3N0VA

Crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
280
structure length
280
Chain Sequence
DTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDRQSGRFFIRVEFRQPDDFDEAGFRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHCLNDLLYRQRIGQLGMDVVAVVSNHPDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQVIEETGAELVILARYMQVLSPELCRRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATAHYINNDLDEGPIIAQGVEVVDHSHYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a formyltetrahydrofolate deformylase (PP_0327) from PSEUDOMONAS PUTIDA KT2440 at 2.25 A resolution
rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Formyltetrahydrofolate deformylase
total genus 76
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3n0vA01
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 3n0vA02
4ZYZA 4LUBA 2BLNA 4NV1A 5T41A 3O1LA 4GMKA 2I9SA 2NYIA 4EW3A 2MDAA 3DA8A 3TQQA 4DS3A 1CDEA 2ZHOA 1GRCA 3DCJA 2JHEA 4ZYUA 2KO1A 3OFFA 2YWRA 5JJBA 2PA3A 5IT4A 1S3IA 3ENWA 3HHEA 3DHWC 2QMWA 1XTZA 3L7OA 1ZPVA 4TS4A 1UJ5A 1RC0A 2BW0A 1RBYA 2CFIA 2DTJA 1O8BA 2QMXA 4ZZ2A 2RQKA 3TUZC 3ENQA 4QPDA 4ZZ1A 4QPCA 3IXQA 3LUYA 3DC2A 4Q12A 3AV3A 1MEOA 4PWUA 3Q0IA 2CDQA 1RWUA 3IBWA 1YRWA 1MEJA 4ZYYA 1JKXA 1NJSA 3K5PA 1U8SA 3TUJC 1FMTA 1LK7A 3NRBA 1C2TA 1ZLXA 2QRRA 4S1NA 2LVWA 4ZYWA 2P9CA 1RC1A 4M8LA 3KCQA 3OFHA 3UW1A 1ZGHA 4IO1A 3R8XA 1MENA 4EW1A 3W7BA 2GARA 5IT0A 2H9ZA 4ZZ0A 1PSDA 4IQFA 1LK5A 3AAWB 2FMTA 2F1FA 3AB2B 1RBMA 3OBIA 2RQMA 2J0XA 3AB4B 3AUFA 3DDNA 3LOUA 2DT9A 4PZUA 3DHXA 1M0SA 5J63A 5J9FA 1RBQA 1GARA 4ZYTA 3U7JA 1UJ6A 5FIIA 4ZYVA 2QSWA 4NMLA 1UJ4A 3OFGA 1YBAA 2P9GA 1C3EA 2P9EA 2RE1A 1ZLYA 5IS2A 1LKZA 3MWBA 2F8MA 4YFVA 4X84A 3S1TA 4EW2A 4ZYXA 3MTJA 2PC6A 4ZZ3A 4GO7X 3TQRA 4GO5X 3OFEA 4TTSA 1SC6A 1Y7PA 1YGYA 4YFYA 3N0VA 1RBZA 2FGCA 3ENVA 3P9XA 4TT8A 3P96A 2J0WA 2JOQA 3TUIC 5CJJA 3GARA 4R8VA 2LQJA 3CEDA 3MAHA 1CDDA 3KWMA 1KS2A
chains in the Genus database with same CATH superfamily
4ONEA 4HVLA 3EXHB 4I7FA 3PXAA 2CNBA 2X7XA 5ALPA 4AJJA 1O0BA 3PHEA 1A5AB 1NJWA 3AB3A 2DPHA 5DHUA 2PA0A 1KK2A 5DCLA 1GFWB 4NWBA 4MWGA 2COKA 1X2EA 4EG1A 2QN6A 4V19J 2P7IA 2NSLA 3A2MA 3UWMA 2JGDB 4XO0A 2ZVIA 3KU1A 3SEOA 2OHIA 2F7SA 2WMOB 4I1UA 4ZZ2A 1IY1A 1NKVA 1E1RA 2XCPA 3VJLA 1WUTA 4LRCA 1Z39A 1UMDB 2HGMA 3RUDA 5JRJA 2VWHA 1AT1A 5B1DA 1X0VA 3F7NA 3JU3A 2VICA 4LY0A 5TPZD 1XVAA 2H5IB 3GFRA 4RMIA 4IGFA 1QLHA 1P18A 1YU6A 2HZBA 4EA8A 3AAWB 4X3OA 9MHTA 5K8NA 4PUOB 3CT9A 3WRXA 2CWKA 3UKDA 1PJAA 1QS0B 1TTHA 1E9SA 2HWUA 3DCIA 4C97A 1FJ7A 2G04A 4R5PB 4PEVA 2VOJA 3FMGA 1M6HA 1HZJA 5LP1A 4N39A 5JAOA 5AH0A 4HWPA 5EZYA 4I66A 4GMXA 3UMRA 3AA9A 4ECXA 1V9CA 1MCZA 1LFAA 4MA4A 3GGDA 5J2MB 1U8ZA 1A9XA 1S4EA 2MKJA 1I7LA 4L6CA 4IYJA 2AZMA 2OO3A 3LWMA 1JNXX 4JLAA 3IAS9 1TRKA 3N70A 4N0EA 2I65A 2HIYA 3DT8A 1B16A 4DG1A 3LVRE 3NGKA 3L0BA 1UXHA 1IPFA 1K88A 4CCYA 1IN4A 2IHNA 1IEQA 3IMCA 3OY2A 1LTQA 3DOLA 2Y1LA 3VGTA 2DP4E 2CKWA 4RDHA 2JCYA 2JIOA 2WAMA 4EUHA 4G65A 3K1YA 4DL4A 2MSEB 4EG3A 1R89A 4ENPA 2PWYA 4QTYA 4WYLA 1CIVA 2DNQA 3GWZA 4IQFA 5TPWB 4WP8A 1C9MA 2CXUA 3C7DB 4J9SA 4G5SA 1W52X 5IXSA 2W70A 4L9SA 2XZTA 1X7VA 1MT3A 2VHWA 5BSRA 3IPYA 5D7BA 2ZWIA 1XJ5A 4NULA 1TO1E 5CNKA 3OQVA 1XRSB 5BXQC 2BHSA 5CFNA 4LTNA 5IQQA 4PUOA 5KFCA 2YWHA 1E6EA 4QYZK 4UBKA 1JDJA 4P98A 1AU9A 3GLFE 3CUYA 4P4GA 5TJHA 1IJFB 2R0QC 3D5TA 4G1PA 2VHEA 3RYTC 2QLJA 1JIVA 4QUJA 1P9OA 2DNGA 1C0UA 3IUPA 2ZJAA 5IUKC 1KQPA 3ZXUB 3R0QA 1M2NA 5JSUA 1CF2O 5KTYA 4XGRA 1AC5A 1N7HA 5F9MA 5AM4A 4KEAA 1QHHA 4AJ1A 4ZVUA 3H9UA 1U0RA 3CB2A 3SMQA 2ZVQX 3AEQB 4ZEWA 4DUGD 1OFVA 1TJNA 2BEUB 1WCIA 4QARA 1G19A 3VRHA 3TLBA 4KXYA 5K8UA 3N0TA 4DQ0A 3JZIA 4FCCA 1XDZA 1HX7A 2RHSB 4Y6GB 2GIQA 1ZU4A 1UWVA 2FGKA 5BSKA 1UBFA 4CIOA 2YNHA 2H4FA 3AYZB 1OYWA 3RSZA 3D6FA 3GLGA 2OKQA 5FLXA 4G4JA 1B1AA 1Q2UA 2A33A 4Y9SA 1NGSA 3M4YA 5AUOB 4U3JA 3WK4A 1LXJA 1WKJA 1S2GA 4K03A 4C43A 1NCLA 1BMFA 4DR6B 4MV3A 4Z7YA 2IC3A 4U0JA 1O97C 4UXJA 4GH5A 2B0JA 3JASA 5CB6A 2O2YA 4FMDB 3LS2A 2YY3A 1Z4IA 3OFFA 4CR7A 2P2LA 3M33A 5JY1A 2Y0SD 3K4HA 2FVYA 3RJTA 3L7IA 4QUDA 4IIXA 1FWPA 3AHHA 4IJVA 3WYAA 5LLDA 2NP7A 1L3UA 3X1ZA 4XFKA 3FMOB 2QN7A 3OLYA 1GFWA 4DJTA 3WIVA 1UFLA 4U67Q 1XR7A 1FK8A 2ETVA 3FNHA 1JAHA 3K20A 3WIDA 2X5OA 4EMSA 5ETVA 5JH7A 1OB5A 3QKUA 3RHTA 3OKPA 3BJMA 3ZWCA 4PNEA 1JQ5A 4FXVA 1JEDA 4CTAB 3TZEA 3PXUA 3A32A 1J20A 2ACVA 1Y8RB 2XZTB 1RT2B 4UNNA 3HB5X 2NXUA 1EUDA 5DHFA 1ZKMA 5KX5B 1UBOS 4FYWB 3FDFA 3C6UB 1RRFA 4J4HA 2WVCA 1T6XA 5HOEA 3MWFA 4BB5A 2P4HX 1A4UA 1GL7A 4Y2KA 4LMZA 3FTQA 3UIEA 3AUSA 3DFZA 2XCTB 4KN8A 1RHJA 5IVHA 4LMAA 4HY3A 5K6TA 2GRUA 4P33A 3LIPA 4ZP1A 4ALLA 4LY6A 3FJ2A 5C5EA 3CT4A 3WX0A 3EXCX 2KM1A 3I9MA 1N5KA 3P4YA 1ZD9A 4P7FA 3MT9A 1B2LA 2X1VA 4TWAA 1O0PA 1CWUA 4LDJA 2G8NA 3GEMA 3WRYC 4LV6A 3LUAA 2VHXA 4E13A 2BM9A 1IDOA 1JVBA 4FBUA 3WNDA 4WD3A 1JZQA 4A2PA 4ALKA 4YLYA 1UWLA 1UK6A 2Y05A 2YV5A 4F6RB 4BLSA 1LLUA 5HFNA 2B1JA 2IEYA 2JJQA 4UU1A 2QE7D 2IHBA 5IVDA 3LYLA 2FWIA 3ISTA 1SB9A 4YFVA 4OHMA 4ZRNA 2J7KA 1YZQA 5KNCH 4ER0A 1DY3A 1M2VA 4ZCIA 4JLBA 1I7QB 1P77A 4LJMA 3JWEA 1PEDA 1A9YA 3NWEA 3O0DA 1CS4B 4D6XA 4PQUA 4BUJA 3ULHA 2MCFA 3VC1A 5AVXA 2IXDA 2PGJA 1JG4A 5G4DA 1DC8A 1XU9A 3B51X 2Q2WA 3GDWA 1IEWA 1P4AA 2QN8A 1W94A 4PPDA 2XDAA 3VAJA 3R3ZA 3F0TA 5K45A 4E0BA 4D3SA 5I4KA 2R42A 4LF1A 3VKFA 2I5JB 3GIDA 4P2XA 1WCYA 4QL3A 2ZH2A 4H7DA 4DV2F 3EGXB 3JQ8B 2IHKA 4A8YA 5FBLB 2XUQA 5D8DA 3UCXA 1XROA 4TT3D 4D3GA 1FJGF 1YRTA 2HQBA 4JBYA 1VRQC 1YHZA 1ZY2A 3HU5A 7ABPA 2Q28A 4G26A 3RB3A 2NV2B 4ALJA 5FPPA 3DRXA 2DPYA 5ESRA 4U7HA 5DGXA 1FMLA 2JA2A 5M3BA 1G41A 1PW5A 4ZJYA 2D69A 2XZWA 3QU5A 1OD6A 2JX2A 4TMVA 2QFJA 4TV9A 1VCOA 4P22A 2PTHA 3PA6A 1S79A 3DV0B 1F9FA 3KYCA 2FMIA 1P45A 1FUKA 1POXA 4WNYA 5K0LA 4B2PA 1XIVA 1SOAA 3V32A 5FT9A 1Q4RA 1D6MA 2JLUA 3PUXA 4PYKA 8LDHA 1JG1A 2K3IA 5KFUA 4D26A 1PW7A 1RJ9B 3PNOA 4AY3A 3L4BC 4CL2A 1WD5A 4OZ5A 3D6UA 2HNAA 2MLZA 2LCQA 4AJ2A 3WRYA 3BIWA 3KJHA 2O1PA 1IAVA 3HZOA 3A36A 2HDHA 3ZHTA 3NM4A 5DGHA 2CY0A 3I42A 1H2XA 3ZBUA 1XNQJ 1ZPDA 3VNRA 4CT5A 1D2AA 3P9PA 4GX2A 2R2RA 1VIYA 1KRXA 4WLOA 4JLSA 3QU4A 2WLTA 1AV7A 3EWGA 4RABA 3IEMA 4X8OA 2YJ5A 2V5HG 3I1IA 3KDAA 5IXYA 1ZMOA 4A8SA 1HOXA 2VBZA 3GDOA 3AKZA 1S0MA 4Z4HA 1FEZA 1JLQB 2AZ4A 3PQDA 1I3CA 4EGFA 1NB7A 2VFRA 2CMHA 4QULA 1QQBA 1V9SA 2ZOGA 1G7RA 3L7CA 2RARA 2RJ3A 3WYBA 4JIMA 3HWWA 1MIHA 1YFKA 1T05B 5LU9A 5H4GA 4CKCB 2H4YA 1MB3A 3GUYA 5E0OA 1UXGA 5I7WA 2JRCA 1VHWA 5K5EA 3RK1A 4FVCA 2CW5A 3N1UA 1TQDA 4KN9S 4LFAF 4H4OA 1FSZA 2R8PA 4F2GA 3H87A 3AR7A 4PR6A 3IM8A 4FHFA 2EV9A 3WKCA 1QYRA 3CC7S 1HFKA 2Q8PA 2HQCA 3G8SA 4OXXA 1GZ6A 3DKVA 4UVHA 3L8FA 1ZI6A 2EC0A 4HNQA 4L72B 1GPLA 4WK3A 3RYHB 1NXVA 2IZ6A 1U3VA 1WZ2A 3KDSE 3I5BA 4JEHA 2J0XA 3DOJA 1N36B 1U3GA 3B2NA 4LJKA 1MG0A 1SIWA 1BH6A 2QAGC 4V0LA 1MNAA 1NE2A 2XMTA 5KREA 3P9YA 3LFHA 1JS1X 2X0RA 3O03A 3TTXA 1F6TA 4IHAA 4NNPA 4BLQA 3TL3A 5HP1B 3FUCA 3AEXA 2JS7A 5L3SA 2JL1A 3MAJA 3P9IA 4ALIA 4AZSA 3ICWA 2N3ZA 1QKIA 3OTIA 5MF6A 5C2CA 1ID8A 4FJ2A 3OXGA 3ICQB 2WAQD 2AB0A 2YMQA 4KYTA 3RSLA 1NG9A 5EMNA 1T8TA 4YAOA 1XP8A 4NI2A 1RKIA 1T36A 3ZV7A 3B6IA 3JQFA 4DDUA 1SV5A 3T7AA 1YJNS 4NI5A 3THYA 2CQPA 5TGTA 5HMLA 1S7HA 3T9CA 1CZLA 3UMVA 4C7VA 1W4RA 1F2GA 4X1KA 1M2GA 3AXKA 1TMOA 2VFAA 3BPSA 2PO4A 2XO6A 4MR7A 3BMOB 2I6SA 2GKOA 4H18A 4RLFA 1D1SA 1VJ1A 1NZAA 2OG2A 2HU7A 2GUGA 1RYMA 3RS0A 4HH4A 2P8SA 4J9NA 2ATEA 2RAPA 3FYUA 4IWXA 4RPIA 4D0GA 2ADFA 2BMDA 5AW0A 3WO1A 2PUJA 4PZLA 1H6CA 4HMOA 3ML1A 2XODA 4Q3DA 2ZKTA 4KFRA 4EUEA 4Z99A 3C15B 3MTBA 1ACJA 4N47A 1ISRA 2D00A 3DWGA 2IP1A 1W4AA 1WCV1 3B7GA 1J2JA 1ICEA 4P35A 2QSUA 2IXFA 1VPWA 1AKYA 6REQB 3IJEB 3RLFA 3D67A 2HHAA 3BWMA 2OA0A 5IAEA 2IH5A 3VYWA 3HZGA 3O7MA 1Z7GA 2FPHX 5KKAA 2FSUA 2RHGB 3W60A 1HNWB 1OLUA 4GQAA 3I5CA 4BX3A 4O3MA 2FDNA 1F8UA 4HQOA 3LUYA 5G0VA 3ULKA 4LNUA 3NJ8A 4DEZA 2B9VA 4U95A 4RPFA 2AUNA 4FNOA 3HXLA 3KQMA 2DXEA 1Y9DA 4FYPA 2VXCA 4NDZA 3AVWA 4EUSA 1TJYA 1J0BA 3VDQA 2HRCA 3I12A 5LVAA 2NNLD 4MKHA 4UFNA 3VPGA 1RAJA 1DG9A 3OPVA 3N5KA 5JH7B 4TLQA 4WF9Q 1QQAA 3BGDA 2FSGA 3ZCRA 1L7OA 5C31A 1UMBA 5E6UA 4ZO9A 3TG2A 1L7DA 3L9ZA 3ROZA 1ZUIA 3ZXXA 2HQOA 3NDBB 5KFGA 1O9BA 2DAPA 1MTZA 3D2WA 1U2ZA 5AFSA 2JGDA 1EQAA 3PFOA 4L3KA 3OPMA 3JXEA 4GEKA 1ZYUA 3PYMA 3KTQA 1TVKA 4RE6A 1SC4B 1DCFA 1G3UA 4Q3LA 2XUOA 1ISSA 1V7QA 3GMTA 3IQIX 4DF3A 3F3YA 4HK4A 1B73A 2W4IA 2KZMA 5AR1A 3PEYA 4R81A 3U17A 2VJOA 4WLEA 4J0IA 3AG5A 5HMMA 3LCMA 1PVDA 5SY9A 1KXJA 4A27A 3ZCVA 1E6WA 4QBUA 3NBMA 1DV2A 3TO5A 3VR0A 4BE7B 4MROA 1BSVA 2VFSA 2DMRA 2QTTA 4KRYA 2VDWA 1FJEB 5BV0A 1FK9A 4R7TA 4ARCA 2GFFA 1Z0JA 4YIKA 1PFWA 4ETNA 1CB7A 3E2PA 4IV5A 4EFLA 3ORYA 2VJQA 4NEYA 3IESA 1ONBA 2J4DA 5IW8A 4F2PA 2VDPB 2GVZB 1JAXA 1C7ZA 2I4OA 1FRMA 4MSUA 1E3DA 2QRVB 2BGWA 4QAQA 1UIRA 3A12A 5KFTA 4IHQA 4PLYA 2XB2D 2AIRB 1PGOA 3NTQA 3EZYA 4Z9BA 4FWIB 5AKJA 3VF0B 4PSAA 1KC3A 1BX1A 3NBFA 1QO0D 2D41A 1T9KA 4I1PA 2ZB3A 3PGVA 4W5HA 3N5BA 1VXRA 4QUHA 1F60B 1JTVA 1VCNA 1ZK4A 2DFNA 4Z9YA 2P3LA 1G6Q1 5EJ4A 1M5UA 2DR3A 3K0JA 4FN5A 4BNJA 3HHLB 1KHTA 3DS8A 1AGYA 5KYGA 4ZOLB 2XKKA 2H4XA 2VRCD 3LFUA 3MRVA 4YC7A 2FPPA 1KU0A 5JEDA 4F21A 4QPTA 3N2EA 1IZ9A 3HSSA 4XTRA 2QD3A 3HP6A 3L7PA 4RM3A 5CVEA 5JLJA 2YKMA 3AKEA 5IWAF 2WF6A 3NKVA 2NZJA 3NBXX 1JDZA 2RUSA 1P9RA 2W5UA 4R1LA 1PQ4A 2L17A 3EDYA 2HS4A 3LCVB 3M81A 1CRZA 4BJ3A 3OA0A 3HXOA 1L4FA 2FOIA 2IYWA 4F45A 5AESA 3AIKA 3NHRA 4IUBS 1JL3A 3U4QA 2B1IA 4UAUA 4HHUA 1BYIA 4MIEA 3CDEA 4I9HA 5CM8B 1DRVA 3BR8A 1QE1A 1XR5A 2G3YA 1GR0A 3PDIB 4RGQA 3EC2A 2E37A 2DD8S 2EATA 4JJZA 1B1CA 3OZVA 1YMUA 1VPTA 2Z30A 1M2FA 3GLHE 2ZC4A 2P4EA 1XJWA 3DLTA 4E88A 3OIYA 4TYWA 2C5FA 9RUBA 3GN2A 4F1WA 4LSZB 3BB5A 1HT3A 2QX0A 1CRWG 2Q9UA 3PVZA 2H4WB 1Z6PA 4FYWA 5CTAA 3IAM6 5AJYA 3HDYA 4HC4A 2IYUA 1QB8A 3CW9A 2Y2UA 4KHPF 5DOZA 3EVZA 4GKKF 4DR5B 2H4JA 1PL8A 1PZNA 1NR7A 2YL2A 2V8VA 3F7OA 2O1EA 3OQ1A 1H4SA 1OS5A 1VOTA 3GUVA 1GUYA 3AD7C 3D6HA 1KO8A 1K8ZB 3HB0A 3O2IA 3M2VA 2QSWA 1EUCB 4K6GA 2Y99A 5B3KA 3U39A 1D2NA 3VCDA 2N1MA 3CWCA 2UZ1A 1GVHA 1NC1A 3AOAA 5IV4A 2FUNB 4ZCSA 2CUKA 3Q86A 1GIAA 5T6BA 4LHVA 1RTDA 2GD2A 3PACA 3MTGA 5B6JA 3VGUA 2M7SA 5DZ7A 1E4EB 4TS1A 1SU8A 4ZOLF 2G76A 3GGOA 5KT5A 1SU6A 3GCXP 2RHCA 5TLSA 5K0FA 2GO1A 3RANA 4EJFA 1E3LA 2LPMA 1MEOA 4B4WA 4EU0A 2C3OA 1U1MA 2DPMA 3LCJA 4IXTA 1M75A 2PMBA 4CP5A 5H3HA 4YV7A 5HDBB 2PUDA 1J2TA 5JR3A 2Q5EA 1BVYF 1P44A 4D4MA 4G1IA 3QLUC 3T0IA 1M72A 2PS1A 4OI6A 3ZY3A 1EVYA 2FA9A 4B3TJ 2R8JA 2CHFA 3PRYA 4NFSA 4UXIA 2XY7A 1CIJA 1KEWA 2VVTA 3H8SA 3UAZA 5MN5A 2AZDA 3O5TB 1U1FA 2ODAA 1ZM2A 4W8HA 1NSKL 4JV5J 3ZDBA 3UO8B 4R0JA 3A2KA 1OT5A 4PIVA 3C39A 2HVIA 1ETUA 4B3HA 1UK8A 1HEIA 2LXFA 1IWOA 4ZICA 1T9YA 4ZT6A 1CJVB 4HXEB 4LVCA 2I8EA 3M2VB 2J3HA 4HNUA 3TZYA 2LYVA 1NP6A 1GXTA 4U00A 2A1TR 2YNIB 2QVGA 3U1VA 4X20A 5THKA 1JG6A 2X3GA 4JGIA 3AESA 1B42A 1QHXA 3C3MA 3OETA 4EO6A 2FVCA 2EG9A 1ILWA 3BL8A 1QX4A 4WN3A 1W85A 4P81A 3PGJA 3UYKA 5FPKA 3DTNA 2PGIA 4H15A 1HNVA 5DBIA 1R8HA 2FLKA 3OQOA 2IOYA 5KTQA 2Y1GA 4R2JA 2I0FA 5FUXA 2ROGA 4FMBB 2ZRFA 4CN8A 1UP4A 5C35A 4I2QA 1ZOOA 1FX0B 1U04A 4MCIA 2DG2A 2DWOA 2RGXA 2ZTHA 2JBAA 3BB1A 2BGTA 1SV5B 1K4KA 5BRAA 3ANSA 4ESVA 2EKNA 4YRZA 1TK8A 3A6ZA 1UDRA 4DZDA 1QTMA 1TTPB 1OQAA 1A8SA 1WHYA 3HYLA 4RWEA 5JJBA 4UTOA 4I4BA 2DETA 1E8NA 3HVWA 4DIBA 3R4CA 3G2NA 4BBPA 3ITNA 3S8EA 5BR7A 1IM4A 3L6BA 5E8RA 5CH3A 1WSWA 5AT1A 3NUZA 3W2GA 1YE8A 2P5SA 2BLLA 4W1SA 4FE7A 3IR7A 1PHRA 1B15A 1SCUB 4MWOA 4DMUB 1FB5A 1XCOA 3H18A 2NPFA 2WW8A 3F5SA 1V95A 4NRTA 2RK4A 1B99A 2HL6A 4AJ4A 5B7WA 3ZPXA 4YDDB 1CVIA 4ISCA 3R1IA 2PCJA 1F2UB 4R2KA 1WG4A 3PCTA 2MQLA 4OZ2A 3A31A 1UBKS 1GL3A 4ML3A 1L5UA 1XLWA 5K8VA 4P4SB 1ECLA 4NG5A 3QXGA 1VBZA 1YJ8A 3OE1A 3KXLA 2OXTA 1QG2A 3G3EA 3JZDA 2EZ4A 4EJ0A 3JQ9A 1WUIS 1KZ9A 1U1EA 5BN3A 3ZJUA 4PC1A 4ILKA 4EBCA 4C6AA 1IBSA 3HMQA 2WAYA 1E9BA 1EYZA 4E2XA 1SG6A 1Y5RA 4EKDA 4YXWD 2H18A 1I0LA 1BQ3A 2YVQA 5L1KA 3GR6A 1DFGA 5THWA 4FEEA 4JN6B 2C0QA 3K8YA 3FGPA 1ZGGA 4EA9A 2P6RA 4LRDA 1KEUA 2R5NA 1NUHA 3A4IA 3NH6A 2V94A 2XO7A 2OG1A 5H68A 1KZ1A 3PFNA 1T6YA 3MF4A 3V81B 5IC4A 1ZQ1A 3K58A 1P75A 4GKJJ 2DH5A 5HIJA 3C1OA 4Q37A 3FW1A 1Y48E 1R6XA 1Z8DA 2VZ0A 2Y0PA 1EJ0A 3D4OA 3IE2A 3O2NA 3K17A 4V1CI 2FQXA 4BNWA 4DA6A 3TQOA 5AM2A 2IDMA 2DUJA 1GTJ1 2W8ZA 2FQQB 2XSZD 3K5IA 3N8NA 3TBFA 3LY8A 3E5RA 2XUPA 3ADOA 4F56A 1Z0AA 3F9CA 5ICMA 1D4ZA 4ZQFA 3N76A 4Q6BA 1I4TD 3F6YA 1W5TA 1Z5GA 1BFDA 3D28A 4NZOA 5KG4A 2HHCA 1X8DA 3NBPB 3IXQA 3UH1A 4ER5A 1N5RA 1TIPA 1DPFA 1W6UA 3JQ7A 5DO9A 4EP1A 3RIGA 5ALTA 1FJXA 1TZ2A 4Q4HB 4G1FA 4LRXA 2FCAA 2VUUA 1WUHS 5LYJA 1TL1B 3VVLA 1E4OA 3TJ8A 1TZCA 3LGHA 5HANA 1S72S 2REQA 4IOCQ 3AR3A 4KC5A 3BYZA 2C7BA 3UMSA 3MILA 4P8RA 3VJRA 3PNVA 4X4SA 1S1CA 4K9MA 3NM5A 4MGZR 4BP3A 5A5DA 4P75A 5E9JA 4D25A 3NL0A 4JC8A 3KLFA 4ZK6A 2CXHA 3DFEA 1G6KA 3EG5A 2W2LD 1TI7A 1LQTA 3UA3A 4GXTA 2C82A 1S1XA 4I6WA 2W2PP 3HA5A 2FN7A 3JQ9C 2GXUA 4L7VA 3OG9A 5A9TA 5HRUA 4HDSB 2KE5A 3I9KA 1PDOA 3TQQA 1AGNA 1VE3A 3M9XA 2CJXB 3D68A 3GQBB 1I2CA 3ABRB 1ZNYA 2CLIB 2SKDA 1BJTA 4HSGA 4ETWA 4QEZA 2MT9A 2XYPA 1QGYA 4HAWA 1R0RE 3WGKA 3ZTYA 2BMEA 3SXJA 5BV7A 2OD9A 2GIRA 3GNTA 4ZTZB 3BTVA 4LBIA 3B7PA 1SQGA 4XSVA 1PO6A 4WEQA 1WOPA 3E7DA 2GJ9A 1A0OA 1BQMA 3RC2A 3QHQA 3RYIA 3DVRX 1OXTA 2LP4A 2BFMA 4A5OA 2BI7A 1VHLA 4B6OA 4DIEA 4MUEA 2DRIA 2NVOA 1YR9A 4DWJA 5EIFA 1HWKA 3C48A 1Z6TA 4D98A 2WJYA 2DCUB 4MEAA 1M3SA 2AMYA 4QSMA 2JIDA 3MTEA 4EHKA 1EDDA 4A8PA 2Y1RI 2QDXA 3AF1A 1YDHA 3UHAA 4BLGA 4B9AA 1XNQF 4YRQA 2ZC3A 3O3OB 3M8KA 4FEGA 2UYYA 4H1VA 1ZD5A 5CDTA 4L3WA 3VC3A 3PW4A 3ZC3A 5D5QA 5HNKA 2VJNA 3OTEA 5BMOA 1WC1A 3DRRB 2KH9A 3TBKA 4BQEA 1WDMA 4TSKA 1C3VA 5EIWA 1IOZA 1FF9A 3VX3A 4YIHA 1QZUA 2QUKA 3ZKAA 2NO9A 4B3XA 2PSZA 1KSJA 1X7XA 2LUOA 1XLUA 2QVXX 1UCNA 2AJ4A 1T2CA 2Y68A 4GVPA 2GN4A 3LOUA 2Q3JA 2ZVDA 3TFQA 1GPH1 1U1QA 3W2TA 1FQWA 5J2TF 3N6NA 4DFDA 3E70C 1SUDA 3DRPA 4K4TA 3DXBA 2OSQA 4O25A 2X7IA 1X38A 4R6XA 1RWVB 4R7ZA 3QE2A 4UPDA 4S0XA 5TGZA 4B9NA 1PEYA 4AJNA 2WWHA 4A2QA 1ADGA 2X0KA 3VTFA 1HNVB 4LJ9A 2I4NA 4PF1A 2Q5IA 3K3PA 2TMYA 3OUUA 3QIDA 4ZHQB 4F3OA 4PPFA 2DTXA 1GN8A 3KAPA 1YO6A 2ZE8A 3R6DA 4BLOA 3OSUA 3MB5A 1W7WA 2WA2A 2IT1A 3ICPA 1DDGA 4J0EA 4YJGA 1I6WA 2EFPA 4JV1A 1Q92A 4P4LA 3GJ8A 2WABA 1ZETA 4CO3A 3IEXA 1PT8A 4OL0A 4L50A 2BEVA 1NRKA 3PYDA 1ZS6A 4MYUA 5AE2A 3QV2A 1OVMA 1GZHB 3TMYA 2OGTA 4UBOA 2VPZB 5JNWA 2VJAA 4R05A 3TSZA 1VQOS 3R5GA 1E3TA 3R3XA 4DLKA 4NLTA 1XTSA 4C5CA 1KRPA 4GOLD 1LJ8A 3R4VA 4BQSA 4FKBA 3JAMU 3K2YA 2FVPA 2HNKA 3V4RA 1PQWA 5C1IA 5TQ2B 3EXEA 1TFRA 3G82C 3TUIC 5IM5A 2AFIA 2YHIB 4Q18A 1J8FA 1GUBA 2ZR8A 1H2AS 1QOQB 1E9CA 2FPSA 5LR6A 1N0VC 1Z88A 2HNYB 3HHEA 2NV0A 2QVCA 3EEYA 3AKCA 3KKMA 3Q2TC 4E94A 2V4QA 3KBOA 2Q7DA 3EW9A 1XJ0A 5J2TB 4BNHA 5BMVB 3A1CA 4Y0NA 1IB0A 1FP1D 2R7MA 3NBYC 4WSOA 4QXOA 2HWYA 1DQYA 1VLLA 4NYMQ 3HUUA 4UJ3A 1J07A 4MKYA 4AM8A 1E92A 1JSRA 1Y3JA 2HIAA 3OZAA 3GPAA 5F5NA 1DQNA 3NATA 3DT9A 1UJ4A 1TQ2A 4WBSA 5IJ9A 4JNCA 2X5KO 3KDOA 2R7UA 1M6VB 2HZVA 7REQB 3G7NA 4X94A 4DV7J 2A18A 5JI2E 4P6QA 3TA0A 2AFHA 3Q40A 2O01C 3PNSA 3ANLA 1WB9A 4C8YA 4K9RA 2ZRBA 3U09A 1LA2A 3RU9A 4F72A 3U62A 5U9CA 2C58A 2JEFA 1NRWA 2GMWA 2JDID 4Q4CA 4MW5A 3CNNA 3RS5A 1JLKA 1NATA 4RVSA 3EXHA 3BF8A 2ZSJA 3FWNA 4C21A 3R0XA 1D0SA 4ACAA 1YQEA 4P0PB 4UFPA 3VR5H 1J9ZA 3GIKA 5EHZA 3UGQA 3KEOA 4WBXC 3H5OA 3CLVA 5BVHA 1Y5MA 2X5XA 5I8PA 3OIVA 2C2HA 4HH3C 1QF9A 1QO0A 4WU2A 3O3LA 4NBVA 1UMKA 5KTMA 4JI5F 2X0FA 1N8RT 2IYQA 2RIRA 3F4KA 5CFOA 4MCJA 3TKAA 5H9FJ 2W24A 3NQ41 3NUQA 3V6KA 4TS9A 4FC7A 1L5HA 1UEKA 1QMPA 3V97A 3JSAA 5L51A 3HM2A 3LRPA 3HR4A 4N3GA 2FKNA 2WD9A 1T2UA 5IM0B 2PBLA 3MFIA 1N34J 4RWWA 1U2DA 2VSFA 1Q1NA 2VTDA 3KVYA 2F62A 1OH5A 2PMEA 2VG6B 3QJLA 1A6LA 2I3GA 2BTQB 4B76A 2UUCB 2KS6A 1TQ8A 2IEZA 3T1YB 2YN0A 2XQKA 3S2FA 1PGQA 2OQVA 1QGOA 3JTEA 5D3MB 1BEEA 3AR8A 1NI4A 4MVJF 2H2IA 1VHIA 5J4LA 1XMOF 4IO0A 2DIVA 4MVCA 3RIMA 2Y92A 3ZTOA 2QA5A 2P6PA 4G63A 1C29B 4ND3A 4E14A 2BTOA 5C1PA 5HAOA 2IYTA 1QANA 4NLPA 5DLDA 2ROEA 1TU4A 3I2GA 3HU1A 4ZQGA 4C9DA 3AJ1A 1CS0A 4PO9A 4GUDA 2BQUA 4BAGA 5BNZA 3PPIA 3ZJ4A 3BEGB 4N41A 1NY6A 4BP9A 4C8ZA 5JPIA 2EXUA 4NARA 4B4UA 2XBLA 1QZZA 5JG7A 5ICSA 3DGEC 3OBIA 4B0OA 3VKHA 3OTOB 5BYAA 4ZD6A 3QELB 1BDMA 5JQWA 3V1TC 4IFEA 3MEKA 2OXFA 4XDDA 1K0UA 4GLOA 1RLJA 4Z6KA 3O8QA 1GH8A 1CJUC 5DSZA 4IIYA 3AM3A 3G2OA 5JNUA 4TWIA 1RYNA 4INAA 2D1CA 3EDOA 1AQUA 1THTA 4QD3A 2E5WA 4U2BA 3MGAA 1JHXA 2VNKA 4NG4A 1E5TA 3QRPA 3M8YA 4TKVA 5T4EA 2YY7A 3E9ZA 3ZWPA 4RPJA 5H80A 4PFJA 4BO2A 1UETA 3LDUA 3KQOA 3GT4A 3VKWA 2QAGA 4ZIVA 5AM5A 5KG2A 5K8LA 4OX9F 1E5QA 2PWPA 1OPRA 2LR0A 1H74A 3PKIA 5ITZA 1FKPA 2QRZA 4NZ6A 3LT4A 3H8VA 4R8MA 3A3PB 5JBQA 1ZH8A 3H9CA 3B2QA 2KWIA 1Q0ZA 1MTOA 3GRFA 3T15A 4IILA 2DRAA 5KOXA 1N2BA 4YCLA 2ZUCA 5FYQA 2F3JA 4M0FA 3HWX1 1J24A 5CLJA 3WBZA 2KT5A 1WCIB 3RSSA 1ZJ6A 1B14A 2J8AA 2IZOA 1X4FA 2HI0A 2H2DA 4CUJA 3JQFC 1EFTA 4YDXA 2B0CA 3I0RB 1IEXA 4B8ZA 1DKMA 4OIFA 2CLLB 3QVTA 2FB0A 4JBIA 3R5XA 5T3UA 3RAEC 1ISFA 5F33A 5TGDA 1EWQA 3VDNB 3ODGA 1CYDA 1RMYA 1E9FA 3AO0B 2GGPA 3QLVA 1ZD8A 4DN6A 3N28A 2DBYA 5DLFA 2V63A 2VP2A 1NM2A 3DTVA 3CRZA 1NPRA 4DM4A 2WMYA 3C97A 3PX2A 2P5UA 3KT8A 4YHHJ 2BKOA 4YB1P 1W36B 1BX3A 2VA2A 4GL2A 3J7A1 3UHOA 2VOPA 4V3CA 3TTWA 1NA5A 1T24A 3HBNA 4MIAA 2F9LA 2J3KA 1ZS9A 4URHA 4N7JA 4ZVEA 4IOKA 3WISA 3E81A 4XX1A 1SCAA 2X2PA 2C1EB 4TTTS 2VSOA 5IEBA 3BRWA 4LFBJ 4OXIA 1P0PA 4IIHA 3NETA 3SIPB 4LPKA 3GJ6A 2SKEA 3HY4A 5DYYA 5DFAA 4X20B 3DOLB 2H3EB 3FBEA 1HLDA 1T3SA 1VQLS 5IYZF 3W3AD 3O4FA 4ZLJA 3I01A 3QWBA 3C6UA 4ZCTA 3P9ZA 3SZMA 4UW9A 3VPAA 3JD1A 3KKLA 3D8SA 5C2JB 4Q8FA 2Q2NA 3NMUF 1FRVA 3UHFA 5TMEA 1RHRA 1WXEA 4C7XA 2H48A 1XTKA 1S9EB 1GMWA 3S01A 2M2IA 3W5XA 4HGYA 3BF4A 4KGXA 2AYYA 4RUAA 2W2KA 4C03A 4RSMA 1REVA 3Q7PA 1W1IA 4EOGA 2HVEA 4B6PA 1T9WA 4F0KA 4X1YA 1IKXB 3H19A 4YASA 3ETNA 5CYGA 1VQMS 3UN3A 4FOOA 5JLAA 1RDRA 4G1QA 3GBPA 2HGNA 3BUSA 1YB1A 3DWEX 4R2LA 5LQUA 2P2NA 2FOXA 4IDEA 3HSGA 2DR7A 3E1GA 3EVEA 4QDKA 3UQYS 2ZWPA 2B9YA 2DGUA 2ZH6A 1IHDA 4AQYB 1ZGBA 2ZBPA 2FSFA 3DO8A 3EDCA 4QELA 2LDXA 4EB0A 5K99A 3CCUS 3SHQA 4AXXA 3T5KA 1VQ9S 4F2RA 4TN5A 3IBTA 2ZBCA 1LI5A 2Q4EA 1T5IA 2GASA 3K0BA 4UARA 1IY2A 5DW3A 4CMCA 4C7OA 3Q6NA 3PD1A 3TL2A 4KGKA 2XVMA 5CT4A 5E7QA 3UD3P 1NKTA 3V4IA 5AI6A 3T5AA 3MPOA 2XNDD 3EDQB 3JWIA 3UTDA 3KD3A 2POCA 1FFYA 1NNEA 1WEKA 1MMFB 3BS9A 2E48A 1CE8B 2IY5B 3DI6B 2HBQA 4XIYA 1RGVA 2Z58A 2IJRA 3X1XA 2EX0A 1IOLA 3D4JA 4RUKA 2Q50A 3TLGA 1DARA 4MRSA 2TSYB 2Z8ZA 3W0LB 4FCTA 1RQNA 1Q8BA 3B52X 2XGOA 3D1QA 1OAAA 2FPIA 3A05A 1PG5A 4OZLA 3X2EA 2BRUA 1WRBA 1NZJA 3QE3A 5BO5A 4CL3A 1DTQB 2C1ZA 2AJ0A 1R9MA 1IH8A 3OQJA 3VQSA 2ADBA 1V71A 4MQ5A 5D2CA 3F71A 1GTEA 2WSBA 4ZQIA 1HLPA 3TL6A 1I3NA 5AQ1A 2P1ZA 2PT7A 2FMUA 4R5PA 1I4EB 3PQ6A 1HW8A 2CXTA 4J2HA 5IS2A 3U48A 3BSCA 4TX1A 3U31A 3GIRA 1IQUA 1RI7A 2WV9A 1J5PA 3HVJA 3IC5A 3KUGA 3ZBTA 2QP4A 3JAWB 2R1VB 3MW8A 4M0UA 2IW1A 5TPWA 4J3JA 4Y6SA 1D8TA 4XTCS 2QTWA 4GBED 1BO6A 4F9EA 2AUTA 2G9VA 1D7AA 4E07A 2VBFA 1RWVA 2EAUA 2VDOB 3VZHA 1GG9A 4U6SA 1RHUA 5EWJA 1ZH4A 1KAMA 4AW9A 1Q5YA 3E7PA 1SQ0A 5IJ0B 2EKLA 4EL0A 2WSMA 1S8FA 4EB6B 3WGHA 1RQRA 1G1XA 1K7CA 5DEOA 5A0TA 1JJCB 3BMQA 5IDXA 1KFBB 1XZQA 3ZIUA 2MZTA 1HA3A 4QPJC 4RL6A 3SHWA 2PG3A 5AVWA 3ZVMA 4BNUA 3PFEA 3TOZA 2ZCJA 2DISA 2B4TO 1XI2A 3B1XA 4BZXA 3U7QB 4KR2A 5LBTA 1MOSA 1W8IA 3C8ZA 2WF8A 2HXGA 2PMWA 3HRKA 3VM6A 1XQYA 2MIIA 4IG0B 1GQRA 2YNGB 2RD5C 3UMMA 5C9ZA 4DTIA 1IHYA 3NAIA 3SC2B 1MN6A 3VVBA 2UXBB 1DAHA 2ZHBA 1GCOA 2J08A 3NNCA 2PYZA 3FFWA 4EYEA 3ZUPA 1SI9A 3BWVA 5JUMA 1W9HA 1YACA 1TIBA 3TM5A 1V25A 4PCQA 4RV4A 3NCRA 4RW6B 3K16A 3R7WA 1FA9A 4OJYA 1APBA 1K1EA 2QTFA 4QOJA 2CL5A 2R5WA 4DR3J 2KSQA 3QGHA 3CJ8A 1NTRA 4O4HA 1DIGA 2B34A 4LTDA 5AVJA 1YQ9A 1VPDA 2H5JB 1Q8KA 2HSZA 4FYMA 4D0RA 4MUYA 5TEVA 1OLUB 4FYJA 2WSFC 1F51E 2CNKA 2VDKB 3G2JA 1H0RA 4WBFA 3O4JA 3QLUA 4RW6A 4BO0A 3QX3A 3DM2A 1YZ3A 3MM8A 2H00A 3IIJA 1VJGA 2BOAA 4LXUA 4D3FA 3N2ZB 4MKVA 1R15A 2ZRNA 3M6UA 3UCUP 1PRYA 3KUHA 2D5BA 2B56A 3JSBA 2H31A 4DNFA 3FN4A 5KNCD 2QP9X 5K1ZA 1GTVA 3L02A 1XRPA 1TAGA 3BCRA 3ZHQA 4J0DA 3PG5A 1VLJA 2ZSAA 1LV8A 1VLVA 4Z37A 3PCRB 3VOTA 2CLFB 5JSZB 4V0KA 1EVJA 1ZXXA 2ZZTA 4YREA 4OJNA 4L27A 3DE2X 2SNIE 4EH1A 3BXZA 3V8EA 4GEGA 1J5EB 2NUPA 4NYIR 4IV0A 4NOLA 1IBLJ 4BNVA 4UD2A 1V5WA 2LWIA 1LX7A 2ZXUA 4O4LA 5A2QU 5TARA 3HBLA 2FG6C 2P68A 1Y3BE 4YNBA 3QMVA 2J7PA 1TTQB 2UU9B 2OCIA 2O3JA 1N52B 2WWFA 1QS0A 3M6WA 1LI4A 1HYBA 5AW1A 4JUZA 2P8JA 3BMNB 3FOWA 2IS2A 2O8BB 2YZKA 3VYTB 4YY3J 4WKNA 2X77A 1T91A 4UUNA 3FLMA 3KR9A 3CRQA 2OMEA 4CI9A 4G4SP 4GUAA 1WL8A 1GNLA 1XXHE 1T2VA 2HLPA 2H51B 1JI0A 1K9SA 5D0EA 4WFZA 1KD1T 1C7IA 1CUIA 4ZAWA 5CIWA 1ORDA 4RJJA 3VSBA 3DF9A 1OIWA 4ES2A 3WRWA 4MUIA 4KB7A 1XD8A 2N46A 3GJ3A 3DWIA 3SSSA 3SR4A 1NF8A 3QXSA 3OPXA 2IOQA 2VPPA 4DDHA 4DEVA 4G0OA 5B09A 4IDOA 3RUBL 2W93A 1FFWA 4KDFA 1AGPA 1L7NA 5AUPB 1T8RA 2KVQE 1UC8A 4CDGA 3QYJA 2HJWA 4QJ5A 3O4VA 4DQLA 3QMPA 3FSEA 3EIQA 2B51A 1PLKA 1HO3A 4M0EA 1B0VA 3W5IA 2JFGA 2OBLA 3BTUA 2X3YA 3WIOA 1S97A 2DR8A 2X9VA 3CX3A 1K0VA 2HQ3A 3VWSA 2JHCA 4RV9A 1AA9A 4DQRA 2YCBA 3NTVA 5IFMA 1S8NA 2QPOA 3M9LA 3C7CB 2UXCF 3L46A 4TKUA 4IS2A 3S2EA 1UDWA 2ZBFA 4D3HA 4PXYA 1BXGB 4DRXA 3PITA 4F12A 4CM8A 2ZE6A 1KJQA 4NLDA 1C1XB 5M2RA 4P2SA 3I37X 5GV8A 3RK4A 4B44A 4YB8A 1AK2A 1IY8A 2KFZA 1EFRA 1PAUA 2XYVA 4JYAF 3FG9A 3D6MB 3ICOA 4OU4A 2YNIA 3INNA 1IMJA 4TQUS 1Z35A 3T7RA 4QGHA 3ASZA 4Y2AA 2BM8A 4CT4B 3CMCO 2YQ4A 1IN7A 2VKTA 1ES9A 2ZVSA 3ODPA 4N77A 2QRVA 5D3GA 3ETJA 5ETQA 3I83A 3LUPA 1S7CA 2YBDA 4I36A 1RW4A 4Z4CA 3RVKA 1E2UA 5JIBA 1CVLA 2W8KA 3FYCA 3LUGA 3PFFA 4URVR 3CNOA 3L1HA 4WJKB 5TQ0B 1G8HA 5FTMA 1K7YA 3ETDA 1E4YA 2R8YA 4G5HA 3ZNJ1 5A04A 5EWLA 3BWXA 1RCXB 1OX6A 4X0EA 2QRKA 2PN6A 1N1MA 1A77A 2Z58B 2HVDA 2GEBA 2OVBA 4F26A 3UY4A 1CE8A 3CX4A 1Y3DE 3UNXA 4G0WA 4CV2A 4CO2A 3LC1O 3IUBA 1IFXA 1UPCA 5LNK1 5JCOA 1CG6A 3HV0A 4GX5A 4HAUA 1A9SA 5DJBA 3QMMA 2DT9A 3GJ4A 4EM6A 2JVOA 3YASA 5FNVB 2TMGA 3ETGA 3ESYA 1CPZA 5FL7A 5DLGA 2MTLA 2H4YB 1WHSB 4IHJF 4OAPA 3EGIA 4UVDA 1G2OA 3VAFA 5EUMA 3CRRA 2DTEA 2QM8A 1BJRE 3QI7A 4TUYF 4IJQA 2V4JA 1G8MA 2IH2A 1CBUA 4FDFA 2VK1A 1R6BX 3FBTA 1G8SA 4LNAA 5I5EA 1VC5A 4MINA 2WB2A 1SMKA 3ZD8A 4AS1A 1XJCA 4FJ0A 1FNBA 4TTRA 5U4XA 3QKIA 1AQIA 2R44A 4C08A 4CMGA 2FGJA 5FLEX 1J4AA 1XZAA 3RUEA 3G5MA 3DUWA 3CRW1 2Y6VA 5LJ3Y 3J80Y 2YWWA 2GTPA 2R8KA 2IA0A 3Q5GA 5HQTA 2WNHA 4OX9Y 1IBCA 3TJZA 3A3YA 3QI2A 4ZT4A 2FMFA 5DLYA 2W2MP 3M5PA 1K3UB 5FWYA 4PANA 2A88A 4CIWA 1Z5WA 4FILA 4L22A 3WX4A 3EXYA 5B1HA 3MT7A 2OB2A 1WSRA 2V9ZA 3MMSA 1WEZA 1NFRA 4C06A 5AVRA 3C3LA 4JFAA 2C7QA 3QKSA 4YBRA 3BXXA 8ATCA 1GTSA 1LW0B 4DSOA 1X9MA 2GS9A 4BQNA 3PCXA 5K6RA 2QL7A 3M1LA 5D5PA 3OE7D 1F0XA 1U7DA 2P1RA 4ZJOA 4DV6J 2UZ4A 1DJPA 2GNOA 1JJ7A 5JCJD 3G2KA 4RF5A 4Y2RA 4X92A 1W19A 3AVQA 3P45A 3S6EA 3O9VA 2AFVA 1NV9A 4ZVTB 1P0IA 1SH3A 4BGVA 1LF5A 4ZO7A 3LYUA 3R3JA 4ME6A 4DCPB 1U0SA 1ZU5A 4JHXA 3KELA 1X7YB 1EK6A 4DSIA 3M3PA 3HA3A 3S8SA 4Q9JA 3ONWA 3DQQA 1TP7A 1TVMA 2O7RA 1E6YA 4D41A 2IBOA 2C03A 4CQNA 5F1PA 4FKMA 5ALIA 1ADBA 1KYTA 2JH9A 4PW0A 5D5HA 4H7HA 3C3EA 3CE9A 1UFRA 3PYEA 5E4TA 2IPNA 3O8RA 1IR1A 2E3JA 4K4XA 2PJZA 1QG4A 1FVOA 3JVIA 5EL0A 3UO0A 4J6EA 3G86A 2JI7A 1RJ9A 3KZNA 3HE3A 3OFEA 3AHPA 2DNHA 1LLQA 5U1PA 2WIDA 4GRDA 4IIBA 4O4JA 2BL4A 1B74A 3UJAA 1HWIA 2OESA 2OB1A 4YRJA 4BFUA 1RAFB 3I3OA 2BJDA 4GYWA 4EW3A 1QAQA 3RUFA 2ORIA 1ZIOA 1L5SA 2WT8A 1XXHB 1O4VA 3W5YA 1YZTA 1L4LA 1KVSA 1IM2A 2J0UB 4DFMA 3II6X 3BSNA 4A8WA 3L7OA 1FRNA 4YI3A 2J3LA 3PFBA 2UXCB 2F3QA 2BEWA 1HE5A 3GHYA 4DV6F 3FNGA 1RBAA 2RUGA 2G80A 2R7AA 2HLHA 3IMEA 1N8SA 1IBKB 2EX4A 3GAAA 2VFVA 6PFKA 1CY8A 2XSJB 4EJSA 4UCQA 1WR8A 1I4LD 4HN4B 4CM5A 4PZVA 1RP5A 4NH4A 4ER6A 2FY8A 5DM6Q 1JLLA 4CEJB 2EL9A 3SCLE 5BW4A 2F4VF 2BEFA 1JNYA 4U2CA 2QI9F 4KR9A 3N2IA 3UWTA 5HDQA 1LWOA 3FR7A 3V8RA 1P81A 3NBZC 4URSA 2WDZA 1X3SA 1QK3A 1PLLA 2ZB4A 3A6EA 1TYEB 4ZPDA 5AHWA 4PQEA 1T0PA 5IT4A 2PRKA 3FHJA 1MMNA 2R66A 5DM2A 4S04A 5CT5A 1U2TA 1O5JA 1MO6A 4YWHA 5E7IA 4QQ8A 3DD5A 1MPTA 1XX6A 5GADl 1R0LA 2NUAA 2V0CA 4QNNA 5E3AA 4UDOA 1RWUA 5CVJA 2H08A 2W90A 4X5OA 1JEYB 3QFHA 1ZIPA 3HFSA 1NDCA 2LXUA 4H0FA 2VC2B 5CCMA 3VU1A 1J0XO 4K4VA 1N0UA 4NX2A 1GNRA 4XK8C 2QIOA 3K5NA 3LHKA 3TD2A 1USUA 3IIIA 1V48A 4EAQA 2FZKB 2VDWB 4G07A 4OHYA 1FDNA 1NAQA 1S6QA 3O8DA 5JVGQ 2Y1LB 1W44A 1S1UB 3AK4A 4MYHA 2H16A 2QGFA 3V6DA 1X31C 1XRNA 3TQSA 2PZLA 3QOFA 4H4OB 3M7IA 3ZOKA 4HNRA 4JJ6A 2QF7A 3A3NB 2A9VA 3QF7A 5GJCA 2CUZA 5DNYB 5KKNB 2AN3A 2OPQB 3FHCB 4LXQA 1QP4A 1GADO 2VQFF 2NZWA 4DQSA 1LDEA 2MMYA 4LREA 4MJKA 4YJGB 3DYAB 2AEJA 2PSEA 4YECA 4AMUA 2QC3A 4TMZA 4B4VA 1C3XA 3VKVA 2PZGA 3C43A 4BO9A 4ZDJA 4YRGA 4M98A 2QLLA 5FIUA 1BMFD 4QCLA 4NV3A 4Q01A 1Y6RA 2WSSD 4WAUA 2PT0A 5DGTA 3V6MA 3NWOA 5FOUA 1UMCA 3MMAA 1XC7A 1ETHA 2OBXA 3AUAA 5ED4A 4WW0A 4CIBA 1N3IA 3FVQA 2N1BA 3PJRA 3EXHC 13PKA 2YJ6A 3G0BA 2VEOA 4QIWD 1E6MA 2KM8C 3IR5A 1SHJA 3T7KA 5FFFA 2J6TA 2VBYA 3FBBA 4E1BA 4DFKA 3HR7A 1UVMA 3CJQA 2JJYA 5CRIA 3KV3O 3E5NA 4L73A 1P1TA 1WZEA 2CPZA 4B45A 4LE0A 1V0JA 1KDVA 1NK7A 2II6A 4X45A 5DYNA 2EU8A 3HUTA 1H3DA 5C52B 5L9XA 5BWOA 4WZQA 4BB0A 3M32A 1U94A 2IITA 3WK7A 4ES3A 3TPFA 2EFVA 5E2BA 4PXCA 3E05A 3LA0A 3U3ZA 4LF9B 4M95A 2MY7A 4OBBA 2O7SA 5FH9A 3OL8A 2O8DA 2JA1A 3BSFA 1JHRA 2CVZA 1NDUA 4OGFA 1D6SA 2XKAA 1E2JA 4HEQA 3DOOA 1HHQA 1M8KA 3KSBC 3WLHA 4URWR 1U2QA 4LSWA 1ABFA 1QYCA 3DYIA 5L1LA 1R4MB 1WELA 3ZU2A 2LIPA 1Y3IA 4DYHA 5JQGF 1PBNA 1L8OA 4W8OA 3FTEA 3KTOA 3TVYA 4MP6A 1Y5NA 3SS7X 1Z7BA 3T94A 4DYVA 4UREA 2L41A 4HRXA 3OU6A 3QEAZ 4KQIA 1IXYA 3GYXB 3KJNB 3VO2A 1M0SA 1C5KA 2YR0A 1ODFA 4KKOA 1WXGA 2P3SA 4XVUA 2GXSA 2XTMA 3R5JB 1FXSA 4PQYA 4DL2A 1IBKJ 4LW8A 1JXAA 1NN5A 4AQDA 5RUBA 4TLCA 4A16A 1U5CA 1Q15A 1RPZA 5D6OA 2V50A 1PTKA 3IQDB 2KM8B 4NNJA 3A28A 2VXOA 4GZMA 3KRTA 1QRDA 1JU3A 4K9LA 2OD6A 2PO7A 5EQFA 5D01A 2F1HA 3JXOA 2M52A 2Q66A 4H7PA 3MGBA 2H06A 5D6NA 1MBZA 1BXGA 3CJ5A 2JJ1A 2B5WA 5F52A 3B8HA 1ESNA 2KLHA 1P0FA 1YRLA 4KR6A 4Y2IA 5K5MA 1CB0A 4Q3CA 2DPJA 1Z0SA 3ANXA 2V03A 4JROA 4X4RA 3TLZA 3AF0A 2HNZA 4CKWB 3IWNC 4QOTA 1FT8A 1L4KA 4UTRA 3ZI4A 3RB4A 2OELA 5CFQA 1DEKA 3I61A 1I4WA 2XCQA 5E4FA 1AXEA 3VR1A 5GIOE 1KOFA 3F3SA 5DNWA 2O0LA 5DHTA 1ZH6A 4QDTA 3EMTA 5ADVA 2FFBA 2HDWA 2QN1A 4HDRA 1J9EA 5IKPA 4AF8A 4LKOA 1DBIA 1TKBA 3C6TA 2QLBA 1TUEA 4J16A 3IT2A 4C76A 4ND5A 4JUFA 4CKZA 3UJ8A 1NNUA 5I7VA 2ZTMA 2WYOA 4KQ6A 2DIUA 2M0GB 5B30A 2E18A 2Q6IA 1VQ1A 1CR4A 3W5VA 2SCUA 4MRMA 5BR8F 1RB0A 7AT1B 2HAEA 5CHYA 5CGQB 5FOQA 1E3WB 4NBLA 1ND5A 3SIRA 5FWAA 4Q7KA 1MH9A 2O0JA 2IUUA 3RQSA 4XCQA 2HBRB 2GFQA 1M6YA 1GHTA 3LF2A 4XYBA 1OIAA 5JWRA 2VP6A 4C7JA 3P49B 1S57A 3V1LA 2B30A 4COOA 1ZJWA 2HY7A 3GLVA 3O2QB 2NN3C 3HV2A 1OXVA 5JRZA 2C7GA 4R40A 3HXMA 4Y2SA 3M3HA 4E7PA 1RTHA 1XRMA 1SCKA 3NHUA 3HNPA 1TV6A 2DU8A 2W7TA 5F21A 2BGRA 1NEEA 4N5SA 5E7MA 4OLFA 2O8DB 1N57A 2C9CA 1WDKA 1STOA 3L7JA 5D4OA 3HGQA 2ZYTX 3LAMA 2EFHB 3B8EA 5C37A 2UAGA 2O5DA 4ZTUB 3TFWA 1PK7A 5MGNA 1QTQA 2D1YA 3NWJA 1Q3KA 4RKUC 4CETA 1CU1A 3R7WB 3CVYA 3MRXA 3E2MA 4K6MA 4JI6J 3CD0A 2RG1A 1Y4UA 1X8KA 1JR3E 1ZHOA 3S1AA 1AA1B 5ETJA 1SPBP 3I58A 2XJ4A 3HMJG 4Z9AA 2I1QA 3I30X 4D42A 2VF4X 4Q3OA 4BU1A 1U0JA 1H9AA 3IT3A 3IB6A 1U6IA 1NXSA 2PD3A 2GERA 5JS6A 3OZEA 1T0UA 2W9BA 3G0IA 1NBMA 1AM4D 4XARA 2O20A 5FCDA 3ZWAA 4M1YA 3ZZ1A 5EJMA 4CDIA 3V8NA 2R8OA 1EFHA 4BN5A 2CPJA 2P41A 1HWUA 4KE8A 4C4YA 4MKGA 5BQFA 4BVJA 2IXBA 2JIZD 3QKSB 3CURA 4L0DA 2XMKA 3T5LA 4DPWA 5TMBA 1Q53A 1SZDA 1LPPA 2AHRA 2AJFE 1O51A 4CKYA 2PBZA 3WXMA 4W5WA 5GOZA 2Z2YA 1CR1A 3MN1A 1V11A 4HQ0A 5I42A 4CDMA 3ZGVA 1ZK1A 1NLKL 2HCBA 3NLLA 4F25A 4KGMA 3GGSA 1F2UA 1S3SA 4DR7B 5HLFB 4EF6A 2FN4A 1LWXA 4FOLA 3K09C 2HK8A 4NA3A 2VJKA 5JT1A 3R20A 4D0SA 3DOMA 2E4VA 2GN8A 2NM0A 1T43A 1SCUA 1AN0A 1S1MA 3K57A 3OECA 4WE1B 4PZPA 2WKWA 3UVJA 1JXVA 3UAXA 3EM1A 3UWDA 4RLEA 5I3QA 4Q48A 3J80A 1EA7A 3OUYB 2A5GA 1RAHB 5A6WA 1YAJA 1RTIA 1BWQA 5ALMA 1X94A 2AG6A 3OOSA 3GCDA 5DE3A 2X2EA 5AJZA 2LQ9A 3GX1A 1KH1A 5CA5A 1E1MA 1A8UA 1MWZA 1CQWA 1UPMB 2HNZB 4CKWA 2FJ0A 1FTCA 4D3ZA 3EA5A 1T4GA 3OVSA 2GPBA 2FDCA 5FV4A 1IE3A 1K5PA 3VDRA 5KC8A 4DEYA 3CULA 1LWEA 2GBFA 4MH0R 3GYGA 2QJWA 3SQXA 4F8RA 1CHDA 3DMPA 1ISPA 2QTLA 3AOEC 2XTZA 4LI0A 5FOSA 1S7IA 2RDIA 4EECA 4WTYA 1U45A 2NR0A 1G5IA 2GCNA 3VZDA 2WVHA 1WDLA 2FPWA 3POTB 3DOCA 3SSAA 4JL8A 2GO9A 1VPVA 2CLOB 2V96A 5CVVA 1HD1A 1K2WA 3X3HA 1YB7A 3PNBA 4B73A 2G77B 4LSGA 1J42A 1PGPA 7GPBA 2OPHA 2AKEA 4DU8A 3KXKA 2LD4A 5C25A 3D6JA 3JQMA 1IKYB 3C16B 3W5DA 1COWA 3PJEA 5JSFA 3C7TA 1ONSA 2G0NA 4IIEA 3TPCA 1WOOA 1HE4A 3GP9A 3RVBA 1GPKA 4JYBA 2XY4A 4CLUA 3PD0A 5KEIA 2ZH5A 5DZSA 2UYQA 1LVGA 3SXUB 3TRKA 3VU0A 1D2HA 2BBWA 1XOIA 3B82A 4DHVA 2RS8A 3UFBA 4BWJA 4Q1CA 4LECA 2WWGA 3T4EA 3GCXA 1RMQA 3TZ6A 3I76A 1R74A 2YJZA 4XASA 2O0KA 2XB9A 3F6PA 1T9UA 5D15A 3TXYA 3P0EA 5EWGA 2V7WA 3FUVA 3QU7A 4KH1A 4ZVKA 4RS3A 4LQCA 2RRBA 2DSTA 5CJPA 5KFHA 1M0TA 4M1MA 1XMOB 2AG0A 5T6MA 4AP5A 3IKMB 4TM8A 3N6LA 3CXRA 4ED1A 2LKZA 3L3CA 2V6BA 2YQ0A 3IFSA 4PO1A 1GJRA 1JWAB 4F0MA 4ARUA 1ORWA 3EDQA 5DNAA 1LBEA 4I7FB 2Q9AA 3H99A 1OLSB 4ZAYA 4Z4FA 1NE7A 4POOA 3SVLA 1E9EA 4B74A 4DCSA 1E1DA 2O2IA 4H4CA 2XM3A 4NX9A 3HEMA 2PX2A 1XZKA 1PTJA 2F1IA 2DEIA 1ULTA 1V43A 3RE1A 3KUDA 3CVWA 1Z22A 4TVAB 5DHAA 1V11B 3PEWA 1JLBA 1H2HA 4O4IA 4NEZA 2WOJA 2C7PA 5D7NA 3Q3JB 2CQBA 2FJPA 4BNYA 1FSFA 2EZ8A 4BMYA 3W1YC 2JFBA 1S6UA 1Q11A 3AEUB 2WJ6A 4UUBA 1PV1A 4X62F 4DG9A 3OT1A 1IXZA 5CYQA 1G0OA 3NT2A 4J9MA 1N32B 5KFNA 3RJZA 3UXMA 4HKTA 3OE7A 2A9PA 2P4QA 5DRYA 2RDMA 1QPZA 4EG7A 1JHAA 2DHDA 4B3MJ 5KOHA 2YKPA 3LRTA 3EVTA 3TE7A 1U7ZA 3GNLA 3U1NA 1E8DA 2ZW9A 5HLFA 1SY7A 4N5MA 3WB2A 4ZARA 4G0MA 1KZ4A 3R6LA 3R1LA 2FW1A 3EGEA 1LBHA 3GGPA 3GRKA 4WKCA 1ZI8A 4YRCA 3TRJA 1VMAA 2ZBGA 5EG5A 3FSJX 3K9NA 2AEEA 3V2UA 1UVJA 3G6KA 5IDQA 2I9PA 3CD5A 3K30A 2ZVPX 1CNEA 2BONA 3AVOA 3LPMA 2YIVX 2YNGA 3RFTA 2HM7A 5JSKA 1XCPA 1LU9A 5EE0A 4FM9A 5CVUA 3O0TA 2A0WA 3U7IA 1PR9A 2JLRA 2CKMA 4S2EA 3CWJA 3CCCA 1IHXA 3JTNA 1H8EA 2JD0A 4IFYA 1D09A 3IUYA 3WBFA 3QIPB 5DDIP 1ZRSA 4IFVB 5LMUJ 3F3MA 3WTBA 1S1WA 4RLQA 5GZ1A 1U98A 3N8GA 4O2AF 5DXFA 4V0RA 5B55A 2CLKB 4IVNA 1W0KD 1ZIDA 5E9QA 5AK0A 3ZZ0A 2XDYA 1QTRA 4U9IS 1O5OA 2A4MA 1SC1B 1RHRB 1PKUA 5E2AA 5ER6A 3PEHA 1P9QC 4M88A 1R66A 3A8KA 3VR4H 5FBWB 1AQ6A 3MWLA 4FHEA 3VKGA 1SVOA 4WECA 3FCXA 4GW3A 5KT2A 2ZJ3A 1MNQA 2CNNB 2DH9A 3N75A 2IYNA 4X4TA 2RG7A 4GOJA 5HXAA 4HDOB 4P3PA 4L6IA 4HG2A 4JJIA 4WPAA 3ZHYA 2VRNA 2GCIA 3ETOA 4M1KA 2AC2A 1JSCA 1DO8A 2ACKA 3NS5A 2QQGA 4G2NA 4PX5A 1E1YA 3VH1A 4IMPA 3NFYA 1FUUA 2GVZA 4AY6A 2AXNA 5HSPA 2COEA 5ILOA 3CPHA 3U27A 1RT3A 4ZAXA 3HI6A 1M2KA 4RW4B 1J2RA 2RNEA 2X0DA 4Q9NA 3NIWA 3BSWA 2VLIA 1YUBA 3RVOA 5C5DA 4PLZA 3CZAA 3ZQ6A 4LK2A 4DSKA 4F0HA 1ECJA 1SHZA 5DG8A 2JCVA 3Q8UA 1TKTA 2BGUA 3FBGA 2PLNA 2EK1A 2P62A 3N05A 3PEFA 4TMKA 2FWAA 1TECE 1JH9A 5FUVA 4O2BB 4OYIA 3QBJA 2YQ5A 4XXHA 5HTKA 4NJEB 5JZ9A 3SX0A 4DA0A 1EBFA 3U7JA 1MLDA 4X44A 1S9DA 4NPHA 1P5ZB 2NU9B 1WEHA 2G63A 3ZE2B 3D4BA 5CM9C 4V0QA 1O3YA 4UNRA 1NBEA 3UA4A 2DBBA 2DR2A 3EPJA 3F90A 4E5NA 1Q8LA 4ARBA 4PO8A 3F9RA 2ET6A 1P62B 1LI7A 3C16C 3M6XA 3P0HA 1N8TA 1U9JA 3FHOA 4BKPA 4HGRA 3SYLA 2BABA 2W0SA 1YS7A 5CDUA 1D09B 4IFYB 5GJWC 3K8QA 4WXWA 1T4CA 2Q3DA 3UDEA 3HDJA 2YWBA 4A6XA 4NMHA 3I9V9 2HBRA 2KHCA 4HAOA 2NIPA 4P72A 3D3BJ 2RGUA 4MUXA 5FAXA 2RGNC 3IBWA 2IVZA 4D56A 1X80B 2QN2A 3VO9A 5JANA 1MV8A 3M8QB 2FP3A 2PT5A 5CB8A 5CK4A 3ZX4A 3R24A 3OO1A 1WB4A 1R0CB 5D84A 1RJGA 2CJYA 3ET4A 3WWPA 3MPYA 1FF2A 2H2WA 5C3UA 5KINB 1S89A 1Y3HA 2JZ5A 1NNLA 3JWGA 3VH2A 4RMNA 3H2YA 1TL3A 4RBUA 3AY6A 3QVOA 5F2NA 1Y00A 3GZNA 3STUA 2V7BA 4JUAA 4DR7F 1G5TA 4QG3A 3N59A 1X39A 3WMXA 1W26A 4OKNA 3MR3A 2R48A 1GX6A 1IHUA 3OOJA 2WSSA 2ID8A 2VPYA 2AI3A 3BKFA 2I2XB 2GEDA 4LRQA 1ZZFA 4JJ4A 4Y6IA 2O52A 3OJSA 4KO2S 4C8MA 5DKFA 3CJ4A 5CPBA 2C59A 4MVJM 3WZ0A 4LCBA 4QGAA 3D8RA 1C1BA 1ZCJA 4CBVA 2M6LA 1IC6A 3F8TA 3CQ9A 3L1VA 5COQA 4TQRA 4DI6A 4B85A 1OFIA 5BQ5A 1WZIA 3D1VA 2XWPA 4RADA 3RBVA 4PY2A 1EMDA 4JP5A 2HADA 3T3NA 5JXHA 3HM9A 3RBAA 1KIAA 2WDPA 2FHPA 3C8MA 1WXDA 4PS1A 2GEVA 2VYCA 2HFZA 1ANKA 4JT8A 2RDJA 2PEHA 3RSQA 4IYQA 2O8CA 1MV5A 4QR1A 3R9XA 4YAUA 3PX6A 3OX1A 1YQTA 2TS1A 5IZ4A 4JI4J 3RG6A 2Y8EA 3F8WA 5ICFA 4UZFA 2ATVA 3I2IA 3WAGA 1FERA 3KPVA 3H16A 1E1RD 4AYTA 3BJEA 4I50B 5C32A 4F6CA 1TFUA 1WHXA 1GA4A 4ES1A 1WXFA 2RBGA 1JZTA 5JECA 2RHRA 4U5XA 1J8QA 2I6QA 1X80A 4CO1A 3NEPX 3ZWVA 2YJGA 4HT3B 3HWRA 3QEBZ 5F8MA 4BC1A 2L18A 3NT4A 2O2HA 3QYYA 2PGOA 3DEZA 5I42B 1XKLA 2H9AA 2GCPA 2E29A 1XQ6A 4BNDA 1PI3A 4UTPA 3OAAA 4BCBA 3ZLJA 4LF7J 3UOWA 3QT5A 1VFNA 3A9RA 1FJ2A 4F06A 1PFYA 1UEJA 1RT7B 2DKNA 1VLQA 2XZDB 4YBZA 4GPD1 1QRUA 3MLBA 3HZZA 3B9PA 1DTTA 2X8BA 3EIEA 1JHVA 4ECEA 5DG9A 1J21A 3IPXA 5GADI 2CFTA 3EPKA 1C9NA 3A9UA 3Q1LA 4EI7A 3NGLA 3N07A 2GHWA 1GRNA 1AOXA 4DL3A 1P74A 2V74B 4Z49A 1XMBA 2NU9A 2V45A 5PNTA 1HKAA 5ITZB 3BPSP 1X1EA 1M1ZA 5KNBA 3ADKA 1GPDG 3VZSA 5D0RA 1L4NA 4P32A 5H9EK 3UE2A 5LKAA 1CKEA 1P7VA 3MK31 2ZDHA 2DPGA 3I8OA 3QAEA 3WGNA 4G0PA 4C7KA 4FGWA 3PV0A 4DV2J 4O2BF 4JGBA 1YCGA 1NI3A 4LBZA 4EY5A 2BHLA 3FI9A 4KQJA 1XKXA 2I1WA 4X4UA 4M8LA 2HNYA 4DUZJ 4MW9A 1KI4A 1CQMA 3NEYA 3LBAA 1SQ5A 2IM3A 3UT0A 2R97A 3I31A 3TANA 3TR0A 2J9YB 4OLOA 1F9EA 3RR7A 3HCRA 2IODA 1QRAA 5I9BA 1SXJA 3T8YA 2ORVA 1AE1A 3M1VA 1KI6B 2FE1A 4OYPA 3NWRA 1FJGJ 5HL7Q 4C3UA 3EZXA 5DK6A 3L04A 2TYSB 4X4QA 5IK2A 1IBMF 3QWFA 5DM60 4LSZA 4BZWA 4B6SA 4NYIQ 3PW5A 1N2XA 3BR9A 2EX1A 4D5EA 2UXCJ 4LG1A 1QSGA 1W5BA 2VCYA 1NM5A 1K27A 3W8NA 1KSFX 4DQDA 1FTRA 2BH9A 2AKWB 3TN7A 2P78A 1REQA 4F3NA 4JYAJ 1E1CB 3FCUB 2K2WA 1KVIA 5H7XA 2VCEA 3UGJA 4RXTA 1VGQA 4ZI3A 1BN6A 3RRYA 1KBQA 2Q1LA 1NF2A 4S1WA 2NT3A 1CBKA 3B89A 4XUCA 4X66B 5ICEA 1J5OB 3FNIA 1NYRA 2YV1A 4JI3J 1EG7A 2DC1A 4AROA 5KB3A 5D4LA 1VG8A 3E3XA 5KIAA 3R7BB 4UVEA 1F12A 4Y2TA 3GLIA 1JB1A 5G0SA 4X4VA 4MV0A 5K6AC 3Q9UA 5HZHA 1PR6A 1FDTA 4XIUA 1Y8CA 1XMIA 4C0QC 4IDAA 1HRDA 2IAJB 2P4SA 3WLRA 3KLHB 4MV7A 3CTRA 3ELDA 1I6MA 3OTQA 2XA2A 3FWYA 4O59O 4N3NA 1JE1A 4HDKB 5CB0A 3JSRA 5DHQA 1FX0A 4DDWA 4R8LA 1OWOA 3PGKA 4DV3J 2QVZX 1YMQA 3JCZA 3RAJA 3E9YA 1TFWA 1QF6A 1H6KX 4EGAA 1N3LA 1ICIA 3CINA 3OH8A 2SICE 3HG7A 2W00A 4QJIA 4Q3AA 1I3KA 4PQFA 1BE6A 1WD7A 1E61A 4RHTA 3MS2A 3HRHA 1VMKA 3DV0A 2ZM6B 2JLYA 5KI6A 2X8JB 1F3VA 1G3IA 2KYXA 5IEJA 4BMPB 2VP4A 4LYFA 4O4IB 5FDLB 2I7TA 3MLEA 1GPNA 4N01A 2XQFA 3EXAA 3P7MA 2BUAA 1KQFA 2N47A 5DNEA 3TVDA 1MR3F 2ZT8A 4RF4A 3CJRA 3S1LA 1E96A 2OBBA 3BXEA 3OZFA 3VVMA 2VQEF 4FYVB 1E7YA 1J9GA 2JOQA 3RGWS 4MLCA 1NJIT 3Q2SC 2J46A 2WIBA 3IJ5A 4RLHA 3VPSA 3EIOA 4WZAA 3LKVA 4M54A 2YBEA 2G1UA 4B33A 1N0HA 1N0WA 1AB8A 5LZ2A 3GLHB 4B71A 4ZO4A 4ZAFA 2O1SA 3C66A 1FYFA 2BM1A 3O93A 4N4AA 2OPBA 3QFCA 2FJVA 4G9BA 4V3BA 1JFSA 5E6RB 1X7GA 5AVTA 4ZP8A 5HK9A 1LPBB 2KG1A 4BNFA 2HMIA 1V9LA 4FDMA 3MCOA 3HFGA 4IO9Q 1ENZA 2DCMA 5A9SA 1LBIA 2BOVA 4FHCA 1KEKA 2FMTA 4RJ2A 3AEKA 2O23A 3H5VA 1CYEA 2ICAA 3TINA 4GPZA 5JPCA 1T3OA 1KKUA 3L93A 3SM3A 1CY7A 3LQVA 4FUQA 4Q1BA 2YZGA 4K8OA 2CWXA 4QECA 2M5YA 4KAFA 1RXEA 1HQYE 4GKKB 1Q1AA 4Y2UA 4OQXA 4YRRA 5K6AA 2QYTA 4DFPA 1VYUA 3I9FA 4BKRA 4INZA 4NV1A 1XQXA 1GNKA 1DUIA 1TD9A 2CGEA 1TL7A 3CYFA 3WBJA 5CFRA 2YXNA 2ZK7A 1OXSC 1ZM9A 3M5CA 4FSDA 1UJ5A 4DR4J 1Z26A 1N6NA 1H5QA 4QKQA 5CT6A 1ACMA 1VCMA 2XGJA 2JASA 5ALUA 3QATA 1U7PA 3R9XB 2E7WA 4OGWA 2AS0A 4PZAA 4XB2A 3TIGA 3G4SS 1VK3A 4D4HA 2QJTA 3NOOA 1DKLA 1PUXA 4QVGA 3MPDA 2YKGA 4X71A 4UEWA 1TLLA 1L3IA 1JA0A 2VUIB 1TM7E 4ZCRA 1UQUA 3V7UA 1W1WA 5DBGA 4RKYA 5LJ5Y 1DMRA 1H8HA 1I33A 4YMGA 1PILA 1UBMS 2HRBA 3UC9A 3KR2A 1Z4LA 1QV9A 4WERA 4H7KA 4LF8J 3JQAD 1ACMB 4DS5A 2CA9A 3RFXA 4E4TA 2CXOA 3ZXYA 1XZFA 2Y1DA 2O48X 3E3OA 3F3KA 4H1WA 3GEIA 1PC5A 3ZWDA 3DHEA 5LIPA 4EGSA 1S6QB 5ETTA 3OTOJ 3CVVA 1ZUD1 4D9IA 3VYVA 2J48A 2QS9A 4G25A 1HLWA 1PKEA 2HA2A 1KC8T 1YITS 5TQVA 1W5SA 4GI2A 4ER7A 4KYZA 4CF5A 4CF7A 5AI5A 1IM8A 2GF0A 4HGQA 4PZZA 1S1VB 1ORVA 4LHXA 2YIJA 4J16C 2P6MA 3AIOA 3BYPA 1IQRA 4NDNE 3TVTA 4KO1S 2MSCB 1SVMA 4JKYA 2R6GA 5AQEA 1NSFA 1CW2B 2GBGA 2J45A 4J0HA 5IM4A 2PS9A 1TX4B 1P61B 3ES9A 1YZKA 2VTEA 3O8OB 1LC0A 3FVWA 3TWOA 3AB4B 3RM3A 2HFKA 4NA2A 4Z3DA 3GILA 1JDBC 4CLLA 3NC0C 1HM5A 2ORED 1YBAA 2I5JA 2V7GA 1QMGA 3IRXB 1W30A 4LMPA 1SH7A 4X54A 5EIAA 3PE6A 1WORA 4NNOA 3THVA 1EEXB 1KWKA 1FE8A 4OXYA 1A82A 3P5SA 4YMHA 1LPOA 4L6V3 1MIOA 1U2RA 4RNHA 2VNJA 3L9WA 3A06A 3VYUB 4BGEA 4CODB 4EGQA 3HVKA 4FHGA 1KONA 5KTOA 1W0JD 1UZAA 2Z5VA 2FLNA 1R5BA 1YI8A 3R8YA 3A11A 2VT7A 2XMPA 4LYJA 3VZQA 2EZUA 3GZNB 1M33A 3WKAA 4MLDA 3KS9A 1NQOA 5CMLA 2WSIA 3W1EA 4JC5A 2XEDA 4RFLA 3DEAA 3SIPA 2PUBA 3O3NB 4GOXA 4J9LA 1J27A 1E5DA 3H2ZA 2PR7A 3D7SA 4QYTA 4MV9A 3RZAA 3HPQA 4YYEA 3JX9A 5IWAB 1TKXB 1QM5A 1WB5A 3OQHA 3X1DA 2BOPA 3JYQA 3UB2A 1MW9X 4C0SA 3BD8A 3ZHCA 4CLKA 1RWQA 1G8GA 4R3UC 3WE7A 3KJXA 4OMDA 5DJ5A 3AV0B 4W98A 3KK3B 4DBZA 5C0OE 1NUUA 2FKAA 1YDWA 4QWAA 2WIGA 4QOEA 5DNDA 5K0TA 1DC5A 2J85A 4XWWA 2AFRA 2G08A 3TGLA 1KORA 1KPHA 5REQA 3DJYA 3MURP 2C04A 3OX4A 3WGLA 2DO0A 5EWJB 4NFLA 4KAIA 2V9CA 2KVIA 3LXXA 1NVDA 3IR6A 1JLEB 1FBTA 1W25A 4A9AA 3UK1A 2MSSA 5F8GA 3U81A 5JTUA 1N1DA 3H2GA 3RRXA 1D9FA 3D3NA 4ZOQI 4EHJA 7REQA 1T0TV 3BMCB 4OJ1A 4D4IA 1EDBA 3LQFA 3ISNC 4HXFB 5EQDA 4KC0A 1RTHB 1T10A 4LHSA 3DBVO 4QEDA 4TOIA 1QTNA 1WD6A 4QIFA 4XAQA 1BYUA 2RIPA 1C8BA 3IL2A 2QRUA 3ZLBA 5J1PA 3E61A 1U4SA 1Q1EA 4M9UA 4Y2HA 4F4FA 2OLWA 2JJ4D 1ZR2A 2OEJA 3UAYA 2U2FA 1L1FA 821PA 1PGZA 3LLSA 3ZNOA 1RT3B 3KLGB 1X7DA 4TYMA 2XGGA 1N78A 3EYWA 3HN7A 1XEZA 2BUNA 4BNMA 2HCJB 1VL8A 1ADCA 2N7YA 1LF0A 4UNPA 2JFOA 3SAJA 4K9NA 2EJBA 2VG5A 4DS3A 2JBHA 2XQJA 3GLSA 1YFJA 1HYHA 2R751 2XOXA 2WAXA 4C14A 4G09A 4HQLA 3B3JA 3LRXA 4FK8A 4X8HA 1UA0A 4WFQA 4O2RA 1H69A 2YH1A 1OKKA 1B7GO 3FDZB 2IWHA 5IASA 2G0TA 5D0GA 4GVXA 1BD4A 3KJQA 3WBBA 1QNFA 3WHLA 1GV0A 3KQLA 2H7YA 4LS3A 2FWJA 3DO6A 2PXHA 3E03A 5JJCA 2Y0DA 4AXBA 1E3JA 4XQ9A 4QC2A 2NU7A 1DOAA 2LKDA 2VDQB 4Q4HA 4URGA 4FPRA 1S2DA 2F1JA 1UEXC 4TKTA 3AF2A 1S0VA 3JRNA 4H3SA 4V0OA 2AC4A 1ZP6A 4UDYX 1AUXA 3U9LA 5KYWB 1Z07A 1VLMA 4KO0A 3V3TA 1MJGM 2ZI7A 2LQJA 2GD1O 5HILA 5JBIA 4BVKA 1SQEA 3KJNA 2QEQA 4WCFC 4AUMA 3GIIA 4FE4A 1RT1B 4RD1A 1T9GR 3X1YA 4EYKA 3TDNA 4MJ3A 2WRMA 4FGLA 3A1NA 4O5OA 2MY8A 4WTOA 3B5IA 4OQYA 2OAP1 4PXEA 3C5WP 3SJAA 4DCJA 3D3WB 2G28A 4D9MA 1DAOA 4ROTA 1KEPA 2OWDA 2RH5A 3K71B 1Z75A 2DKFA 2VODA 2YVLA 2PVCA 3QMQA 4G4GA 5KX5A 5CITA 2PFFB 1LWEB 3QJGA 1YIOA 5A5VA 1OWMA 3SQOP 3ZY2A 2K4MA 2K7ZA 1DQ8A 1LBQA 3R2CJ 4E5VA 1XWWA 2OYSA 2Q0HA 3WSWA 1RWBA 4JP3A 3H9BA 4MYTA 3V4ZA 1UKCA 3EFOB 2RDDA 1B0PA 1PAEX 4C20A 4LAFA 5KAMA 1EK1A 2R96A 1KR2A 1V6SA 2C2EA 2ZI4A 1N6LA 2J0SD 2FGCA 4AO6A 3J7YI 5TR9A 3MIIA 4DR2B 3Q0EA 3GJ5A 3FCOA 4HGNA 3BN4A 3C98A 4MGEA 3MXHP 1RYZA 4UU8A 2NGRA 2Q29A 3D4NA 3I05A 5EFZA 1FDVA 2VPXB 1JPVA 3SCIE 3R40A 4ZTBA 1FTQA 2VRCA 5GAHU 3W7AA 2EFGA 3I34X 3QT6A 2P1DA 1S7GA 4KQKA 1PWHA 4L7QA 1A7AA 5EP3A 1PTJC 4N8NA 3H8JA 2JIPA 3FPAA 2CK3D 4UTNA 5KTPA 2K7FA 4OK3A 4OV1A 2B5OA 2C99A 3WGOA 3QKRB 2Y77A 3H3FA 3RRGA 1MX3A 3IWLA 2HLTA 2C8JA 1YVDA 3CMMA 4U7UD 1MG7A 1KI3A 2FN3A 3WRXC 5LLSA 1WXQA 2JHFA 3DGPB 3GQCA 1Q57A 1PX2A 2AYXA 1Q0UA 2XAAA 4F3CA 4FYVA 4OMCA 2UYOA 1JHZA 4KSBA 2VHGA 1PK9A 4AJPA 1Y9OA 2E6KA 1OFUA 2F8SA 4UHKA 2XE4A 3MTIA 2CJXA 1LPMA 4IDDA 2I29A 1MH1A 4N12A 1PJLA 3WZMA 4WCFA 3ZWYA 2OHXA 4XGIA 1ZCAA 3MUFA 1QFMA 2LGJA 4RKEA 2X8WA 3BBCA 4RJTA 2BJ8A 1XDUA 2H1YA 2O4UX 1AS3A 3PWKA 4GL4A 2BC9A 3FRJA 2VYNA 4RNFA 1BKSB 4K40A 4YAWA 3V9AA 3EMKA 3VPCA 3KL4A 4J4TA 3W2EA 3V2UC 2PEYA 4JQOA 4KPYA 1GLGA 3LMKA 3MEEA 4WXHA 3BGWA 1T0JB 4CM4A 3QPAA 1PU2A 5EFOA 4YYZA 2I7DA 2N82B 2IEAA 3CLSD 3ZVKA 3REFA 1T0BA 3LOQA 3HI9A 2GGSA 5SZKB 4DSLA 5JO9A 2ZJOA 1N48A 1Q2XA 4N03A 3TEFA 1IQPA 4RGVA 5KOYA 3VU9B 4G0VA 1F7VA 3L6CA 1B7YB 2WJWA 4OHXA 4OM7A 3WGTA 4JENA 1ZGAA 3SBXA 2QTWB 1JW9B 5BV2P 4OBXA 4BQOA 5FR1A 4YUYA 2EL7A 1VJ0A 4WE1A 2JEGA 3OPKA 5I4MA 2AP6A 1X70A 2WUVA 5AXNA 1G291 3PIDA 4Y0VA 3ZG6A 3MECA 4LOKA 1MVNA 4YJ3B 4W5RA 5IC6A 5BWBA 3U19A 3CEPB 1G55A 4W82A 3R6GA 2GBIA 1EFDN 5SY4A 2EFNA 3PTZA 5SICE 2XD4A 2W42A 1XQWA 2A6PA 1LY1A 4M1WA 2QJFA 4LOJA 4H77A 2PXCA 4C89A 3PVCA 3WLNA 3MOIA 1G59A 2X4LA 3K53A 3ICVA 2QG9B 4X60A 4KQCA 3EEFA 1U0EA 3LX6A 1KLMB 3QLEA 1NPDA 2M88A 3KEGA 4TV9B 4RK6A 4RK7A 3MB8A 3JPYA 4LJAA 2GVZC 3NVMB 1AZSB 5K3DA 5JW6A 1R0AA 4KNVA 3L09A 2WF9A 3DE6X 2BFDA 2KL8A 4D43A 4ZCPA 3Q8PB 2M32A 2R5FA 2GNAA 5AKZA 4ABTA 1BMQA 3GPLA 2QVYX 1A2OA 4J8PA 3L7KA 2EKZA 1GO2A 3PQ2A 4OGGA 2CE2X 3DKDA 1X86B 4JX8A 4DR1F 5KTTA 3R6LB 3IAEA 4LZNA 3MWEA 3R44A 4PX2A 1FRIA 2CXRA 2RMKA 2ORWA 4HJXA 4WA7A 2CVPA 4K50A 3BSSA 4PRKA 4OJHA 1NC3A 4CQ1A 2CQ0A 1M83A 1XZEA 1ODKA 2BGNA 4L5BA 5SUHA 2V5AA 3J81Y 5DXJA 4E22A 1L5LA 4GMFA 4BQRA 3WQBA 4JITA 3QYFA 2Y1JA 3ETCA 5BPHA 4B6FA 1CY6A 3RH0A 3CJTA 1FSPA 4R1SA 3AIIA 5HCIA 2PH1A 3MMJA 2HFVA 3P2YA 2VZ8A 5JWHA 3I6ZA 3EGNA 1T3TA 2QJOA 4UOZA 3L79A 3UWPA 4JYAB 2KJWA 4JB0A 3PUJA 2PC6A 3LQRA 4B3OA 3JYOA 3GE9A 2UP1A 4U8YA 3VR4D 3QYAA 4TZKA 1XA4A 1ULUA 3G88A 3AP2A 1ZISA 4S35A 2LA4A 1C9KA 3RTVA 4BJ5A 4MR9B 2GCOA 2JHEA 1EFUA 4YP0A 4BKMA 2L0XA 3ZHZA 1M8FA 2CL7X 3PW2A 5D85A 2O06A 3H2HA 4MLPA 4HDNA 2AW0A 4BMDA 2QG9A 4UUWA 4AG5A 3QBDA 3JYNA 4GVBB 3OHAA 5FI1B 1GU1A 5KAKA 3JZMA 4B4D