3N0VA

Crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
280
structure length
280
Chain Sequence
DTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDRQSGRFFIRVEFRQPDDFDEAGFRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHCLNDLLYRQRIGQLGMDVVAVVSNHPDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQVIEETGAELVILARYMQVLSPELCRRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATAHYINNDLDEGPIIAQGVEVVDHSHYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formyltetrahydrofolate deformylase
publication title Crystal structure of a formyltetrahydrofolate deformylase (PP_0327) from PSEUDOMONAS PUTIDA KT2440 at 2.25 A resolution
rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 76
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3n0vA01
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 3n0vA02
3R8XA 3DCJA 4NMLA 4TS4A 3Q0IA 1NJSA 1XTZA 5T41A 2P9GA 3DDNA 3ENWA 3OFFA 3TUZC 1GARA 2PA3A 4M8LA 2JOQA 4IO1A 1GRCA 1C3EA 4PZUA 4ZZ0A 3S1TA 4GMKA 4YFVA 2DTJA 1RC0A 3AUFA 3MWBA 5FIIA 3DHXA 3TUIC 1FMTA 1ZGHA 2BLNA 1PSDA 1RC1A 2GARA 3DA8A 4YFYA 4EW2A 3MTJA 5J63A 5IT0A 3LUYA 3OBIA 4R8VA 3L7OA 1SC6A 2FGCA 4ZYUA 4NV1A 1YRWA 5IT4A 1RBZA 2F1FA 4ZYTA 4LUBA 2QSWA 1YBAA 2RQMA 3U7JA 3IBWA 3ENVA 3ENQA 1LKZA 3MAHA 2H9ZA 1O8BA 3HHEA 1C2TA 3KWMA 4ZYWA 3TUJC 1U8SA 2JHEA 5JJBA 2P9CA 4TTSA 2DT9A 4GO7X 1MEJA 2QMXA 1KS2A 3CEDA 2BW0A 3LOUA 2QRRA 3AB2B 1YGYA 2LQJA 2QMWA 4ZYVA 2CFIA 4ZZ1A 1MENA 3GARA 3P9XA 1LK7A 5CJJA 4ZZ2A 4QPCA 1CDDA 3N0VA 2J0WA 1JKXA 4IQFA 4ZZ3A 1Y7PA 2CDQA 3KCQA 2PC6A 4X84A 1UJ6A 5J9FA 4Q12A 5IS2A 4PWUA 1UJ5A 2P9EA 1ZLYA 1ZPVA 2RE1A 3W7BA 3OFEA 4GO5X 2RQKA 3UW1A 1RBMA 2YWRA 3DHWC 1RBQA 4DS3A 2J0XA 2LVWA 3OFHA 2ZHOA 3AB4B 3NRBA 1CDEA 3DC2A 1RWUA 2MDAA 2NYIA 4QPDA 2F8MA 3AAWB 2FMTA 3TQQA 1S3IA 4ZYZA 1LK5A 3K5PA 4EW3A 3O1LA 4TT8A 3AV3A 3IXQA 2I9SA 1UJ4A 1RBYA 3OFGA 2KO1A 4ZYXA 3TQRA 3P96A 4EW1A 4ZYYA 1M0SA 1MEOA 4S1NA 1ZLXA
chains in the Genus database with same CATH superfamily
3CJKB 2QW1A 4GPAA 2IXEA 1S1UB 3QSYB 2VJMA 4V1CB 4OO3A 4S1TA 4ITRC 1QR6A 2CXOA 5DYWA 2YHIB 4KQFA 4E21A 1U1DA 1KN6A 1HHSA 4WKGA 5T7BA 3VZHA 3B48A 3OCJA 4RF3A 2YXNA 3MTJA 1S8OA 2I6FA 2XZDA 4BO6A 2JLYA 3KB1A 5CH7B 1VE3A 3JAWA 5HZHA 4ZVPB 2Z30A 3LXXA 1SC9A 2BMDA 3VTAA 1YVFA 4JI4F 3CCTA 3GV7B 3M7IA 2XTJA 4LF9J 2CK3D 3KHUA 3CR7A 4MITA 3LUJA 5E7MA 2DRIA 4DQKA 2AYBA 1MENA 4FR2A 2OPPA 2C9YA 2J4FA 3HR7A 3UAWA 5CITA 4CH1A 5FWXB 4JI5F 1FX4A 1IFXA 1SHJA 4J94A 4B3RF 2ZITA 5TY0A 1T1JA 1ZG3A 3DDUA 1P7ZA 2GAGC 2GM4A 5DNWA 4DV1J 3FIUA 2Y76A 6LDHA 3RAJA 1ILWA 1U6BA 3MJSA 3LP2B 4R8UA 5AD1A 2X7XA 4YRLA 2WAQD 4AO6A 4IMPA 2KSQA 3J81U 1E66A 4ED2A 2B25A 5JLJA 2E55A 4DLRA 5JASA 1X7ZB 1PZHA 3ZUGA 1JHMA 3ZS9A 2G13A 2C2YA 1JHDA 1OWMA 3RFCA 2N1BA 1BN6A 4Y6SA 1X9GA 4MJ3A 1UQRA 3AY6A 3E70C 1DQRA 2VPXA 2H9ZA 1PO6A 4QJVA 3PUIA 3AF1A 5BUSA 2E18A 1SCIA 3I28A 3G8SA 2H48B 3ZTYA 2BZSA 4F3YA 3HJCA 4ETZA 1E3QA 4IUYA 3RNOA 1RWWB 1V3SA 4PHHA 1QMGA 3FQLA 2QRNA 5MAOA 1Q0ZA 2QM3A 3MNFA 1J42A 5L46A 2LVBA 2H4XA 3PPIA 2CL7X 3F90A 3FCYA 2YJ3A 3EQ6A 5DRYA 1FYEA 1WG8A 2KI5A 1Z2CA 1LWNA 2PSHA 4BP3A 2WVAA 2ZKUA 2QRUA 2KE5A 4CMCA 1NFFA 1RJEA 3D8TA 7MHTA 3C7DB 1D6SA 1K7FB 3OZCA 3B9PA 3G1WA 2PZKA 3B1YA 4KQHA 1XZMA 1Z3CA 3CIMA 3HRHA 2CQBA 5J40A 3AFMA 4MYTA 3DZKA 4WZAE 3N8NA 2PN6A 2JJ8A 2R3VA 5B6IA 3IQHX 4RK0A 2CQDA 3GUZA 1UEVA 4E07A 3K1TA 1S7GA 1KOLA 1GVNB 3F9CA 3PJWA 2D3WA 4UTPA 4GX1A 4JQOA 1PJCA 4ZLNA 3E05A 5KFRA 3W1YC 1RWKA 3CKMA 4B76A 4XLTA 3A1DA 2IZ5A 4EA8A 4QU6A 1LK7A 1NY6A 3INGA 5L1LA 1XWFA 2PC6A 2GK6A 2XDYA 2R7LA 4QJ4A 3PWTA 4CF6A 4EKIA 4F8RA 1KONA 2HUPA 1LPPA 1RKBA 4P92A 4GKVA 1N3YA 3TQEA 5EJGA 3QLUA 1GOTA 1RFLA 4Q5IA 1XQXA 1BFKA 1E3WA 2IAJB 2WMDA 4QFBA 3DBIA 2FLWA 5SZKB 3OCYA 3VPCA 1WEZA 1GPDG 2YH2A 3A6DA 1XN1A 3EZYA 5DG9A 2H5JB 5A3JA 1ULBA 3I1JA 1OGYA 3PU6A 2NZCA 4UNPA 3MFHA 3FDZB 2VP6A 5ALTA 4HAVA 4LBWA 1PEKE 4FE4A 4G0OA 4OJQA 1N4AA 1YJBA 3SZLA 1QO0A 1SKUA 1HY3A 4Y6OA 5FR2A 3HKEB 1EHIA 2FEOA 5TGDA 4KLZA 4GPZA 5EUQB 2YHBA 4DA9A 4LSZB 4YB1P 2RGRA 1OY1A 2LXUA 2E5JA 3ENVA 4QA9A 4BFZA 3JWIA 3OFKA 3UHJA 1PILA 1RVV1 1BX3A 4TTIA 1CUBA 4KGMA 4E33A 2Z83A 1I6WA 1KK2A 3RR7A 3TAMB 2QMXA 4PX9A 1A72A 4NC9A 3W77A 4ND3A 1T0IA 3AJDA 3D6TB 1RCOB 4NMWA 4M6WB 5BVHA 4M0LA 4Q05A 4C8KA 4FWIB 5ERXA 4AW9A 3FX2A 3PX2A 2C7VA 2RQKA 4NONA 1SXLA 3NDJA 3JQAD 4UAUA 1RM0A 3A10A 2HIYA 3FBTA 1L5VA 3JX9A 4GP9A 3QKRA 1PBNA 5IBPA 2JEIA 4QUDA 3PE6A 3PLAE 2V3WA 3CLHA 5KPJA 2H4JA 2IJRA 3K2YA 2HY7A 1VPEA 1DRWA 5EE9A 1YCHA 4E2YA 4DA8A 4QTYA 2GO8A 4JYAB 4DKJA 4FMDF 4C89A 1O6GA 4ME6A 4HI1A 3MPOA 4ID8A 4TT3D 1LFWA 2R97A 4FC6A 1M75A 4BHTA 1U8SA 2VAXA 1RMQA 2PUDA 4WK1A 2FLNA 1E5XA 2DECA 5AI6A 2C5AA 1MNEA 5JAPA 1T4MA 2HLNA 5CVUA 2P5VA 4UHCA 2I33A 4TTQA 1DKNA 1YDEA 1JKIA 3IJRA 4H7JA 4Q82A 1ZA2B 5ADUS 5CIWA 1RK8A 1YVDA 2CNKA 1KEWA 1II9A 3C85A 4AM8A 2QJFA 2AE2A 2V96A 4B32A 2B9YA 1U04A 1I1OA 4TQSA 1V0JA 5KKAA 4ZEOA 5I48A 2HAFA 2PSEA 3Q8VA 5AIAA 1SU8A 4DU7A 4O2BF 4IO1A 4TROA 2PUEA 1ZS6A 3V7UA 1PGOA 1X7DA 4HBZA 1YR3A 3DGPB 5H16A 2O01C 1RQPA 4HAXA 2AI1A 2XS7A 2R44A 3RRZA 2GHTA 4MAMA 5BQXA 1E9FA 2D13A 1Q7TA 4BGVA 1XKXA 1ZSNA 2VI5A 1M6HA 2DPYA 4ENSA 2YRWA 4P36A 1E2MA 3B38A 2IC3A 3R9WA 5DQIA 3PZPA 2WPDA 4QGGA 1HRKA 3BULA 5T57A 3GFRA 3FHCB 5B53A 2IVFB 5CVCA 3C14B 1NF9A 2BP7B 3RJTA 2RGGA 5EFZA 3GJ3A 3P4UA 5B55A 4X1IA 4X65B 2V54A 4C0LA 2R5FA 1Z7WA 5G1OA 3PF8A 3RD5A 4DL9A 1R9MA 1HYQA 1T5BA 4O4HF 3IR7B 2O2XA 2O2EA 2B6HA 4JIGA 1W4AA 3KRTA 1ISPA 1NLZA 5AJHA 1FX0A 4DE5A 1FFAA 4DCCA 1O7JA 2IA6A 1YRXA 2BRUA 2PD3A 1WXQA 4O3QA 4MWTA 1WCWA 1IJKA 1NJSA 2G6BA 4L9AA 2P2YA 4CEJA 2JOQA 4JYBA 3KV1A 3L5OA 1Q0NA 2XMJA 2WSSA 1A1VA 1TKDA 4WGFA 2Z2JA 2ZJAA 1RGVA 4RD6A 3NXZA 1ZH4A 2YV4A 5L53A 2WBMA 5JD3A 3RG8A 2ECFA 4X1KB 4JP3A 1A8PA 2BY4A 2PA0A 3ISNC 4W5JA 3VNSA 1W0KA 4PZCA 1P27B 5L9XA 2MMGA 3IA0A 2Q5EA 4X61A 2HWTA 5CYPA 2HN9A 5FOXA 2VBCA 4ECRA 3OZGA 1ISJA 3KZOA 2Z5LA 1DC8A 3O4VA 3DLLQ 2PCLA 2OI2A 2AYYA 4WXEA 4JJIA 5KAMA 2IS1A 1PE0A 1DRUA 4X0EA 4E5MA 5FTKA 4LRUA 5CFQA 5LSAA 3BERA 1VIXA 4P08A 3KEQA 3MCSA 2EL9A 4DA0A 1HR0B 2PDAA 3M9NB 4RUHA 5ALGA 5J2MA 4G8DA 4DG1B 1JSLA 5BR7A 3C5CA 3GV0A 4INZA 4MDFA 1Z4MA 4DMUB 1YZTA 4EMSA 2WF6A 3D54D 5FFNA 4R31A 3A0RB 8GPBA 1N2CB 3MM5A 4BVFA 4Q24A 3PX4A 1F0XA 5A6WA 3N8KA 1OFVA 4HMPA 4BLTA 2OESA 1A9YA 4PZYA 1W7AA 2JAOA 2WSBA 2XXAA 4AN1A 1JMTA 5BW4A 2NCKL 3UMJA 3ZE6A 3MQFA 2GD1O 3I1IA 4KN6A 1RA7A 1X4CA 3G02A 3SS8A 4B35A 4QOIA 2ZDGA 3JTEA 2JIMA 4XR9A 3KWFA 3TOVA 3DPIA 1G9SA 2EZ4A 1DTQB 1J5PA 1IRIA 4O4IA 1U8WA 1IN6A 4NYIQ 4K50A 2GRJA 1O54A 3ROGA 3RRNA 3HUFA 4I7EA 4ZTZB 1M1NB 1RYSA 2ERRA 3ZHZA 4BKPA 1H93A 2KJWA 4LBZA 2MSDB 2BOVA 3UVJA 1F9HA 4YAFA 1KF0A 1QIGA 2WIJA 1C1DA 1CP3A 1M5VC 3G13A 3D8RA 2JAWA 2PLRA 5HXAA 3A3YA 4AZVA 2C1EA 2OPSB 3JU3A 1U5BA 1BVHA 3R74A 5ITVA 1I5RA 2PS9A 4G6VB 3F3SA 4KXXA 1ODFA 2FZKA 4K26A 4A0QA 4HB2A 3C5HA 4OYOA 1Y5IA 4USHA 3UDEA 1KWKA 2A1TR 3RQSA 1PK9A 2E87A 2VHUA 4TUYB 4F4FA 2DG2A 3O4JA 2E5WA 2IYWA 3HHEA 2WHYA 1E1KA 4ZC1A 2I1QA 4MUBA 2W6CX 3VZIA 4F9EA 1T5LA 2HIMA 1Q1BA 3T4XA 2H1OA 4YBRA 4HYQA 4HUTA 4I6GA 2RC6A 3GW8A 3ESAA 1VJDA 1VFJA 4DZDA 1G8GA 4KBGA 2YFKA 4D3ZA 3U3MA 3G0BA 1BYUA 3BHNA 5J2UB 1XC9A 2IMOA 3NT4A 5EXPA 2HQIA 4W5RA 4AK9A 2NU8A 5E7QA 1YRTA 3CTPA 3S2ZA 5K0FA 1RAEA 1ZUHA 5EMJA 1OD6A 3OE5A 5LXTF 2A9QA 3U60B 2UXCJ 4G5YA 1LV7A 2JIZD 1GR0A 2GB4A 4F72A 3PFGA 3KHHA 5DGCA 4WNCA 3G79A 2MSWA 3AETB 2XIJA 2ZCVA 3OI7A 4DJDC 1QLWA 3HR8A 1L3TA 1VQ5S 3W62A 1AQNA 3IL2A 2AYXA 2QQEA 4YFVA 3S4YA 1I5OA 4B74A 1IK4A 3AF3A 1CIVA 4TVOA 4JI2B 1RI2A 1O5JA 1AN0A 2JFQA 2FEKA 3KB8A 1PJ5A 3F6CA 1SCUB 1Z83A 2VBWA 3AWIA 3R3WA 2CKMA 4US2R 2FY1A 1JDNA 4OLOA 1D4OA 2IHZA 1YR1A 5EKXA 3MYRA 5JZBA 4PX3A 1E1CB 4E70A 5JS2A 5JADA 1YV9A 2PLFA 2EC5A 5EWJB 4MV0A 1P44A 4UUQA 5IV4A 4ZVTB 2WUEA 1M6YA 3NWGA 2IDZA 2MKCA 1W75A 2C7PA 1WIWA 5I42B 4I14A 2RIJA 3KVRA 3IHKA 1BXRB 2G28A 2WM2A 1RIIA 4LJLA 2AIRA 3F6PA 3H2ZA 4NXNJ 3WP0A 2BTQA 3JQ7B 1ZY2A 1Y6QA 2B83A 3NDIA 4WX2B 4CKCB 1NJXA 3SCZA 2J3JA 2YS7A 3ZKWA 1MVLA 4UPVA 1UJ2A 3MSXA 5INTA 5JROA 2WBLC 3KZ1E 1J1IA 2HA5A 2EDCA 1LQ9A 1N5DA 5EXDA 1B99A 4F0MA 1PFKA 1X0VA 1R0ZA 2O3TA 1IHDA 3KJEA 2V59A 1PR0A 3FSIA 2OC4A 1JG2A 2QMHA 3WGYA 2P0AA 2DGOA 4A0FA 4J0FA 4DLTA 2I65A 1DBIA 3JQKA 4JI1J 1QH1A 4JHXA 3BWXA 4EY4A 3CRZA 4G9EA 2A0UA 3SHQA 1G4HA 3P9QA 1VIAA 4FGJA 1PBAA 4LX8A 4ZMSA 3N0VA 4AMGA 5ED0A 3MI7X 1UF9A 4X66J 3SXUA 4GQAA 4IGKA 4ECVA 2CDAA 1ZLYA 1T9GR 3HHLA 1MLAA 4KQ1A 3LD9A 1WOSA 3EQ7A 4GI5A 2CZ9A 4ZK6A 1S9GB 4MFBA 4PYRA 3IBTA 3ZE2B 1JPUA 1ONPA 3R4VA 1QQAA 2JHCA 3LWMA 1P2GA 1XMQF 1YE3A 3BGSA 1SQFA 4REOA 5D5PA 2PGDA 3CURA 1EJ2A 2XXJA 3IM9A 1GNQA 1DOZA 2YXEA 4WXHA 3OTQA 1G59A 1EQUA 3T5AA 1FX1A 3L0SA 5AJYA 1BC5A 2ONYA 3DTVD 2IODA 1ZUIA 4XIYA 2RS8A 3IR6A 4FHZA 4L50A 1MH1A 3LGAA 3ERCA 4JT8A 3V97A 5KYYA 2ACKA 1VBFA 2Q9CA 2C2RA 3OBBA 1NU4A 2B98A 2CJAA 2VBGA 3EPIA 4KIWA 4DFPA 5KT3A 1F12A 3RO7A 1NM2A 1T6NA 2GEVA 4ED7A 4INAA 5DNDA 3DYAA 1JFVA 2ENUA 1M8KA 4KLNA 1FC0A 4QXAA 4US1R 1AQJA 4Q2MA 4C2MA 2ZI9A 1Z2ZA 4YUWA 1SXJD 3H4TA 3QENA 4EPRA 5L4LA 2HMUA 4B81A 2M9MA 1SJ1A 2Y1DA 4XGRA 3RGGA 3D6HA 1M54A 1VLVA 4ZFNA 2EBHX 2EWVA 3ZBUA 2OUKA 5BNZA 1Z07A 3ZK7A 1YKFA 4JLJA 3L7UA 4N5MA 4WPAA 5ALMA 5F33A 1SD5A 1EK0A 1TK9A 3H9BA 2AMYA 1JAHA 4BFTA 3L6UA 5LD2C 5DJ5A 4IUDS 4J8PA 3R7WB 3LWLA 3A2MA 4PONA 1CUZA 3X1YA 1PAUB 3ASZA 3JS5A 3M2VA 2E2WA 4IV0A 4EY5A 1R9JA 4CV3A 2JFDA 1KJ8A 2HSEB 1TIBA 1R10A 4XM2A 3MRTA 4UBLA 4G0ZA 3Q24A 3K0EA 1E7WA 2ID9A 3F6YA 2IFTA 4BQPA 4M99A 2V65A 3LCMA 3VOSA 2QNRA 3GH3A 2Y1GA 1MO6A 2LV8A 4HAYA 5D84A 2BFCB 1SURA 1N77A 1YA6A 1V1MA 1EGAA 1W73A 3HLKA 5BORA 1TL7C 3LO5A 1HNNA 2B3TA 3T5MA 3WGQA 1E2NA 2KYXA 4DHVA 4M89A 5DKFA 4JENA 5E1MA 4MDHA 5JPIA 3T3OA 3DDIA 1EX6A 2P40A 3NCPA 2UYGA 1RYZA 2QD5A 3L95X 1FXSA 2Y6VA 2CPYA 1CDZA 3M5CA 4DCPA 2B37A 1FXDA 2CPHA 3GJTB 3B2QA 1TUBA 4BFXA 5JTUA 3N9UC 3FBFA 4NPOA 3D1OA 3CWCA 5K9ZA 1PX2A 3C6TB 2PD4A 4LHEA 2YW2A 2YWJA 3TZWA 2DB3A 3J7TA 4A6DA 3MOJB 3D4OA 1S1TA 1W2GA 4O8ZA 1L5SA 5C8YA 1G6BA 4JB3A 4DUGA 2VZ0A 5IM4F 1YBAA 1A2OA 4K6GA 3VPDA 1OFHA 1UMCA 2OPBA 2XUQA 4G1PA 1L8AA 3MRXA 5HJXA 2HKEA 4BVGA 1EAMA 2QEQA 2IM1A 3NTXA 2BFBB 4TV8F 1ORWA 1AN9A 2YN4A 4C0OC 4G5HA 2RKWA 2RGWA 2COKA 4PWWA 4OPMA 1B64A 2VZEA 4LNAA 5CTJA 5FLYA 1ZM3A 3QYYA 1G8MA 2GMWA 4LFAF 3D7LA 4MMZB 4O8CA 2HFJA 5DNYB 3G8YA 4RU2A 4B6FA 3GFVA 1M7BA 1K8YB 2BGNA 2NO1A 1F3LA 1E94E 1XDZA 4CKWA 4PLGA 1RT1A 4FCCA 1HFKA 3GIWA 1G3QA 3TLGB 2CJXB 4X6LA 2L3MA 3IB6A 5KQPA 3W5BA 1Z4KA 3QOWA 1FRLA 2W4CA 2K06A 3B6EA 3HUDA 2QM0A 3TX6A 2XNRA 5AVQA 4RD3A 2R7UA 4LF7J 1XNHA 4K03A 2G5TA 1LXNA 2V8BA 2QPLA 1UCNA 4DC1A 2CMGA 4BO1A 1SB8A 3CY6A 4L8WB 1SC6A 3A58B 4O2RA 3E9MA 2PZ8A 2PKXA 1YR6A 1VSBA 4MI3A 3TD2A 4PWDB 5EZYB 5M2RA 3U9LA 3UOGA 2W48A 2R7AA 3TWZA 1U3DA 1FERA 5K14B 3ESCA 1BWRA 2DZDA 3H2LA 1RT5B 1DTTB 4ID5A 3J7YI 1CJKA 3THYA 3ZDAA 1ZZFA 3IPRA 2P7IA 3ISVA 3K71B 1MXFA 4JT4A 2Z1DA 2P2SA 1N6PA 4OYAA 2QX7A 4FUQA 3HKBB 4G5XA 3PA8A 2AUTA 3VPXA 5DZ7A 4RENA 3PXGa 1XTIA 5T4EA 1JIQA 5GM1A 3CFYA 3LRPA 4DR4B 2MSSA 1SVLA 1G5PA 2VQFB 2I6GA 3PW5A 2CMFA 3RUHA 3NS7A 3TRFA 3SU8A 1R6XA 1Q0QA 1JW9B 4P5DA 1LBTA 1X4GA 4N12A 1COWD 1I2CA 1U65A 1LWCA 2ZWPA 1E5DA 3UMGA 2WWHA 3GN1A 3H1TA 3EFHA 3LF1A 2QLWA 1LDNA 1NW3A 2OQRA 1Z6GA 3RUIA 5CFZA 1F2TA 3GRCA 2I9PA 1TM5E 1PG2A 2IPOB 3S1LA 2Z2XA 3E3MA 1GTRA 3Q7PA 4Y2IA 5IANA 4Z4QA 4D9FA 1YE8A 1C0LA 3U44A 3FMBA 1NE7A 4EF6A 1TQDA 4CLTA 4ZKDA 3GYNA 1KJJA 2VHVA 5C1OA 2Q45A 1BVYF 5KG4A 2D74A 1V8PA 3KLHA 3VPHA 3BPSA 1GNVA 4BLVA 2WT8A 3H6GA 3KQVA 4FEAA 2G08A 4E6PA 1ZUD1 1L5HA 5ARCA 2JGAA 1BQXA 2P9EA 4ZVGA 4GI1A 5EIOA 5ESXA 2VATA 2P9TA 1T0TV 2TMGA 4OA8A 1QOPB 2FFBA 3TTVA 1CY4A 3MBOA 5DH9A 4UM5A 4X93A 1XNQJ 3T3EA 5E7IA 4CIAA 1UK9A 5CHYA 1ZKMA 3FI9A 2B51A 4BN5A 4H16A 1EKRA 1CY0A 5F3WB 3BFVA 4FJ0A 4JI3J 2JI7A 4MWOA 3GLUA 4R8LA 1IUOA 2UVDA 1MO3A 2DC1A 4X6XA 1IOLA 4R7GA 1MOSA 3LF2A 4IDQA 1LJUA 4GMKA 2Q6LA 1O58A 4Q7MB 2JCYA 4KDFA 1V8OA 3PSAA 3TYTA 4OP2A 2CYBA 5DLEA 2XMTA 1IKYB 3V4MA 1GZ7A 2GEKA 4NY1A 1RSZA 4BO0A 1BH2A 1R4NB 3AIKA 5KTMA 1RU1A 3Q2OA 5J2NB 3SYNA 2FVXA 2PO5A 2MZSA 4K3VA 1Y1SA 1K2WA 2QYOA 3UH1A 4WZMA 2HA7A 2RJ3A 4D7AA 1EVEA 2J59A 4A2WA 1UC5B 1VMKA 2MHNA 2ZREA 1WP9A 2AJQA 2YXLA 1C9KA 1BCRA 2J5QA 2HL6A 3G82C 4CCYA 5I7UA 2VYNA 1AUVA 2OKGA 1FJ2A 3I12A 3FVRA 4H3KB 2B1IA 2A9VA 1YF3A 1TU0B 3CRNA 3ZZ1A 2BGJA 2G06A 1RSCA 3JARA 3VZQA 5JSQA 5LR6A 3ELUA 1UXJA 3PHBE 1CS4C 3GPDG 3M3HA 1BE4A 1DJOA 3A3KA 4E8UA 4PNPA 4W92B 3I9V1 1Y1TA 5EXSA 5TQ2B 1ODTC 4DR7B 1W26A 1Y9OA 2P9FA 3N2IA 3OX2A 2C9BA 2MR6A 1K1SA 5HJYA 1FYXA 1RZRD 2R1UA 4R0VA 1CLUA 5MFZA 2FR1A 3C2PA 3WNQA 2ZJ3A 5A9SA 4DR5F 3PR2B 5EN4A 3VAJA 2J9FA 4I9GA 2QRGA 3A1EA 4YMUA 2PFDA 3HA7A 1Y8ZA 2XGOA 2EQ5A 3H2GA 4MW9A 4CLDA 5F7OA 1N5SA 2D4HA 2ZJQQ 1O9HA 4M22A 2HH9A 1YK9A 1UXKA 1Z5OA 4KX5A 3H4DA 2O2JA 3GFQA 4E51A 1R8CA 4YAGA 3DP9A 1UBJS 3EZLA 2Z0MA 5DX0A 3REQB 1FKPB 3RQIA 4IR7A 2HFOA 3JQ9C 2DSTA 3MM9A 3JQ6A 1T6ZA 1V1JA 3Q1LA 2E5LB 3PIOQ 2SXLA 4NEGA 2P6TA 4F9FA 2JAPA 3NHRA 3LWBA 2GM5A 2L9NA 4AN0A 4CIOA 4EZBA 5M7EA 1KWMA 3KNGA 2H7VA 3IE0A 4F3TA 2PRZA 4XJTA 1WC3A 1IJEB 3ZCRA 3IWNC 1TKZA 1NXTA 3DFIA 3PF9A 2Y71A 4J43A 3FA2A 5ETMA 3Q5GA 3AK4A 3B4MA 2IOFA 4UOCA 1GFSA 2WU0A 2NXUA 4DPWA 4Y1EA 4IOBA 4UEOA 5AW7A 1R16A 3BO3A 3FNBA 1F0PA 1R4MA 4BL5A 4EPWA 4N03A 2ATCA 1UT6A 2QE7D 5JYEA 2CHGA 4M8IA 3PTAA 1MW8X 2JHPA 3EUAA 3QBTA 3THWB 3AY0A 1P4JA 4YI3A 3BGRB 1LC0A 4BIIA 4P5EA 1AMNA 1TF2A 4NA2A 3TUPA 4W4MA 5KQLA 1I4WA 4M9RA 1ZGAA 2EJWA 4MHOA 4RF4A 3ZG6A 2VODA 3GNTA 3I3SR 2W2PP 4ANCA 1NJFA 3MC1A 4DS3A 4LKOA 1QLNA 1DAFA 4V0RA 3V8MA 1N9KA 5EVJA 3OMWA 2ZPAA 4D99A 1Q15A 4V03A 1QS0A 4ECEA 1P0IA 1XTRA 3CCWA 3PJGA 3DLTA 4IXWA 1IB6A 2WOMA 1G21B 2X0NA 4RPKA 1YB4A 1KMQA 2D6FA 2H1WA 2NXWA 2VB6A 2GPNA 4Q0BB 2AZXA 3NC0C 4ZZ0A 1U1MA 1X1QA 1OLSA 5KOJB 1KJIA 1RCTE 1ZM2A 3BEOA 2WPNA 4WE1A 5J2UF 1N0VC 3CZ4A 2Z56A 4KPUA 3I9ZA 1MIOA 3I9FA 3ED5A 3E3XA 5D3MA 3W2GA 4CIWA 4AJ9A 5K8JB 4CDGA 4LNHA 3RU2A 5JSZA 3DAOA 3LP1A 4Z4CA 1GY8A 4OYRA 1HI1A 3SVZA 1VLQA 4ZHRB 3EZ6A 1FRJA 4XPEA 2P68A 1CQJB 2B5JA 1N34B 5CZVA 2QYTA 2AW3A 3EUWA 1CZKA 5IT9A 1XK7A 1OAOA 3FLMA 3LWNA 4C7MA 1YS9A 3KLIB 4XPZA 3IIEA 2BJ7A 4LF6B 4Q4HB 5C4IA 4GVLA 3LHFA 1SKWA 2QN7A 1NVBA 2X5JO 1UKCA 3TF5A 4QCLA 4HNSA 4JI2F 3BJIC 3L07A 2IPAB 1JPJA 3WBKA 1FJGB 4JQCA 1P2DA 5HK9A 5AJUA 4N0EA 4O3NA 1W6UA 1NASA 2CJKA 5K8IA 3GO4A 4NX2A 4NEHB 4R51A 5J4LA 2V7PA 1IUNA 1IQPA 2APOA 1L5YA 3V8RA 4MV9A 2P35A 5KKNB 3N87A 2W9BA 2QIPA 3DOUA 3ESDA 4B5KA 1KSGA 5CX1B 3CX6A 4Z1MD 3I9V6 3KWLA 1M8JA 4MW1A 3RR2A 1QLJA 4ZVSA 4A73A 3U6BA 3KT3A 5HIIA 2OGTA 4F7DA 3A2KA 4UKDA 1N8TA 1NVMB 1S7IA 1DKQA 4N8OA 2GN2A 4XD2A 1XVTA 4ZDIA 3E7PA 1EGHA 2JGFA 1UZNA 3CPWR 3TRGA 2E3JA 1TJNA 4PPFA 1SVSA 4PZZA 1KXZA 4EU0A 2HRQA 2IE8A 3TKYA 3ODGA 3M8KA 4X4TA 1VA4A 4PG8A 3E8XA 1KHWA 3OEED 1EESA 3ETMA 3DZCA 1F14A 3TWOA 3W2HA 3PW4A 2E4YA 3X1KA 2PXAA 5KG5A 2VF3A 3DBLB 2AKYA 2X42A 4R41A 3KLFA 1T5IA 4UBKA 2YMQA 2VWGA 1HMPA 3U26A 4F8EA 3QITA 2WY2D 1N5QA 4E3ZA 4D97A 4DV2F 1U1NA 1R0XA 4XCQA 4IINA 3GLHE 4WLNA 2X86A 3IILA 4M9XA 4IXMA 4AL6A 1DXYA 2HGNA 4OKIA 3FRHA 4IJMA 1OU4A 1GTJ1 3N28A 3KELA 2GMLA 1OIAA 4QOTA 1IM6A 1O89A 3AF6A 5E2IA 1QYVA 1XFDA 4RS3A 2HB6A 4OAQA 3GFFA 2I4LA 3J7Z5 1S2IA 1X14A 4GEKA 3SDZA 5IKPA 3T61A 1GUYA 2HA4A 4CEIA 3IKLA 3IOYA 3UT5A 5CT6A 2J87A 5CG2A 1X77A 3EG9B 3I6QA 3CDBA 5MFPA 1XR6A 5CW2A 5EA2A 5DRKA 2Q2OA 1FKOB 1Y5MA 3OV7A 4HB3A 4C03A 1B26A 5BQ5A 5JD6A 4K0RA 4BMCA 1YU6A 3GJXC 3MYYA 4WFXA 2ZH8A 1REVA 1UM9B 5BSMA 2DEIA 2QVYX 1FLAA 2PAAA 3OD2A 2KN4A 1VLMA 2HCJB 4X8LA 5TEWA 3QIDA 3TEFA 4FINA 3VYUB 4FIDA 5IN4A 5MHTA 2W6ZA 3AW8A 1L8OA 1EM6A 5CGQB 4GSKA 4GR9A 2P62A 2OHDA 2RQ4A 5JXGA 3QIPA 5KNBH 2ASVA 1CQPA 3V1YA 1O4VA 2AG8A 3FTQA 2P9ZA 1KKMA 2XWYA 1NI5A 1M33A 5KTKA 4FJ1A 2XEDA 3BGLA 3L6RA 4XUEA 1NMQA 4KXMA 1AD2A 4XVCA 3AT1A 3F3KA 5CURA 4UHFA 4K5QA 1VL6A 2YBDA 5U4XA 2GPSA 4WXPA 1A50B 3MERA 4G65A 2AFVA 1GZ5A 1UK6A 3GBVA 3CKLA 3W9IA 4GVPA 5E3IA 1OXXK 2W2MA 3UMFA 1E6YA 1D2EA 2R85A 4I1OA 3RRHA 3WR5A 1DJ0A 3U27A 1X7XB 1F60B 2RGXA 3UUGA 5GJWC 4YN3A 3BPDA 2R25B 4X95A 3NNHA 2GPAA 3OLZA 3TOZA 1DLJA 3KUDA 1VQ9S 4KGZB 1VJGA 2OFHX 2R4TA 3EVAA 1UAAA 4NG5A 2JFHA 1ST2A 1HKHA 1DKMA 1GCOA 1UKVY 4YJGA 3EQZA 2AFHE 5DYIA 1Y3CE 2C4HA 3C5WP 2Y66A 3TOCA 5ALKA 4RHYA 3BK2A 3PHTA 3KPVA 3HBAA 1YQXA 4FOSA 1LZKA 5CD4H 2CFXA 2X4DA 1I6MA 3VU8A 2V0GA 3F2VA 3JCZA 3GEPA 3NYQA 4KIFA 2L18A 3Q72A 2DGXA 2YX7A 4WXOA 5ALXA 5HIJA 4BMXA 4IGAA 3T9AA 3QELB 1VI6A 3AV3A 3C6ZA 4KAJA 2P2DA 3WB1A 4B4DA 3IPLA 3OEWA 3S68A 1HWJA 4ZLPA 3JPYA 4RQUA 3WSWA 4V0LA 1U8AA 1ZEJA 1WPQA 1EVJA 4R54A 2YZNA 4TL7A 3G9QA 4NJMB 4FGSA 5DLYA 3QLHB 1CR1A 4BC9A 3CW8X 1MPTA 4MHSA 3PJ9A 4FIZA 2RHMA 2D3TA 3LBNA 4WF9Q 3G68A 4NA3A 1QOQB 3HDSA 5CYQA 2CCJA 4RZSA 4OJ3A 1XLVA 1ODKA 2GYVA 2FGCA 4P2XA 3BJRA 2WIAA 3N8IA 1RABB 3MAHA 4B7UA 3PV0A 1QIHA 2YNGB 3QT5A 2GLTA 5EKSA 4M60A 2W37A 2B6AA 1CB0A 3HYNA 4DCSA 2IBTA 2LKDA 1X1TA 2K2PA 2QMWA 1YAHA 5E38A 3NH6A 3ELBA 1BG6A 3R6LA 3PFNA 3MM8A 5DV9A 3K0JA 1VMIA 1WXFA 2H16A 3BO2A 3BJZA 2P9YA 3QBJA 3C6UA 1ZD5A 1U1FA 5GOZA 3GCGA 1YR8A 3FIJA 1WSVA 5ETJA 1PG5B 2J0UA 2XMAA 3TBFA 2VUTA 2EC0A 3K8YA 3AJAA 2V6GA 5LCXA 4JA0A 1EHYA 3FPBA 2M52A 1IJFA 3UCUP 1E1RD 3ZDCA 3RSHA 2FHOB 3TRIA 3H2HA 1RE0A 2R68A 5EZYF 4TNOA 3WFJA 1CF2O 1MQAA 4AKHA 3A9TA 1M5HA 4HMOA 2UU9J 4B9AA 3PEFA 1M5RA 2XULA 3F67A 1H6BA 1RXIA 3OAAD 4IVRA 3U09A 3I32A 3GYGA 2VG8A 5TS2A 1SD2A 3EIUA 2PUAA 3K6SB 2J9ZB 2MB0B 4CGZA 3ZIAA 4WXYB 2H06A 2ZXEA 2I1RA 4S24A 4LXGA 5CABA 1LJLA 4MIEA 3GQBB 5KYUB 1RAHB 2HMIB 4K9LA 1YRAA 2FUG1 1TFYA 3L6DA 1ZOOA 4BWGA 1JJHA 4X64B 3H87A 4LOHA 3ZLJA 3AXMA 4ARVA 1W85B 5AQEA 4AXBA 4UM9B 1Q8IA 1Y37A 4WNIA 4Q4JB 3GBPA 2IC5A 4CT8A 5EZQA 5B0GA 3D6VA 4LOAA 2G17A 1N6IA 1ZK4A 1JDZA 2X8JA 1EJ7L 1W36C 2G9ZA 4RAQA 1NNI1 5JAOA 1QRTA 4XSGA 4K9PA 3PI7A 3TRJA 3TOSA 4EJ0A 3I0RA 3ZLUA 2LP4A 1F1BA 4FFLA 3NL0A 1KERA 1OCEA 1VLLA 4GKJF 1DWUA 4P3OA 5JRZA 4GC9A 3WMWA 3IQDB 1YFJA 1XEWX 2H54B 4C20A 2GVDB 2PQ2A 1P6XA 4QPXA 4K4WA 2PUBA 2W6OA 4LZNA 1VKJA 2BBOA 1VR6A 3I4HX 4M5DA 4F46A 1BJKA 4WFAQ 1NNEA 2WSYB 1XEZA 1AGPA 1NK6A 4IJQA 5D6OA 2P0YA 1AG9A 1FRZA 1UC9A 5K51A 1BE1A 5HDBB 3TJZA 3O4IA 2A78A 2NNLD 4NE7A 4ZJPA 3UENA 1P1KA 4JFRA 2DUUA 4PXCA 1BW9A 4RKEA 1B14A 2RGNA 2EJTA 1UZAA 2CLMB 4FHEA 3NQ41 3RVMA 1UFWA 4JI8J 1TCCA 4BNXA 3PENA 1H8HA 4Y1RB 1FFCA 3ZLTA 5LZ4A 3NNCA 1BIFA 2E7XA 4FPRA 4TS3A 1X5TA 1M6VA 1NHKL 3OCVA 2RAUA 3F7NA 1XB2A 1U2RA 5B0FA 2FPGA 3OKCA 2MT9A 4CV1A 1SH0A 5J2PB 3O8WA 3DGFC 2X0KA 4U7TB 4D74A 5GJCA 3GA7A 4EUKA 4R2IA 4E32A 2NIPA 3N39C 5CGZA 1YZFA 3ADBA 1H8EA 1O1YA 3IFSA 4Q1CA 3AJEA 4YB7A 1C0TA 3TI0A 3SMVA 4E5NA 2MINB 4B1FA 2ZUVA 1U8UA 2YJNA 2Q3HA 2FPKA 3L7MA 1HKUA 3W3AH 1J8QA 3Q88A 4WJKB 3SAJA 4AQ7A 3HP4A 3IUSA 4ZJQA 1ICEB 5EERA 2WU4A 5JPCA 1N6QB 2BKUA 2VYVD 3FRYA 2BELA 3OLYA 2QZ4A 2IPXA 2ZNYA 4CO0A 1RYEA 3MWKA 4KBIA 2JK1A 1M8GA 4WFNQ 3I8SA 4XDDA 1I4DD 3KV3O 2GF9A 4MS4A 1A9ZA 1U2GC 1KH1A 4LQ9A 1WPRA 3KL2A 1MGOA 3R0IA 1Y5NB 3I6ZA 3DVLA 1JEDA 1E2LA 1IJBA 3AVWA 1RRVA 2CIMA 4QR1A 3A8EA 4X4QA 3QFWA 1AKNA 3K70C 5KX5A 2XOEA 1K9SA 4DL0C 2NYUA 4FLMA 2KM8B 1A0OA 1Q16A 1PJ8A 3BFJA 2N75A 5HMZA 1RI7A 4GF5A 1QSYA 1NKVA 2IY8A 4CGYA 4N76A 4DLKA 2NO6A 2DEUA 4DEXA 3JQGA 3HRKA 4PWUA 2ZANA 3NASA 4GBGA 5ADHA 1RU2A 3QX3A 2P75A 2RGDA 4W4TA 2J6SA 1IBLF 2NSLA 4R83A 1T4BA 1WC0A 3DE4X 3WIUA 4WBXC 3UXYA 1C5KA 1KQOA 3STUA 5LMNJ 1BRMA 4XB1A 1JXOA 2NADA 1GNTA 1YJWS 4KYVA 2V2QA 5EJ5A 1DQ9A 1UTAA 5ED4A 1L7RA 2AYMA 3D67A 2IITA 3OZEA 2RHQB 4NCHA 3BXZA 2PQ6A 2HW3A 1J07A 3H5LA 1MO2A 3I9NA 2IRYA 3TEHB 4EF4A 3OR2B 4MQ5A 2XTNA 4DPKA 1RR6A 1T4CA 4TVSA 1Q6ZA 1SVMA 1YITS 1I3KA 1O0CA 1K7EB 1I24A 1Y5LB 1GKUB 2AJDA 3DPSA 4O44B 1DCKA 5B0AA 3PP8A 3O1IC 3R9KA 4F84A 4MQLA 3CVXA 3D6MB 3IA2A 2GV1A 4CRWB 2VSXA 3NHPA 5AVJA 2FUG6 5L6MB 2HJVA 5E9QA 1M2OB 2JH3A 4F5EA 1JEEA 1XZQA 4YDQA 2HBZA 3RVBA 3IMKA 1MTOA 3D8HA 2MTLA 3P5TL 4GGPA 3AEYA 2E44A 1L7AA 4DA4A 1Z37A 4G25A 4ZCLA 3F4LA 4KAAA 3W5IA 1NP3A 3FYUB 4K4ZA 1Q1GA 1RYFA 1TTTA 2CWXA 3TNYA 3P52A 4AP6A 2ZYDA 2CHEA 1R8AA 2D7JA 4XFKA 2A0KA 1DS6A 3A7EA 4YS6A 5D3GB 1W46A 4P2GA 3BK7A 1A7UA 5FO0A 1M90T 2G6TA 4EB6B 1TM7E 4PLFA 3KTQA 4LJ4A 1E1DA 3OFJA 3SP1A 5DDOC 4YDHB 3BXPA 2QX4A 5G4DA 1JLMA 3PQ3A 2Y3YA 1E6VA 1G20E 3O8RA 4DFDA 4HNAA 1BHSA 3RAFC 1QIEA 1D5CA 4DMLA 4C6HA 4BV9A 3HV0A 2W98A 4TMYA 4M86A 2DY0A 3MMAA 5ABPA 1W52X 5DN9A 2LWIA 1NMZA 2DM6A 3W5DA 4WESA 4RE6A 2PH7A 5HJ5A 1FD8A 3IUBA 2A84A 3QGGA 4TU7A 3JVEA 1S0UA 5IVKA 5BXQC 2IS6A 4L4UA 4PXSA 3RS3A 1RAFB 4QIFA 3JR3A 4IKAA 5LOVB 3QNUA 3RWOA 1W4RA 2YRFA 2R0QC 5TPWB 4FX5A 2NYRA 1H4QA 4ZPXA 2DXDA 5JQGF 3HEAA 1NH7A 5HSGA 1LB1B 1NXOA 4CL3A 3JATB 3EN0A 3PWSA 3OJEA 4GQBA 3ZNJ1 4IZIA 4NHEA 3WLKX 1WKLA 1WKJA 1BXGB 2PT6A 3F78A 1XL1A 1OPRA 2W6IA 1AB8A 3QRRA 2DGQA 1FRVA 2WJIA 4QPJC 2YYZA 4MPDA 5LOQA 4S0XA 1T9YA 5B2ZA 3U49A 5DM1A 1XCMA 2CDRA 1B16A 1F4VA 4EUNA 4DJJA 3GT7A 1CULB 3BDVA 4KH1B 1T8RA 1ZNXA 4I67A 1X4BA 4KH0B 2Z9DA 4USIA 5HWSA 2WU1A 5I7OA 3EPHA 5JEEA 4TLEA 3AZOA 2X4LA 5ELMA 2BX6A 1OKKA 4FEEA 4XD7D 4EEZA 1O95A 3L77A 2V4MA 4OX9J 1UBOS 4CLXA 1QY7A 5M2PA 4YP7A 4DLZA 1EXDA 1FMLA 1CR4A 3T6JA 4UOZA 1XZAA 1SXGA 1S97A 1EBBA 4RJIA 1E2KA 5F2EA 3DOLB 3EAQA 4YY3J 4MLZA 3D9BA 4IL5A 4TRJA 5BV7A 3AGQA 3P26A 5IUJC 1XWLA 3LXUX 3UJDA 1BGXT 1I51A 4KREA 2EBEA 5BVGA 4LE1A 1AS2A 3PCRB 3LZDA 2CQ2A 2DPJA 3M6XA 1L5FA 1ENOA 2I3AA 4PYKA 8ATCA 3GILA 2K6GA 1R4AA 3EGVA 4JI7B 2ZTSA 1F2VA 2MYNA 2QT0A 1GQYA 3KDSE 3L6OO 4P75A 1TAQA 4BS2A 1TT5B 3N3BC 3DHWC 1IBMF 1DJPA 2L9DA 1GPBA 2YHSA 4L74A 4BNYA 2NGRA 5DHFA 5HMLA 4WFQA 3BBFA 2V7QA 2QLJB 2P8IA 1FPQA 4X63A 4DNQA 2B8QA 2EWMA 4DIKA 3EF3A 1MB4A 3RS9A 4D9CA 5AUPB 4LF8F 1MEEA 4YECA 1KTIA 5KNCH 2MJLA 4IQ0A 1U2PA 1T6XA 2QUZA 2HJSA 3OO0A 2CBXA 4USUA 4C8OA 4B5LA 3GJRB 2I29A 4ZEVA 3OZFA 4KFRA 3PYDA 4IIBA 1E3SA 4LUBA 4FQ7A 1Q0HA 2OZLB 3A3OB 2QI9C 1GN8A 1TVCA 2K7JA 2I5JA 2MZTA 4JJZA 1KZ4A 4DPYA 2VQ6A 2G4BA 5L40A 1M10A 2P3QA 3W2FA 1QCCA 3L0YA 1DBRA 1HEIA 5LKRA 4OJGA 4BQOA 4G24A 1AB5A 3CB2A 2NYHA 2IXBA 4IIJB 2NLOA 5LYJA 4LBIA 2UDPA 3IEXA 2WWWA 4YJ3F 4Q66C 5EKUA 3PPVA 1GKYA 5DBGA 4Q8EA 1VRVA 3QUBA 1YB2A 4AO7A 2JKZA 1F9AA 2FZCA 3R7SA 2JFBA 3TX8A 1E61A 4A8JC 1DBVO 3S1AA 2G2OA 4JLAA 3RAXA 1WEYA 4R1TA 4CKEB 1LH0A 1G0NA 3A3PA 2PS1A 2D59A 3NKFA 2QQ5A 3PLRA 3CLUC 3OQIB 1AH2A 4YB6A 5A0YB 1XK8A 1FTYA 4E2ZA 4EI8A 2JLSA 3IJEB 3VH1A 3C4QA 2QFJA 1YOVB 1I1NA 4BJHB 3BL8A 4X8OA 4DF3A 4HEJA 3NORA 1R9GA 2CZVC 3HVTB 3PRVA 4GRSA 1NYTA 4IVNA 3WJ2A 2X2PA 1T1IA 2RKOA 3ZU4A 4QAJA 2O8EA 4Z7QB 3A4YA 4RK5A 5DB4A 1B0VA 1KK0A 4Q9DA 2WUWE 2Q27A 4ANDA 3QIAA 2XSJB 5F8MA 3EHDA 2DHXA 4TM8A 3WC0A 4LS3A 5A1JA 1I30A 5I5EA 2J48A 3LNCA 3I6MA 4O3MA 2RH9B 4AZTA 3VA7A 4MA4A 1HYSA 5B3JA 2YXPX 5JS1A 1GU0A 1NNSA 2GCOB 4MCAA 3WDKA 1KRWA 5JE8A 2CQHA 1W5BA 3EYAA 5AKIA 3FSYA 3AWDA 3ZZTA 3VZPA 1QFYA 4LISA 1C0EA 3OF3A 2QO3A 2VKTA 3DLEB 3DEHA 2V4JA 4CMBA 1HLGA 4UQPA 4PZ9A 3ZXUB 3PD1A 1RC8A 2HWWA 3CNQP 3WK6A 3T9NA 1ZGGA 1EFAA 2KHZA 3H2JA 1GZHB 4YRJA 4C4AA 4E7PA 2GUGA 4TMFA 4R05A 2JZCA 2QUBA 4C3KA 3OZDA 3W5SA 3M2UB 5KJEA 1F4LA 2BRKA 2DNLA 1V3VA 2PEBA 2ZDPA 3LPDA 1J39A 2CJWB 3ASUA 3WP1B 1M6NA 4HFNA 2VTBA 3INTA 3VZBA 1YH3A 1UKEA 2A86A 1VQYA 3FRJA 3IXQA 1VLYA 4ED0A 3PEEA 2HQGA 3TLEA 3X2SA 3E03A 2RBKA 4YJKA 3MCTA 3MOSA 3NJ8A 4PC6A 3UGKA 2XQIA 4ZAYA 1SC3B 4NBKA 5IAEA 4QBFA 3L1IA 3VALA 5I51A 4YIHA 2HBYA 3EGCA 2HRBA 3UICA 1KRHA 1Z8NA 1RZVA 3QMMA 4F4CA 4MI9A 5D00A 1KD1T 1T2FA 5JXWA 2Y0CA 4XQ9A 1EVIA 1IVYA 4JH0A 1BROA 2BONA 2UUAB 2NUTA 4GVBB 2ZRCA 4LYYA 1C4OA 4IV5A 1ZMXA 3B7WA 2HYIB 2H1CA 4AS1A 1GLVA 2Y67A 1PYTA 4IOMA 3ZI7A 4DV5J 1MRNA 1NR5A 5CA1A 1PS8A 3GMTA 3EMDA 3E2IA 2X0FA 1XA3A 2C22A 1YB7A 1D3AA 4B6QA 1TMOA 3HSYA 5F98A 1DT5A 1DDOA 4DS5A 4NFHA 4BB0A 5EJMA 2CPEA 3VR3D 5DETA 3O73A 3DU5A 4QPDA 5JNWA 3ENNA 1VC0A 1NBMA 2VXCA 2JBAA 1WTAA 1F2HA 4HNVA 1SH7A 4MWZA 5J43A 3UG6A 1VBZA 4X64F 4NBVA 3R8YA 1OPZA 2HF9A 3KEFA 3OW2R 3K72B 2KT5A 4C3MA 1JR3D 1UWKA 4D5EA 3IDZA 3L3CA 2J6TA 1F6TA 2JHFA 2IGBA 3JZDA 4XIFA 3C7AA 2AC2A 4JOBA 3OZWA 2QN8A 3LQ1A 4OX9Y 5KG2A 4TYPA 5C51B 2ODEA 2V8GA 1RJFA 4A47A 1O96A 2AX0A 1NK8A 4TU9A 3INNA 1NH8A 1JG4A 3OQBA 2YVAA 2JJMA 1YS2X 4O4LF 3TDMA 4D8VA 1UMJA 2POCA 3SBEA 2Y1XA 2LQJA 1SCNE 3MQ4A 2ISQA 2YOHA 2P2GA 4FS2A 2BUBA 4M0PA 1VIOA 5A5FA 4CLPA 3TG2A 5FA8A 3KG0A 1Z34A 4U0JA 5BN3A 3KFVA 2PUHA 2WI8A 3EVMA 1ML4A 2HWYA 3PNIA 4KUGA 3VMMA 1WD5A 4AJEA 2Z0GA 4ERDA 2JA1A 5AW1A 4E1BA 5EMKA 4QQNA 4BN0A 2QXTA 1WMEA 6ABPA 3G4SS 2KVQE 2HHPA 1P1RA 1QG4A 2QTVA 2HO4A 3I37X 4BE4A 3KLEB 4WIAA 2OFWA 3K1AB 1WE2A 2AL7A 5GONB 1KMCA 2ZDQA 1V3ZA 1RPTA 1J5EB 4BBZA 5FULA 3TRKA 3EVGA 4Q02A 1Q83A 4DCMA 1Z29A 3K96A 1ZR2A 3JV7A 1G291 2HXSA 1K3UB 2JL9A 1X5OA 3T95A 4KO3S 4NA1A 3WZ2A 4AICA 3AXSA 2VDWA 1RT4B 4P0QB 1ONOA 2E5FA 1WHVA 4IFYB 2I5PO 2XYQA 3JR7A 2W6MA 1VJ5A 4D56A 1ZH0A 1RQGA 5GAHU 1XT6A 3V55A 2Z5GA 3SZOA 1GL3A 1JEQA 4MRRA 4PLCA 1IBKB 5KVCA 4ZVNA 1ZP6A 4BLPA 5L8VA 2F3SA 2V68A 5KNLA 3BD9A 4QYXA 1S57A 4QRHA 5AXKA 5FNVB 2J7UA 1EFVB 2P4EA 2C5LA 5D6GA 4F0HA 1E89A 2IU4A 3DSRA 1TL1A 5ETRA 4EGLA 4EJMA 4UM7A 2XKJE 4ZYLA 1GU1A 1VFPA 4ZRMA 2O1PA 2OEMA 2O2HA 4LQ3A 3VAAA 3RUBL 4M53A 3H8WA 3WLAA 3AY7A 3P2EA 1EXVA 4E7OA 2VK4A 1MP0A 4QGHA 3LDGA 3C1TA 4P2FA 3PX7A 4TSFD 2X77A 1GFWA 2XD9A 2DP4E 3RAGA 5A02A 3C15B 1OV6A 4U7UK 3K8ZA 3DVAB 3FUUA 2MLXA 1B1CA 5HATA 3AX6A 1UFLA 4URGA 4BCCA 1FU8A 5KFQA 4TLQA 4AF6A 2NWQA 2BW0A 3SIPA 3AD7C 1FDIA 1LWFA 3CZRA 3REFA 1QTNA 3RG2A 3BZWA 3U02A 3BO4A 2Q6CA 1PIWA 2QV7A 4H9GA 4Q1BA 3EMKA 3VAZA 1QHHB 1TZ2A 1UZLA 4IG3A 3R9IA 2A7XA 4DQDA 4UM8B 1NAHA 2LCWA 3P9IA 3HDQA 4LSNA 4IVQA 4U9RA 3I87A 2AEEA 3YASA 1USIA 2CVZA 5K3FB 1ZLXA 4U9HS 1LXCA 3C48A 4TL8A 4N3GA 1JDBC 1DUIA 2AZTA 1CUFA 3B9RA 3DR5A 1BDIA 1U1QA 3DH0A 3I2HA 4RQTA 1FNBA 3IAS6 2PKQO 3ZCPA 1ZWLA 2AEJA 2J32A 2D1SA 4DBZA 4M5KA 4YB5A 1YKSA 3OY7A 2D0PB 3DWFA 1JLLA 1HZZA 1CQIA 2M3DA 3EHEA 3TMYA 4Y2MA 3U3OA 1PSZA 1RPNA 5GAGU 2A9FA 1MD9A 4L3OA 3AIMA 4Y2GA 2X13A 3W6NA 1NU8A 1TA4A 2EKZA 4YWJA 3I96A 1FESA 1IPFA 4K8RB 5C5DA 2RCYA 4KXQA 2XZTB 1DDIA 3USZA 1AF4A 5REQA 2O5RA 4X3CA 4AROA 1ZH2A 1PNRA 2YIVX 2QLBB 1I3NA 4CO2A 4U7HA 2XWXA 4LC1A 3L0ZA 4DAOA 2VASA 1U1EA 1VIYA 3PXAA 1QE1A 4UM9D 4CMEC 4RDXA 4HVZA 2I6WA 3SLRA 3RC8A 2DHCA 3UYLA 4LREA 1YBTA 1GUFA 4LQLA 2EATA 4C21A 4B6JA 2YVQA 4ASUD 5EWFA 4Q44A 3FSEA 3C8DA 3L7KA 2H5IB 2IEYA 2GAJA 1RI4A 2WSMA 1F8GA 3BMCA 3CN7A 2IMWP 1DL5A 3TB6A 4MB2A 1LQUA 1XDBA 4LKRA 5HIMA 3GLIE 2A5DA 3G5AA 1RACA 1Y8RB 3DLGA 1Z16A 2AJTA 1ZA1B 4ZO9A 3L0BA 3OX3A 4LZLA 2X2FA 3UD4P 1QYXA 2XITA 1C3OB 2DIVA 2H2IA 2QKYA 2XYHA 4CTAA 2JATA 3VISA 1T2AA 1H9BA 3DCNA 3O7MA 3WISA 2J6CA 2PQ0A 1PSWA 2PZGA 3AM5A 5J5AA 3PEVA 4BJ6A 2BE9A 3G85A 4AJHA 2BQRA 4KMOA 4DCJB 1VOTA 1TLFA 1KYTA 4DEVA 2RIRA 3I39X 5CJPA 1GV1A 5CA0A 4XW2A 4EJSC 2HCBA 4KXVA 1UJMA 4OLBA 4JL8A 3VSEA 1I2BA 4CM9D 3HLTA 3FFAA 2V5UA 5LOVF 2DNKA 1ZGJA 2Z2YB 4C4WA 1OXBB 2LVWA 1QK3A 1CDEA 1SVNA 4BX8A 1CVRA 2CQ4A 1ZPDA 3MURP 4QYIA 4CJXA 4RCZA 4DLEA 1D1QA 4NFSA 4IY1A 3T4UA 1EHCA 4NE9C 2P11A 2I9SA 3I9OA 3GAFA 1XXHE 3Q8KA 4I4LA 4XUCA 3OTBA 2QUHA 3ZQUA 5DLGA 4DSEA 3UVEA 4OSOA 1J00A 1PZFA 1XERA 2RKIB 1UJNA 3M8QB 2QAGB 4OHZA 2Q1UA 2OLJA 1P6TA 3DMNA 4USVA 4LPKA 4FXDA 5A9TA 5LP6A 2FOXA 1IK6A 4G86A 2KXHA 4NYJQ 2BMAA 1FX2A 4ENTA 2ZRAA 5JNVA 5DM2A 1Z6YA 4K5RA 1JN0A 3WKBA 5H82A 4P3KA 1QRUA 4K6HA 3G0HA 5DU2A 2FVPA 2PEHA 4JYAF 4KR0B 1J5OB 1TK2A 6ADHA 2QA4S 1EUYA 3WGIA 2HNDA 4A8YA 1GNPA 4F5ZA 3K5NA 1AVTA 5JNSA 4IDAA 4JLWA 4LV5B 1UJ5A 1Z5UA 5HQ3B 5DE3A 1X60A 1IHYA 4HX2A 4BGIA 1G2PA 2FD2A 3HCFA 3BJEA 3N0XA 1Z0ZA 4EGAA 3KG4A 1OH6A 3DM2B 3IBCB 5J5VA 4NMXA 1CUVA 5FUMA 4G36A 1J22A 4RE5A 4Z51A 1EVKA 4CL0A 4AN4A 2ROGA 5F5NA 1FT8A 1O9BA 4QJ3A 1A8SA 4LCEA 3MZIA 4S2EA 3M8PA 3A70A 1CJUC 4LI0A 3STHA 4OL8A 2YBEA 1FFSB 2H1IA 4XOIA 4AD6A 3D0OA 2BGLA 1YNOA 4I2PA 2ZUAA 3AHPA 2FFHA 2BF4A 5BQ3A 3IV9A 3QF4B 2GZMA 1JHRA 3BKXA 3ONDA 4UFNA 3ZD8A 4UC0A 3AVQA 4OFXA 1WZNA 4D43A 4UHHA 5KVVA 1C0IA 2RDMA 5A9RA 3G9TA 3PI6A 3RVKA 2GN0A 1MPXA 4ZI2A 3BB1A 4BGEA 3VTFA 2W2OP 3FWZA 1B0AA 1FRQA 1KO1A 3US5A 3OT4A 5B3AA 2HNKA 4IYJA 3LQFA 4BO3A 2Z8XA 1D0SA 3IAM9 2XRFA 1OB5A 5BYKA 3M8ZA 4ZD6A 3AUYA 4X65F 4XX0B 3KYJB 5M04A 2IYQA 1KAEA 4WJZA 5FJ4A 4EQ6B 2AYEA 1JQJC 4L51A 2AV6A 2HLTA 5BRAA 1J6UA 1L7QA 1W5EA 4JYMA 1N8NA 5G40A 1KLMB 4B6GA 4MW6A 3ILVA 4IIJF 4OXKA 4GECA 5T4FA 1DG9A 5AP9A 3I42A 1UEKA 2Z43A 2IYYA 1XP8A 2DWUA 2EARA 2V1XA 3OU7A 4AZSA 4OJKA 2ASDA 4I1TA 2W8BB 1V95A 4HP8A 2ERXA 1EXMA 3SX2A 2ZI4A 1RPAA 4UU8A 2WWGA 3ZWKA 1D4AA 1HBUA 3HLYA 3P5SA 3MWEA 3GRRA 4BEVA 1N7HA 4QXPA 1I4OA 5IAOA 1WB4A 4UY8T 1FTNA 1DC3A 1G18A 4HAIA 2HRCA 1KI3A 3A1CA 3SSSA 3OFHA 5A8WB 2DNQA 3U16A 4DB4A 3K9HA 4NLPA 4FBTA 2Y77A 4X7RA 4JC4A 5DYYA 1C7QA 1PL0A 2WVHA 3HEBA 5FB3A 5KU7A 3IMCA 3MR2A 3O2QB 2JFUA 4H17A 4ALNA 3B8HA 1GPNA 2HFUA 4MROA 1ONNA 2D7DA 4KPGA 5KC9A 1GG2A 4DIUA 1HR0F 1VRTB 4HOYA 5B1DA 3ML1A 1LSOA 3A14A 3GT4A 3CJTA 5FO1A 5LA6A 3CC8A 4TMVA 3AERB 5I8ZA 1J9ZA 3EXAA 4YMIA 1LOUA 2RDDA 4OUDA 3GPCA 3O8OB 1XMSA 3CJSA 4DSFA 2PX6A 2OH2A 4ZU3A 3ULKA 1TF7A 1RT7A 1FI4A 4Y0NA 3SJAA 2XMZA 1UDRA 1JB1A 4DSZA 1S2OA 1UBCA 2VJMB 1VZ3A 3KYLA 5IAGA 1NW7A 4TXMA 1H9AA 4QUJA 4IIXA 4WCVA 3X43A 3Q83A 3ID6C 2IV3A 3DBOB 2Z57B 1CLFA 5J1NA 1NOKA 4F25A 4BP9A 4MWCA 1ECGA 1PEDA 3JAWB 2Z30B 1D1TA 2VDUE 4DIEA 2QRKA 4N3AA 1N75A 2BE7D 2GVZA 3B6ZA 4FWBA 4GOND 4R84A 2ZSEA 3GH1A 1F1JA 3F5MA 4LJMA 1Q1NA 5GZ6A 4HATA 5IFLA 4LV8B 4UW2A 2IBSA 2DWCA 4DA7A 2J7PA 1XVLA 3I0MA 4FZVA 4NULA 3ZNPA 1KDNA 2DXEA 3K9LA 2ZSDA 4AY3A 5KVQA 2V5VA 3IP0A 5KO2A 5JFOA 1YASA 4L78A 2IYUA 2CJYA 3KM0A 4C7XA 4R8UB 1PS0A 4MWEA 1KI4A 4RVHA 3ICLA 3EVNA 4PGAA 1SKQA 3O2IA 1WTFA 5FI0B 2NZ8A 1CU1A 4LYEA 4KW7A 4KUEA 1M1KT 2UZ0A 4D8WA 4XCXA 3SV4A 1ZZNA 3HSGA 3KYDA 1II0A 3V2IA 5GV8A 2VNAA 4N6NA 3PNVA 1KSPA 1FVHA 2L0XA 1O6BA 1IQTA 5DRTA 5SYMA 2GJIA 5JUMA 2WF9A 4RYLA 3QK7A 2CXXA 4ZRNA 5C5CA 4TUYF 3KOWA 2VPXB 5F8IA 1NMYA 3E22B 5EC8A 4L0QA 4FT4A 4RW9A 1I3OB 4ES6A 4HQRA 2J6IA 4ZQEA 1MU2B 5D5HA 2HA2A 5CLQA 2UUBJ 4HR2A 3FKSA 2IELA 2WJ4A 3PDUA 1P1CA 3V1TC 4WKBA 2Y0DA 3ROPA 4F8JA 2C3YA 2XMQA 4BQSA 2FN8A 1JFFA 5FIIA 2W01A 1PJLA 1FA9A 1OGIA 3CKKA 4GSYA 3RSSA 3BEDA 4TMXA 2PTHA 4MPTA 1S01A 3H7AA 4N41A 4B9SA 2AR0A 3LQVA 2QN6A 2QPTA 5AVYA 5ETPA 2OFOA 5DISB 1RI1A 3A4VA 4N3BA 1K5DA 1YCFA 4QT4A 1Z7BA 3U3JA 4V19X 4BU1A 5EYPB 4J6FA 3JXOA 1XXLA 2ZBDA 4H15A 1DE0A 4TTRA 1VQSA 1OA1A 1C9YA 1MB9A 3WXMA 2XS2A 1U28C 3GGOA 3GD7A 1KEEA 2EHDA 4A92A 2WIKA 2OZKA 3UJ8A 1PYOA 2Y1LA 2DHSA 1RWKB 3DOKA 3KK1A 4BQQA 4N5SA 4MKAA 3KAPA 2LPMA 2Q6OA 1S6QA 2YXBA 4FYWB 2Y1IA 5J2TA 1JS1X 3VH2A 4AWXA 3ECCA 2QJ3A 1UZUA 1RPZA 4ZV4A 4OLHA 2UXDJ 3LSTA 2PV7A 1QV6A 1E3WB 4EBCA 3NAIA 4ENQA 4JBNA 4DBVO 3ZW7A 4Q45A 4YI5A 3BGFA 2J3DA 3W9HA 2VQEB 2P4QA 3GMDA 4JOQA 2PMKA 3PVCA 3RVOA 4JYPA 3AI7A 4YCBA 2PH3A 5DTEA 1NQAO 2Z1NA 1DP4A 2QTFA 2HSDA 2X6QA 5A0TA 1NHVA 2CY0A 4R5PA 3OUYA 3TLCA 2JVJA 1SKUB 1NDUA 4FN5A 1NX9A 3WIOA 4UHBA 3CUSA 5B1SA 5AJXA 1NUEA 1YZQA 1I4LD 2Z4TA 4FFVA 4DANA 2NAPA 4KBYA 2PZEA 3R3VA 2HJGA 4MKXA 2DHRA 3TZKA 5GONF 4BNTA 2LD4A 2UZ4A 3CNLA 4CKYA 3KSDO 4POAA 1C1XA 1PKXA 1ZVMA 1XNJA 3DC7A 4OD0A 4MR9A 4GPIB 4L8FA 5BVHB 3E5MA 3IEKA 1Z62A 2C03A 2BT4A 5DN6D 3LT2A 2CSUA 2Z6UA 1VGRA 2P41A 3OLBA 1IOWA 5JC1A 3R7BA 1HWLA 1DIGA 4HB0A 3TVZA 2VCYA 3R0JA 1P9YA 1OO0B 2XKKA 3QKRB 1M1ZA 1NJWA 1GNRA 3TP2A 1AGRA 1WEXA 4MGYR 2RH5A 3T06B 5FNVF 1E9VA 5JFTA 3BRWD 1NUUA 3KUGA 4ZMBA 1X9SA 1S1MA 4B9VA 3HNRA 4C8MA 3U56A 1WTBA 2YKGA 3LFHA 3WL6A 4RMHA 2XC9A 2CDQA 1SVKA 2G25A 2HWUA 3ZZNA 5KNDH 3HN2A 4FOPA 3ZTOA 3CPSA 4LIPD 3QW2A 3GJ0A 2O0JA 1SEPA 4ER6A 4XDCA 3I5XA 2YKQA 3NETA 2XECA 5L39A 4BZWA 2DPGA 1ZESA 3QTBA 3OG9A 2HVHA 1N5IA 4A5OA 4LY3A 3ZGVA 2J5KA 5FD1A 4MVCA 4Q0MA 5K3OA 3D1HA 1FNSA 2ROPA 3MBKA 4BLOA 4PEVA 4PG7A 1RHJA 2V6BA 7ABPA 1G2OA 1EWKA 3BN7A 1K1EA 2P79A 5DIFA 3IDFA 2PLAA 2F59A 3QX7A 1GT8A 1E6CA 2XCTB 4K4TA 4F0JA 5IH7A 2CNKB 3MMBB 2GD0A 4TTPA 2ZYRA 1QM9A 3K1ZA 4PLWA 1YUBA 4P4TA 1HNXB 1KMHA 3KYBA 2Y9HA 2AZ3A 3WHLA 1GAQA 4KACA 3DOJA 2PJUA 4LDNA 2WCXA 1PWZA 3ANTA 5JISA 1ZVVA 3STWA 5GADU 4JUBA 2Q99A 4HDAA 3JYPA 1Z36A 5BN4A 3Q7SA 5EE5B 2DUNA 4D9MA 3N2ZB 1RQ7A 5B6JA 2Q3EA 1Z2NX 4IFEA 4YRPA 4XVRA 3DHYA 3GRKA 2PMBA 4GRDA 2ZE6A 2VSYA 1JDJA 1FNNA 3DZGA 3QVSA 3LUAA 2IC3B 3PQFA 1V8BA 5A4FS 3DKKA 3IQFA 3LKZA 4JU8A 1JZSA 5D78A 5FLXY 5KTSA 4KZKA 4X1IB 3OJOA 4EPTA 1FE4A 3PHJA 1J27A 2B92A 4MYSA 3V8VA 1T0HB 4NLXA 1E6EA 4FVMA 4QSMA 2PA3A 5FR1A 4GYKA 4Q9LA 4IHQA 2C54A 4D9IA 2TMDA 5AXNA 1T3HA 3EVFA 3DUWA 3V8QA 1VB3A 1FX0B 2IPLA 3LLSA 4B7AA 1P6QA 1PR9A 2F48A 2FH5B 1W88B 3T3GA 3EPKA 4BWFB 2XQVA 4GNKA 4CEJB 3X0DA 4YT4A 3UMYA 5A4MS 1K7SN 3QW4B 2OBFA 4NOMA 2CCKA 4ENRA 4ZYVA 2CZ4A 1T2DA 4D0RA 3C3JA 2LZ0A 3SE7A 1I1GA 3MGKA 2MR5A 1EHWA 5F4ZA 3ZWPA 5IJWA 1GYPA 3ET4A 4JQSA 4HWOA 1ZOPA 1CNEA 3AILA 1NVVR 1EE1A 4HL9A 3Q6MA 3W5ZA 2JH8A 2YQ4A 1QFSA 1TM1E 4XDGA 3KT6A 4WADA 5FEMA 1WCXA 2YNFA 1DURA 4EUHA 1MAAA 2E82A 3WRXA 4MA0A 1KAHA 3ROEA 4HZUA 1OUMA 2B36A 1S1WA 2DR5A 2R1TA 3JYOA 3PVZA 2IPNA 2W2LA 4B4WA 4QBIA 5AVKA 5AJVB 5AJ3F 2C2OA 2EBWA 1HDXA 4WE3A 3QHPA 3SYKA 4OTZA 2VHXA 1SQ0A 3LPEA 2R2TA 1PGQA 3VZCA 4TM7A 2EIHA 3B54A 1JMVA 5DBIA 2OHJA 3P3DA 3GEBA 3DE6X 3VR6A 3MM5B 2YWEA 4HTAA 5F52A 3RC1A 3HWSA 1EUDB 4R9VA 3QFRA 4H31A 3ZIUA 5HFAA 1GPYA 3ZJ5A 2XXAB 1AZSC 4JX9A 3QJ5A 4GO1A 3E8MA 4MIAA 3IOEA 1D9FA 4F2PA 3H1PA 1NXWA 5AXLA 3G8TA 3DW1X 3KAQA 1GZ3A 3ZJYA 4I6AA 1Q44A 4KJIA 2E5GA 3ZWOA 3QE9Y 1OZHA 3ZVNA 1IKXA 2N7YA 3NONA 1XX6A 1QUFA 3NBPA 3LM8A 3GD5A 4O4IB 4EHKA 3EGNA 3HVJA 3A11A 1SA0A 1Z6QA 4JI5J 3UPDA 4UJ5A 4YRKA 4DR4F 3PXDA 3UVJB 3WRYA 2VQFF 3DR3A 2PGIA 2QW8A 4OSPA 5EUBA 4YAUA 1X8JA 1WACA 4E5KA 4LOIA 2W9AA 2O5CA 1EWVA 3UQZA 1RTHA 2PWAA 2VTEA 1PJTA 4LK3A 1ISGA 1TA9A 2C1EB 2XMVA 2FHKA 5EN1A 1YR9A 2LDIA 1QX3A 5G02A 1H2UX 3HEMA 5IZCA 4YQYA 4HB4A 3PICA 4EFMA 2FGKA 2FZKB 1GRQA 5DGDA 2OZEA 5LPNA 3HP1A 4NNJA 1Y5IB 4RABA 4OOEA 3ZHTA 4QGFA 5DTRA 4IO0A 1N5OX 1F7UA 1XZPA 1RISA 3WI7A 3LPYA 4GUDA 4R25A 3HDTA 2BGMA 5KFAA 5F9MA 3PDWA 1OB2A 4H7KA 4MB0A 3IO1A 3FNIA 1Y1RA 2ST1A 1P5RA 3KHLA 4KQZA 1YBVA 2VDNB 2XM3A 3P32A 4CL8A 4ZK7M 2YWGA 3LVRE 1X7VA 4D4MA 1KL7A 4LY0A 4LRAA 2ZFHA 1E79A 1T34A 4B71A 3Q8WA 1NQUA 2Z2MA 4L8GA 1OSNA 1U63A 4L6AA 4DS4A 1NI3A 2NU8B 5HF5A 4CQNA 1CXZA 3ADDA 1RAEB 1W25A 1V9CA 4V0SA 3K0SA 2LMIA 2PZAA 5DHTA 3GIRA 2W58A 1EM8A 4DUYB 1ZCFA 3MJEA 1KHVA 1VE1A 3W60A 2HK2A 4U7GA 2EP8A 1BKDR 4MI1A 3FLBA 2XCRB 5FBWB 4DR3B 2PI4A 5SZJA 3BKWA 2B4YA 1FS5A 1NOIA 1QVGR 1I5OB 4AG5A 1ZS9A 2ZTMA 1NVGA 1Z75A 1UA0A 2VOPA 4MPRA 4KPFC 5KAKA 2IE0A 1C4AA 3P2YA 2MKHA 4CR7A 3V9AA 3OR1A 1M7HA 3R0QA 2X40A 4IEIA 4UU1A 3PR3A 5DNVA 2H8KA 2I7VA 2HSWA 5HBGA 2QP4A 3FWKA 1CJTB 1ESNA 2CB0A 1ZVJA 3WV4A 4HVLA 1S4MA 1NTRA 3UN1A 2PGOA 3DE0X 2V8DA 1JLGB 3WHPA 5IJXA 3B3AA 2EBFX 5BWOA 1Y9JA 1ID8A 5DHQA 1ZL0A 3IP1A 2BTQB 4ZO6A 5KYVA 1KR5A 5GAEI 3EXHB 4XKJA 2ODPA 3ZY3A 3EXG1 4OYBA 1CVLA 3RS7A 1W30A 4DV0J 1TD9A 5CPBA 3PD0A 2RAFA 3BTSA 3ZKWB 2R7KA 3KE9A 1KDYA 1L5WA 1Z5GA 5EWGA 3SFZA 4DR7F 2WV9A 1HWYA 1TL3A 1ZIYA 3V1LA 5EUMA 3OC0A 1ORHA 2COLA 3WJAA 1P1BA 3PO4A 5ULLA 3SX0A 5C7YA 4HL6A 2P5SA 1J9EA 4E5SA 1QH1B 4KG7A 3IELA 3EIWA 4AYXA 2GEJA 1LRKA 4QR0A 2PLWA 3SQOA 3NCHA 2Z3VA 3QX9A 4QJ5A 2CC2A 3H0KA 3RUCA 1PZGA 3H9UA 2NZ2A 1TK0A 2G76A 1FU4A 2UKDA 2OMEA 3SXUB 3RPEA 3HHLB 2E5LF 3M6WA 4XPIB 1JAIA 4U4AA 1YDMA 3HDYA 4MFBB 4L07A 2J76E 1NMEA 1ZWKA 5ALEA 5P21A 1HL7A 4CIVA 2B69A 1JBEA 1ZXBA 3D7MA 5KYKA 4PO3X 1OLXA 3LUCA 3BG5A 3U7JA 3OCUA 3OPNA 1AKRA 1AQ6A 4ZMMA 3WSVA 4B3SB 3BB4A 3BHMA 1P74A 4YAOA 4KJZA 1GEEA 2W93A 2M88A 4FC7A 3IR6B 1LGYA 1QAJA 4HT3B 5KYYB 1ZTWA 1RKXA 5LB4A 4GBJA 5TPZA 2JIPA 1GCGA 1WD7A 2QGZA 6Q21A 2EBUA 4TXLA 3S0JA 2FPSA 3DYAB 2O3RA 3Q12A 3ZU5A 3HPOA 2ZUSA 3GLKA 2Q7XA 5GMEA 4NV3A 3TIIA 2G1HA 2P2CA 3LTNC 1JQBA 3AEQA 3B6JA 1QE5A 3PL5A 2D62A 2B8JA 2X7IA 2ZH4A 1W8IA 1UANA 2ZBGA 2C4TA 4BRUA 2E1AA 3WAJA 2CLCX 2JI8A 2R8ZA 3LQKA 1WXIA 4KMRA 4COOA 4DV4B 1TQ2A 2CBZA 4K1XA 1FMTA 1K92A 2V9PA 1M9NA 4JSRA 5HFNA 4DYVA 2ZXUA 2Q62A 4MPPA 4LXTA 4RUBA 3DTTA 3A6LA 1WSWA 2UVVA 1M5TA 2AGOA 1FFWB 2J0EA 3GHYA 1NBAA 4UVEA 5FWNA 4QQKA 3NLCA 4D3GA 4BVKA 1Y89A 3ZXXA 2HU7A 1Y82A 1HDZA 4MRPA 1DTEA 4PYLA 3O3OB 2QSZA 2GASA 3F1LA 2G9NA 1FXLA 2BE2A 5C32A 4UEQA 5I8WA 1KY5A 1LVHA 1AKYA 1N3LA 1LX7A 1ZAXA 3ON5A 2VUIB 3KEGA 4H7IA 2ZCJA 5DNEA 4C6TA 1V1MB 2GPBA 4J0QA 4FGKA 1RQRA 1N34F 4OXIA 1YZGA 3QPUA 3RYHA 3Q8XB 3PC8C 1LBHA 1K6IA 2IYNA 3NUQA 4DUZB 2B3TB 4KSBA 1ZPWX 1X8KA 3NBXX 4C4YA 4LF6F 2AJLI 3KCNA 3WAKA 5J4KA 4HNRA 4BV8A 3W8GA 1LW2A 5L1IA 3W5AA 2VA3A 4PSDA 3VQTA 3S44A 2H31A 5HJEA 3QWBA 4LTMA 4C4SA 2BCGY 1FJGF 3O90A 4DCPB 3RVRA 2QZJA 3AEKA 2RAPA 4JROA 4FGLA 2ZBQA 2QD2A 1TUBB 5HRCA 4JI0B 3GUVA 1CG6A 2OM6A 4W5TA 1KOHA 2FC8A 1HYGA 3EBOA 1YIOA 3V2UA 1CYDA 1L7BA 3AR3A 1E6LA 4X62B 1QE0A 2EFYA 2LKCA 2VPPA 2ZGVA 1Q14A 4GZ5A 3LO8A 3PYMA 4ZZ2A 3CT4A 2UZ1B 4OYLA 3H04A 5C8YB 4X5OA 4JMLA 4V19J 5FTNA 4C3UA 2CZGA 1UMCB 2GPTA 3G2LA 5HVFA 4WCFB 3AVUA 1A04A 3UMRA 2CV0A 1GM5A 3MT0A 4D9NA 2JJ2A 5JMNA 1VCTA 1UPUA 4OK5A 1Z73A 4X9XA 2GX8A 4E2FA 3ZE7A 2OAUA 2VHQA 1U2SA 4FSXA 1RT3A 3L1HA 2OILA 2PSZA 1KFJB 5I7HA 5CD4A 1U0SY 1UVIA 1TZJA 5EWEA 3HP6A 2JI9A 4CKWB 3P9PA 1ZHHA 1M5UA 1RT1B 1GX5A 4ZDKA 1XJ5A 1UQTA 1SB9A 2CLEB 3K0CC 3RLFA 4Y2CA 1ULAA 1HLPA 4LI3X 3NI2A 1MT3A 2YS6A 4Q9JA 5BWCA 4CTKA 5CJJA 2Q6IA 4XM1A 3LMKA 5KG1A 4RHFA 3EGWB 8ABPA 1T2VA 5AR1A 1B3RA 4XAQA 1U5CA 4P52A 4WLVA 1PL7A 4DXLA 3NTOA 3ONNA 4PTYA 3HU3A 3E8OA 3MRSA 4X90A 1ADFA 4ID5B 3K53A 1CJKB 2QM7A 2YWDA 3TAUA 3KQOA 1UMDA 1H74A 4KUHA 2M9KA 1KHHA 4JC8A 3GSDA 4Q3DA 3UO0A 2OMKA 4K5SA 2Y0PA 4Q9HA 3QXJA 1FVXA 5EIWA 3RFUA 4HWTA 5KT6A 5HQMA 3K05A 3FYCA 4RBUA 5FTJA 2VJKA 1UIMA 4H08A 3IESA 5EWLA 5B2EA 2G70A 3H4BA 1A8IA 3KSBC 3IQGX 5JDCA 1EZZA 3L4BA 3HDGA 3EQ8A 5BWNA 2OORC 3NS7B 3ASYA 4EHIA 1AFIA 2XHEA 4INOA 1VJWA 3MJ4A 2Y4NA 2XTAA 4HQNA 1CY7A 2CXEA 1V8ZA 3SZ3A 4KXNA 1LWCB 1L6RA 5IDYA 3U3DA 4JUAA 3DYBA 4RV4A 4UUWA 1HTBA 2YNMC 4Q3NA 3JD1A 4P80A 1F2TB 5BW6B 4YRAA 4FONA 3U4GA 2DD8S 2O8DA 3GA5A 2B4UA 1ANKA 1H38A 2YWRA 2RHHA 1M34A 3ADOA 4YQWA 3WL4A 3ABRB 2OD2A 3NEAA 2O57A 2J9DA 2IQ5A 1N32J 1M2EA 3EDRB 5HAOA 3BWEA 4G0VA 2ZUBA 1PR4A 3QV1A 4UTXA 3WICA 2D74B 1J06A 2HM7A 1H3DA 3OKFA 2AYZA 2AFRA 3I6BA 2D00A 4AKTA 4KC0A 3TZHA 2ID7A 3K16A 5AE2A 1L5HB 1KP2A 2PMFA 5LMUB 5JHGB 3OEYA 4TQAA 1NONA 1FFEA 2L41A 4UTOA 2JCXA 1CC7A 3U9SA 3LDFA 3UC5A 3S2IA 5DT9A 2Q3CA 4ER7A 2A9RA 3C2QA 4X3PA 2KL8A 3PFHA 3H1GA 1P4HA 2NO5A 3RU0A 2AW5A 3RYFA 4K6CA 1X1CA 4JVOA 3T4EA 1PKUA 1IN4A 1X19A 1GPH1 5LLDA 4H2DA 4UZEA 2KFYA 1DKUA 3IM8A 3R1IA 5AIBA 2UYOA 4MW0A 2FEWB 2WWVD 4MQBA 4B2YA 1GAEO 4LUCA 3Q41A 4JLUA 3L2OB 5ELXA 3BGIA 1LDYA 4Q7AA 1ISIA 3G2KA 1JKMA 2FSVC 1E3MA 1WF1A 2VP4A 4WP9A 3NAZA 2JFOA 3RUFA 3H2VE 4GYJA 2QT9A 2JGLA 4RVUA 1ZK3A 4GL4A 1XKQA 4HRYA 4QQFA 4FBGA 3NHSA 1U8TA 1NZDA 2HRRA 3RU3A 2FFJA 3IHLA 3RYCB 3JASA 4LDZA 4MVJF 4QXQA 3KJHA 1BCRB 2CV1A 3KQPA 2HT6A 1O94A 1XAHA 1NJZA 3HC7A 1PR3A 2I8LA 3MD3A 1W2BR 5T7LA 4BP8A 4D3FA 4F96A 3G5LA 1YAJA 3OPVA 3E82A 3NGDA 2AG1A 5K3DA 3JARB 2XVMA 5JSUA 1L4FA 4TKVA 2XIQA 1PBUA 3NEYA 4XIUA 1DAHA 4UU0A 4AYWA 3A37A 3ORSA 2XLIA 1GQQA 2VUSA 1CJCA 3K9NA 2QX8A 4LJSA 2HEGA 2ESRA 4B7ZA 4AXIA 1LFAA 5K8UA 5AT1A 4PGHA 2Y1JA 1R4ZA 1VHFA 4BCBA 1VQKS 1WHSA 2WJZB 3S1SA 5A9SB 4B3MB 4HN4B 1KGDA 1QZ3A 3EWIA 1QO0D 4QG3A 2CVHA 2WZQA 3DHVA 1T10A 1XU9A 3BF4A 4WT7A 1JILA 1VTKA 2P1ZA 5LWHA 3VGJA 1MWYA 2EU8A 2RKBA 1ORDA 4DWIA 1YZHA 1C7IA 1UC4B 5CXQA 1QC5A 4HYYA 4EG0A 3VDQA 4PZEA 3WKEA 5GMDA 2VVTA 2FX3A 1E2PA 1Q86T 3SS9X 4M9UA 4OI4A 1BGWA 1SKYB 1DBDA 4QW8A 3RYLA 1XALA 1A7GE 3TSWA 4BDSA 3IT3A 5KFNA 1XYYA 1FDDA 1TZMA 3G7NA 3P5BP 2WLSA 4BV3A 3MLAA 1BA2A 4CG3A 2XQGA 3OMXA 1OS5A 1X1DA 3MTEA 4IRCA 1TKZB 2GRUA 3PYEA 2IBKA 3K5WA 3GK3A 5IXYA 4AJ1A 1BN7A 2HRYA 4NYPA 3IURA 4EJFA 1DARA 2JIQA 3MFIA 4QPCA 4R4JA 1EFUA 4K59A 3IAS1 1CW2B 4YC7A 1GAJA 2C7OA 1R4MB 3HE3A 5F35A 2ATCB 4PABA 4B7CA 3EZNA 5A4IS 4KYTA 3SQWA 2E9ZA 1E3TA 3GAAA 2QB5A 3ISTA 3O0DA 3OTOJ 4CW7A 3SXPA 4TQUS 1FXWA 2IXTA 2NTJA 3D8BA 3NDPA 1KJNA 3CZMA 1P5JA 1A5BB 2ZAIA 1PTJA 3E7FA 2KMLA 4EA6A 2PANA 1IMJA 5KFVA 5K03A 1ZN8A 1R0SA 4MP6A 2QN2A 4F4ZA 5KFUA 1TIKA 4M36A 2JEGA 1AXEA 4R3NA 5ETOA 3OU6A 1T15A 3HXPA 4AZWA 1QAQA 2WOMB 1Q53A 2PKQP 2E7WA 3RB8A 4DG8A 3AFOA 2TMKA 2J9XB 3VVLA 2DH5A 1NLKL 2JGMA 1D3WA 3O9MA 3M3DA 1OLSB 5AFSA 3AI3A 3SQNA 4ETIA 4WE1B 5CLGA 3THXA 1ODIA 4Z9XA 2BMVA 3CNBA 2Z56B 1JXLA 1MIOB 3HXLA 5D3MB 2AGPA 2GBFA 5DQHA 2XMCA 3WKDA 4DL3A 3D64A 3IOMA 1ZM4A 4B2LA 1VQ6S 1P2FA 3CF4A 1B6GA 4IIFA 2B5JB 2H1LA 4LECA 4E5UA 1T1EA 5A2QA 4OXQA 4YMVA 3K2IA 4PGMA 2B3DA 4UTVA 4JLOA 1F38A 2C28A 4P3YA 3KTOA 4EBBA 2XBPA 1YQGA 1H0HA 2XUHA 3GUHA 2FY8A 3ESYA 4L9WA 4MW5A 4I1VA 4EHAA 4RULA 1U4OA 1BDMA 3V1MA 1JK9B 3MXTA 1YQUA 1HL3A 5CFRA 1R6DA 3TUJC 4IQ8A 4AJKA 3L9WA 4ETMA 2AWNA 4XWAA 5IT9U 3E4CA 2IQIA 4MVJD 1VG8A 2RB5A 2O54A 1SJ3P 3PQ8A 1N54B 3PGJA 1VDHA 1XRLA 4ZVSB 1RWQA 4JP2A 1Y3KA 4RSGA 4K05A 2WSSD 1CZRA 1HDYA 1BJTA 1K0VA 4UW9A 4BFUA 3B3JA 3NBUA 1UBNA 2O0KA 4XH9B 1KQNA 2A3RA 2GVNA 3NTQA