 4BJ5A 3KUHA 2UUBB 1NHGA 4R0NA 2GLXA 1KJNA 3EIWA 5JG7A 2VKZG 1YNOA 3LWNA 1CJTB 3U9SA 4IXTA 2FE4A 1I6LA 2XECA 5IT5A 2BFMA 2EPIA 5AXCA 1EPUA 5IAAA 1I4DD 4R2LA 1JQEA 1W96A 3E3MA 4NS1A 1C1CA 3GLJA 1ZA1B 1MB0A 3WX0A 2WTUA 1S48A 2L42A 1U63A 4TLBA 3KK0A 7AT1A 4YN3A 2A4MA 4ZLNA 5DU2A 2XWJI 2YJ3A 1RWOA 1VYTA 3FFXA 1K0TA 3M1VB 2J9RA 5JEEA 1YQTA 4MWOA 3VBCA 1ZN8A 2Q41A 1SIWA 1E5LA 1TL4A 3MAQA 4Y3CA 5I45A 5LMNJ 1PS9A 1AKNA 4HKTA 1XU7