3N0VA

Crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
280
structure length
280
Chain Sequence
DTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDRQSGRFFIRVEFRQPDDFDEAGFRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHCLNDLLYRQRIGQLGMDVVAVVSNHPDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQVIEETGAELVILARYMQVLSPELCRRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATAHYINNDLDEGPIIAQGVEVVDHSHYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a formyltetrahydrofolate deformylase (PP_0327) from PSEUDOMONAS PUTIDA KT2440 at 2.25 A resolution
rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
molecule keywords Formyltetrahydrofolate deformylase
total genus 76
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3n0vA01
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 3n0vA02
1XTZA 3DC2A 4YFYA 1ZLYA 3ENWA 4TTSA 4ZYVA 1UJ5A 2H9ZA 3U7JA 4X84A 5IT0A 3AB2B 1MENA 4TS4A 3K5PA 5IS2A 1MEJA 1CDDA 4DS3A 3KWMA 3OFEA 5FIIA 2DT9A 1RBQA 3DCJA 1GARA 3IXQA 3S1TA 3W7BA 3HHEA 4IQFA 3TUJC 1UJ4A 3TUIC 3TQRA 4ZYUA 2CFIA 1RC1A 1MEOA 4ZZ2A 2DTJA 1U8SA 3ENQA 5J63A 3NRBA 4YFVA 3P96A 2KO1A 4EW3A 2BLNA 2RQKA 5CJJA 1RBYA 1YGYA 3ENVA 1RC0A 2NYIA 3AV3A 3OFGA 2FGCA 5T41A 4QPDA 1O8BA 2F1FA 4ZZ0A 2QSWA 4ZYYA 5IT4A 2PA3A 3MTJA 4M8LA 1ZLXA 2MDAA 4IO1A 3N0VA 4ZYZA 2PC6A 1C2TA 4TT8A 3CEDA 3OFFA 1RBMA 3O1LA 3KCQA 2P9CA 5J9FA 1LK7A 2LVWA 2QMWA 3MAHA 2F8MA 4GO5X 2QMXA 3DDNA 4ZZ1A 3UW1A 2JOQA 1ZPVA 1LKZA 3OBIA 1LK5A 5JJBA 1CDEA 3DHXA 3R8XA 2GARA 1KS2A 3TUZC 4PWUA 4NMLA 2YWRA 4PZUA 1JKXA 3MWBA 3DHWC 3LUYA 4QPCA 1GRCA 4EW1A 4LUBA 2BW0A 4GO7X 1PSDA 4Q12A 2J0XA 2QRRA 2LQJA 4ZYTA 3OFHA 4GMKA 2I9SA 3TQQA 3P9XA 1M0SA 1ZGHA 1Y7PA 2P9GA 4NV1A 1YBAA 1C3EA 3L7OA 4EW2A 1NJSA 3GARA 4S1NA 1S3IA 1RWUA 2CDQA 1FMTA 4ZYXA 3IBWA 2J0WA 4ZZ3A 2FMTA 1UJ6A 2JHEA 3DA8A 3LOUA 1SC6A 2RE1A 1RBZA 3Q0IA 4ZYWA 3AUFA 2P9EA 2RQMA 4R8VA 3AB4B 2ZHOA 1YRWA 3AAWB
chains in the Genus database with same CATH superfamily
4UEWA 2PKCA 4WKOA 3KVVA 3BWBA 3QI7A 3PJFA 4DSUA 1E1QA 1VHWA 1NF9A 3VCDA 2IV2X 3I9V1 1N5YA 5FR2A 2J8AA 3C97A 1TL4A 2Y0CA 3BJMA 3IELA 4B85A 1KI1A 5G0UA 4IJKA 1ONOA 1MGOA 1LBTA 2FB9A 3ZUGA 3PQ6A 2XODA 1T8WA 2BBOA 4MUJA 1C0IA 4HZIA 2HB6A 2RHLA 3JD2A 3W5AA 5BNIA 5JY1A 4V1CB 4URZR 3C1AA 2YFHA 4CM9D 2IVYA 2CJXB 2P75A 3FKSA 1AUDA 1PDWA 3THVA 4D02A 3I2YX 3I73A 3RARA 1A88A 2H1RA 1G5PA 1Y11A 1G8JA 1VQ4S 3H83A 1H9CA 5ECYA 1RPTA 2E5WA 1OWPA 2UXDJ 3OFHA 3HYNA 3KBBA 4L50A 1WC3A 1TW3A 3MURP 4I4TB 2ZSJA 4EI8A 4EENA 3E5MA 1NKBA 4RBUA 5FA8A 1KLMA 1GPWB 1RKVA 5HJ5A 2QFJA 4AD8A 5FF9A 3QVMA 4MGZR 1PCXA 3AVYA 4MVJA 3MOJB 2EF0A 3V42A 4I9GA 5F5NA 2Y1KA 4Q82A 3NOQA 4Q15A 2JBAB 1Z0SA 4OYMA 4X1KB 4CCSA 3PU6A 4RY8A 2Q7XA 5HMZA 1JB9A 1NTRA 4CGYA 1CQXA 4HAZA 1U1LA 2Z2MA 1R16A 1H93A 4Y30A 3L1KA 4FCTA 2HHPA 2BF4A 4QGFA 1GQEA 2XM3A 2Y3IA 3BXPA 3ND8A 4WLOA 3PQ5A 1QS0B 1T2CA 3DV0B 4U5XA 1JR2A 4BP3A 4XB6B 2X3GA 4IWXA 5BY2A 1SJ1A 4X62J 1E9SA 5CVJA 1YRYE 4WK0B 4P1ZA 2ODNA 3RW6A 1MNQA 3OPYB 3QEKA 4IHAA 2DGDA 4R0NA 2HQGA 3SQGA 1QE3A 3CQ9A 3D64A 3NXSA 4X71A 4NCGB 1RQ2A 2QOEA 1Z25A 3P32A 2JJ8A 4EUHA 1SVOA 2UUBF 2NOAA 3WTBA 2NUTB 2HMTA 3WGNA 1MC8A 2BHTA 4EQ6A 1JNRB 1DDIA 3WLNA 4ZI5A 5AKIA 5BR1A 4RIEA 4EA6A 2O2EA 4F02A 4X4SA 3THYA 4AZ0B 5E3RA 3ELDA 4OV1A 1JXMA 1ZQ1A 2IXDA 5DHFA 2OEMA 5ITZB 4NBWA 3EGWA 3FW1A 5MN5A 4AKEA 1UPXA 3EC7A 2J9ZB 1BGXT 3C87A 5KVSA 1E7RA 5DK4A 3DVQX 4GOXA 4LHSA 2GNKA 2FJXA 3B60A 4V1CI 5KAKA 4ZEWA 5I3QA 4Y3UA 4RZRA 1NBMA 5JXWA 4XRGA 4KY3A 5BMVF 4HX2A 2HADA 2VPQA 3ZFVA 1XCBA 2XYPA 1R7IA 1UDWA 3AUUA 4FT2A 2GN1A 1O5JA 3D8RA 1QBGA 4K6KA 1X60A 4IEFB 2MZRA 2HSZA 1OAOC 2C94A 1V3UA 4WOPA 4L72B 5KNBH 4OHWA 2ZTVA 3DRPA 1IDOA 2F67A 4OX9Y 1YCHA 3BJEA 3T34A 1ZEJA 2ONCA 3JVVA 1XNQJ 3WRYA 3G2MA 2AJ4A 3MCAA 1RMYA 5BQ3A 3WMGA 1A2KC 1IXZA 2HG4A 2WVAA 1LY1A 4DQRA 2BFDA 2YHAA 3HULA 2ZUUA 5BR4A 4W9NC 1P4RA 2F4VF 2C2GA 4D9GA 1EYZA 2GBLC 1HT1E 3RK1A 3NGUA 1Z34A 5ESWA 4M8NE 3MM9A 3OLZA 3IUSA 5B53A 5BUCA 1OAOA 4YOEA 5CFOA 3AFHA 3IKJA 2JL9A 1EIWA 1VQLS 4JJ4A 1QU2A 3GYXB 1Y7IA 4YY3F 2EJCA 4D97A 4YQWA 5EE9A 1IKVA 4IVPA 2QLNA 5FBVB 4FSXA 2B34A 4R71A 3GCWA 4YP3A 4L5JA 4W9NA 3KFVA 1RT9A 1KEEB 4RJ2A 3CEHA 3TVDA 3O8WA 5H70A 4BB6A 4BCBA 3DOKB 5JDCC 3PYDA 4CCAA 2HLTA 4R9UC 4PS0A 4QUBA 2GM9A 1K4YA 4H17A 4EI2A 1E61A 4J0FA 1P18A 4Q4LA 4MKRA 1FU8A 4JXJA 2HZCA 3EYAA 3F0NA 4MHOA 3S2YA 4BVLA 3HMJG 3NUQA 4FHGA 1KC1A 3LX4A 5LYJB 7YASA 2VDNB 2BTEA 4X62F 1C8LA 2OK8A 3I09A 4GC5A 3AUFA 5CT8A 1AQJA 3KETA 4MKGA 3WQBA 2Y8WA 3TJ8A 2F1KA 1XZJA 3FLEA 3C5HA 4BX2A 5HIJA 4ZMMA 3DZBA 5JDCA 4QUJA 3VAMA 2H1YA 2IZ5A 2ZR8A 3D1OA 4KFBA 5G4KA 3WGYA 4C6HA 4ZCMA 3CO0S 2FTRA 4QR1A 5J2TB 5KOIA 5A1TA 2X0DA 2XG8A 2GCOB 2RRNA 3DQZA 5LYYA 2Y71A 1J5XA 2RHOA 3ERCA 3P20A 4ZJPA 1BQMA 5ED4A 3WLSA 2JOQA 2FOIA 2VQDA 4INAA 3PXAA 2VFRA 2QX4A 3EHEA 3FMIA 3F46A 4J6EA 3DWFA 2NSYA 1BKSB 4R2HA 4QG3A 5C18A 3UKDA 5LA6A 1MU2A 3Q86A 4PPZA 3V8NA 4LTNA 1TVKA 1ZJWA 3MWFA 5CLHA 2DUJA 4DPTA 1OSDA 2LU2A 3M6UA 3TLEA 3C14A 2Q4EA 4S35A 2LU1A 1XMBA 5JD5A 3KSAC 4Z51A 3P8ZA 3D1JA 3CCFA 2C7GA 4KE6A 2OFOA 4POAA 2ATVA 2XUZA 3LLCA 2FJEB 2OXCA 3LNCA 3S1TA 1LQ2A 3NC0C 1M5UA 2E7VA 4B9SA 1C14A 4KUGA 3JQBC 1JSXA 1W88B 1C3LA 1XD9A 2XCPA 3ZO7A 4C08A 2OXFA 1IKWA 1B64A 2B4VA 3DM2B 1OI7A 1UMDA 2XCSB 1VBXA 3MOGA 4L3VA 4EMTA 1C8KA 5T5QA 3A9WA 2ECQA 2K3KA 1ADGA 5CUQA 2ZCVA 1UOPA 2IXAA 5E0KB 2OLKA 1H2FA 2IEBA 1TVRA 4H6PA 4L9SA 2BUBA 2QR3A 4EQZA 2HRBA 1IVSA 3HCBA 2W25A 4C8MA 3I0RA 2CLSA 2WTBA 3KJFB 4FNHA 1C2PA 3PFNA 2AI3A 1ZYQA 3R76A 1SPBP 3QBCA 5K0ZA 4IXTA 1Y9EA 5L9AA 2O0JA 1F2UB 1HWLA 2XS7A 2XUKA 1IYZA 5JYDA 4NPOA 1XYGA 2FUG9 2ZUTA 5B3KA 3W7VA 1R6XA 2Z09A 4AXIA 4E08A 4WP3A 1OB2A 1TT5A 3ETLA 3MWKA 1RTDB 1FQKA 3TZKA 3ENAA 2DHGA 3DXBA 4C11A 5JRJA 4I55A 4NCAA 5BSGA 4EY3A 2DPHA 3AJAA 2ZBEA 4P7TA 3E61A 4EDFA 1XWIA 4OG2A 3AHHA 2R8ZA 5DNVA 4LF1A 5DWVA 3F6PA 3L8FA 1GCUA 2ZEJA 2OCGA 2O3RA 4RUKA 2VBFA 3E01B 1QUPA 5D87A 4DR3B 2XGJA 4C0OC 1J8FA 4NABA 4RPLA 2K06A 3PRYA 2QRQA 4Z1MD 4YR9A 3HKEB 5GIPE 1U6KA 1LVHA 4URVR 5JC1A 3GXBA 2IUUA 3UE2A 3DKRA 1QO0A 4LK2A 1WTAA 2RB5A 1NKEA 4AJ2A 4P82A 5EIXA 1H2UX 4HGOA 1XNRB 2EHJA 5DYNA 5JSZA 2B6HA 3E8MA 4NBRA 1ZBTA 4IIFA 4EEYA 1ZC3A 3WX4A 1MGPA 4DSKA 3BMCB 4J7UA 3L77A 1A4RA 5A6PA 5C4GB 2QA4G 3S1AB 2FPGA 1N4AA 1DRZA 3Q0TA 3FZEA 4DM4A 3OQOA 5GV7A 4OJNA 2DH8A 4L22A 2BEFA 2Y6UA 4G0QA 3R4VA 4P3NA 4DCMA 4DR2J 3RRMA 5KO2A 1JKJA 4N49A 3M6XA 3AT1A 4D99A 3DAYA 1M8JA 1Y3HA 3DFUA 2W2OP 5CNMA 5DCUA 1NLZA 3KQOA 4M38A 5MLCV 2Q5CA 2WSYB 1VQ6S 1P7ZA 2HA3A 4HLQB 1JAXA 1EQMA 1T3OA 1ZIPA 1L4KA 3MAHA 1CEYA 1FUIA 3PPVA 5I3CA 4F04B 3KG2A 4PZZA 5KFBA 2ZVJA 2P65A 3B1ZA 3BJYA 4QZVB 1XGKA 1RT5B 4CHTA 2GKOA 1UEJA 2NSJA 3DRRB 1GXTA 4DREA 1C50A 1FZTA 3IAXA 4LF4B 4IV5A 3G8CA 3O3OB 4U7JA 2JDID 3GFQA 4F4CA 1ZWKA 3C16B 2KMLA 1HZJA 3ZI7A 2P2NA 3OCXA 4MKBA 3CRW1 4IG0B 3DMYA 3BWVA 4PPFA 1WC1A 1CU1A 1JP7A 2QTWB 4HD8A 5FQOA 2CLFB 5KVCA 4J9KA 3Q2TC 5EJEA 3EXG2 2NLOA 1APSA 3NWOA 1NJ6A 3A1UA 5I7RA 3Q12A 3U4MA 3AP3A 5A7HA 1EWKA 5HQ3B 4HDQB 3IRUA 2WT9A 5HROB 3UY4A 4C5CA 1CUWA 4CQMA 4LXIA 1I7PA 4HZGA 5FO1A 3QMPA 1M3SA 2I62A 4G5RA 3K35A 6AT1B 2RGDA 2F3PA 3N5BA 5ANRB 4G1IA 4MJ3A 5IQ6A 2EU8A 2GJ2A 4C6AA 5JECA 4BWFB 1WCIA 3VPHA 3EDQB 1RE0A 3E7FA 1JLSA 1G8AA 4RBNA 1UXHA 1DRVA 4EA7A 1H38A 5F77A 7GPBA 4AZWA 4OU5A 1GPYA 4D9CA 5JDIC 3F6CA 5HDBB 1P73A 4AY6A 1FQOA 3MD0A 3QE4A 3URKA 3UOGA 4LNUB 2A0FB 4U2CA 4HVLA 5EX0A 4UW2A 1T3ZA 4H4KA 4AVYA 2NAFA 2BR3A 4HS4A 5AVRA 2HHUA 5GAEI 2HJHA 1JI0A 4R1QA 5IJXA 1RAAB 3BTVA 3C6TA 2CDCA 1LFAA 2HNBA 3IBSA 2FJDB 3MZ0A 1WCYA 4KX3A 3L7YA 3CPEA 1QU3A 3KJHA 3HMKA 2QL5A 2ORIA 3PZBA 5K7SA 4FYPA 1U3VA 3PGVA 3C6KA 1MQAA 5H9WA 1HARA 4M1MA 4HSGA 3RANA 2Q4BA 3O74A 2K7JA 1EFCA 2RGRA 4U8GA 5KU1A 3TQRA 1NYLA 3N2ZB 2O06A 3Q7EA 2PMWA 1GFWA 2XMWA 3GG0A 3WNQA 2AJ1A 4NYIQ 1AXRA 5IM5A 4X4OA 3C15B 4HLNA 1CHDA 1E9EA 4O3RA 1EK0A 4I2PB 4OQ4A 3B6IA 4NYMR 2BACA 2MTLA 3C45A 5ALMA 2E7XA 3EA5A 3W5HA 1SCKA 2KFZA 1K75A 1CF2O 1PO6A 3TVTA 2EFDB 3QWFA 2I76A 2CE2X 3KDOA 5AJ3F 4FB4A 1DAEA 2JFVA 2XZTA 4ILRA 1TQ6A 4GIBA 4PLCA 1QANA 2PEHA 3V7UA 1REQB 4PLZA 3W4KA 4DCJA 1YL6A 3T7AA 5D00A 2GUGA 3QWUA 4HADA 2YNHB 3BKFA 3PS9A 3VRHA 3KP1A 1YQEA 2VTDA 2XD4A 3WSTA 2HA4A 3S0JA 2DQYA 2QP4A 5E1DA 2QD4A 1JKHB 4D3ZA 2O8FB 3G1UA 3HCFA 5TMDA 5K99A 1GDHA 1M2OA 3GL9A 2DWOA 3GLIA 2TMDA 3VAYA 3AFIA 2ZWMA 4O23A 2XT0A 4YP6A 4QIWD 2A57A 3EDCA 4O1IA 3KK3A 2YYZA 3IDQA 1ZJ6A 1OX4B 3EMBA 3KKKA 4KGXA 1DPFA 3QNWA 3OESA 4FOPA 1ZMBA 2F3SA 5JS1A 5FQNA 1C2TA 3IQFA 3JSMB 1IBLB 1MDFA 1IJBA 1RB0A 2P2YA 3PICA 3ZJVA 4I1UA 4F4JA 4FFSA 3H40A 4M7OA 2ZB3A 3OTOJ 3L7BA 5KOJA 1RXSA 4KZKA 4DILA 3G2HA 4HUQB 1JX4A 4KE9A 4P7VA 1PYTA 1I5EA 1TVMA 5IAAA 1KY5A 4EG1A 2ZPUA 3H5AA 5U1PA 2QTZA 2CYYA 4RDHA 1E1CA 1B6TA 5D3MA 2ACMA 2YWFA 1RHRA 3FGVA 2EFCB 3LAWA 5SZKB 4EWLA 2DCLA 4JJ8A 4R2LA 2W93A 5CVCA 3C15A 2AN1A 3JSYA 2R7WA 4Y2GA 1OBVA 1XNRJ 1FVXA 2SHKA 3MGBA 1GYQA 4AQ7A 4QBFA 5FPSA 3MUNA 1O0PA 3FBTA 1JLGA 3L7DA 1DIHA 1VQ5S 3Q8WA 3UN1A 4QOFA 1P0MA 1CJKC 1HNWJ 2IUEA 3RIEA 1UVKA 3STTA 3DLLQ 4C98A 2IOFK 4EG0A 1U6BA 2RC6A 1XZHA 3S1SA 2HBRB 1BX0A 2XGPA 3C6TB 4KQ2A 2IMOA 1QAQA 1R4NB 5LT5A 5GAJA 3LAMA 1SG0A 4ZOAA 2A0WA 2CUTA 4C5BA 3A6PC 1HQKA 4DIKA 2OYRA 3A2MA 3K70C 1KZ4A 3PSAA 4JI2B 3BFPA 4QXPA 1D9DA 3C24A 8AT1B 4JLJA 5F7OA 5H59A 2PL3A 1C0KA 3FNEA 1CVJA 1Q7RA 4K9QA 4DUYB 1YS6A 4A73A 1BFKA 1VL2A 5GADl 1IBKB 4OHBA 2WHYA 2Q27A 3AX6A 4BZZA 4TYBA 1Z4OA 4ODIA 2O5RA 3KHGA 2X42A 4HLCA 2CZ9A 4TKVA 3A3PB 2DFVA 2ZJ4A 3UJPA 4GX0A 3TEFA 4Q4JB 4E1AA 4I50A 2GCFA 2AA3A 5IHXA 2VPWA 1C4KA 4QGSA 5I3UB 5JNUA 3AY0A 4DLPA 3TA1A 1SPBS 1YD7A 4LHYA 4M0LA 5DIZA 3PQ7A 2GVDB 2VC1A 2NX2A 2PSSA 3GROA 5K14B 4TXLA 3DKKA 1ZW1A 4J0HA 1GUYA 4GPAA 1N8SA 4DW8A 1KDYA 3PNBA 5BQXA 2DFPA 1IEXA 3C16A 1OI3A 3WKAA 4OI4A 3LI2A 4YJKA 4MUFA 5C5DA 4RK4A 2IHZA 4GBGA 3LGAA 1ISJA 2FDNA 4QBHA 3AR7A 1A97A 1A7KA 1OGIA 4BMNA 4RTOA 3M6LA 1U0HA 1VM6A 1PBNA 4KYIB 1XIQA 1A1SA 2IHVA 3GPCA 5BSHA 1A7AA 4AP9A 4KPFC 4CTAA 3SLKA 1SK8A 1OWNA 4E11A 3CJQA 1V95A 4YT8A 1G1MA 3K7EA 4E5NA 3PGKA 1Q0ZA 4ETXA 2B8PA 3WJ2A 3WK4A 2J41A 2HZBA 3O0DA 5CBKA 4YUYA 2R8RA 2AIRA 5IN4A 1DQRA 5KWEA 3IDAA 1VSBA 1NVFA 2P7IA 5ADUS 2HSGA 3O73A 4HQFA 1LTKA 3QJ5A 4MRPA 1XL0A 1QUFA 4E51A 2WOMA 3D3KA 3GLVA 3OD1A 1FPQA 2BONA 4WLVA 1QFZA 2IZ1A 3O4VA 2J9FA 1OA1A 2PQMA 2R84A 3KHTA 2PT6A 3LPDA 4XGRA 2WJ6A 4XGQA 4EKDA 7MHTA 2YPYA 3AEZA 3WRYC 2R65A 2BMDA 1RLDA 3HXMA 4PG7A 3X1XA 1GQRA 2ZRFA 1TZ2A 4E70A 1GFWB 2CJQA 2K87A 1MAVA 2RJ3A 2OAUA 5D4PA 4A36A 2QRJA 1QXSA 1M0WA 4HWSA 3MUFA 2HHTA 4U7WA 3I32A 4HMQA 2YINC 2QS9A 4QGBA 4XR9A 1QH9A 4JVSB 3WMXA 1FTNA 3FLBA 2XCIA 1S1UA 3POTB 2CV1A 1HKUA 5LXYA 2O6LA 3SFZA 2A5LA 4F60A 3G1WA 3KD3A 3ZKAA 3HB9A 1Z45A 3BUSA 1D9AA 2ZUDA 4JI5B 2NGRA 3NUZA 1M2VB 3PNYA 2QN3A 5DEIA 3CVUA 3I05A 3KMSA 1MAUA 4IWYA 1RT7A 3T7TA 1EP3B 3MJFA 1IHYA 3T7JA 1WW2A 3I04M 1J2EA 3O31A 4HWTA 4ND7A 5KAPA 1FQJA 2OELA 5BT8A 4J43A 4JJZA 4HLBA 3M70A 3DU5A 5JNRA 2XLKA 3ZLJA 1GPAA 1RTJB 3UYKA 4LXTA 5HEKA 5BUQA 4KAIA 1Y7TA 2PUVA 3SN6A 4IF6A 3SZLA 5K20B 1EWVA 4PKDB 1KXZA 4JUAA 2Q62A 4BNFA 4MYSA 6AT1A 1TK8A 4AY2A 5KFGA 4KUEA 3OTOB 3P2EA 2FHPA 3HM2A 4R1TA 5AOBA 1NJYA 1WL8A 3TE6A 2JVKA 1UP1A 1G20B 1KDTA 2A9JA 2I6TA 2W9CB 1XP5A 3GAMA 5GMEA 5G1NA 3RTDA 3U3OA 5TE9A 3AR6A 3UA4A 4HP8A 3A8KA 4P6VF 1WORA 4MEBA 4OBEA 2ZH4A 4QOTA 4Z1OA 3PJGA 1GX6A 6FDRA 4MKZA 2B0JA 1BMQA 5AXAA 2YKGA 3DR3A 4BTVA 2REOA 2IYSA 1VKOA 4N65A 1BXNA 1OX5A 1ULSA 2BJWA 4IJMA 3ZBQA 3H5TA 1GAWA 1JDBB 4B4VA 2VJBA 1VRTB 1KE1A 1TVKB 3ZC4A 3IODA 3QVUA 3F49S 4O4HA 2W6IA 4UXJA 4YT5A 3HGTA 1FJEB 2HFSA 3DZIA 2F8EX 1DAIA 5HIKA 5ARBA 2XS5A 2B8JA 4BN4A 3ECCA 4FBTA 2HUPA 1K1QA 3NGTA 5BN5B 1EUCA 1Y4ZB 4AJLA 5L7TA 3RNLA 1EFAA 4MK9A 2ZKTA 4ECVA 4E2ZA 3P4XA 4UY8T 2JIZD 4CEHB 2UUTA 1GSIA 5EZ6B 3DP7A 4MULA 1M2JA 4FMCB 4UHKA 3DQPA 5EDWA 2AJFE 3DCJA 1HWKA 3K9HA 3K0AB 2GAIA 4KMOA 5ALNA 4C3ZA 3HHLA 3MUOA 3BGFA 1L4HA 3QU7A 3W05A 2W2MP 2Z4TA 2ZKUA 2PBZA 4TRRA 3CINA 3KOAA 2X9VA 1K4KA 3IBFB 4JQSA 4UF4A 2P1RA 1T6ZA 3CCLS 1M1UA 3ODPA 2ZUSA 2RB7A 4LGCA 4KRFA 3ND7A 1EUDB 3NGKA 1KXJA 2CVFA 3HO6A 4FFMA 2Q5JA 3DOLA 3E1GA 3POTA 4KHMA 1KHWA 3E01A 1JJFA 2C54A 4NIMA 3FFWA 2HBZA 3H6KA 1GTSA 1O0BA 1NLKL 3C43A 4FE4A 1EGQA 4PPGA 1NCLA 4HH0A 3RS3A 3U39A 4REQB 2RS2A 3QVTA 2C04A 3CEPB 2VYQA 3CGIA 3D6FA 1SOWA 5DISB 3UD3P 5KFOA 4QEDA 1I36A 5HVFA 1TYEB 3CG4A 2O57A 1HWJA 4OF4A 4Y2SA 5T7BA 5ALOA 3ED5A 1CJTC 2X0EA 5I7OA 2AB0A 1U6ZA 1MEJA 2X5XA 5F5XA 5D84A 2X1MA 1SA0B 3FWKA 3UGQA 3R27A 3VSDA 3SVTA 7MDHA 5DM70 2I8LA 3FBBA 3CRNA 4UTVA 3HRKA 2VYND 3BBLA 4WD3A 4ZAGA 2F3RA 4QU7A 1J27A 4FUTA 3LL4A 1KQOA 1S0MA 2GK3A 3PFCA 2QRVA 5FTNA 4GWLA 2IZ6A 4B7ZA 4CXMA 4UJ3A 4EO7A 1SHLA 5EHHA 4PCUA 3D8NA 4YAWA 1B0PA 1A7UA 4OI3A 5IF3A 2HVDA 3GQBB 1G2PA 4FFDA 5A8RA 1TU0A 10MHA 3SJBA 5F5LA 1P4SA 1TNDA 1YA6A 3BCRA 4H7PA 3H84A 1N6QB 1L9KA 5AESA 3K1JA 3RRXA 1N33F 3RU2A 2B92A 1F0YA 1DKOA 4JCOA 4K2JA 1KP6A 3P9ZA 1S10A 5BW4A 1Y9DA 3HDJA 3DM2A 4RCVA 3MCZA 5GZ6A 3PIDA 1UWBB 4X90A 1S3SA 3ZVLA 4J9SA 1J20A 4U9IS 4DV4B 3BM7A 1FNXH 1F60B 3G87A 4R98A 3QRQA 3LHDA 3EHDA 5J4YA 4OQJA 1WUJS 2WT8A 1O95D 2QTRA 3N3BC 5JVDF 2B9YA 5FULA 2QZ4A 3NTXA 3HJHA 1L5YA 1P2TA 5F51A 2EEPA 4BKRA 4I9UA 2I22A 1NW9B 2PN1A 3HUEA 2VDQB 3EWAA 2HA0A 1Q2UA 1H5UA 3LY8A 1E1KA 1B0TA 2EZ9A 4UZFA 1SXHA 1PJLA 3AJ9A 4V2IA 5IXYA 3CSSA 1KAMA 4F4HA 2D5CA 1N77A 1HT3A 4ES1A 5DTQA 2CXPA 2AN9A 4CRJA 4RTJA 2UYOA 2ORED 2YV2A 1H6CA 5AO9A 3ORQA 5BW6B 2YQ3A 3ZTQA 3Q8YA 3FYUA 1XEFA 2J9RA 4NHOA 1PJCA 3V8MA 3OPVA 1JGTA 4IIYA 2HNKA 3DVAB 5JFTA 4GI5A 2WINI 4RW6A 2GM4A 3UI3A 3GBPA 1KFEB 5LP1A 3ROQA 1J1IA 2VA8A 3KXLA 4KXNA 1RT4A 2PZEA 3DOOA 3PHJA 4XQ0A 1U2FA 5LXTB 3CR3C 4ZU6X 2H4XA 1FNCA 3W04A 3QLEA 4Z4HA 3K9NA 4KQJA 3ZCTA 2HPZA 4NYIR 4GMDA 3ZE1B 4B4OA 2W2XA 2VPPA 2W9XA 4OP2A 5MGBA 3GIIA 3JQDA 2UUOA 4UDNA 4QQKA 3UUGA 3JZAA 1JJIA 1MC1A 2FWRA 5CPFA 3IHTA 4G5FA 2VF7A 1UVJA 1VQSA 4QRHA 4LJYA 4YRTA 1W5FA 4Y2JA 2QJWA 5IJZA 3S81A 4F71A 1TK3A 2Y0SD 4ERNA 4OM7A 3BD8A 1SOVA 3R6TA 4IIHA 1N2SA 1RM0A 5H5JA 2P3OA 3NHLA 4DNXA 3VZDA 1V9LA 4MWDA 1GV0A 3WX0A 1RM5A 1MXFA 1K8RA 5CVUA 1Q1EA 4I5DA 5AVZA 1FDIA 2A6OA 2EZ8A 1N3LA 5FBWB 4KRWA 4FBLA 2KYRA 4C0WA 2IBSA 3W8NA 5A0VA 1C9NA 1IJKA 1EA7A 2HRZA 2I8CA 4KLCA 3SYRA 1VGYA 5GV8A 5FBHA 3KK2A 4FF1A 2VBGA 4DLZA 3OIDA 2JVRA 4JN6B 3HCNA 4Q9NA 1Q44A 4JI4J 3PNPA 4U2BA 4URYR 2JEOA 5K3DA 2P90A 4Y6SA 4KGXB 4ZPDA 1KYZA 2XA9A 4B45A 4DM3A 4C05A 4IDKB 3H18A 3W9SA 3LPAA 4A4DA 4I9HA 1Q3TA 1HI8A 1X94A 3U4DA 3TQQA 5JVHQ 1K7FB 2UVDA 2FPKA 4RJVA 1JR6A 5JJCA 1WEZA 2II6A 2O2ZA 1TL3A 3E3LA 3H9CA 3AV0B 1ATZA 3JSRA 1DQYA 1Z0KA 4NOHA 3NEYA 2A5FA 4JB2A 1VI2A 2EVZA 3FVRA 4TN5A 3O8RA 2RHSB 4JJ6A 3CTRA 4XSHA 4X84A 3RS7A 1CY4A 2H5JB 1FYFA 1UC4B 5GQSA 3B5EA 5CNJA 1T10A 4RU1A 3GJTA 2QU7A 2QDXA 4QUEA 4K0KJ 2JFUA 4FJ1A 5K8PA 5M3BA 4MROA 3ROTA 4C2BA 2WHXA 3WQHA 4AICA 4E3ZA 3PX7A 1I2DA 5I3ZA 4X65F 2SCUA 4OK5A 3OQ2A 4NEQA 4DF3A 3N2NA 1KJWA 1UKVY 1PJ4A 4DUYJ 1TMYA 3E9EA 3WLJA 4CG3A 2PXAA 5DN6D 3M8QB 1UPUA 2IV7A 3DLHA 3MWJA 4J9RA 3NPMA 1LFDB 1Z2EA 1WJGA 3GT7A 4Q4CA 3LS2A 4CR6A 2UXDF 3AH6A 1PG5B 821PA 3D3NA 2JGDA 5A3RA 2XAAA 1J2TA 2PYIA 2ODEA 2ZQYA 1Y7PA 1QS0A 2LV8A 4NV1A 3SQDA 2ZH8A 5K0EA 1NP6A 3MM8A 3H2ZA 4KEAA 4B43A 2O6HA 1L8AA 4ZYWA 2PL5A 2WF8A 1R5BA 2C92A 1LW2A 2WIDA 1OX4A 2DT9A 2GZRA 2OPSA 3LQVA 4M7WA 1PV1A 4ZVPB 3NRJA 4NMWA 5FPHA 4B48A 3LDFA 4V19J 3L7KA 4LIWA 3VU9A 1NSKL 2F7VA 2IYYA 2XY4A 4JVNA 1RYZA 5IC6A 1UBSB 1BJKA 3GWZA 2J7UA 1EVKA 2ZU6A 2G1JA 4RW7B 1RWBA 1ZK2A 1CTQA 1FJCA 3BQ1A 1IG3A 3SOZA 2IEZA 3KQTA 4DR7B 4NASA 2BMAA 4RVNA 1GRVA 5JD4A 1MVLA 3IEPA 2YKQA 2N1MA 2X1BA 3P1JA 1JEDA 2OV2A 3K9QO 1F3FA 1BE4A 1NLYA 1J2JA 2V6AA 2M52A 5B58C 3QU5A 3SKXA 1EXWA 3FCSB 2QMUB 1EBUA 3A1NA 3GFBA 4S0MA 3NYWA 2UXCJ 4TYMA 2CNWD 4DUTA 3UXMA 3OF2A 5DH9A 5H3CA 4EPXA 2W6JD 4L9WA 4C04A 4JJGA 3CVVA 4QWAA 3OKFA 3FCCA 4JOQA 4OJHA 2N0SA 2Y1XA 2DJ5A 4H6WA 2KU7A 1CQJA 2A4KA 3E9ZA 1VMAA 4FR0A 4M8SA 4FBMA 5A6SB 4OD0A 3PVCA 2VFSA 3A26A 3B3GA 1DKPA 1U7LA 2IYXA 1JKJB 1JFTA 3TEMA 5MGNA 1P5HA 3DE7X 1R10A 2XY5A 1C7EA 2Q4OA 3R3JA 4JI7J 1YBFA 3NEKA 1OJ4A 1W6UA 4F56A 3OC6A 3PEYA 1SQ5A 2DJWA 4OP1A 2PMHA 4X44A 3NX4A 1XE3A 2B82A 1SH7A 1WX1A 4JASB 4PRZA 1C4XA 1JA1A 1JDSA 2I71A 3L3BA 2R7QA 3ZTWA 3DDUA 1JG3A 2LXFA 3THPA 3B8HA 4MRVA 5ECWA 2AEEA 1U63A 1TMMA 2MINA 2ZTUA 2WSSA 3PR4A 4DDMA 3W3AH 3EWSA 3RQIA 2C28A 4LJ8A 2PEBA 3EPJA 3OY7A 1BE6A 2E5LJ 3ZQKA 3UKJA 1ML4A 1VP3A 2GNPA 3EOAI 1BH6A 1NSQA 4K9RA 4LJAA 2WTAA 4XDZA 5J63A 4DX7A 5KNCD 2PSJA 1AH2A 2WLSA 4LR8A 4YJGB 2I5PO 3SMQA 1F3LA 2DX7A 4CNYA 3GV0A 1PNTA 4Q9KA 5IQQA 2ZK7A 4ZGWA 3MCOA 5A0TA 3PKMA 3K09C 1GM5A 4X93A 3ER8A 5HF9A 1KJJA 1XSEA 2BKNA 4RULA 4I8XA 2Q1TA 1PJ3A 1OFHA 2ZSUA 4YRJA 4LZJA 2GYUA 4C1NA 2W71A 1E5VA 5JMTA 2J9DE 1T2AA 1JUDA 2ASYA 1SOUA 1CC8A 4KNWA 1KE2A 4CLOA 4D3HA 4JUZA 2W43A 4QYRA 1WSRA 2EFNA 1HYEA 4U8VA 1IULA 4DJTA 2ZG6A 1RRMA 3L0PA 1LV8A 4MJ7A 3MR5A 1V3TA 1RMTA 4D3SA 4MARA 3AILA 3ZNNA 1YZTA 5K6RA 5AKLA 3LV8A 3QSYB 4CO5A 3PCOB 1F1BB 3RRFA 3U3DA 4OJGA 4CO2A 3QMVA 4C7VA 2R42A 1STOA 4QIHA 1AMUA 5KYYB 4NZNA 2PUJA 5J1TB 1P6QA 4KPUB 2V45A 1NSPA 2FZLA 4NAUA 3OEHD 3ETOA 1P9OA 4WZZA 5CH3A 4LXYA 3G2OA 2PHZA 3LNTA 3PX3A 3FBFA 2X51A 1LPAB 5FB3A 3QVOA 1DAKA 4EB3A 3CRQA 1S9EB 1KAEA 1N7IA 2DLNA 2XMZA 5KYUA 3VYRB 4D45A 3AEUB 1HNXF 3EGVA 1QP0A 1FSZA 2X4IA 3TUZC 4LSZA 5HQ8A 1W59A 4OQNA 2FK8A 3MCWA 4EW1A 1T03A 1XZIA 1WXEA 2X2PA 1M1NA 3K7RA 1JQAA 1GKYA 2VOOA 4DJDC 4HB2A 3FYUC 3ZN2A 1VG8A 2XQVA 1MEEA 1P8AA 1VOMA 1MOPA 2E85A 3R75A 1T9KA 2VP0A 3I6BA 2G0JA 4IH7A 4KRXA 4AZ3B 3CHYA 2ZH7A 2PA8D 5LA6B 3NP9A 1TMJA 2AR9A 3ZX5A 3W5IA 4UUWA 3E58A 1V8OA 3CEMA 3WKEA 1MN9A 2GVZC 3MF5A 1FDOA 4DXAA 2OFWA 4WFKA 2CLEB 2GHQA 3C5EA 4FB5A 3IG1B 1M1NB 2HLUA 4MA4A 4JJEA 4HWKA 1GADO 3NWRA 1VJGA 3OJCA 3KKLA 1GGVA 1SD2A 5ALIA 4XX1A 3D7RA 4IZ6A 5EIEA 5EE0A 2F1FA 5GAHI 3VMMA 3O75A 2F1RA 2ZBCA 1Y3KA 2JAPA 3IVRA 2OHXA 3IWXA 2E66A 2X6QA 2ZROA 1HHTP 2HJSA 2X0RA 1XQ1A 3KJNB 3K0AA 1KDZA 3GP9A 1ODLA 1YZHA 2PD4A 4KMRA 4QPPA 1W4ZA 1EWYA 3PF8A 3VKUA 1PYGA 1CULA 3CC7S 1NX9A 3B4MA 1ZOOA 3Q9SA 1WSAA 3B52X 3D8SA 2QMZA 3RIMA 5LYJA 4M6WA 2CADA 3TNVA 3GCZA 1ZNYA 1C9MA 3W78A 3AG5A 4HO1X 5CHYA 1M6YA 1OS5A 2DNPA 4FW8A 5EJ6A 5I5GA 1N2EA 1MA0A 5LLDA 3W77A 2W6OA 4Q03A 3PRDA 4HI2A 4R9SA 4LWQA 3PUKA 4YJ2B 1XMOB 2CD7A 1A76A 2NIPA 2OD4A 1JS1X 1Y5IB 4PWZA 1JJBA 1V39A 4RVOA 1T26A 2JX2A 3R74A 3IQWA 2CQBA 3EVGA 3CULA 2Q5OA 4G0OA 4DV4J 4DMLA 1N1EA 4LY3A 3ETCA 4R1MA 5AFSA 2AD1A 3HN7A 4QJBA 2EKNA 3A6KA 4XE5A 4KWEA 4C8YA 3OHMA 1R0YA 1DIOB 4HR7A 2G4CA 3QW4B 3QH4A 2C8LA 1RHMA 3OLYA 1Z0IA 4HNHA 2J32A 4OOEA 5E4YA 221PA 4JYBA 4KC0A 2PO4A 4PXYA 1F0PA 2IPMA 1I7DA 4O4RA 4W1RA 5REQB 2H3HA 3FPLA 1CZLA 4C06A 2AWOA 3VKFA 3CPSA 3NT4A 4IOMA 3TDKA 1NM5C 3SQLA 4QYZJ 3RG2A 3CB4A 3DFKA 2V7BA 5IU6A 1OT5A 2YWCA 3G86A 3WL8A 3GV8B 5CCMA 1XRSB 4PWDB 3PKJA 4KI7A 3DULA 4QDTA 5KREA 4M94A 2YBVA 3PVZA 2MPUA 4KSCA 1X4FA 1J9ZA 4R8UB 1M2VA 1YJTA 1RXYA 3TO8A 3QVSA 3L4EA 1VA5A 4PYRA 5FUYA 2HBRA 5CVTA 5K0GA 4K88A 2R1VA 1R7RA 1X86B 3VHLB 4O59O 1UFRA 1BS2A 3JQAB 2DR7A 1LKZA 4W92B 3H16A 2VSYA 3I53A 2QRGA 2MLZA 1HE8B 1NJ1A 4ETMA 2ILTA 2WOOA 2XZPA 1YJ9S 4AFFA 4OHFA 3RLFA 3TLBA 5DGHA 1GG2A 3L1UA 3CLRC 4EPWA 3M6MD 3IP0A 4X62B 1F6WA 4L4RA 2CDQA 1B14A 1KEEA 4BLQA 2FQQA 2CPHA 1N3IA 1OJLA 3FNNA 3RVMA 1XERA 3VHRA 5FX2A 3CT9A 3OZAA 1O97D 2HTEA 1RQ7A 2XYRA 4QD3A 2YTZA 5EZSA 4DSTA 1EFDN 4BBPA 3B6ZA 1Z0AA 5DNYB 1SBYA 5JEDA 4IFEA 1EJ7L 1AS2A 5CYFA 2L69A 2A78A 3TB6A 4JB8B 4ELUA 4XUGB 4TWAA 2D0PB 4XDCA 1X0PA 1LW7A 4WKYA 1CY7A 1Y33E 4RL4A 2YZ7A 2YWDA 3WIBA 1C1DB 1MO5A 2BJ7A 2H0AA 3EM1A 4C6TA 4JKIA 2BBTA 3U61B 3H2BA 5B4VA 1A6LA 1XK7A 2YMPA 1ZTTA 4WZQA 4KN5A 3S28A 2BFDB 2UVUA 1NPYA 2IV3A 4MUNA 4Z2XA 1XX6A 4CE6A 1VHIA 4WDQA 2KXNB 3LA6A 1K6EA 4MAFA 3KBOA 3W63A 3FVTA 4MI3A 1YONA 5BOSB 1XALA 3TYTA 1ACMA 4C87A 5EUHA 2H9YA 2VZ8A 4BN0A 3CZRA 3KK3B 1NSYA 5MDHA 2QTCA 5GADI 3U60B 1I24A 3AKZA 4MX8A 4GQBA 4XDYA 1H9AA 4CTAB 4CIAA 3COVA 3KDPA 1M6WA 3FAKA 4J37A 1ZEMA 1WQ4A 3OZFA 4KPCA 3GEIA 4QJ4A 3B1KA 4DR2B 4C78A 4QYMA 4JT2A 1UJ5A 2V58A 1PFVA 3T6JA 4RD3A 3L9XA 3M8KA 4K6HA 1YJUA 3MEGA 5HBMA 3KAPA 2FKNA 3DEHA 1H5NA 1JSCA 4D8XA 2IHNA 4RYDA 4EKNB 1ZNQO 2WG0A 4MR7A 2C31A 3MSXA 5EQTA 2AOXA 3V5RA 4Q5IA 1BFUA 3GJ4A 3EIHA 3DC7A 3CUWA 3W64A 2HK8A 5GZ3A 1UQUA 3RFXA 3H20A 4FXWA 4KE5A 2LKCA 4RJTA 5AICA 4QPZA 4OEHA 2WFLA 1EG7A 3DPSA 1B15A 2JFOA 1XD2A 1JECA 2FZ5A 3E18A 5DEOA 4D4KA 4K4SA 3VDRA 1SB8A 2DNOA 3N5FA 2DR2A 1ZCAA 3B6JA 1KAOA 1IBLF 2YVLA 2AZ1A 3FJ2A 2NUAA 3C6XA 2AE2A 3ZDRA 1BDIA 4MQMA 3I9LA 3W8GA 4ES6A 5E41A 4ZVOB 4S1TA 3R97A 4KMMA 4MNTA 4HDRA 4MUAA 3DV0A 5A9RA 4Q1EA 1HZZA 4TXSA 4TTQA 1Q7CA 2YOFA 3V3TA 3GNTA 2D2IA 3C1OA 5AJ3J 4TYNA 3ADCA 1RRKA 3C6QA 1U0GA 1N3BA 1S2OA 2BHSA 4K9DA 5D3ZA 1XLTC 4R9NA 2RK3A 4YP5A 5LD2B 1G19A 5IKOA 4HAIA 4CODB 2B9WA 2FLLA 1K2WA 3TQSA 1PQ4A 1Y42X 2XQKA 1E5LA 2QSWA 2D3WA 2H1LA 5JROA 1PJ5A 2K7KA 4F84A 2X3YA 5T7LA 2ZLBA 2ARKA 3DJFA 4DG1B 4DCPA 1QO9A 2NZXA 1UOEA 3AXSA 2AS0A 3OX1A 3CLUC 5C1OA 3GU0A 3CR8A 1KZ9A 1NE2A 5J2QA 3EGCA 1BVRA 2FSFA 1FFWB 3W1YC 2C83A 2QR5A 3MS4A 3OL7A 5JPCA 4FE3A 3JTEA 2F9DA 2J6CA 2JZCA 3VR2A 3U7IA 5TQ0A 2VXOA 1LF0A 2PYDA 5B1HA 2BVZA 1JG6A 1LBEA 3TPFA 3B2QA 4B2IA 3KD2A 2PO5A 1E9BA 4N03A 1RM4A 1ZONA 1S6OA 2YJ3A 1E6WA 2D54A 4GO1A 5LD2C 2BI7A 3R8CA 3LZ6A 3O94A 1GYPA 2Z43A 3G0DA 1C7IA 3IESA 2C7OA 5HLFB 3FOCA 1FI4A 4R5HA 4OQMA 1S97A 1O03A 2W0MA 3U5ZB 1QO7A 4F04A 4JI7B 5GWXA 1SIBE 3FBGA 4FYWB 1L5ZA 2BLLA 4XO0A 1GPKA 4ED5A 1Q17A 3QE3A 2H5IA 1GAOA 1LDGA 3JYPA 5I9LA 5E2AA 1YHQS 1MG5A 4WL0A 4NV3A 3EXEB 1N2CA 4QPCA 4ZKDA 4OX9J 2RGXA 1EK6A 1ZH5A 3JQCA 4B8ZA 2DFKB 4A8KA 2F9MA 5A3QA 4RZXA 1TFUA 1NDCA 1IPFA 2UVVA 2X6TA 5EX3A 4AJEA 1J42A 3MCTA 3EDMA 3WHKA 1NK6A 5LXTA 3AOGA 1XTPA 3Q10A 1UPAA 5BWLA 4DPKA 3LSTA 3SZUA 4AT1B 4LGYA 1HXHA 4GPTA 4G0NA 4DCJB 2ZVPX 4EUVA 3ZI4A 5MHTA 1TZBA 4D6PA 1RWVA 1RJJA 1ESMA 3KZMA 1REQA 3KUEA 3C16C 1GUBA 1DVRA 3JYOA 2YNFA 4CF3A 2EX1A 1PWZA 4QFDA 2O5DA 5EA2A 4RKRA 1WHVA 2YFYA 4UHEA 1F12A 4IF4A 4TSFA 4MAKA 4M54A 4KDRA 1H5QA 3V4IA 3IHLA 1GXLA 4CYMA 2RDIA 3HRIA 3IEVA 3ZVMA 4BO7A 1Q21A 4UAUA 4JBNA 5LOQA 1OC4A 2HEGA 1AZSB 3I83A 2DY0A 1DQ9A 1DC6A 4CEJA 4DLVA 2XEXA 1DRJA 5J2UF 2WIKA 4NAHA 1J5EJ 2G28A 4YTEA 4KWTA 3D7KA 4L8WB 3ZTPA 4EFMA 5LIPA 3CC2S 4REMA 1MO2A 1JI3A 4CDIA 2OHVA 5F98A 4D80A 1E2FA 1C0PA 1RHQA 2O3SA 3SBEA 2CUKA 4B09A 3F7NA 1VI5A 3DOMA 2RH4A 1F0KA 1GTVA 3GRAA 5KG1A 2PMKA 3LWNA 4J1TA 3Q72A 3CS3A 2JAQA 2ZSFA 2DF8A 2Q21A 4YMLA 3G5TA 1QH0A 1GXUA 4EMDA 4YV2A 4A8JB 1HNZJ 1X80B 5E3IA 1HBUB 4DNOA 5KZMB 5BVGA 4C89A 1UAAA 1JN0A 2DY9A 2Y93A 5SICE 4HT7A 4DQKA 2P0EA 5LSRA 1M90T 3H11B 4ZQCB 5BXYA 3CE9A 4ZVSA 4B6RA 3CVXA 4HHEA 3KZXA 5ETJA 1KRHA 2XNHA 1QVZA 3KE8A 2OSVA 4G1QB 1WP9A 4HRVA 3R8FA 2ZRGA 5C2JB 4BVAA 5M04A 4UULA 3AHFA 4DMZA 3HM9A 1NXOA 5KFXA 3ZWQA 3WC0A 4TU7A 4AIRA 1I4WA 4TM7A 4IOLA 4XDGA 2XMSA 4RMGA 2GGPA 2C5BA 5BNTA 4ZC8A 2FQ1A 2GK4A 3WWOA 5C7IO 1WZ2A 3QHQA 2VJKA 1XZPA 1FWKA 1G1AA 4PICA 4Z6KA 4M1OA 3OJUA 1BX3A 1RU2A 4KHPF 2ILYA 1XXHB 2DUWA 5JNTA 2Q6KA 2G7MC 1GAQA 2PZFA 3D4LA 1X9WA 4JI1B 4AULA 4KWHA 5CD4A 2JI7A 3KLFA 1VQMS 2C2BA 3D9BA 4ZI2A 3FRYA 1X1RA 1U3FA 4ZPVR 3VH3A 1ZD5A 3T9ZA 4RSMA 3SQWA 1N4DA 5CAAA 5EP3A 4DWIA 3DBLB 2CNLA 1JQBA 2Z95A 2XHZA 4K0KB 3AD9C 3U3KA 2QMYA 2NXNA 2ZUEA 2JANA 3LDAA 5KHAA 4UUAA 4KN8A 4IUCS 4MDFA 4QIGA 1B74A 4TRMA 3MD3A 3VF0B 2WHRA 3V6MA 1AKMA 3ISJA 3OFSA 1HW8A 2HJGA 1Z8FA 4P2XA 2Q9CA 2H1CA 4D2IA 3GY0A 2XPCA 5J2TA 4JI4B 3EMVA 1JLBB 2XCTB 2CCJA 2B99A 5IKPA 3V4RA 3C3JA 1OTXA 3X1DA 2KT3A 2ERRA 5LMNJ 4WESB 5AK5A 2GMWA 3REQB 1AIPA 3KYDB 3MINB 1CYDA 5FP0A 1SBZA 2ISSD 4IV0A 1YMQA 4AWBA 3HHEA 1GY8A 1MRSA 4JNCA 4E88A 5IXUA 2RD2A 2AN5A 3PV8A 2L2QA 5DXJA 4QE3A 4P4LA 5EOVA 4O4JA 1P29A 3L0DA 1FP2A 3ORFA 1V71A 4W6ZA 4K28A 4G4SO 1CV2A 2K7FA 3C19A 4XFJA 2YUIA 4ZP6A 1SUCA 3HADA 2D3UA 2ZJ6A 3UWTA 2QZJA 1SKYB 2GJ4A 2UZ1A 5JTUA 3FZYA 3RODA 4X4UA 4JCCA 4K4WA 3MRSA 2VUUA 5JG7A 1DJNA 1Y37A 2NZ4A 5DTIA 2CLHB 2EKZA 4AJPA 1BMQB 5K8UA 1J2RA 2JRLA 4I3FA 1FERA 3WYBA 1XTTA 3NGRA 3NO4A 1EFPB 3JQAA 3DAGA 1FDDA 1VRWA 3AR8A 4JUBA 1VBZA 1CUFA 1NDQA 4IGKA 1E2BA 2IS4A 3G2QA 1EP9A 3CJ5A 4HEHA 2BP7A 4L4XA 2ANBA 4B5LA 1T8RA 5T6MA 1JL3A 4HYYA 1Y6QA 3TZLA 3NOVA 1ZIXA 5AHOA 3IR5B 3CCUS 4ILMA 1JFLA 3FMFA 3VXKA 4TKMA 4NU8X 2DR0A 5DTJA 4DHVA 2O8DB 4RQTA 4GXQA 2AH5A 3LF2A 3U7QB 2BF7A 1BRMA 2AD9A 4PRKA 4C6RA 1USGA 4JYMA 1P1JA 4YT4A 4ZVUA 2IU6A 1FCJA 1NJFA 1QJCA 1GGJA 4DBQA 2I1QA 2C9YA 3B3FA 2CDAA 1REVB 4FGUA 4Q1AA 3KCQA 1I80A 4IXDA 3T3GA 2FV8A 2D00A 3C7DB 1O2DA 1QQBA 1KS2A 3JZIA 2B4YA 5AHRA 3JQGA 5CITA 4XVRA 2IPXA 3I0ZA 4I3GA 4G5XA 3I34X 3GRYA 5ALRA 4ENOA 3WDMA 1D0VA 4UQLA 1X0FA 1EE2A 1HDYA 2FPHX 2QEXS 1KMIY 3PT9A 1GDDA 2PJUA 5IG2A 3MK31 2VAXA 3IAEA 4NJOA 3IM9A 5EGNA 1RQ0A 2LW7A 5EPOA 4LQ3A 1Z13A 4MP6A 4R8SA 2CMGA 1VL8A 4YH1A 4RX6A 3OM8A 2Q49A 1S1TB 3V9PA 1TCCA 1KJ9A 1PZNA 5TT0A 3I5CA 1WG4A 2OAEA 2XYVA 1A98A 5ALKA 1WCV1 1Z2OX 2B61A 2FRVA 1XZDA 2NUPB 4L1KA 3V6KA 3KQVA 2HWXA 4RADA 1DHMA 4X6UA 1H0HB 1RXEA 4G37A 3G8SA 3V4LA 3JYQA 1QAYA 3AXMA 3WHLA 2BCGY 4KO8A 1N0UA 5AUOB 3LWLA 2BW2A 1G6Q1 2OYSA 3ZGVA 3A8IA 1SAYA 1K89A 3LKDA 1YRTA 2NT3A 2OUGA 4NX9A 2EKPA 5DYIA 2RILA 2VHXA 2HCTA 3T1HF 1SQFA 3JQKA 2Q41A 3QPAA 1E20A 2W01A 5JIBA 1Q7YT 2AGOA 1Z2PX 5E33A 3K58A 3R5AA 1UJCA 3BR8A 3G96A 2W2KA 4P5DA 1QGUB 1A2QA 5F7ZA 2JNWA 2FJPA 4KBGA 4NYJR 4OIXA 2ZNZA 3VPAA 1M1YE 1HW9A 3PLNA 4ND6A 5HOEA 1FTWA 1NZDA 3HV2A 3JQFA 4A15A 2PUTA 3NMRA 1J09A 5JADA 4CT0A 2XOKD 3T5BA 2Z3WA 3TDMA 1EX8A 1JBQA 3BX1A 1JKIA 2XF2A 4K8OA 3LXUX 4LQDA 3KR1A 4KQIA 3VV3A 4CIWA 3RSQA 2H1SA 5JO9A 1YF3A 1Z0ZA 2ZBRA 2DT5A 4IOJA 1KJZA 5K8TA 4I4BA 2H4WA 5CIQA 2IS2A 1GPBA 3BORA 3NBZC 2QTFA 1RWPB 5CYPA 3Q7TA 1TCBA 2QBYB 5FWYA 3V5NA 1AQLA 2J0XA 4IGFA 2VOEA 4RXUA 3BH7A 1C4WA 2KI5A 5CAEB 2R3VA 1U3TA 2NU7A 3NBPA 4XQCA 2BOVA 4EZ9A 5IVIA 4BWGA 4P34A 3TOZA 2ZB2A 2AXNA 3EJ6A 2V8DA 5I4IA 4HQ6A 5A62A 2HD4A 3DLTA 2LKDA 1II9A 3TNLA 3EOBI 4LJ6A 5FPKA 2TSYB 3QG5A 3X0DA 2LIVA 4QFBA 4YCMA 2X76A 3V9AA 1ZXLA 3VR5D 2MSSA 4YAGA 4IQ4A 3AJ1A 4MWSA 1L7BA 2O50A 4KBYA 2PSZA 4HRYA 3EF3A 1DB3A 5CZXA 3GG9A 3OVSA 3F97A 4QAJA 3KDAA 4Q37A 3D7MA 1X80A 3DJYA 5KYKA 3AVTA 1UWAA 5ETRA 3ZWCA 2JFGA 3FC9A 3PUHA 5B1DA 5F2NA 3MXHP 4UUMA 2WQZA 2WG1A 2FG5A 5AM5A 3TL2A 3LQKA 1YJ8A 4U0JA 3WLEA 4E6PA 3CMES 3KB1A 3ZU5A 1SHUX 4PZVA 1DXOA 4TYQA 5FLYA 4FXVA 2MZQA 5I8WA 1RHQB 4AZ0A 5LC1A 4Q3LA 1N75A 2YW9A 3ZNUA 2MY8A 1SIZA 3U4QB 2JLFA 2LEAA 4ND1A 1EHIA 2QX0A 3KLIB 2IC5A 1URPA 5EC8A 2W58A 3O4IA 1UL1X 1X4AA 5KC8A 4HMPA 5TQJA 1Z5UA 1PT9A 4MJLA 2DPXA 3FWPA 2VXYA 4M5IA 5CX1A 3PXGA 1SZPA 3L7UA 3NGXA 3K30A 3AOBA 4QXOA 1UBKS 4P2GA 3CD6S 2NN3C 3OE7D 4C7BA 4N7RA 2PXXA 1KIAA 5AMXA 4IQ0A 1Z35A 1B8UA 3FDFA 4OZ2A 1FT8A 3R1LA 2Y4OA 3DDSA 4OXQA 1CUYA 4N5DA 4OP3A 3IEKA 1YA4A 3SHQA 3CCWA 1Y10A 4RWXA 3DZJA 1YQTA 1PZGA 4U3JB 2D9PA 2BQRA 2GJ9A 4V02A 2DQSA 3H6HA 2JBAA 1BMTA 1QHIA 2JD2A 2O1SA 3TOVA 1M5PC 1PJAA 2F43A 2ZE7A 4PC3A 4Z8YA 4O1MA 4I4CA 3ZGYA 3VR5A 3EUWA 1FSSA 4CKBA 2E44A 1JQJC 1PBUA 1AC5A 1RWMA 2DFDA 1CQJB 3NHFA 1UXGA 4MA5A 4HK4A 4C22A 3COJA 1ZBDA 2CLDX 1ORHA 4CO4A 2QC3A 2Q66A 4QCLA 2X23A 3GJ5A 1QTQA 3UW3A 1JTEA 1KWGA 1XDBA 3R0IA 2PGLA 4X65J 1WY5A 3UN2A 1W30A 3NJ4A 1KIFA 2A7QA 1DQZA 4KRYA 1B1CA 4ZCQA 1OVMA 4M5MA 3OUTA 3RBDA 5H82A 2LXUA 4R1OA 4D9IA 5KNDA 1Y63A 1S49A 3HL4A 2HA5A 3V7WA 1XQYA 2PMFA 2BCEA 3MXOA 4YDHB 4RZ2A 2A9FA 2GVNA 1VCNA 3LD9A 3GJ6A 1CZKA 1EVIA 2Q07A 1XNQF 1XTQA 4WBNA 3UQZA 3JZMA 3KLVA 1PYDA 3VALA 5EWLA 1HE4A 1PKXA 3KALA 3RTVA 2YRXA 2D1TA 2C2OB 4O4LB 1MZPA 4ED7A 3OZSA 5BSVA 3W3AD 5KYXA 4HPXB 3DXYA 4D5EA 2H51A 1GSAA 4GAEA 3MLAA 2OP1A 4M22A 1XXHE 1ROFA 3TRJA 4DU8A 4CT5A 2HNZA 3BXHA 2CFTA 5AJWA 4DS3A 5J2NB 4JUFA 4KGZB 1CZRA 2E87A 1LDYA 1Z33A 3P4UB 2Z8YA 3FUVA 1QR2A 3RBEA 1IVYA 5M29A 4XVQA 1YKWA 1EB9A 4C4YA 5T64A 3CEJA 2HMVA 1LW2B 1LC3A 2XI2A 4BNGA 5GZ1A 2ERCA 3EWNA 4LJ5A 2V3WA 1OBOA 3C3MA 2AC2A 5F35A 2W7TA 2VTBA 4GECA 2FWIA 4ZJLA 2H3EA 3P9YA 4OX6A 4AKHA 1A9YA 4DARA 2WYHA 5ECGC 1TV6B 4FS1A 3R3TA 2R1TB 1JXOA 2DULA 2G9QA 4Y6RA 4NYZA 2Z30A 3HKDA 3HZGA 3M4YA 1FSFA 2JGDB 2YJ5A 4KBIA 3N9UC 3CLSD 1D7AA 3TCXB 1HQUA 4Z0NA 1FE4A 4KAXA 3U7HB 4YB8A 4TRJA 3J7Z5 4WNAB 5JH7B 4ZVQA 2DP4E 3QBEA 4BE9A 4X5OA 2J6TA 1CR4A 4P2SA 1M0TA 4RLHA 1DGQA 3L6BA 4FF4A 4IRMA 5KTKA 2D0DA 4A8JC 1HMVB 3BJZA 2UUCF 1RAEA 1A72A 3LXMA 5IWAB 3NHBA 4CCYA 1YUNA 5ALZA 1PIWA 1XQ6A 4JUIA 1WOPA 5CZVA 2RSQA 1CLUA 2IIHA 2ZH2A 4XCXA 2XVYA 4NMXB 4Q48A 1URNA 4LBIA 3ENZA 4ED4A 2E4XA 3OFNA 4B2YA 621PA 1IATA 1II0A 3K0HA 4XW2A 4U5QA 1X3LA 2IM1A 4Y0VA 2D2EA 3OP1A 5JSQA 1EGHA 4JENA 4KXMA 3LRTA 5CFPA 4LN1A 1I1QB 3MJHA 3OTDA 4ZOCA 1XF9A 4FW9A 1UMBA 3OVAA 1KQSR 1M6VB 4E09A 1X19A 2FPIA 4DMKA 3IS3A 2FLKA 3A6EA 3O8OA 1YFJA 1KYXA 3OZ7A 1WKLA 1EZ4A 4UEQA 4BP9A 2QZZA 3D7SB 2OBFA 4MV3A 4PYKA 2RNEA 3LBYA 4HLUC 4I4IA 5TB5A 2Z58B 2YOGA 3ZTSA 2HWTA 3LHIA 1ESZA 2I2AA 1DAXA 5EXTA 4H31A 5JALA 4YEAA 1LWFB 1TO1E 3KX2A 4PYIA 2A3NA 2IJRA 5HP1B 4KNVA 2HHSA 4EYHB 2Z2YA 2IDLA 3A6JA 3TUIC 4Z2AA 3KU4A 1DWUA 4LBHA 1V5IB 4ZCRA 5EYPB 3EUAA 4OXNA 5G1PA 3HLUA 2QL9A 4FLEA 4OHRA 4FR2A 2H1HA 5IC4B 1YDEA 4UU8A 3R7LA 2PIDA 4M37A 1TDJA 1IUNA 3AQIA 3E0QA 3F5QA 2WA2A 3GIJA 4R2IA 3WWEA 2J08A 3FMVA 3DXXA 4G1FA 4WBSA 2E7WA 2QRPA 3WGVA 2EW8A 1C80A 3RUBL 3NHZA 1CJKB 4H4KC 4BL5A 4MLPA 1ZG3A 3G5AA 3REFA 1D09B 2PS3A 1U2RA 1WAMA 3PNLA 1UFVA 5ALQA 4RE5A 3QEJA 4EYKA 1JILA 1OXBB 3QRWA 3VDXA 1P4GA 3PFBA 1E6YB 1A9ZA 1KQFB 4L02A 1R0RE 1GD1O 4R0EA 2QG9B 3KQMA 2DE0X 4L8GA 4R2KA 1FA9A 1XL1A 5EUMA 3FBCA 4QSHA 1BO6A 4PZDA 3FUYA 2VA9A 4FKXA 1MC4A 2GI4A 2AC4A 1N0VC 2IZ7A 4EO8A 2DO0A 2Q1YA 1T8PA 2F00A 4RNNA 5AM0A 1YRAA 4UZBA 2R8BA 3MMAB 3ZVRA 1U7XA 4W5JA 1REGX 3GOQA 4DDFA 1WCXA 4H4EA 2D69A 4PWWA 1GGHA 2L18A 3DCIA 1I51B 2V7QA 3RUPA 3HZOA 5H02A 2H7XA 5FT9A 1H1LB 5KFKA 4DTCA 2G1KA 2HQIA 4KODA 2QGFB 1ZH4A 4WZ6A 2J3DA 1YHYA 3MWBA 1CFJA 3N8GA 4YHBA 1JQGA 4JS0A 4HI0E 3LA8A 2OHFA 4ZP9A 1M34B 3OQBA 4BMDA 2R8HA 1FDNA 2VRCA 1IOVA 1BN7A 4WE1A 6NULA 3HWSA 2DRDA 5ETPA 3LALA 2I6GA 3SXUA 2K6GA 3ESXA 1SM4A 1TAGA 2C5SA 2JC1A 1GNVA 3PW4A 3DZ8A 1HLFA 1KI7A 5IAKA 1XQWA 2X6RA 4UUBA 2PUCA 2IBMA 3LX8A 1Z08A 2GZMA 5DPMA 3LHFA 4RX1A 3T4PA 4CEIA 3OOHA 1FO1A 3QFTA 4NBVA 2P6RA 4CLFA 2FSIA 4IFVA 4PO8A 1N8KA 1SL2A 3SFTA 4YP1A 1Y5IA 2BFFA 4YT2A 1R8BA 1C3JA 1CB7A 4L73A 4OXYA 4ALIA 3O82A 3JALB 1HMYA 3MQ4A 5FUVA 4MPJA 3SC2B 1M34A 3L0CA 4ZVRA 3L07A 2VQ6A 1UT5A 1ILWA 1G8KA 4H1WA 5E3CA 1REVA 3CW2C 3VSAA 4P7KA 4DR1J 2XQFA 4PW0A 5K6TA 3MEEB 2OCBA 2FN4A 1X13A 1UDXA 1IJEB 3PYLA 3QX9A 3H4TA 3FYDA 1ND5A 4XYGA 1OBFO 4PG5A 4KFBB 2O7RA 1JHDA 2H2HA 3EXHB 3GDWA 2VJCA 1BDHA 1E60A 5SY9A 2FW7A 4GOJA 4RLSA 1WD5A 2NNLD 2EK1A 4ZOBA 5A05A 2RGNA 1H9BA 4ZREA 2HHHB 1PGNA 1DURA 4ZYVA 1G6BA 3JXOA 1ZIOA 2PE8A 5B0GA 4B3SF 1TAUA 3OSNA 4X64B 4EHDA 3HHDA 3IXQA 3JQ6A 5E1OA 3V1YA 1S2GA 2X2EA 4EGCB 4ZCKA 3WQRA 5HNKA 1Y6RA 3TJAA 1H73A 3C7TA 1JXQA 2I38A 1C41A 5EQFA 2BFAA 2WBRA 3GHYA 4AG6A 1AN0A 3QKUA 1B42A 1E6YA 2ZJ7A 4K9OA 1RKXA 5L7YA 5EJIA 2P4EA 5A1JA 3QGHA 3VR6A 4KOAA 3QELA 3CD5A 1OYWA 3OM0A 4Y1FA 2X19A 2QAGB 1XYYA 2W48A 4CV0A 1ZXBA 4DYVA 3JRNA 2QG4A 3OR2B 1E3DA 3GVIA 4G9BA 4F3TA 4XIJA 4PF1A 1JXVA 2ZR9A 4CH7A 1G2QA 3G8QA 3D6HB 4RIGA 2XO7A 4ZU1X 1CWUA 1HLWA 1YR9A 1U7OA 4EB8A 3OQ6A 2B9XA 3UOWA 2JJ2A 4F4YA 4G0ZA 4FOLA 4C0KA 2Q8PA 3ET5A 1KD1T 1OH7A 3BHNA 2H4HA 4HB4A 5IBPA 4DIBA 5KFHA 3T1OA 1Y34E 5EZ5A 4N7JA 4ANFA 1LWFA 1IPHA 2BL4A 1I3MA 5P8WA 2X41A 3JQ7A 1R6DA 2IX9A 3GR6A 1WSWA 4UUQA 1K86A 1VBMA 3Q3IA 3FDSA 1F8YA 1Q81T 2QN7A 3FJ1A 2EI5A 2Y6VA 2M7SA 3DE4X 2IP4A 4QHTA 4M49A 3ZXWA 4CIYA 3TPCA 2W4IA 4EF4A 2ZDPA 2VRBA 4B9EA 1IJFB 2G6BA 3K9GA 3OXLA 3MHPA 3N2KA 3R7FA 5EIOA 1ZKDA 4Q1VA 3AHDA 1RS0A 1VC2A 1BA2A 4U7HA 3NBQA 5T4FA 2J33A 5C8ZA 2UYQA 1E92A 4WEOA 3BGRA 4C4AA 4D3YA 4F2GA 3IVGA 5A0YB 3K72B 2EBFX 2V4JB 1QD1A 4Y18A 5M2UA 1ZNXA 4K2AA 5JW6A 5KT4A 3D0OA 1OLOA 1XD8A 4EYIB 4RMJA 1R50A 4CP5A 4EZEA 3D7NA 1KWMA 2F7SA 2HMAA 2V7QD 4USTA 5EMKA 1SKRA 1VLLA 2VDJA 4Z4EA 5I7HA 2FWJA 4RETA 1VSTA 2DNQA 4AO6A 3KT3A 3FEYB 1UAGA 5KX5A 3KKZA 4MKVA 4UM7A 1II8A 3UT5B 4FVMA 2J4CA 1IWAA 3A1EA 3REOA 2F2TA 3LC0A 2WAYA 3IMGA 4R5MA 3ENVA 3IE2A 2NYIA 1K9VF 4ZMBA 3CCJS 4KFCA 2IWRA 4IH4A 2H11A 2N75A 3F3YA 1XRNA 2QGFA 1UBMS 3DNPA 3RVBA 4UNSA 1OZAA 2OHOA 1XJQA 3T0IA 3VZSA 5CFRA 4GBJA 4XYBA 4HQOA 4P3OA 2H5EA 3D6AA 4Y2KA 4MV8A 1WJ9A 2JKYA 3CUEF 5L3QA 2DTDA 4A0GA 4EUFA 3I9KA 3V7NA 1V35A 3EGXA 4IFIA 5BVGB 4F5EA 3H5LA 4BS2A 3PVSA 3R23A 3UAOA 1U3CA 4JSYA 5A3VA 1BH2A 3QEBZ 1EHYA 3IIEA 2I78A 1E94E 4QBUA 2C3PA 5A4MS 2E4VA 3O3CA 2PPLA 5A03A 1IEQA 1FJXA 2OXEA 1FRLA 1HUQA 2M1XA 4LF7B 3BL8A 4JY7A 2G09A 1XPUA 1UINA 2PS0A 1FRIA 4N9WA 4UOZA 1ESNA 3O9VA 3CN9A 2IYVA 3SNHA 1U1NA 2NS1B 4AN0A 1AF4A 2ACEA 2GV1A 3TI0A 2U1AA 4HN4B 1LF5A 1HE1C 4LCBA 3P19A 4CDGA 3LLVA 4C4PA 5KTNA 3TGLA 1M76A 5B7QA 2RIPA 2FHJA 3PXEA 2ZJ3A 2J9CA 3D1VA 4Y0FA 4TMVA 1Q1GA 1V47A 2AXPA 2VDRB 2CBXA 4MW9A 4P98A 4GQAA 1ULHA 3AY3A 1VFJA 2OAP1 4FPIA 1RJFA 2WVFA 3A06A 4CRWB 3VPGA 1VHFA 3R9WA 1IUKA 4BFLA 1VA4A 2AC7A 5K8MA 2PV0A 3PUXA 1IBLJ 4LQCA 2BQUA 1I10A 1VRCA 3N6LA 2DBRA 4BWJA 2PGAA 2IE0A 3OF3A 3QPCA 3CVYA 2PAAA 4KO0B 4JFAA 3HWRA 3SZGA 4B5KA 4D7AA 2FY8A 4BV8A 3ACBA 1TKDA 3ZGOA 2V7UA 4DCVA 3L8MA 2BI4A 3UCUP 3FFXA 2FI1A 5AM1A 3HXTA 1C81A 2N7YA 5KVVA 1NKTA 2GA7A 5DM0A 1IY0A 5G41A 4KXUA 4F8EA 4PAGA 1KWKA 2PKQP 3PXCX 4JLWA 3CKYA 3TR0A 1BXRB 4J1SA 2DZDA 1L5VA 1DAOA 2OPRB 2QRKA 3H75A 3VR2D 2JATA 1RYBA 4JELA 2C7BA 1JXAA 2AYGA 3D3BJ 2ZUWA 4WK6A 5DYYA 3OXFA 3DV9A 4PO1A 3BWMA 3KWLA 2RSLA 3DGPB 1OJ7A 2H5IB 5TS2A 2F8SA 3ELHA 4FYWA 1VC5A 2VG5B 3IX7A 1A8SA 3WL7A 2FP4B 3H1AA 1PR3A 3CIZA 4FCCA 2ODTX 3IA7A 3BTSA 5HKBA 3K8QA 2B8QA 3IUBA 3PNMA 2GVDC 2GARA 1FNOA 4IEIA 1J9GA 3SEOA 3C3LA 2IP1A 1MJGM 3ADKA 2J5BA 1MWQA 3U9SA 1J0CA 3LP0A 5H1YA 1ZM3A 4NZ6A 3KEFA 2B8EA 3M5DA 2V7XA 3GVHA 3IP1A 1GR1A 3HTXA 1KEVA 3DPIA 3GEHA 1ZZEA 3QPDA 3ICCA 5K14A 4ZQHA 3DRSB 1YL5A 3UT6A 4CEJB 2VIIA 3A1CA 3ZWVA 3KYLA 2MLXA 1H7XA 1AO0A 4QQFA 3RUCA 4KXXA 3UDEA 1JG1A 2HX1A 1WHTB 4RSGA 1F5NA 1S6PA 2M6SA 2Q6OA 2VG6A 2CYCA 4ECTA 1CEZA 3W62A 3RPEA 3R5GA 1KVKA 3C3PA 5CVVA 1ZPDA 4EY6A 4TL9A 2L3MA 2Q8QA 3NBUA 2VSFA 2HJVA 3SOPA 4BNJA 4QU0A 2FMHA 5EEGA 3MT7A 4MOWA 3NG8A 1KY2A 4UZCA 4XJVA 1Y3DE 4W5NA 1SUEA 3U37A 1TLTA 4CKWB 3VR6H 2ZB4A 2JA1A 1W0JD 1KTIA 1PD1A 1E3QA 1UP4A 4MDHA 3JAMY 1QH1B 2ZSAA 4JLSA 4TV8F 2CQHA 4TYPA 4LRFA 1JHPA 2Z04A 4BQRA 4MCJA 4AXBA 4FVCA 4DQLA 2QIFA 3PW7A 3NM5A 5HJEA 3KSUA 4UASA 4Y6LA 2ZYSA 5FPTA 3IVAA 1SCJB 3GUYA 5BORA 3PQ8A 4BO1A 3GSDA 4J5OA 4EYQA 1RI1A 1FBNA 3V7YA 3FVYA 3LTEA 4MHSA 1X8XA 4HACB 1ECCA 2XLBA 3T9BA 4R6WA 3MSCA 4U7PB 1Q53A 2CQIA 2I3BA 3DGFC 3BH6B 1RBYA 3QWBA 4GRDA 1CUEA 4DOZA 1VKRA 3KK2B 4G0MA 4M5HA 2YX1A 1SXQA 2VJMA 4OX7A 1E1CB 4FYHA 4GUAA 1KEZA 1QGYA 1XR3A 2IUTA 3L8DA 2Q1LA 4EG8A 4JYCA 3C4VA 3LUJA 4F67A 2GOYA 2YVSA 2GJAA 1AV6A 4WKRA 1HI1A 3TZQA 3BEGB 1TLFA 2JH3A 2XDYA 4HUQA 4Q0MA 5LJIA 1MB4A 2DLDA 4X1OA 1OFVA 3ISZA 3W3ZB 1K8AT 3DBOB 1V3VA 2CXEA 3TZWA 2IZ0A 3P97A 1N1MA 1HNXB 5AW0A 2F8TA 3V80A 2H18A 5JNWA 3MQ2A 3TAPA 1DDOA 2BQ3A 3G2IA 2IFXA 4USJC 5JYCA 3DBVO 3PEJA 3LT0A 4GFDA 3QPVA 1C7ZA 2VK8A 3CT4A 2E37A 4RGVA 4IDDA 4TPKA 5IZHA 5JWRA 3STXA 2FTKE 2L08A 5CW2A 3MDFA 3F78A 5BV0A 1HA1A 5ALTA 2VJPA 3VQSA 1JKHA 4F8RA 3ZW9A 4CZ2A 5KFLA 2QUIA 3P2IA 3ZWYA 2Z2IA 1U5CA 3B3AA 1HV8A 1ZY2A 1QM9A 4MQ6A 1DIRA 4IYRA 1Z22A 1NURA 3C15C 1N5LA 4LVOA 1T9AA 3WIVA 4ARAA 3SWWA 3LC2O 2IDJA 2DGXA 1I33A 4ZODA 2A9PA 3FCEA 4G85A 4DWVA 2QTGA 1CUZA 3DPUA 3M8QA 3OZEA 4X91A 2NUAB 2ZJ2A 2O8EA 4O2RA 2CQ2A 2ATEA 1D03A 2DHSA 3EXCX 5F9HA 1Y6ZA 3G79A 1T4CA 5CPBA 5C31A 1H6BA 2RKIA 2DXIA 1C0EA 2ES4A 4NOLA 4LF5B 5KG4A 4NYMQ 5FIIA 3PW2A 3CPHA 3QXCA 4IIGA 1SVDA 2CXSA 2V2QA 1B8PA 3BGOS 2XBMA 1FBTA 2RGCA 4DZTA 4D44A 2YWXA 3O2IA 3M1YA 4PCLA 3MG9A 3ITKA 1E8MA 4CM6A 1EB0A 4FU0A 4Y2PA 2V55B 4RESA 4ZFNA 3Q88A 4UQTA 2QL5B 2R7MA 1XKLA 1S9GA 2PM8A 3E7DA 4TWZA 1D1SA 3C7CB 3T41A 4ZOEA 5F9MA 5C42B 5B30A 3O8QA 3O8CA 4JVOA 2NSBA 5GPBA 2QE7A 1M74A 2ZGVA 4OM8A 2W9AA 4OH7A 3FFAA 4EKIA 1ZSYA 3IVCA 4D57A 2GO1A 3DR5A 4EEKA 3ONFA 2DVMA 1G0NA 2GDJA 1B0UA 3MA0A 2VZ0A 1R0BG 2PEZA 3TUPA 4PANA 1FRHA 2NU9A 4LRYA 3U7QA 2TMGA 4KOEC 2WHPB 5KUTA 1XEXA 4ZMSA 4ED8A 4KR9A 4F2PA 2NG1A 2P6MA 2YASA 1O96B 3JATB 4F26A 4I7FB 1XCLA 2QM3A 4RF4A 1HLPA 3D1LA 4XAKA 1PDVA 3ZDAA 3VX4A 5JSUA 4B2PA 1KJIA 2AWNA 3VR5H 2C7VA 3THSA 2ZXUA 1GL7A 1KAGA 4YWHA 5K8JB 4Z0HO 2UP1A 1JNYA 1VQPS 4G3IA 3CJTA 3H42B 3R3UA 2GN0A 4GG1A 1JB0C 2XMBA 4UBIA 1G98A 2ZT7A 2JGEA 1T5SA 3RHTA 4LFCB 3EIXA 4ZPTR 1QFYA 1XB2A 3F4KA 2D62A 2IVFB 3N6XA 2DMRA 2XKAA 3DDNA 3VPBA 1RHUA 2BGJA 1NJZA 3JD0A 3E6AA 3DRRA 4JT4A 1GTHA 4OQXA 5E6RB 3W2GA 1U8ZA 1RADA 3SR0A 4WK3A 2FZCB 2RGAA 1ZRHA 4XFDA 2CZQA 4FHZA 2UZ1B 3D6FB 4FKBA 1T9ZA 3LVFO 1EK2A 4Y9SA 1LTHR 2GF0A 2OP5A 4REQA 1V43A 1I7SB 1GGNA 2A18A 1BOOA 2JEGA 1MAWA 3G8TA 1FLDA 2JGIA 3SHVA 1ADBA 1YZGA 5EWMA 2AJTA 4QIVA 3NTQA 3AHCA 1WZUA 5B36A 3V7FA 4KMSA 3OQVA 1IR2A 2ATCA 3NASA 2FEMA 3GLUA 3TZCA 1Y1PA 3NALA 3PHEA 2NW6A 2VR1A 4DSZA 3EIOA 4DEXA 5AK0A 2ENWA 3CNHA 3TA0A 2R25B 2I1LA 2W7PA 3H0EA 4TS3A 3WZ2A 4DR1B 2XY7A 1Q78A 4B9UA 3MB8A 2BBEA 3DDOA 4PFJA 3NIGB 1WP4A 2EJVA 4E0DA 5JVDA 2K8GA 3QY9A 2PVCA 1E7WA 3ADOA 5FFFA 3AVWA 3IKVA 3FYUB 5KFAA 2DQZA 3CF2A 4CL8A 2VH5R 5LMNB 3D5QA 3VBEA 4D3FA 4GO7X 1G42A 4EBFA 2JGLA 4NLQA 2PSEA 4ZVRB 1MMFB 1JEQA 1CXZA 4NCNA 1T4GA 2CPJA 2GMLA 4X4TA 1W2GA 1U2PA 2WT4A 2BMVA 5ICCA 6REQA 4YMWA 2O2YA 3KOXA 1S3IA 4PCQA 2JLRA 2O52A 1OH5A 1R89A 3Q2SC 4HDGA 4CUZA 3CM0A 4LMRA 5B1SA 1XU4A 3P9XA 1S3GA 1OO0B 3D2CA 3T7RA 4Z37A 2DQKA 3HB1A 1H8EA 3BGOP 4H0FA 3GLRA 3KJXA 4GZ5A 2AVNA 4KO4S 2JLSA 5KNDD 4F6LA 3RK0A 4NF2A 4PQEA 1I4OA 3N2YA 4OJQA 1G41A 2CVPA 4X4RA 2IHBA 3ZXXA 2AFVA 4FGSA 1Y0BA 2R8IA 4TY8B 1IM6A 3W9BA 1PL0A 2X9NA 4GSYA 4IRUB 3MPYA 3P9SA 1J06A 1UZDA 1OFUX 4ZQEA 3OX4A 2NUHA 4LSGA 3MTDA 3FYTA 2JJQA 4URFA 1R5NA 4F97A 1FU4A 1NFFA 1NF8A 4ZVUB 2QW8A 4KPUA 2M6KA 1FWPA 2NZJA 4BNHA 3K0FA 4YO8A 1KK1A 2VUTA 4M99A 1RQGA 4M7RA 4MIYA 4B17A 3PFOA 2VS1A 3VYVA 1QONA 4H6VA 3CNQS 5FDLB 4JI0B 2MR6A 3VO9A 1GNPA 1VKHA 2J0UB 4EBBA 4QPJC 4JC0A 3V8RA 1YMUA 2MQPA 4C0AC 4X92A 1Q0NA 4LE0A 4KYUA 1DG1G 4CLOB 1G3UA 3SXJA 1XUOA 1EE1A 2GJKA 3IAAA 5FHRA 3L49A 4RNOA 2VBIA 5F2KA 5LUAA 2FR8C 3EZGA 2CG8A 2B4KA 3U02A 1EUZA 1U0HC 4GKJJ 4OHXA 4DYDA 3EUNA 2Q6BA 3D0IE 5E9QA 4MRAA 4LHVA 2D8AA 4LVNA 4P0QB 1PO7A 2FHJD 9ABPA 1U4OA 1S48A 1G6OA 2I7DA 3S6EA 4JI6J 1HFJA 4J9NA 4IRXA 1P44A 4KTQA 4GLBA 1QIMA 1Z7YA 3OR1A 4AZ3A 3TL6A 4XIGS 4GKBA 4CMCA 3DUFA 4RF2A 2BW0A 3GFTA 2V68A 1DQ8A 4NPAA 5AE2A 4L0DA 2QSFA 4QOGA 1GGKA 3IAM9 3HHLC 2I91A 3GJ7A 2UU9B 4RFSB 3PI7A 1PZFA 3QLVC 1EUDA 3CWQA 4Z4CA 5FOSA 2B0GA 3EZ2A 2GXSA 1Y5LA 1AZTA 4G84A 2BC9A 1P61B 3UN3A 3NNDA 2JLCA 3MEDB 4OSPA 5U47A 3BCSA 5C9ZA 2Z08A 3H1FA 1GCGA 1DC5A 5CW1A 4KQHA 1WB9A 4ZCIA 2ZRHA 4DMCA 1R0AB 1GMWD 1SBCA 2IUFA 3UANA 1Z7EA 3KLOA 2DQ4A 2WM9B 4TMYA 2XUDA 5CDUA 2XUQA 3IMEA 1DP4A 3K6JA 3BQ9A 4IMIB 4NNPA 3CDUA 1XCGB 2JDJA 3UFCX 4JWTA 1CB0A 3BYZA 1XJ0A 4HBGA 3OM9A 2JIMA 4A2WA 3VOSA 2OIHA 2XMAA 4R7TA 2GYVA 3CSUA 3S8MA 4H4OB 1JHRA 1TM7E 1HNZB 2CGEA 1I6JA 3I56S 3COPA 3ET6A 3MPDA 1OHHD 2UZ0A 4FT4A 3EZ9A 4K2HA 1YJ5A 4DV2B 1IM4A 2J3JA 3H4DA 4BC1A 1S5ZA 2NR0A 1AW0A 1U94A 3F8WA 3G7SA 3OZGA 4C2UA 1N9ZA 2HLDD 4DJFC 4H3SA 1UM8A 3UUWA 3ZDBA 4DQXA 2DPIA 1L4NA 3M7VA 2BUCA 4EG6A 4A8YA 2P6PA 2QB5A 1L9XA 5E7JA 3FRIA 4ENUA 4Y7CA 5CCDA 4HG2A 1M5RA 4ALMA 2CA9A 2X1HA 1EDBA 2YIMA 2R8XA 2ATXA 3ZWKA 4YVFA 3L7IA 2ALJA 1RKIA 3SFUA 3D2AA 4PONA 3I6IA 1JJHA 2ZBUA 1CY6A 1Y8AA 1F2TA 1BKYA 4I6EA 4KN9S 2BZ1A 2QM0A 1PAUA 5KOYA 1NJ5A 4X4VA 1NBAA 4WTOA 3RJ5A 4CQNA 4LYFA 3TLGB 1PILA 4GX5A 3MPUA 1X0VA 3A3PA 4L6AA 3W2FA 1AS3A 2AG1A 3PEWA 1K73T 2VK4A 2QK4A 5DW0A 4M95A 3M6AA 2ASLA 4KQFA 3HNPA 4AM8A 4Q47A 3UVJB 3Q40A 4YA6A 2JG3A 4JUDX 1RAJA 1CQNA 4U1RA 1T4MA 4U2GA 5PGMA 2CG4A 3RSCA 1UVIA 1CR2A 3V00A 1VBYA 4HAXA 5EXDA 5BSKA 3P5BP 1K8ZB 1TK9A 3JV7A 2HAIA 3L95X 5K6AA 1JWBB 4V03A 1PR9A 3VGJA 3E9RA 3SZRA 5HJXA 3KM0A 5FA5A 3N5CA 2XRFA 5LSAA 1EDEA 1SCUB 2MIIA 1XDUA 1ZL0A 4GI3A 4C03A 4W99A 4HHHA 2H92A 4M5JA 1DKNA 2Q50A 2I2FA 3OIGA 5BN4A 3MWLA 1SXGA 3TM5A 2V5UA 1FD2A 4ZDIA 4IX9A 3U3RA 1V1RB 3HXQA 3M0EA 2RFLA 3KEMA 2NUTA 1N0IA 4EZBA 1FMCA 3ROMA 3G17A 3WGQA 1ZH6A 3O4JA 2EIHA 1SUQA 1KMHB 1ZUWA 1XQVA 3KHRA 2RU9A 1XVLA 3IKMB 2KX7A 3WGIA 2FEWB 3B1YA 4FZJA 1N5IA 1BDMA 1Z15A 2TMKA 2CC2A 3LW7A 4RL6A 2HSWA 4DL5A 4U7UK 3KTFA 4BMZA 3T5LA 3I6ZA 4C88A 1JJAA 4OA8A 4EJ6A 1U0SA 2P8SA 3I87A 3CLVA 5CQGA 4YUVA 4PZ0A 4RNHA 1RYRA 1S6YA 2P62A 4ZI3A 1G5TA 2ENUA 3N8IA 5E0OA 1CJMA 3TW4A 1PNOA 4AQDA 5AXNA 2YY6A 4ZRDA 1M5TA 2UXCB 3WADA 1NZFA 3GX1A 2MSCB 3ANNA 4P93A 5IWAF 3MLBA 1NVXQ 1E7SA 1U5BB 2QAGC 1EX6A 5GINE 1MD9A 1NXQA 1WNTA 1N6LA 2XWJI 3LBNA 5FI5A 5BW5A 4LUCA 1P2FA 2V34A 5HVNA 1AMNA 1GYRA 1M6NA 1HNVA 3WYNA 2JFQA 3F6SA 2HHAA 4BXOB 1HBOB 3UF0A 2OBMA 5G4DA 4F4ZA 1P6TA 4Q9IA 4EU0A 4JH0A 5KFNA 3DI6A 2XNJA 2QA2A 3ZD9A 5L1LA 1AUXA 4NV0A 2NPIA 1ENOA 2OD7A 5EKTA 3CWCA 1PG5A 3L40