3N0VA

Crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
280
structure length
280
Chain Sequence
DTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDRQSGRFFIRVEFRQPDDFDEAGFRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHCLNDLLYRQRIGQLGMDVVAVVSNHPDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQVIEETGAELVILARYMQVLSPELCRRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATAHYINNDLDEGPIIAQGVEVVDHSHYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formyltetrahydrofolate deformylase
publication title Crystal structure of a formyltetrahydrofolate deformylase (PP_0327) from PSEUDOMONAS PUTIDA KT2440 at 2.25 A resolution
rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 76
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3n0vA01
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 3n0vA02
3OFGA 1C3EA 1RBZA 2J0WA 2FGCA 4X84A 5T41A 3W7BA 2BLNA 4ZYXA 3R8XA 1ZGHA 3O1LA 3CEDA 1GRCA 1SC6A 3P96A 3MAHA 1UJ5A 4YFYA 2P9GA 1YGYA 3MTJA 4ZYWA 1CDDA 1YBAA 2QMXA 5FIIA 4TTSA 3DHXA 3ENQA 3AUFA 1ZPVA 3HHEA 1O8BA 2PC6A 4ZZ0A 2QRRA 2QSWA 5JJBA 4EW2A 2CDQA 1CDEA 1RBYA 1Y7PA 5IT0A 1RBQA 5J63A 4ZYYA 2RE1A 2F1FA 3LOUA 3OBIA 1NJSA 3DHWC 3TQQA 1M0SA 4M8LA 3OFFA 3TUZC 3IXQA 3MWBA 3OFEA 3OFHA 4ZZ3A 3LUYA 1S3IA 1FMTA 4R8VA 2MDAA 3NRBA 3S1TA 2CFIA 1UJ4A 1RBMA 3TUIC 1LK5A 4GMKA 1RC1A 3ENVA 4PZUA 4LUBA 2NYIA 5IT4A 1KS2A 3K5PA 2ZHOA 3UW1A 1UJ6A 4GO5X 4GO7X 2P9EA 4QPCA 3KCQA 2LVWA 2YWRA 1MENA 1MEOA 2H9ZA 3N0VA 1PSDA 3AV3A 3KWMA 3L7OA 2PA3A 2F8MA 2RQMA 2QMWA 3TUJC 4Q12A 4ZYZA 3AAWB 1MEJA 1JKXA 2DT9A 2JHEA 1ZLXA 2LQJA 2RQKA 5CJJA 3GARA 1XTZA 1U8SA 1LK7A 4ZYVA 4S1NA 4IO1A 1LKZA 1RWUA 2J0XA 1ZLYA 3DDNA 4PWUA 4NV1A 5J9FA 4ZYUA 2GARA 2P9CA 3AB4B 2JOQA 3P9XA 4TS4A 1C2TA 3DA8A 4DS3A 4ZYTA 2FMTA 4EW3A 1RC0A 1YRWA 4ZZ1A 3TQRA 4YFVA 3DC2A 4TT8A 1GARA 3AB2B 4ZZ2A 4NMLA 4IQFA 3ENWA 4EW1A 2I9SA 2BW0A 5IS2A 2KO1A 3Q0IA 3U7JA 4QPDA 3IBWA 2DTJA 3DCJA
chains in the Genus database with same CATH superfamily
2G4LA 3F0TA 1Q3TA 4BC7A 4LC0A 2Z04A 4ER8A 2O1SA 2UXBF 4DJTA 2RFLA 2C96A 3SZUA 4FNMA 4RK6A 5A0YA 4DG8A 1SKQA 5JUMA 4BNJA 1Z2NX 2H2DA 4G26A 2VEOA 4DR7F 1RIFA 2P4UA 5DO2A 5KB3A 3P45A 1DOHA 5KT2A 3JTMA 3TZZA 4JLPA 4QU5A 2SXLA 2VDHA 3BF8A 3CIMA 2PFKA 1B7GO 1EDEA 1GN8A 3GUYA 4J0QA 2KL8A 2X8LA 1E3LA 2X15A 4DX8H 3VVBA 2EFNA 2R62A 2RVJA 4L7VA 2ASLA 5B0FA 4M36A 1DAMA 5TGTA 2B51A 4K50A 2GKOA 2NIPA 1S1UA 5GQSA 1VJTA 3MEDB 2GFHA 2OP5A 1NDCA 3UGTA 2V4ZA 2F63A 4HGNA 4G37A 4LSLB 4IF4A 4B02A 5FUMA 1CJVB 2A8YA 1EEXB 1YACA 1MROB 2OUIA 1HUQA 1E3EA 4GQAA 3NM6B 2WAYA 1SVKA 1SC1B 1J8DA 1TKXA 3OKAA 1ZD4A 2AFHB 3K0JA 3K8QA 1RI5A 3UQYS 4YHHF 4BWGA 1T24A 4KGXB 1TLLA 3OSNA 2Q4RA 3IUMA 1E6VB 2AJCA 5K14B 1G8GA 5B7PA 1N0HA 3R6GB 1T1GA 3HWSA 5I7HA 2GAIA 3H5NA 2PJUA 4C1NA 3LUYA 1Z34A 3TGLA 1TJPB 3SF8A 4QIGA 2JCYA 4AS3A 4OJMX 2ZOFA 4X1YB 3I9LA 4YMVA 2O59A 3MFQA 2XMBA 2FW0A 4OHVA 1QE1B 2QTNA 2SKCA 2Q41A 4ZVTB 1QG2A 1B0UA 2QK4A 1S1XB 1IQZA 5I3PA 4Q6WA 2PUCA 1XZCA 3JSAA 4JI5J 3DE7X 2LYVA 2JJ2A 5DTMA 1E3TA 3WMFA 4Q4JA 3ZDYB 3LHKA 3BR9A 3JSXA 5I7UA 5GIOE 3ZGVA 2Q4BA 1L5NA 3P2YA 1KQGA 3B6MA 3CVKA 3SE0A 1FEZA 2CLHB 3BF4A 1M2FA 2HQOA 1XNJA 4WN3A 3VVMA 3I6QA 2AIRB 4BMOB 2KE5A 4YXFA 1I4TD 1YA8A 4FF2A 3OQJA 5TV2A 4UBIA 5AJWA 1JIXA 2EKYA 5HF6A 5G0WA 4TY8B 4X62J 3W0LB 4A73A 1J0DA 1IXZA 4KH0A 2QTHA 3E01A 4KFSA 4O2AF 3NU1A 4NU8X 1MWQA 2WKSA 2W2VA 4MV9A 1R27A 5BP7A 4YMWA 1TZ0A 2A5FA 4TMZA 5EJMA 4MAMA 3I45A 2BFCA 1OBHA 3AJ8A 2AJBA 5BUQA 1H6BA 4QQ8A 1MQ9A 3WKDA 3O8RA 4R1TA 2X0NA 1N75A 3HRIA 4AMBA 2GLUA 4FEAA 4OV1A 1XF1A 1E96A 2HZVA 2ZRJA 2CY0A 2J9YB 3DNPA 1L5LA 2ENWA 1R8SA 2G77B 3O8OA 3UDLA 1U7WA 3PIRA 1UBKS 5BXYA 3D6FA 3R7SA 2XNKA 4QX6A 2EQAA 2AJQA 1TO2E 3PNKA 3DMTC 1V6HA 5EGSA 1J1UA 1U7ZA 2J46A 3GVPA 3FJOA 1WNTA 5BYAA 4MS3B 2C9MA 3CNOA 3KKFA 3PXEA 2V55B 2PKEA 2QI9F 3P71T 3PIPQ 3A0RB 3CCCA 4OHKA 2OWEA 2E9ZA 2PI5A 2QMXA 1H23A 3JZFA 3V3TA 4ZPDA 4OXYA 5EX0A 1WLYA 1ZS9A 1G7CA 1CF4A 1UXKA 5IXYA 1VLLA 1KU6A 5KTNA 3SVTA 3QUTA 5H9EJ 2CLEB 4R5PA 2GSWA 1EXWA 1L5RA 3B82A 5B3AA 2ENUA 5IKXA 1JFLA 3V1TC 3DVRX 4Q3CA 3I9ZA 3ZWKA 3S3TA 3QF4B 4D4MA 2M32A 3KVNA 4H1WA 5HS6A 1XD9A 4K2JA 4D9IA 2APOA 1X74A 1LNZA 1CBKA 5HBMA 1WD6A 4S1TA 4EGAA 1D9DA 3PRBA 5E6RB 4Q9NA 4CBVA 4FHFA 4XAKA 4NLUA 1CP3A 2M6RA 1YAJA 4NNJA 1QKIA 1VBNA 5AVWA 5ETLA 2VQ3A 2D2FA 1AUSL 5KEIA 5C1PA 1ZP6A 4LFBB 4H4CA 3HJFA 4C7VA 2GRUA 2CV1A 1CG6A 3QPWA 4L22A 1WZNA 3RDPA 1O5JA 1YZ7A 5C24A 2JKYA 3KOYA 3U0BA 2ZCJA 5A0TA 10MHA 4II2A 3QKTA 2XMQA 4BDSA 4QPJC 1RHMA 2PU5A 2HXGA 1EX7A 2CHFA 4AIRA 1ILWA 3AQOA 1QHNA 1V3QE 4I1PA 2QI9C 2CZVC 2H7CA 2O2XA 2OUKA 2CN1A 4WLNA 3J7AN 3DU5A 2XUHA 5AUPB 3F6SA 3T7IA 1VLJA 2EL7A 2Y76A 1S0NA 5THWA 1X1QA 4QODA 4OA5A 2UU9F 1PFWA 4NLWA 2YNMD 3ET5A 2OAQ1 1GQYA 2ZBUA 1XZJA 4ZLNA 2GHPA 3E1SA 4LZPA 1YZLA 3OZIA 5FFMA 2AG8A 4MMZB 4XTRA 3GJTA 2HR1A 3EARA 4E4TA 2UUBJ 1P61B 5LWHA 2KM1A 1E3QA 1NQ5A 5AK4A 3S1SA 4GP7A 2OAUA 1AX9A 4DR5F 1VSTA 2YWDA 3KG4A 3NHKA 5DLEA 1LPSA 1OI4A 2FU5C 4XJSA 1Z0KA 3KQSA 1Z1ZA 2VQSA 1TX4B 5AK3A 3COVA 3U60B 1NXXA 3CPSA 4I9UA 3B1ZA 1D2GA 4GOLD 2GN1A 4DLNA 1L4EA 2V5UA 3FCEA 3P0JA 5JVDA 3IP5A 1VR6A 3KJNA 5JFOA 1PG5A 5CJ2A 3CNQS 1B2RA 2RAUA 4RZ3A 2BW7A 4HT7A 3E61A 1WSWA 1M83A 2FN9A 4YB5A 4KE7A 1O5TA 3BEDA 3LP8A 4LVUA 2BHSA 3P0FA 4RGYA 4NX9A 2DNYA 4I7EA 3T54A 2EJTA 4BFZA 3K9QO 1SK9A 1NKEA 5JI3E 1YO6A 2BKVA 1D6NA 5ETRA 3LS2A 1EK6A 3ZCUA 2BE7D 5DHQA 4NCAA 2E7VA 3RUIA 4G8CA 4PSCA 4YJ3A 3DZGA 3ZK7A 2R8GA 4ALNA 4L4SA 1CJUA 1JK9B 4CM7A 2WVAA 2GGPB 5H3CA 2BFMA 3AERA 4D4HA 2ZITA 2IPAB 3NBUA 3ZIAA 3Q7RA 4AN1A 4UAVA 1SV5B 2F67A 4PS1A 5CEEA 2QYOA 4BLQA 5CVTA 3NG1A 2BQRA 4JLVA 4AKHA 3P8ZA 3HI6A 2C7VA 3AFIA 4KQ6A 1RM5A 1JG6A 1SC3A 2F48A 2OL4A 4PHFA 3BN3A 2DHCA 2ZHOA 2XO7A 5AM5A 4POAA 3VPCA 4R2IA 3SYKA 4ZJUA 5J1TB 3A32A 4RMNA 3G17A 3G2PA 4QZVB 5LLDA 4UUXA 2PIAA 5DBFA 3KQNA 5J58A 4LHEA 3DV9A 3ANLA 1HMPA 3GUCA 3QFWA 2K87A 4S05A 1F6TA 1FY2A 1XQXA 3QIPB 2VF4X 2LRHA 1GP2A 3R0ZA 5C2JB 5K3FA 3ZCRA 5FTNA 1RPZA 5K3BA 2XDQA 2DTDA 5U9CA 1RBAA 2VF7A 3A4NA 2KBFA 4RXTA 1P2UA 3NIWA 1Q1KA 4MTPA 2JAOA 2BDEA 2B8WA 3Q9LA 1JLSA 5IDXA 3UJDA 3FNNA 1ORIA 4FFBA 2KYXA 3BHJA 1XJWA 2J8SA 3NUQA 4EPRA 5B3JC 3JAMU 2F1HA 2HBQB 4LK2A 1BC5A 3ZD9A 3WYGA 1M0SA 2Z1NA 5HE9A 3G4SS 1KLMB 3FKSD 1OYEA 2DH8A 3FOEC 1OHHA 4BIMA 2HS3A 1HL6A 4CWAA 2AOVA 4GVLA 3D4LA 4IHJB 1P62B 5CG2A 2QL5A 4QYSA 1HE3A 2PH7A 1GXSB 1KYTA 1SCKA 1QVFR 2GPTA 2F8MA 5JALA 3U17A 4COKA 4GLLA 3U7FB 2NUTA 2B4KA 2R2AA 3SK0A 3NTXA 1NYLA 2Y0PA 2RQ4A 1EJ6A 2DPXA 3P9PA 1RRCA 3H87A 4KB5A 1DPGA 3U5TA 4I3HA 1ZNXA 5L8RC 3R3VA 2QAGC 5D5QA 2P6PA 4I0WB 5IKOA 4XB1A 3O1JC 2ZJ3A 1UA1A 1K3TA 1S4QA 4G0WA 1UFVA 4KGZB 3UH1A 3ZJUA 1JVSA 2BAGA 2FP3A 2QYSA 4AY4A 1BMTA 2EZTA 2WK4A 2CWDA 3FHCB 1Z4PX 1XU9A 5I48A 3G2LA 2B8PA 2XAAA 4QWCA 1ESNA 3HKDB 1TL4A 2VQ6A 2W01A 3PB3A 4RLQA 4NXNB 3OZWA 4KLZA 2AQIA 1Z5OA 1QK5A 1VPTA 1PCAA 3CWJA 3LHSA 4X8LA 1GVNB 1PU2A 3LKBA 2VJOA 1B76A 1W7WA 1QFXA 1UCNA 1M5HA 1NN3A 3HKCB 1UF9A 1EB8A 1HETA 3OFHA 1IK4A 1JQAA 4CM1A 1TU3A 2B0JA 4WGFA 3WYDA 3EFHA 3JWGA 2AKEA 4USMA 5AI9A 1RXOB 4ZO6A 3JTEA 1CZNA 1FTYA 4M7PA 1NVDA 5IFLA 3TUJC 4WOJA 2GN4A 4LQ3A 2QTVB 5ES4B 4WKRA 3IVXA 2O05A 2QOEA 1ROFA 3MJTA 3IBGA 3RBXA 4IV8A 4EQ6A 4J9KA 3CBQA 5JSFA 1PQWA 3BWDD 1KNXA 3BL6A 3A6KA 3RF6A 2RHCA 5IAGA 4YJKA 1LLCA 1J23A 4W6ZA 1T1RA 1T35A 2OHIA 3VU1A 5LQUA 2BT4A 1U6ZA 1NUUA 1X7YA 2O1XA 3EXG2 4QNRA 1ECGA 4F8YA 1U2DC 1NJWA 1E79D 4V2IA 3RC9A 2AQ4A 3K9NA 2XHCA 2YZKA 3P9RA 2ZPUA 4H60A 5LMZA 1T3HA 4F04A 1SXJC 2QRHA 3F46A 1GTZA 3CR7A 3PNIA 4FOLA 1YG0A 3ZXUB 1HDIA 1BXGA 2EDCA 4PKDB 4BXOA 3ENVA 3EXEB 4IJ6A 2OH2A 4XVHA 5BNZA 4RUBA 5F2OA 2CC2A 3TIXB 5C7LO 2D1TA 3R40A 3CCQS 1X0XA 2OMEA 3PUJA 1RABA 3QW2A 4PW0A 2FOIA 1HTBA 1H69A 2CDNA 2WTXA 4YCAA 1HBNB 5LIPA 3AEKB 4RMJA 5EKXA 4NICA 1LKZA 3EC1A 2PQ6A 1QO7A 5LMNF 3FR7A 2VHQA 2VZEA 1HTTA 3KZMA 4CMBA 4YECA 3QH4A 1ZS6A 3F6CA 4OSOA 4E21A 1H1LA 1N36B 4A5OA 3F97A 2H63A 4MT1A 5AJ3F 1WBJB 2IUFA 1LB1B 3QNUA 3GZNB 1OD6A 4IXMA 1YU9A 3MTJA 2EYQA 1DB3A 3ZNOA 1LSUA 4UQLA 4FKXA 2CBGA 2CJ9A 3RB0A 4YUVA 4H54A 2GFQA 1H2XA 3LC1O 3IBFA 1P3JA 1LFWA 5AI4A 1A4UA 3TQCA 3MD0A 2MR6A 1Z33A 4WPAA 3DO5A 2IS2A 1K2WA 3G0IA 2TECE 1KDPA 4ED9A 1MAWA 3OD1A 3DHEA 1M0TA 1X94A 5AVJA 1QYCA 1C0IA 5IAOA 3KLFA 1UQTA 2GAGC 2VAXA 2NU7A 1T0JB 3DP9A 2PLWA 1O87A 4E5SA 1PNRA 4XK8C 2CVHA 3CLKA 1YNSA 4LXIA 2WYUA 2OD6A 1X80A 1R2QA 1H3FA 3WRVA 2BA9A 1W581 2D00A 1J56A 4JI6B 3EXHC 1OILA 1REGX 3SBDA 2Y9HA 5JD4A 1XXHB 5IH3A 4JLSA 2ZJZA 3IQDB 2ZDQA 3G1WA 2YKQA 3O1LA 5EZQA 1Q7CA 3KLGB 3E18A 2H1WA 3DAOA 3HLTA 5M29A 4KN6A 1TGYA 4RY8A 1LNQA 4R8LA 4BTEA 3NTVA 3W8NA 3LC2O 5D3GA 1JVNA 1SU6A 2FWAA 4NNPA 3GG0A 4Y2MA 2Y8WA 1POXA 4ARIA 1N8KA 4JJEA 1NVWQ 1GK8A 1X15A 2C2OB 1A2BA 2W2PA 2QP9X 2DXIA 1ACJA 5C25A 3IE2A 1QAMA 4DRXA 2YWEA 1MMDA 1TQ2A 1RYNA 3D8NA 4R41A 3M8PB 4N03A 5IC6B 3H6GA 1Y8ZA 5AJVB 2ZAMA 2VRCA 4LGYA 4N3GA 4HKTA 1E0DA 4ID5B 1CF9A 3AP3A 1NNLA 2L3MA 1DQ9A 3DOLA 4L6AA 3GG2A 3GWCA 3B6KA 5AW7A 2G9UA 1JLQA 5BWBA 1VRUA 5FUVA 4WZZA 2OPHA 3E2PA 1C81A 3MM5A 1KVSA 1ZY2A 2VP2A 2JBWA 3H5SA 1B4DA 3IVCA 2EX0A 1T9TA 3JD1A 2II6A 3T9ZA 4XRGA 2O8CA 3JZAA 2CNWD 2W90A 2IFXA 1CY6A 4E22A 1J8YF 3O8DA 3ELWA 5GGXA 3BYRA 2ZM5A 2E1CA 3H05A 3T1VA 2GKSA 4L6CA 4LF5B 4BO8A 3LX8A 2DBVO 1JX6A 4G1CA 1P91A 4GKKF 3A9SA 2XY6A 4RH1A 3GP8A 3GD5A 4UTOA 4ZCSA 1W2HA 1BA2A 4A27A 5CG1A 1YJWS 2N47A 4LMPA 3V33A 4DV0J 5JHGB 4ETWA 4GLFA 2GCGA 2J9EA 1SR8A 2UXDJ 3BZUA 4IRCA 2C82A 2M70A 1NPYA 2O0JA 3I87A 3HUDA 2CQDA 4C4YA 4Y9DA 2EF0A 1I0ZA 5JV5A 3AD7C 2XXAB 1RWMB 5JARA 1X4BA 4K86A 3FC9A 2RH5A 2JLVA 2FRDA 2H31A 4MS4A 3SX4A 4QT4A 2B4UA 2XR1A 4INZA 1NRXA 3T3NA 5KAMA 3IALA 3U1BA 5A0VA 2FLNA 3USCS 2G5CA 3PSAA 2OCKA 2HQBA 1M6VA 3HZRA 4KGVA 1CRWG 1P80A 3K70C 3ERCA 2Z2XA 5K20A 1NONA 3LUPA 1UINA 1OQ6A 4H7HA 3VA7A 3PNMA 6Q21A 3AVTA 2ZIXA 1GQ2A 5CHYA 1A4IA 3G2JA 3C66A 4HDRA 1JB1A 2J8ZA 2RGAA 2IEAA 4UM7A 4BEBA 2C2YA 4ITRC 4G1PA 2OBLA 1YSJA 3GJYA 2F55A 3W1EA 3HB1A 5J5VA 4P9NA 2Q1UA 1C0UB 3D6HB 5MAOA 5H5JA 4FR2A 3HI9A 2PLRA 3D3WA 5ES3A 5LVAA 3W6PA 2NUPB 2E18A 2RHSB 2NTEA 1G5PA 4MVCA 3VTIA 2YKNB 4B7XA 2I6TA 4CTAB 5KFVA 1XPJA 5HAOA 4HNAB 1O95A 2JBAA 3I9FA 4RNCA 3NTRA 1GAOA 1CUSA 3M9OB 4DA9A 4MIAA 1WU7A 2IEDA 3OOJA 2CQBA 3WK5A 3A3NB 3VTKA 4FR5A 3QLUC 1U0JA 3UGQA 3SZGA 1BVUA 1UFKA 2FEPA 2V34A 3W8FA 3DOKA 2RH4A 4GKAA 5FL7A 1ZKDA 3EGZA 2QRVA 3N3AC 4FR0A 2ZTLA 2Z2MA 1NEEA 1GKKA 4EO4A 2YX4A 1E3DA 2J3HA 1A5TA 3A4VA 5EESA 3C3WA 4NOLA 2V7GA 5EIOA 1ZAWA 1FLNA 5F1OA 4LF4J 3V46A 3WIOA 3KFXA 3M7VA 1PDWA 4XYLA 1LZKA 1AKQA 4C0SA 3VAFA 2W6MA 2QZPA 1H2TZ 1FD2A 5CCEA 4MUEA 2MLXA 4DI6A 1UC8A 2FSPA 3E9RA 1KO8A 4X4QA 4R2MA 1H65A 3HN2A 5LQRA 3F5DA 1S1VB 4MRMB 5E2BA 4W9NA 3D6JA 4ZVRB 3NWBA 5CA0A 1IAVA 1MXHA 1RA7A 2VUGA 1MFZA 5IDWA 4AJHA 5KFNA 2YVKA 3BMOB 3CFYA 2QLFA 4MYCA 3WYEA 4TVAB 1GILA 1J2RA 3MXOA 2XB2D 3R6LB 3K7RA 1X86B 3WK7A 2LXFA 4BEVA 1UR5A 1FSZA 1F8FA 2JLAA 2VTBA 3PZBA 4HK4A 1NZ8A 1KJZA 2X1LA 1Z4QA 4IH9A 2XS7A 1NSTA 1Q16B 1PVVA 3GRZA 1TXGA 1B0AA 2DXDA 5CB4F 1DUSA 2NYIA 5CK4A 1L6RA 3K16A 5HK8A 1MTOA 1GEEA 2OKGA 2TS1A 2Q49A 1YOVA 1IJEB 3PR4A 1EFUA 3NTOA 1JIJA 1PBAA 4KXNA 4NJOA 2I2CA 3L8YA 1V11A 3D6MB 2G1AA 3ILJA 2VBIA 2UUWA 3DN9A 3OPVA 3DUFB 3IB3A 3QWFA 5FPSA 4EGQA 5HJYA 4OIXA 2Z6AA 3L7YA 4JVNA 5JECA 2GCEA 1ND6A 5FNVF 4L2IA 4Q9JA 3OT1A 4DJEC 2UXBB 1WC6A 3L9XA 2IIBA 2I5PO 3UKOA 2ABYA 2FHSA 2XF8A 5DQHA 3KT0A 3DMHA 4IGIA 4DR7B 2OMOA 1Z0JA 4ZZ0A 2XEXA 1GXTA 4UZSA 1Y7PA 3ROTA 4QBUA 3SEOA 4JR0A 4EIWA 1SOAA 4H16A 2MQOA 5KHAA 5EG5A 1WWKA 1Q3KA 3D3NA 2H92A 1LY1A 3W6OA 4R3NA 3OCZA 3W65A 2N7YA 3M6AA 2GB4A 2JDID 2WZCA 1FUUA 4RY0A 3AXMA 3VPSA 2Z5LA 5E2AA 3NWEA 1D9XA 1G98A 1OJ4A 2X0IA 1GADO 4RKQA 4UOGA 3D7MA 1O1YA 2VPXB 2VDWB 1GL6A 1YRQA 4L27A 2HIYA 2QRJA 3IUJA 3RJ5A 4RUKA 5JAUA 5RUBA 2VWPA 1RLTA 2OD4A 2ZYAA 2KLHA 4RMIA 4BUZA 3TAMB 4GYJA 4X45A 3NNDA 4RVOA 2RD2A 3E70C 4C7BA 3A9WA 2R8OA 4YHHB 2I33A 1DUIA 4PLTA 1LJUA 3QPVA 4CKCA 1O9HA 3WYCA 5EI5A 1OYOA 3LZDA 4Q9AA 4ZOLF 3ORHA 4M5DB 1OPXA 4A0RA 1VLZA 1SRQA 2XDYA 2O8BB 5B0GA 4KIGA 1YCFA 1A9TA 1JE1A 3I0RA 1U25A 2XMSA 1S10A 1XSEA 3QM1A 4CMJA 2I1QA 3DKRA 3JRNA 3EQZA 4U2BA 1E5VA 3K1AB 2HZAA 3QY0A 3KXDA 1UPMB 4YDXA 3OG9A 2OZKA 1L1FA 4DNOA 2AW5A 4EY5A 1W94A 1K7SN 1JLBB 3AV0B 3GGPA 2YV2A 3RG2A 1I6KA 4PU0A 1IMOA 5IZCA 4OKSA 4B9VA 4ED7A 2V4RA 2PIDA 2IBTA 1YE3A 2PQMA 3FGZA 5JQGF 4B3DA 2GKGA 3W3AA 4U2DA 5KG7A 2C95A 2MZTA 4LSNA 1ULBA 3UCFA 5C5CA 4PVCA 1L5UA 1Q95G 4L4UA 4QGBA 4D9CA 4LF6F 3LWLA 5K99A 3BRWD 3V00A 3A12A 4O2AB 1IOLA 4YACA 2GS8A 1MGOA 3CUTA 1DHTA 2CNOA 3NC0C 3OQPA 4D79A 1W76A 3JQ8B 4FB4A 5KG3A 3L0OA 2OZLA 3G9UA 2C0CA 4NMXA 2ZUTA 1BEEA 2NXEA 1SUEA 5ECDA 3TUIC 1QGUB 3FFWA 2VAVA 4F6LA 4O3PA 3H98A 2FEOA 5AKEA 4L8FA 1TW3A 5FULA 3HO1A 1NVBA 1YQTA 1FCJA 2PV0A 4JB8A 5JMWA 2FXIA 2CGEA 5TGZA 2R6ZA 2REBA 2XOKD 1MEEA 1X8XA 3IMFA 2DHAA 3GRPA 2EFPA 1II8B 1D1TA 2P9CA 3D1LA 1WHWA 4KIWA 4LZZA 4W4MA 3K09A 1I2CA 1UVLA 3I96A 2HIMA 2B1RA 2H4FA 3A8TA 3EBPA 3THSA 2AF4C 2ZS7A 2Q9BA 5C3MA 1KYQA 2ZJOA 1U1RA 3M7IA 1FDDA 3B3JA 2JFGA 3DEKA 2NMVA 5TY0A 1RACA 1B41A 5J1EA 1GGNA 1K5HA 4M1OA 5F7OA 5THQA 3HSJA 3L8DA 5HRCA 1WZEA 1NF3A 2Y1WA 2ZT5A 5AESA 1EVLA 2N9UA 3E4DA 3UPFA 2YX1A 1RWVB 3ZNNA 3LGAA 4WGGA 4P7TA 1RYYA 4I4TF 2NAFA 3C6MA 2YS7A 2CG8A 1APSA 2PH1A 4ZN6A 1S8FA 3T1QA 1M5PC 1R16A 2ZE2A 4NCIA 4WXHA 3ZWNA 5D2CA 4MJXA 1NXSA 1H8ED 2J9XB 3B53X 2WG2A 2GCOB 1F7VA 2FZCB 4K4TA 2QR3A 1HQUA 1D0EA 1H9AA 4JJ7A 5DWVA 4B6JA 1IR1A 1RDRA 3U26A 5E1BA 5G0UA 1P3Y1 3B7GA 3WMWA 3OFSA 2EK6A 5HRUA 4Q4HA 2ZH9A 2YVAA 2J6HA 4DDHA 3H7IA 3V1LA 5F9NA 5TMBA 5LT5A 4NI5A 1V5WA 1HEUA 1S9GA 1T26A 1WY7A 3BD6A 3TXXA 1EWQA 4HDNB 3RV4A 2JGJA 4DWVA 1TVRA 3CZCA 3PYFA 1KI3A 1N2CA 2A3JA 2FZ5A 4RYDA 3LYLA 4DMCA 3SQMA 3P9KA 1N0IA 3RCBA 4ZRMA 1LDYA 4AJEA 3P2KA 2ZH8A 3N0WA 1N5KA 2PJDA 4HEJA 3JR7A 3ABQB 1PT8A 2JD0A 4WH0A 5EDWA 4YX9A 4DMLA 2UU9B 1JZQA 3IYLW 1VYUA 5EZ5A 1L4YA 1KAOA 2H11A 4DGSA 3CLSC 1Z62A 1P9RA 3LNTA 1AK1A 1N5YA 3EUNA 5DT9A 1FIUA 3MLAA 1WXWA 2BZ2A 3D1VA 3LLSA 4BNWA 1SBQA 3G86A 1C1CB 3Q1LA 5EIAA 4D45A 4JI2J 1Q91A 4FDUA 1XRJA 3BIFA 4DR5B 5KT3A 4YT8A 1XZ8A 4EWLA 1VJ5A 3LWZA 2P2NA 3LIPA 2W00A 4Y9RA 4LR8A 2W2NP 2QD1A 2ZM6J 3A9UA 3WGIA 5G4KA 2I2AA 4L50A 3LBFA 2X6QA 3IVGA 1R6AA 1A8UA 2C94A 1MTZA 2JFYA 4HYEA 1Z82A 4G0ZA 3OH8A 3KHTA 2GD2A 3FNFA 3LOUA 5A04A 1H2UX 4JLWA 3H11B 5IJ0B 2LVBA 1CLEA 3E5HA 3PRVA 4G5RA 1M5SA 1D1SA 2ZIZA 2ZRAA 4OJGA 1T2FA 2OFXA 4DNXA 3IMCA 1X7XB 3JXEA 1IXYA 1ZJ4A 5H7XA 5JNTA 1K47A 4D5EA 1Z5VA 4U2GA 3M0EA 1RQLA 4YJHB 1RT3B 4G81A 3H84A 2Q2WA 3SDEB 1MX9A 2Q2NA 2HBRA 5ALYA 3T5GA 4WUTA 4C6TB 2B9EA 3B1XA 4EB6B 5BV8A 4XD7D 2ID4A 4HSGA 2XC9A 5HE8A 4MR7A 4C4ZA 2ZLBA 1PW5A 3M49A 1Z26A 1SZJG 2YBEA 3T3GA 3WHLA 4GPAA 2BY4A 1XJ0A 5TQ0B 3B3QA 2VXBA 2J3LA 3Q1KA 1A9YA 1NP7A 4Z0TA 1ICEA 1YIJS 4FHZA 2ZC4A 4BRWA 1R0XA 1JHVA 2GQ0A 2FZKA 2KG0A 4M1KA 3E8MA 4LDJA 2QN1A 3L95X 2XSJA 3OQIB 3VNVA 4FHDA 1YBUA 3RSHA 5DETA 2HHXA 5CFQA 1UT5A 2QAGB 3BMNA 4WY8A 4B43A 3CD6S 4ZO7A 1WMBA 4B8YA 2ZS9A 3QE3A 5AKIA 2XQJA 1XTIA 5B0DA 1FL9A 4KQIA 2BI8A 1U1EA 5LQNA 3RT9A 4PV7A 3I61A 4DR1J 4B6PA 1Z5PA 1K6EA 1AN9A 2NYRA 2IEBA 1C1XA 3ACBA 4J6FA 1LOUA 1TKZB 1AS2A 4D4GA 3UMYA 4MVXA 3THXA 1E2HA 5JJIA 1JXEA 3BBFA 3HUTA 4AZSA 1WG1A 4JI0J 1Z56C 4WN9A 3MAAC 2F9FA 4BNUA 1H05A 2WPNA 3TS1A 2BC9A 3KKEA 3UAZA 1M90T 2JIMA 1EBUA 1N5SA 1VFPA 2IPMA 3PF9A 4Q15A 1U48A 3TAQA 3KUCA 4HEHA 2G40A 5FIUA 2EP5A 4F25A 4ECAA 5E95A 3AINA 3NLLA 3OE5A 1UOEA 2GHWA 5KYUA 3T0IA 1QIFA 1U4NA 4PAWA 4DA4A 3K0SA 4RQTA 1U5CA 4QOIA 2E5LJ 5BNFA 1TQDA 1KDRA 1MU2B 1XEXA 1G0OA 1PYOB 1IZ0A 2W0MA 4L08A 1YQUA 3IAM6 3LVRE 2R8XA 3ESRA 4X0EA 2HMYB 2NXWA 4A8HA 3KPYA 1IOWA 1NTOA 5H4GA 1Z7EA 1KD1T 1TT7A 4A4DA 2EW2A 1MWZA 2LDBA 4LUCA 3OP1A 2REOA 3GLVA 4DZRA 3UJPA 3DDOA 3MA0A 3PEUA 3E7PA 3MI7X 4GM0A 2AF3C 1R1DA 4GGPA 4N1AA 3A7EA 3Q6NA 5T4BA 4BASA 4F2DA 4YXWA 4WL0A 2WB1D 2PX3A 3TBKA 4EYSA 4B4UA 1HDZA 3ZJTA 4ND7A 1SXJB 4X4TA 2ADCA 1SA0B 4W5NA 4FDFA 2IELA 4HTIA 1Z22A 2W6ID 3V8BA 2BRKA 3OFGA 2W37A 2KYRA 3HZEA 4UREA 5KIAA 3OHAA 3DB2A 4ZYWA 3VR2A 4FNIA 4N7TA 2V0NA 5DQGA 1I3OA 5CU7A 3QWUA 3DVSX 4US2R 1MC1A 4G1QB 3A3KA 3MN1A 3N86A 1Z4UA 1UBEA 5BWNA 3LUGA 4Q66C 4RVSA 3UXHA 3TX0A 2AMFA 4MPPA 2BMAA 4FFPA 4WKGA 3KQKA 1S2OA 3WKBA 2NXJA 2ZUUA 4WK2B 5ETTA 3C0KA 2A86A 5JNVA 1I3NA 2RE8A 1HKAA 3R7BA 4X8HA 3TRFA 3WGVA 2O2ZA 4O33A 1RT4A 4CJXA 4HL6A 4P22A 1NLYA 4Y1GA 3DTVB 2XCAA 1YUNA 2FGKA 3BDEA 2OGUA 3HPRA 3RVKA 3HX9A 3QVVA 2A9VA 1KO4A 2F90A 3L7MA 1W88A 3E7XA 5C35A 2G1KA 4U7DA 1HI1A 1ZHFA 3D43A 4J7AA 4FYYB 2E89A 2B99A 1N1GA 3W5YA 2QGZA 3QSGA 1HFWA 4HLDA 4U5XA 2CNKB 3JAMY 5CNMA 3K73O 5KOJB 3SJBA 2J9ZB 4GLJA 1PRYA 4YMTA 1ZH5A 3NEPX 3DZBA 3TM5A 3AHDA 2R2TA 1X70A 3GSIA 2E1AA 2JVIA 1OY9A 3JQGA 3PIIA 1BWEA 4C29A 4GGMX 1J42A 2EOAA 4H4OB 3MERA 4O2BF 3WIVA 5AM3A 1U2QA 1TF2A 2PKCA 3C4JA 3ZHYA 1RD4A 2Q3HA 1GAWA 1BMQB 5DVZA 4N5LA 4QOGA 1R0BA 3EXHB 2AKWB 2JHCA 3WI7A 3SZ3A 3BOSA 3PKMA 4LTNA 3NDPA 3PDIB 4DFDA 3K0KA 2J5KA 5KNBD 2R4QA 2WKWA 2LGJA 5ANRB 4QRDA 5LMNB 2BMVA 1NW9B 4BCBA 4J9NA 5CTAA 3JY6A 3FBGA 2PS9A 3TOCA 1KR4A 1LSJA 3OJ0A 4RW6B 1JILA 2G76A 2DAPA 3D8HA 1A9ZA 3GBVA 3CKKA 3E48A 5KREA 4N49A 2X13A 4AMZA 1HNWJ 1BX1A 1WIWA 2GPSA 5IYZA 2YWCA 2GEFA 1P9LA 1L4BA 4MICA 4JZYA 1R6VA 1W6UA 2QQ0A 4A1OA 3JATA 5KT4A 3K4PA 3FGOA 1D0IA 3HV0A 3DLEB 2IDEA 1SVDA 3GUHA 1JLAA 2JX2A 2ZQZA 1Z45A 3UJBA 5J2NA 1C9DB 2H9IA 4XDYA 4LNHA 3UTCA 4DXHA 3OCCA 2DPHA 4XSVA 5K0ZA 2J41A 2OLEA 2FUCA 1T2NA 4DSIA 2VBWA 1HHTP 3CIZA 2YN4A 5E6SA 3VH2A 4QEZA 3ZHUA 3VR1A 1B14A 5EJEA 3PACA 8GPBA 3GJRA 4CF4A 2I8LA 2YL2A 1CUZA 2HVIA 3TNDA 3EZYA 5JH7F 5DGDA 2AGVA 2EFEB 4WMLA 1FRIA 2FHJA 3A3OB 1K0VA 1H6AA 4J3NA 3K6SB 1QFYA 1XZDA 4J0FA 4Q16A 3IP3A 1SPBS 2Y1LA 5TMPA 3VALA 3GOQA 3JQAB 4YGXB 5EHQA 2AHOB 1T9WA 1GT91 1SD1A 2HU7A 3WQQA 4LBPA 4DN0A 1RT2A 1XCGB 1SCJB 3K4HA 4EHJA 1XVLA 3GLJA 3D8UA 5KFYA 5AVQA 1U0NA 4RK0A 4ZAGA 3KDAA 1UM9A 2MYTA 1Q0HA 2E66A 3JPWA 5IMBA 4CIWA 1RTHA 3K8WA 1ADBA 2FN4A 1EFVA 1JPVA 4B2YA 3HP6A 2HU5A 1RM0A 1NT4A 1B99A 4HH1A 4CM6A 3RAGA 2HSEB 2XZTB 2QDXA 1U1GA 2VXYA 3ZQ6A 4L4XA 2R4UA 4DE5A 1S6QB 5E2QA 1HT3A 3K70B 4DNPA 4FCCA 1C9JA 1XLWA 1ZN9A 4EHLA 4CN9A 4R8UB 1BQMB 3LPMA 1GFIA 2VJPA 1VIMA 5HBRA 3EZLA 1YJCA 2O0KA 3ELDA 2E1PA 3S4YA 1PL0A 4YRKA 1MAAA 2C03A 2BHLA 4ZPJA 1IATA 2XKKA 1NDLA 3V6HA 1U11A 1EX6A 1A8IA 2BQUA 3SDBA 3ZIDA 1H38A 3DPSA 4TLCA 1QIMA 1YQ9A 4XQ9A 3NJ8A 2DQZA 2IODA 1RZMA 1E9VA 2VUTA 1WPRA 1MQAA 1MO2A 5T6BA 2QG4A 8RUCA 3VGTA 3W5HA 3NL0A 3C14C 3HVJA 1DEXA 5B7WA 5I9SA 4GKKB 3F47A 2C2HA 2BFBB 4TQRA 2JKVA 2PR2A 1HGXA 3K9LA 4ND8B 1O94A 1UKZA 4ZI7A 1QQBA 1T0TV 1ZRSA 1NKBA 3WBJA 1BLUA 2ZAIA 5ITZA 4A8QA 2PWYA 2L0XA 5DMHA 4NJMB 1MO5A 4QYRA 2VF2A 2WWFA 3I0NA 2HA7A 2R8KA 2PMWA 3KLEB 3QPUA 4X41A 1RYEA 4HX2A 2YC2C 5IJAA 4B4KA 4RL1A 1LC0A 1XZHA 1ZHHA 5CBPB 3PV0A 1ZGGA 2MPUA 3FFBA 1PGPA 2R8BA 5EMJA 2X8AA 1FMFA 1M1NB 3UTDA 4OVKA 5JCZA 2R42A 2QTZA 1D5CA 3AEXA 3LT2A 1OVGA 2MHEA 1Q0ZA 4BC9A 4HYKA 4IIEA 4QWMA 4ZQCB 4M86A 2XUKA 1SJ1A 1JJIA 4ONEA 3SIPA 4XUGB 1HQKA 3TEJA 1Q11A 3OVBA 4OU4A 4PN3A 5JMNA 3H0CA 5KNBH 3NGMA 4U8HA 1QC5B 1NNI1 2DY0A 2MZ1A 3C4QA 2Q4DA 2JIPA 4WW0A 1KMCA 1HW8A 4IDNA 3N7UA 1ZVKA 2N3LA 2H9ZA 2D1QA 3MPDA 4C4XA 4RMHA 1W73A 5D6OA 4CP5A 4JV5J 1Q82T 3HCXA 1T5LA 3ZHBA 3VR6A 5I8ZA 1IN8A 5BYBA 3RPEA 3ETNA 3MAJA 3PFBA 4JT8A 4US0R 2VP6A 1DAPA 3TLZA 3PGLA 1CUEA 4MCIA 3ESCA 4WKYA 421PA 1E9SA 3DQPA 3W5SA 4ZEXA 1FNBA 2I6WA 2C9CA 1R12A 2DLCX 1XKLA 1I5OA 4PLHA 3H2ZA 2ZOGA 1P4SA 1FZQA 2EKLA 4C22A 4F21A 4TYYA 3HKZD 3T7EA 5L9XA 3AVQA 1PX0A 4POOA 2WOMA 1K7FB 4U7WA 3GPLA 2QT1A 1H2VZ 2VR1A 3AKDA 2OP1A 3HR4A 3NVDA 1RKJA 4R8KA 3KPUA 3IP0A 1I7LA 3KBOA 4TXMA 1AKRA 3A1FA 1FQOA 1U9YA 5L95A 2UUCF 1WVGA 3HHKA 2QUIA 1I8TA 1LFAA 1EQUA 2GHQA 5TS3A 4K5RA 3OF3A 2HN9A 2A2ZA 3D0KA 3IG1B 4G4IA 2GM4A 4IUFA 3HABA 5F9HA 2FSGA 4YEDA 1OGIA 1RT1A 1B74A 4TY9A 5JHHB 4Q0MA 3OIYA 1VA4A 3ORSA 3DA8A 4P83A 1KY2A 3L8FA 3EVWA 3SFZA 2F17A 3TLYA 3SHOA 3H2VE 1D6MA 3BB3A 4QYMA 4RGQA 2QNRA 1H2EA 2WTBA 3B1KA 1UZLA 3D68A 2AR9A 3JASB 1HZZA 3WQBA 1K6MA 4HLCA 3QVWA 3ILVA 3N7AA 3RS0A 4O4LF 3GJZA 2NZWA 4EY6A 3HJVA 1V71A 1L7DA 1ONBA 5FEUA 3ZWPA 4B3XA 1LI4A 1UK8A 3PEVA 4RDHA 5CB4B 4JH0A 2ONJA 1DHMA 4R1PA 3I9V9 2MSLA 1RBMA 3MBIA 4IQ8A 1XCBA 1D7AA 1OREA 1OYDA 1FTQA 4CQMA 3IS9A 1YB2A 2O5EA 3ANXA 2EG2A 3UFBA 2OPPB 3GRAA 3UDCA 4K8RB 5IM0B 3V1YA 1UBUS 3LO3A 1HDXA 1N7IA 3DBIA 5CLJA 1SXJD 4C8MA 2ERRA 4I55A 3IO1A 2PBRA 4MUBA 3ST7A 2NNWB 2PMCA 1ZA1A 2FC8A 5AHKA 2PZBA 4Q47A 4B4VA 1YHQS 1KJ8A 4TWBA 5DYNA 3VBEA 2AB0A 2VZ9A 2OEKA 1WAMA 3PNSA 3BO4A 3BS4A 4ZOBA 2FLWA 5FNVB 4L1KA 4BEJA 1K88A 4JVSB 2HAEA 3VR3A 4C3OB 1Z35A 2CK3A 4J1TA 1F9EA 4A8WA 1OX5A 4QWEA 3BQMB 3SOZA 2H18A 2WONA 4M7RA 4PG6A 2ZAYA 2CQIA 3UR3C 5FO0A 5IASA 4YP1A 4FXDA 3ZD6A 3JSMB 1RZUA 3FSRA 3PVZA 2JC1A 4ZYYA 4QT0A 4RJKA 2EXUA 1B6SA 3H40A 4UVIA 3COWA 3ZHOA 1XQWA 3DTVD 3R5JB 3I32A 3NRBA 3C1OA 1JLFB 4AZTA 4DC9A 4NI2A 4ZVEA 2FY8A 2I0FA 5CNJA 1N8RT 4JUIA 3DMPA 4R2LA 1VXRA 1XN1A 3UA4A 4DA8A 4M1EA 3NHWA 1CUFA 1MB4A 1ES9A 2ZUVA 3H18A 3JPYA 3ZWVA 4DWOA 5B1YA 1T94A 2LKCA 4YB1P 4Y9SA 5H1SV 1DCFA 4RPFA 1T6YA 1PEKE 1FK9A 1NULA 1IBMJ 1ULSA 2VSXA 1S76D 2VG7A 5HQ8A 3QPBA 2IUTA 3VVTA 1Q20A 3AU8A 4ZDIA 1XDBA 1D09B 5AKHA 3EZ2A 2FWMX 2C2EA 3QFHA 3CNBA 3SBOA 2N4DA 2EAUA 1JIQA 2D74A 2C5BA 2H3EA 1W6RA 5BOSA 4ZOLB 3GIJA 3BAFA 2HBZB 2BVNA 3VDNB 3IR6B 3JRWA 2PT7A 3RVLA 2XGSA 3A1SA 1LWEA 3IV6A 2CNDA 2YV3A 4HS4A 1WR8A 2Z57B 3MG9A 2YIMA 4F1KA 2P2CA 4W92B 4HUQB 4R1LA 3C43A 1PSWA 3BZWA 2O3DA 3BMXA 3M1AA 1WG5A 3HVIA 3P9IA 3BB5A 4DJJA 2RBEA 2PJRA 5LYJA 3U49A 2C2NA 4YASA 1C1YA 4PZEA 2OG1A 4OX9J 4NLSA 3M8QA 1NBHA 4FUQA 2V1UA 2YJZA 4I6GA 1JH8A 2SHKA 1UXOA 5JQGB 5CDUA 4DPXA 2QA5A 2V74B 2DVIA 4KXFB 4Z0NA 4U7UK 4X71A 4JI3F 1L0BA 1U3GA 1JQBA 4YIHA 5JU6A 5KX5F 1EBFA 3X3HA 4LF6B 1TTHB 2QVZX 4Q8FA 4PQFA 4GMGA 2D3ZA 1LQUA 2V9ZA 2HEIA 3V2UA 1D8ZA 2VG5B 4ARVA 4V0KA 2IRXA 3IMKA 4MWZA 3UMCA 3K5OA 5BNIA 3M2VA 4ZOEA 1XELA 3WTCA 1ANKA 4K40A 4V0RA 1MOPA 2QQ5A 3C5CA 2EI5A 4M2LA 1UL3A 5P21A 3B78A 3CE8A 1TL1B 3N5FA 4KO0A 2L19A 4C01A 4D6PA 5BNWA 4ZDNA 1V4BA 1XDWA 4N8EA 4JI8F 3AKEA 5K0TA 3F8WA 4LZJA 2N7CA 3MTEA 4GBMA 4E30A 2E4WA 2VH5R 2X1MA 3HVAA 1BE0A 1KONA 2ET6A 5DE3A 1R8BA 3NHYA 3PDJA 3T1AA 2J3JA 4P7FA 2XBUA 4WP9A 2NCKL 3LUJA 1XZKA 4NYJQ 3R7NA 3X1ZA 3S2UA 3JQAD 3RVQA 5EQTA 1QLHA 1NXVA 5JBIA 1FU8A 4NV3A 2C3PA 1V95A 5FR1A 2PXAA 3R76A 5DULA 1RTDB 1UFOA 2ZU6A 3NOOA 1HEIA 5C8YF 1ECFA 3EDRA 3T34A 4TTQA 3VKWA 4DPUA 2FPWA 3T9DA 4C0XA 2PEZA 1KBZA 3C39A 2VK2A 3P96A 1XCMA 4DL6A 3UC5A 2X1HA 4QRIA 3VZIA 5D6GA 3MM7B 1R0AA 1SCDA 4BV8A 5G53C 3FGNA 4YT5A 1ST3A 3FVYA 3HMKA 1TUVA 5DBOA 3Q2SC 1O5OA 2JEGA 1CLFA 3Q85A 4GM1A 3SJ7A 2PLNA 4BS2A 4I4TB 3RJMB 3HSKA 3SQWA 2P62A 4FI3F 1VZ2A 5FFNA 3OQNA 3NV7A 1BQNB 1T5OA 3V2IA 1OR8A 3K70D 1SJQA 3KDOA 4YMLA 3Q0TA 5HN0A 2QRNA 2G72A 3HMQA 3A14A 3V48A 3LU1A 1RAHB 1UIMA 3HA3A 3Q8UA 1T8WA 2QPLA 2GQQA 2QDKA 4KO2S 3NEKA 3M30A 1IKXA 3DC2A 4A03A 4NZ6A 3WNCA 2ZVIA 3PQ5A 2DNLA 1WSRA 2DQKA 2WY2D 1FS4A 4DQKA 3ZXWA 4EY7A 4FGUA 5CITA 3N3BC 2YCLA 5LKRA 3N70A 4LYDA 1Z2EA 4XIGS 3EEFA 1QIIA 4I50A 4QBFA 3D4IA 3QPIA 4DWWA 2OSVA 2YY3A 4RW9A 4FGZA 1VYHA 1R66A 3IXQA 4OHXA 1GR1A 3R5AA 3LP6A 2XGJA 2D13A 4MPRA 5ICGA 2JI6A 1P6XA 1M1KT 3KTFA 1I24A 3QOWA 2IJNA 3RUHA 3J80U 1WCXA 5I7RA 3SKXA 4W1SA 5JBNA 3KC2A 2MMYA 3ML1A 2R8IA 1RRMA 5AKKA 2AJ2A 4YV7A 3PTZA 1Y6JA 3UWDA 3LPEA 1PN3A 1PQYA 4P33A 1A5BB 3CRRA 4FI3C 4F02A 1DHRA 1QYXA 2WF6A 1Z0ZA 4WLFA 5FLXA 1TCAA 4DM4A 3I6BA 5E6UA 3TJ9A 2P0EA 4K7JA 1VKOA 2DNKA 2H4WB 3L77A 1N8SA 3PD7A 1T5DX 2WSYB 4YPFA 1FFDA 4OHBA 1HF3A 4DMHA 2GAHC 2KTQA 1WCWA 5F2NA 2EFCB 4J2OA 4OX7A 1ZOTA 5EIXA 3BSFA 4BO4A 3SXUB 3WLEA 5K2MA 3V6DB 4BBAA 4XCVA 5KNCD 3FMWA 1N6LA 4EATA 3AF6A 3ZKWA 2H48A 3N2ZB 2FVCA 4EI9A 1Z17A 3T7AA 5AW6A 4O4RA 4TS1A 4OYAA 2NPOA 3K0AB 1PJRA 4H77A 3MAAB 1NPPA 2AL7A 4X95A 5GJWC 3EAQA 2VP9A 3V1NA 2EBGA 4BO3A 5HYVA 1J0XO 4C7KA 1NSPA 1UFQA 4NPOA 3ZQKA 1Y5LB 4HFMA 3ND6A 5KYGA 1KH2A 5AXCA 5F2EA 1QHHB 2KQUA 1I94J 4HDMA 1PV4A 4D5GA 2FDCA 1GLVA 1EDOA 1BW9B 1D1PA 5TJ9A 2QVBA 2SBTA 4Y7CA 3FDFA 2VTKA 2OK7A 2DFDA 2VBGA 3OURA 4AFNA 4WP3A 3KK1A 4JENA 2W2QA 4YMGA 5GJBA 2D3OR 4WVFA 1QIJA 3MJDA 3UAOA 4LA4A 4CT4B 1S77D 4OH7A 1ZIXA 4AW9A 3QUAA 1JG4A 4BN5A 1J00A 2UXCJ 1YBFA 1KK1A 4OK6A 3HBLA 1H73A 2NT3A 3FUTA 3TQ1A 4JYCA 2F3TA 5BY2A 3DHWC 5JCXA 4YN3A 1SKUB 4FHGA 3KHRA 2Z9CA 1VL0A 3OT4A 1WKBA 4HWRA 1XVIA 3BDVA 1LDEA 1PGJA 1MQSA 2IHUA 3A58B 5KPDA 4AY6A 2HY7A 4HNSA 4A8FA 3DOUA 1RQRA 1H6DA 5F7JA 3UENA 3KDPA 3OLAA 1SY7A 4TLDA 3FW1A 2ASVA 3FZEA 5B7GA 2OEJA 5J1NA 3DDNA 1MW7A 4ZPCA 5KFDA 2HWUA 5FPQA 1COWA 3AUYA 3PFEA 3PL1A 1TTTA 3W8PA 3KB2A 4MMOA 5EMHA 1AT1B 2J9DE 2K1RA 1AHHA 3PCOB 3W4IA 3O82A 1YL7A 1OH5A 3E0XA 3G68A 5J2PA 3GMDA 5JDCA 4BNZA 3VR4D 4D9JA 4OLOA 3KQOA 1E64A 2XZDA 2GZRA 1EYZA 1XPOA 5JSZB 3HXMA 4KPGA 1ZXLA 1TAQA 4PNEA 3MCTA 4D42A 1BY9A 2I3BA 3CX8A 5U4QA 2CPIA 4L07A 5LR6A 2O8EA 3HDJA 4PR0A 3I52A 4J1NA 1HLPA 3REQA 1J99A 1W34A 1JHDA 1T5TA 2PQ2A 3WIDA 4V1CA 1K7CA 3KEGA 3L7UA 2PX0A 2FPKA 5GAGI 5EXEA 4NYMR 2ZETA 1CUVA 3W2EA 1X7ZB 3P2IA 5IN4A 3QVSA 3I6ZA 1D2RA 4Q93A 1M1YE 4AU1A 1Y7TA 3GFRA 3OQ2A 3IRUA 2CIMA 1O77A 4FFSA 1U09A 1PZNA 5H0IA 3HRKA 1WUYA 3KO8A 3HUFA 3GX1A 4U2EA 3USES 1OLUB 3CKLA 2CQ2A 4JJ4A 3HVUA 4BZZA 2IAJB 1TQ8A 1JXVA 1J27A 2PC6A 4OHUA 1ZH2A 2R7WA 1U28C 1OKKA 3MHYA 5ETNA 3WYAA 3N8IA 4E2XA 3IAFA 4R71A 2P4HX 5AP9A 3DLKB 5H82A 3JVIA 1N9KA 2FPGA 2Y9PB 2BELA 5DN6D 4I3GA 2I38A 3CCUS 3OFNA 4BY9E 5CT8A 1LJ8A 2B3TA 3DL7A 3QY9A 2YKAA 3IB6A 4UXIA 3AOGA 3EJ6A 5T67A 3N2KB 1V16A 1ZUWA 2PWZA 2G9NA 4YCBA 1CW2B 2ORYA 4UATA 4R9UC 2DUMA 3BF7A 4QEKA 5GWXA 1XB2A 1MC5A 3RGIA 4F9FA 6REQB 2RC5A 1PIEA 3CW9A 2JGAA 1G2QA 1HW9A 5FF9A 3JD2A 2AOTB 4LV5B 3QTLA 5EZSA 2R7KA 3ADDA 4IPTA 4QRHA 1UWBA 5KNCH 1MX3A 4NEQA 1GGVA 2QP3A 5DIFA 4KN5A 4EI2A 2VP4A 4KT0C 1H2YA 4KFRA 1USWA 3GAAA 3AO0B 3H9GA 2OPRA 3RW6A 3LT4A 5DK4A 1T3TA 4WOKA 4D4JA 3WLOA 4C20A 4L8VA 3WZ2A 4A8SA 1KOJA 1D07A 3PENA 4O2BB 5HJXA 1X60A 4BB0A 4LWPA 3PYGA 3LHIA 3S2EA 2AUTA 2C9BA 4I2PB 3G2KA 1I80A 3VKVA 2M2BA 4R51A 1RADA 3FAZA 4CXMA 4FCWA 1OPIA 2GCFA 1G5RA 4DMZA 2SNIE 1HDGO 3A1CA 4GMFA 4AMVA 3DDCA 4PGAA 4WBNF 2JJ4D 3DI6B 1U1LA 5KSZA 1AN0A 4X5OA 3CE9A 4NAUA 3R09A 3SX0A 3GILA 1JLEA 1KY5A 3TH5A 5FUBA 3M6VA 5BV2P 1RFGE 1JT9A 3V42A 1TI7A 3NVMB 3RSFA 2ZSBA 1WA5A 3ESYA 3DGVA 1N6RA 1MJNA 5FPYA 1XBWA 3EIFA 2CNBA 4CKEB 3DLTA 2B6NA 3AOAA 4M5MA 1G6OA 1MOQA 3ZHXA 2QZ9A 4DANA 3LYUA 3RUBL 4RTNA 3F5QA 4YRAA 3LF2A 2ZD1A 1ZPWX 2CLCX 2XTNA 4L8LA 1R6TA 3ET6B 3T3PB 2YJGA 3NTLA 2XQFA 2VV5A 1NK0A 2ZBGA 3ETDA 2O4UX 1RT5B 2A10A 4PEOA 3BSSA 2FZGB 2CE2X 1CEYA 3O3CA 2Z6QA 1LVHA 3OAAD 5TT1A 4LFAF 4OBXA 2O52A 4CO4A 1WXQA 3FBWA 3ZNQA 2PYDA 2H65B 1DEKA 5SZKB 2IV2X 1DBIA 2G36A 1EP2B 2MJUA 4MFBA 4C7OA 1DT5A 1U9IC 2W2PP 5A7GA 3RT7A 4EJSA 1VKZA 1NBMA 1P6TA 3GFZA 1KVKA 5BV1A 1SUFA 2TMGA 2X42A 1DAHA 2VZ0A 3BD8A 4N77A 1Q53A 5JH7B 1RC8A 4WZBB 1OAKA 3NC4A 1I5RA 4DMGA 3GZTB 1O3YA 3MM8B 3CRNA 5JISA 3BN7A 4MA0A 4PZAA 2MXYA 4ENPA 1G4UR 3H42B 1GL9B 3QT7A 3R0XA 3ADOA 3CLSD 3G59A 4OSEA 3M5WA 4RLHA 4GWLA 3C14B 4CCYB 3EIHA 3MMZA 4K4WA 5HMXA 1UDCA 2XGOA 4JJFA 4WSOA 3EXYA 2VDPB 4QBHA 2OZVA 2PGLA 2QG6A 3S99A 1CDZA 4WXOA 3EE3A 1MQ8B 4A91A 1I33A 2QWXA 1YE8A 5HF9A 1N5IA 1EWYA 2IUYA 3IRWP 2H1RA 3C6KA 3GCGA 4MIEA 4DLTA 3R3UA 2QTWA 3OBIA 1HG0A 2E5FA 4KAAA 4RBTA 1HNXF 5HQJA 2OPSA 4Q9DA 4HGPA 4EMDA 3DLPX 3UD5A 4QOTA 1G20E 2LUOA 4UHHA 4K6MA 4DF3A 4HI0E 2P9ZA 5CIQA 4DQDA 1ISGA 1C8LA 1EFTA 3SEFA 1EU1A 2O7NA 3M2TA 3TK1A 5G3YA 1G291 3M4JA 1BVHA 3BC1A 2DO4A 3IAHA 3AOEA 2WE7A 2DBQA 3AEZA 4DSOA 1IZ7A 3UMVA 5KWIA 2QRZA 3UI3A 2HUPA 3B6EA 3RB4A 3OEHA 1A9QA 1L8QA 1NXQA 2DETA 4QW8A 3B60A 3KYJB 4QQFA 3PJDA 5B08A 5J2MA 1KQPA 4K46A 1J5OA 1O54A 1W4LA 1G19A 2Z83A 1HWIA 3SSOA 4WIAA 3V6LA 1SK8A 4C89A 4TL9A 4WXWA 4OQNA 4YP9A 2B20A 1S1WA 5JXHA 4DCPB 4UXHA 5B1EA 5HJ5A 2D0PB 4ENVA 1HC7A 2EFVA 2O5CA 1XD8A 1TL7C 1X8LA 4UNNA 4IRDA 3CZ5A 3ULKA 4O3NA 4PLPA 3MR6A 5ENDA 3MOGA 2XHZA 5CA1A 3IULA 3K89A 3S2ZA 1G6Q1 1A9RA 1NM5A 4BKOA 1PF7E 4KPYA 2XECA 3M1VA 2BEUA 3GDOA 1QQAA 4MA5A 4GKVA 1FC0A 1JA0A 3THTA 2VBYA 3CEJA 3JYTA 2XLKA 1K7YA 1MBZA 3VDRA 3IGVA 4M5HA 1D6JA 4LY3A 1LRJA 5AVTA 2WD7B 1JSXA 3E3OA 5CFNA 2P2SA 1OU0A 4TXLA 2KT5A 2O57A 3CCFA 3CLUC 4JJZA 4P2GA 3PHHA 4Y6IA 5H59A 4I1RA 4ECQA 3FRJA 4F2SA 3DVAA 1UBGA 4QYIB 1TJNA 5C4MA 4URHA 2GM3A 5HIMA 4F4AA 1XQ1A 5IDQA 4D8XA 1MFPA 3TR6A 4WNIA 4C0OC 1W48A 1UP1A 4YYZA 4UAGA 1OXBB 3WGMA 2VKTA 2C3OA 3WMXA 4FU0A 2WHYA 3GFBA 4J75A 1IPFA 3OTBA 1QGAA 2FDRA 4OUKX 4A6EA 3OEYA 4OB6A 4PZUA 5CVVA 3EXIA 2CWWA 2I4RA 3ZU6A 1QHGA 1NPKA 3DEHA 3WSTA 3JZIA 1KMHB 3DKIA 2QUKA 2JH3A 4LBHA 2WU0A 5C42A 3QXGA 4MJ7A 1SZCA 5EJGA 5I4BA 4G2NA 1I14A 1U98A 4N7JA 2D8MA 3AHFA 1SIUA 1DE0A 5LJ5Y 2CFCA 4MI6A 1OXMA 3DE6X 3LBNA 4K6FA 3NBMA 3RVOA 4FT2A 3SSSA 1L7MA 5EE9A 4M49A 1QH8A 2E1MC 2VC2B 3QEAZ 1N4AA 1TUIA 5ALJA 2J3KA 2HA5A 2FY1A 3WGGA 2AT1B 3H8SA 5BRJA 3OZ7A 3IEUA 2IHVA 3HEMA 2CDRA 4V1Ak 1Q84A 3EIXA 1U5BA 4XDCA 1G21E 2O3RA 2MQQA 2IZZA 4ANCA 5EUMA 2QVXX 2ZB4A 4PYRA 2UUCB 2MKIA 3HXTA 1A7GE 4KRGA 2ODQA 4XCQA 2HWIA 4IRKA 4K6GA 1VQ6S 5L40A 1NK6A 2GMWA 3I73A 1BCRB 3FVTA 1WUJS 3IXLA 3IUNA 3TZXA 4N56A 4BPBA 3V1KA 3QJPA 4KQEA 3KVOA 2FX3A 3UYLA 2MEWA 4JGGA 3ID6C 3MM6B 3AXTA 5AKYA 4X1KB 2MU1A 3HWRA 3PKYA 1KR5A 4CKWA 4HFJA 4TMYA 4M21A 1NR5A 4C87A 1K8RA 2OVBA 4BZWA 4UTPA 4I4LA 2V68A 1OZAA 4K9QA 4NECA 3GU3A 4L3KA 5ADWA 5JJ5A 2GN8A 2PS0A 2WW4A 2VZLA 3UMJA 3Q7QA 4DSUA 4H4MB 4O4LB 2FQXA 3AONB 4B3BA 2Z2YA 4AD8A 4OQDA 2DWPA 3VNAA 4TLBA 3GLFB 2RRAA 2WDZA 2X9VA 1NK7A 5MF6A 1MV8A 1TFRA 1VSUA 1VKHA 2IE8A 3HFKA 2ZCUA 4LF8F 2A0FA 2Y1KA 4GOMD 1O4WA 1N5LA 5ESWA 3D2AA 4PZVA 4UOFA 4BIIA 4HFRA 5FWYA 2J0QD 5AM0A 2OPQB 1GFZA 3VH4A 2QRLA 4N3BA 4L0CA 2G06A 2DPJA 1ZQ9A 1A1SA 3MMNA 4KQGA 1HYHA 1XIVA 3AHJA 1GU7A 1UPFA 4J8PA 2MKHA 3KYIB 4WD3A 3H4TA 5C80A 3SR4A 1BN7A 1C2TA 3H8WA 1JEQA 3I0SB 3GPIA 3BT7A 3F1KA 4DLAA 3THYA 4ZAZA 3LQRA 3D3KA 2M1XA 4EUKA 3U80A 3RSSA 4F7VA 2HRDA 2FYXA 2ZTMA 2AD9A 4KQ2A 1W85A 1CQJA 3CMMA 3DHXA 1OX4B 2FP4A 1I7SB 1R0LA 3R5HA 1I32A 2R66A 1TP7A 1PBTA 4BGDA 2ZZKA 5ITHA 4E14A 1N5VA 3OOYA 4RD2A 1RW4A 1BA3A 2JC0A 4X24A 5F35A 2FEMA 3G6YA 1HI8A 5EE0A 3W2WA 4AJ1A 2PL5A 1JLKA 2W6JA 3CX4A 3F9CA 3PXBA 4U3JB 1TTQB 3D66A 4MRNA 5DZSA 5ITVA 2FI1A 4AXJA 5DHFA 1CZUA 3CEMA 3KYDA 3RV3A 3QSYA 5E9AA 1W8IA 4Q37A 1VGVA 1CRLA 5BMVF 1GNPA 2XY4A 2FLKA 4YCMA 1HKHA 2J59A 4IUBS 3SIWA 1US8B 3BAZA 3BA1A 1NQTA 1Q1BA 3PYDA 3N2GA 1QV7A 4OF4A 4IZHA 5KYYB 5L3SB 1JHOA 2C1EB 4FPXA 4HJRA 2ZI7A 4D4KA 4LY6A 2WSSD 5D8HB 1G16A 1F2GA 1O6GA 4KY3A 1KC8T 5AXBA 2VT6A 1R3UA 3NOXA 3V2GA 1P75A 1SOMA 3HKEA 3TI9A 3NOQA 2IVFB 3R5TA 5MGNA 5EPEA 3K5WA 2ST1A 1WDMA 1G2EA 3G0CA 4FLFA 1F0YA 5EVJA 4C8ZA 1XTPA 2B4AA 2CV2A 1VBXA 3THOA 1FXDA 1A9XB 1B1AA 3X1XA 3Q6MA 3CSUA 5HUHA 4JNKA 4LSGA 3GJ5A 2PRSA 5HK9A 2JLYA 3T5LA 1NUPA 4L3NA 4NEYA 1JKXA 1TIPA 3RS7A 2PS3A 4DR3F 2R86A 4TKMA 4OEHA 1ODCA 4AZ3B 1LXNA 1P1IA 4JI3B 1Z9BA 2XTAA 5KX5B 1CS4A 4KHPF 3ZZNA 1BXRA 4TL8A 2V7PA 1HD1A 4I9NA 3TQSA 1EAYC 4F9EA 1VIVA 1QD1A 2CLMB 4A36A 3KYLA 4ZVQA 1U1CA 4Z3KA 5D00A 4B6RA 2D3UA 2FDXA 3FSIA 5AJZA 1PR4A 2NQTA 3KJXA 3NEAA 2DBZA 5G1PA 1QUEA 3AR8A 1FUIA 2VBCA 3A10A 1T36A 4G5SA 3WRXC 2WD8A 4Z2XA 2I3ZA 1CSEE 5DNUA 4J0HA 1N9GA 1B3BA 3E7FA 2H52A 1RP7A 4JI8B 4LIWA 1VBKA 5T4EA 2P78A 3FTNA 1EQAA 3BTUA 3T3FA 1U5AA 3TVKA 2LIPA 1QRSA 2D9OA 3OHBA 3NXSA 1WSVA 1FJ7A 4LOAA 3U4DA 4RF5A 3EGIA 1S2LA 2V3WA 3IS3A 4MWBA 4MHOA 3QLHA 1FD8A 2D2EA 4HS9A 4UBOA 2VXCA 2B5JB 2X4LA 3AIKA 3RUAA 1J1IA 4KIUA 5C8YB 3AHIA 3O7MA 3LC0A 3T1NA 3U9SA 2P27A 1SXQA 2OAGA 3REOA 5JC8A 2W6NA 1SQGA 3GEHA 3O4FA 4II3A 5JW6A 4H7JA 4Y6GB 4NYPA 1XJQA 2V9PA 1XEWY 3B2NA 5HUJA 4FZ3A 2NR0A 4GQIA 1DKLA 1Z8DA 4MQFB 3LGSA 2LFVA 1E1KA 2LCIA 4KVAA 2K5UA 3C48A 1X4AA 3RS4A 2I80A 3I01M 5LDGA 3L6CA 1OWXA 4Q03A 1S12A 2PWBA 1ORDA 3BMCB 5EHGA 1KOFA 1V8OA 3TW4A 4CMEA 5ALEA 1VJ0A 4DMFA 4B3MF 1FRJA 4DZZA 5DNCA 1G7SA 1SB8A 1L7RA 1R15A 2HMIB 3LSYA 1TUBB 2C4WA 4BNYA 1RRPA 3T8YA 5CB6A 2ISCA 3DOFA 4L3VA 4BNMA 2R7AA 2DGWA 5F5XA 3UJAA 3G82C 1CTQA 5J9FA 2H08A 4O0NA 1UWCA 3HR8A 2CNNB 3DAFA 1ZX1A 4DCTA 5KFCA 4WXYB 3TOQA 4IH7A 4ZVNA 1UOQA 1EVQA 3FA2A 1NBAA 3RSGA 1SC6A 4D41A 3AEQB 3RASA 1U7XA 3URKA 3KJFB 4RTPA 3U56A 4EUVA 4J0DA 5B37A 5K45A 3FMPB 1KVQA 3H9CA 1GG2A 2FPIA 3ZUPA 4B3OB 4GSLA 2UVWA 3FDSA 1IY2A 1SKBA 2GD0A 5FUYA 1H4VB 2O1EA 4CHGA 3F0NA 1YH3A 1L5WA 5FL3A 1RAFA 4ID9A 2R6DA 4NSNA 2FDNA 3CO9A 3WBKA 2OELA 621PA 1F5BA 3VVCA 4A1FA 2LLZA 5CAEB 1DC3A 2X3DA 1UJCA 4AJOA 3GMTA 4IH6A 2VOEA 1QPBA 4O4JA 5JCOC 4N8SA 1EX9A 3HCCA 1X4DA 4BEWA 1YR7A 2GM9A 2XI2A 4PRKA 1DEAA 1JXQA 4WZAB 3D7RA 4QDXA 4QIFA 2CLIB 2W83A 4UUQA 2C5AA 2YHSA 4YLGA 2B4YA 3D7SB 4P53A 1Y8RB 3D5MA 3GXBA 1MO4A 2VFAA 5CYPA 3GJ8A 5AHXA 2X2OA 4MKHA 1JHMA 4DYDA 2AZ1A 3CCES 4HNUA 3JQ9A 3A06A 4S0MA 4WF9Q 2ZUSA 4XI9A 3CMAS 1ZVQA 2FR8A 2CJXB 4H08A 1W26A 3ZDFA 1P1JA 4N5HX 5YASA 4U96A 4TPKA 2IIVA 1FTWA 2C5SA 2OO5C 1IY1A 4NULA 4E98A 2VSNA 3GIWA 3LFTA 5T7LB 1DX6A 1GRNA 2XMKA 2YC4C 3SQGB 2RS2A 4CKXA 3W1WA 1XVTA 3RSCA 3V7UA 4TYWA 5JI2E 1T0BA 2F2TA 1SKYE 2YCBA 2GN6A 4ID8A 1RAGB 3QEMB 2H5IB 3K7EA 2QMUB 1L8LA 2XCLA 3ROMA 1WB6A 4E5DA 4EFNA 1LWFB 4M0LA 5L53A 2CKWA 4WA8A 5HPYB 1H66A 3BXHA 5AM1A 3TJZA 2VJCA 1HEYA 3RB3A 2W8BA 4US1R 4P4SB 1PJ5A 4CVNA 2QHXA 3CUSA 4DSFA 5IQQA 4ZTBA 1T8PA 1E4EA 1SOVA 2BYTA 1CYEA 5EZYF 2P9GA 2VICA 3ZI4A 4R6WA 3GRKA 3TZQA 1CPYA 4DG5A 3KJVB 2IW1A 1DZ3A 3J80Y 1S1MA 5IMSA 4AROA 4FMPA 4GBED 3WNVA 5M7EA 1AQYA 1E9EA 2BABA 5AICA 2B4OA 5IF3A 1YR9A 3AF1A 5ESDA 4UHBA 3NP9A 5ESXA 3LALA 4WJKB 2OBFA 2H5JA 4GGOA 4EYEA 5C31A 1JIIA 4PZ9A 4P7JA 4P2XA 2GMJA 3K1JA 4ED5A 2XRFA 4AS2A 1RLIA 4LFCJ 4I81A 2X6RA 1YCHA 3MJRA 2BDTA 2PYZA 4PSDA 2FSVC 1B15A 1LSOA 1QIKA 4X1OA 3O74A 3EW9A 2BR0A 3J7Z5 4YAKA 4KKVA 1Z4LA 2HXYA 1XRNA 2YYZA 4ZVUB 3PA6A 4JJAA 3QEOA 5EGNA 3POTB 2FXVA 4MLPA 1LPPA 2UZ1A 5D5HA 3TEMA 3RNOA 2O5RA 3AUXA 2IOFA 1QRDA 2YMPA 1S2GA 3WX0A 1Q74A 2P2DA 1E18A 1NJFA 2ZBFA 4Y3UA 2RIPA 5HIKA 1CX9B 2DH6A 4FEEA 1U7PA 2E85A 4OBWA 1L7NA 4TX1A 1HK7A 4P7GA 3H5IA 1A8HA 3B9PA 3GLHA 4X7RA 3TUZC 2JA2A 1NBWB 1PNOA 4JZKA 3NBQA 2RAQA 1OZGA 1A8QA 2ZIWB 3AP2A 4B4DA 4KR3A 1CZHA 4DPYA 2VJAA 1AUXA 5FH9A 4ISBA 1EQMA 1PEAA 3MTBA 3NONA 4Q3AA 1YFZA 1FFXA 3F44A 3OOEA 4N18A 3FCHA 3LUKA 3C3XA 1UMDA 4LHVA 4ZI2A 1OXVA 5I3UA 2WYIA 3FQKA 1XAHA 4FB5A 3NAGA 5KYWB 1X0PA 4UHKA 4X00A 3ZV5A 2DVMA 4D9NA 2YWJA 3MMCB 4C08A 1VSBA 1E1CA 1QTMA 1CF2O 4YR0A 1U2GC 2MMCA 3DO8A 4WKPA 3TLGA 1WOOA 3PW5A 3ND9A 4RS3A 4C5BA 3EYWA 3T3DA 1GL3A 2XYGA 2XMVA 1NYRA 3ROZA 2PZAA 4M0EA 2EZ4A 3AH6A 1Z7GA 3FOFC 1O51A 3OT5A 1XYYA 3ZWXA 1N3LA 1OOEA 4TV9A 3U3XA 4ZEOA 4P4GA 1WZCA 4R9RA 5DV9A 3ZQJA 5AUOB 3QG1A 1YK9A 5C7PA 1XNQF 3ZLTA 1CEQA 4OM7A 3DRRB 2D62A 3BILA 4QR2A 2V6GA 2HBYA 2I9PA 2YYAA 3DKPA 3E2EA 3LP1B 2GT1A 1RQXA 1HXHA 5CXSA 1MJHA 2QC3A 2VNIA 3TINA 2IHYA 1KEWA 4P5DA 4TLMB 3X1KA 3V4SA 3DE3X 1MD9A 4Q19A 4KH1A 1KH1A 1E7YA 2W1BA 2ECOA 2G9ZA 1C1DA 3ICQB 5GIPE 3TL6A 1EHWA 1ZGZA 3PJRA 1M2OB 4OAPA 1NU6A 3O2NA 1VJRA 1ODKA 3CJ2A 3ND7A 2WW8A 2MSDB 4DEZA 3FSGD 4QGHA 1ADYA 2AC7A 1UP4A 5KDDA 3Q3GE 3CRZA 4FE4A 1WKCA 5TVKA 4HCJA 3I1YA 2CQ0A 3CSDA 4C2TA 4X66F 3EYAA 2NUAB 1F1BA 4YR7A 4FGJA 2IHTA 4ARZB 4JODA 4P3OA 4YJGB 4CEHB 1AUDA 4GYKA 3TLEA 3IRXB 2XNCA 3W4JA 3QNWB 4LRSB 3CVOA 3LQQA 1ZAKA 5HNKA 3VAKA 1L1QA 3KQYA 1W2BR 4QFMA 3RU2A 3S8EA 2JFNA 1Q0SA 2WSMA 1LWCB 1QV6A 4PNPA 1I2AA 3BBPA 3LGXA 5AW9A 1VL2A 2AOUA 3PRDA 4JHLA 5E7MA 3JVUA 2RHJA 2RIRA 2H7XA 4LZOA 2R1VA 4G1MB 4WBNB 4A0FA 1Y6GA 4FLMA 4ZOCA 1J5EF 3ENKA 1EWRA 2GXUA 2BPOA 4J7XA 1HOXA 2P77A 4F3QA 4ZJLA 2TMYA 5ETVA 5DG8A 4Z9YA 3NWOA 4ETZA 2WJPA 4MUFA 5HUQA 4XPIA 3SG0A 2YWBA 1Y37A 5AW8A 2JZ5A 2HHSA 4BNNA 4O0MA 5A76A 1TUWA 2WFLB 1SO8A 2JJMA 2FH5B 1FFSB 1GCUA 1RZRD 1I4LD 4FVMA 3BSYA 3JAKA 3E8OA 1N8NA 1D1QA 4UE6A 2BFDA 3LXMA 3BA6A 3M6IA 4OI4A 1OYYA 4LRBA 1MVLA 2CVEA 1Z8FA 4MK7A 4ZT4A 4U9HS 4U9IS 2FA9A 3HHNB 2RF2A 4LFAB 4DWJA 3VR5A 2Q3EA 5H70A 5LBUA 2HGLA 4OQZA 4Z7NB 4XQGA 2CE7A 2HCBA 3L07A 3K2EA 1ZVMA 3G2QA 2YZ7A 1ZJJA 4FFDA 4HEA9 3OX3A 1HYSA 3Q41A 1FQWA 2F59A 1P1KA 1KDOA 2G80A 4RESA 1JR3D 6LDHA 2XWPA 3QU4A 4QHTA 3M8SA 1JB9A 5B2FA 1EJ0A 1E6UA 4Q7LA 2VB6A 1RYZA 1XE3A 3R9XA 4Y0FA 1PZFA 3H5UA 3M9LA 3D6VA 3GMSA 2QL9B 4BMDA 2B9WA 1U1OA 4DUGD 2HRRA 4HWGA 3T99A 5JXSA 1XR6A 1OIWA 1SCUA 3CUVA 4DQIA 4V3CA 3KOWA 1TL7B 3DE2X 5LM3A 1YHYA 1X8JA 1DOZA 5J43A 1AQNA 3FYSA 1VP3A 2BIFA 1GRCA 1VRTB 2NYHA 2YBVA 1FVXA 1WW2A 2RB4A 3KUUA 2Q0HA 1A1VA 1JBKA 1D2MA 1LQ9A 2YV5A 4ZVFA 1C3OB 2FQ1A 1HNXB 2I2FA 2FPUA 2CHQA 5LUBA 4CCWA 2LCWA 3RAMA 2O5DA 4AJLA 1VBMA 2XWJI 4IJMA 2OILA 2G4VA 4MWEA 4WFXA 4ZMRA 3T3EA 2AFIA 3CVXA 4GR9A 4BKMA 3PCXA 4YFUA 4DY6A 5EWLA 4BBZA 4PCAA 2ECKA 1Z18A 1RWKB 1P4RA 4H7DA 4QGAA 4L72A 3VHQA 4C0QC 2LNDA 1EUYA 5CH7B 4NCXA 4NFYA 4Y2TA 3ZE6A 2UUAJ 5BSRA 1VCHA 1EZ4A 3NFRA 1PD0A 4B9AA 4HQOA 4WESA 5BQPA 2XI4A 4A8YA 4LNAA 3FPFA 2OCGA 5CH5A 1ZLYA 2W6ZA 1E2EA 4QEDA 3CZRA 1QOQB 2FR1A 1P0MA 3KIPA 4DR2J 4RNFA 3EAFA 1TKTA 5THKA 2QLNA 3FDXA 4IOAQ 2BI4A 4BV9A 4I1TA 5BV7A 1JX4A 5LJIA 1N52B 3RTAA 4G0QA 4ZPAA 1LC3A 4UFNA 4DARA 4BOYA 1KHVA 1Q0QA 3TRGA 4Y2AA 2YH0A 1JBQA 4UNQA 2CZCA 3WWEA 1SZDA 2FWIA 3KEQA 2VYND 1G9SA 1IB0A 1QG6A 4YDDB 1KIAA 1WSAA 2I6SA 3GZ4A 3V5NA 1KDVA 1V1MB 4OLHA 3TVYA 1RU1A 3N79A 3BGVA 7YASA 2Q6VA 2J0UA 1VHWA 5J2UF 1E5TA 2K7ZA 2VD3A 2PXXA 3LK6A 2GO7A 4KFUA 4FQ5A 4FZ5A 4ZIRB 3AR6A 5HWSA 1OQ3A 1XKQA 2BSQA 1RWWA 3JALB 4R31A 2BD0A 1I6LA 3R5SA 3MEQA 1FBTA 4NDZA 2BM9A 3NT2A 3G8AA 4ROTA 1NLMA 2VBXA 1ABFA 2EWVA 4X6UA 4R01A 3INNA 3TOVA 1RXUA 1KZ4A 5C51B 4KZPA 3K53A 3C41J 2I55A 4R4JA 4ALLA 5JLJA 1GCIA 5LP1A 5BQFA 4YRZA 2YKOA 1JHAA 5JWRA 3N28A 3NAHA 2IOFK 4CQNA 3ZW7A 2Z58B 2Z8YM 1RWXB 3C2QA 1CCWA 3FMIA 5GM2A 2Y93A 3E3NA 4MVJM 4ZVOA 2A2CA 2I76A 3C3YA 1DRUA 2DERA 4AFFA 1P0QA 1YK1A 1MNQA 1PZHA 4LSWA 4QOFA 2DBBA 1IN7A 3N8KA 2CFXA 1EVJA 3IC1A 3KQPA 5U47A 4EYQA 2IPOB 3QATA 1T9AA 4EB0A 4RE6A 1YZHA 4IFYA 2OGTA 3ZR4B 1U0BB 1QWSA 4YRGA 1PVOA 1M7BA 1LV5A 3EVAA 5JY6A 4HACA 4Q4DA 4E5MA 2XQKA 4K9KA 1KEPA 3V32A 1G9TA 2KO1A 3T1YF 4EI8A 1GTSA 2ZNZA 1JZSA 5K05A 1NUAA 4KQMA 4UE3S 1XN4A 4EY3A 1BHQ1 3FWZA 4WASA 3H5WA 3TLJA 3AP1A 4GOJA 1EQ0A 5H8WA 4ZVMA 2B1IA 3SSAA 2WJYA 2IH4A 4JUCA 4QLAA 2IY9A 1KWKA 3GFXA 3R7WB 1M2EA 1PJ4A 2FFAA 4LXUA 3EBOA 4MWDA 2Z3WA 2F3SA 2CQCA 1DS6A 1FPQA 4MQEA 1WV1A 3N0RA 4RC9A 1EWKA 1XEAA 2JFZA 3F4KA 2A18A 1YDLA 1IY8A 1USGA 4J4HA 1WC4A 1FLDA 3RSOA 3INRA 1S72S 1RGVA 5AM2A 1KEVA 2R751 4ENOA 1O9GA 2C29D 4AG3A 3C1UA 1W9MA 2LCFA 3DWGA 2MKJA 1PR1A 2CB9A 4PUOB 4E2ZA 1H9BA 1GITA 3VYUB 1DKRA 2QM8A 2B7CB 1SHUX 2ADOA 5TT0A 4NQRA 5GM1A 2P4EA 4ALMA 3VGUA 4LF8B 3KWFA 2ZRGA 3ZYZA 2V0GA 2GIFA 3JV7A 3ZI7A 1XRPA 3TQHA 3HBJA 2ODWA 4PLWA 5HKAA 5HANA 1JWLA 2GAAA 5EHXA 2JLEA 4J5OA 1SBCA 1RAJA 5LSOA 4KYTA 3AQIA 2ZXEA 2BE9A 1AQ6A 3OL8A 4RW4B 1Z07A 2W6CX 1CRQA 3OESA 4MVJF 2RC6A 3HCEA 3GV0A 2DUWA 3U7EB 1UBOS 3AHGA 5I9TA 4DXDA 1BRTA 2XYPB 3M33A 1XD2A 3OJLA 3EIQA 3IT2A 4O59O 1J09A 1V1RB 2OR3A 3DBRB 5IULC 1EETB 5C4GB 4C21A 5JAOA 3GPCA 3N6RA 4KAIA 2GBIA 2HHWA 2ZRKA 3ZWWA 3A1NA 1NG9A 4B3RB 4FNHA 4UVGA 3G9XA 2P5YA 1IKYB 3SC2A 3ONEA 3D54D 4NZZA 2AI1A 1TM4E 4HB0A 4B8WA 1Q7YT 3K8YA 1KQSR 3ET4A 3WR5A 3KLHA 3KK2A 3VHLB 3U4GA 4BQIA 3DD5A 4EEZA 4RA6B 4EBEA 4CRWB 3D31A 4OCZA 3FPBA 3MIIA 2BFEA 2ZJ2A 3AVWA 3P0IA 1XOIA 5BV0A 5HCNA 2IJGX 2DLNA 3ICWA 5M3BA 1MAHA 4HDAA 4LBYA 1IHPA 4NHOA 5BR8J 4AN4A 3KVVA 2J1LA 4QYZK 2QRGA 4V2UA 2I5JA 3I0ZA 3OZBA 2OCLA 2NTVA 3LNCA 4U7TB 1F2VA 4U1RA 2P91A 2Y4NA 5BMVB 1OWNA 1ESZA 3TPFA 1SC9A 5EWJA 4MH8A 1U8SA 1ZK3A 3CRQA 4MAFA 5EWMA 1UKUA 3LTNC 2MCFA 3G7NA 5IOLA 3UR0A 1TK5A 1OFUX 4ZCTA 1N3IA 4CLXA 3Q2IA 2GVNA 2RRNA 1W4BA 4HN2A 2GHRA 3O3OB 2XT9A 4MIBA 1B6GA 3UFXB 3QXXA 4NZOA 2GJSA 3UJ6A 1FLAA 5LBIA 1H85A 2F4VJ 3BK1A 4NEGA 3WG9A 1JHRA 1G5HA 1E9CA 1PBUA 3ECSA 1Q7EA 1NV9A 3M1IA 4M38A 4G4JA 2UVUA 4JYAB 3WFZA 821PA 2QT9A 3I04M 5AK0A 4EPVA 4LOIA 1WACA 1GPNA 4DR3B 2DEUA 1NVEA 1SIWB 3BULA 2IHJA 1U1IA 4MZDA 5D85A 2RK6A 3R5XA 4KHPB 5ETMA 1PFUA 4AG5A 4DV6F 4R2JA 1NF2A 3UH0A 3FK4A 4RXUA 2XM3A 4KZKA 5L1IA 2AN1A 4XUCA 2H07A 4MW4A 1K6IA 1NSQA 1M74A 3B9RA 3V4RA 1Q2UA 2HNYA 3NAMA 3GNTA 4ZP1A 3HCAA 2CXPA 2G5PA 1M2KA 2XMGA 4LJRA 1PEDA 5IU6A 2YNFB 5K03A 1DMSA 2H4YB 4EJ0A 2E1RA 4KQWA 1WOMA 3VNBA 6GPBA 3AJ2A 4TYBA 1HMVA 1JHPA 3G82B 3KK3B 4OQPA 1KA9H 4BLWA 4PG5A 4J6EA 4NV0A 8AT1A 4L3OA 3E81A 4NENA 3SHQA 4X3CA 4PRFA 3V4IA 4AN0A 1PC4A 3JYOA 4AG6A 1DU4A 4B76A 3L79A 1BJTA 1NZFA 3R44A 1WC0A 1PS9A 3GSDA 4D8VA 1NP6A 5EHZA 4YMEA 2OSQA 4PQRA 3OTIA 4U7GA 1EFCA 1DCTA 3OVMA 1IZYA 1BD3A 3D0GE 2DGXA 1TYEB 1ABBA 2J09A 4ZTUB 4Q1VA 4GR4A 3AJEA 2MMGA 1JYFA 4P75A 4GP9A 4KN9S 4BVKA 2YFYA 2AG5A 1NJIT 5TQ2B 4BFVA 5LP6F 2OPBA 1JJCB 3T7CA 2HRZA 3F7OA 4EPWA 3MMJA 4LJ6A 3AY0A 1IXRC 2IRWA 5BSEA 1UFWA 1O08A 4BVEA 2IZ0A 2A9KA 1W0KA 4MRPA 1QGDA 4EZ9A 3DDWA 2XCIA 3FZBA 4P74A 1QYRA 3F6EX 5E3HA 1SKRA 3C6QA 3HB7A 2APJA 4ML3A 4E13A 4U7HA 5BR7A 1FX0A 3CLUD 3GCZA 4TTPA 4B3MB 4Q9IA 3H7AA 5IJ9A 2J6UA 1DKQA