3N0VA

Crystal structure of a formyltetrahydrofolate deformylase (pp_0327) from pseudomonas putida kt2440 at 2.25 a resolution
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
280
structure length
280
Chain Sequence
b'DTWILTADCPSMLGTVDVVTRYLFEQRCYVTEHHSFDDRQSGRFFIRVEFRQPDDFDEAGFRAGLAERSEAFGMAFELTAPNHRPKVVIMVSKADHCLNDLLYRQRIGQLGMDVVAVVSNHPDLEPLAHWHKIPYYHFALDPKDKPGQERKVLQVIEETGAELVILARYMQVLSPELCRRLDGWAINIHHSLLPGFKGAKPYHQAYNKGVKMVGATAHYINNDLDEGPIIAQGVEVVDHSHYPEDLIAKGRDIECLTLARAVGYHIERRVFLNANRTVVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formyltetrahydrofolate deformylase
publication title Crystal structure of a formyltetrahydrofolate deformylase (PP_0327) from PSEUDOMONAS PUTIDA KT2440 at 2.25 A resolution
rcsb
source organism Pseudomonas putida
molecule tags Hydrolase
total genus 76
structure length 280
sequence length 280
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3n0vA01
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 3n0vA02
3LUYA 2J0XA 4PWUA 4YFVA 2LVWA 1RC0A 5IT0A 5FIIA 1RWUA 1U8SA 2J0WA 1RBQA 3DA8A 4Q12A 1ZPVA 2QMXA 1LK7A 1LK5A 2MDAA 3O1LA 3OFEA 3IBWA 3AV3A 1C3EA 3TQQA 1NJSA 2ZHOA 2QMWA 3TUJC 4ZYWA 2YWRA 4TTSA 4QPDA 3CEDA 4IO1A 4TT8A 3HHEA 4X84A 4NMLA 2JHEA 3AB2B 3IXQA 2KO1A 4ZYXA 4S1NA 1LKZA 4QPCA 4ZYVA 3TUZC 1GRCA 3MAHA 3AAWB 2JOQA 2GARA 4EW3A 1UJ6A 1MENA 4IQFA 4EW1A 1FMTA 2FMTA 2DT9A 1S3IA 3N0VA 3ENWA 1M0SA 2BW0A 5J9FA 4GO5X 2PC6A 4ZZ2A 1UJ4A 3AB4B 4TS4A 3DCJA 1ZLXA 3R8XA 4DS3A 4EW2A 3DDNA 3W7BA 2RQMA 4ZYYA 4GMKA 1SC6A 3AUFA 4PZUA 3KWMA 2F1FA 1C2TA 5CJJA 3NRBA 1UJ5A 3LOUA 3DHWC 3OFHA 4GO7X 1CDDA 2RE1A 1ZGHA 2F8MA 2QRRA 3ENQA 1Y7PA 5T41A 3TUIC 2DTJA 2FGCA 4ZYZA 1YGYA 3OFFA 2NYIA 4ZZ0A 3OFGA 5IS2A 3K5PA 3GARA 3DC2A 3DHXA 4ZYUA 4M8LA 3S1TA 5JJBA 5J63A 3TQRA 2H9ZA 1MEJA 2P9EA 3ENVA 3MWBA 2I9SA 2P9GA 4LUBA 1RC1A 3L7OA 1CDEA 3UW1A 1RBYA 2CFIA 2LQJA 1JKXA 4ZYTA 3P9XA 3U7JA 4ZZ3A 2PA3A 2BLNA 1MEOA 5IT4A 4NV1A 1PSDA 2P9CA 1YRWA 3Q0IA 1XTZA 2CDQA 2QSWA 2RQKA 1RBZA 1O8BA 3OBIA 1KS2A 4YFYA 1YBAA 3P96A 1RBMA 3KCQA 1ZLYA 3MTJA 4R8VA 1GARA 4ZZ1A
chains in the Genus database with same CATH superfamily
1ZOLA 2DR2A 5BQPA 2PJZA 1IUNA 1D07A 2AB0A 4ZGBA 5D6NA 1PAEX 2QMEA 1M0WA 4KAJA 5A4IS 4QTYA 5E6SA 3TA2A 1SPBP 5TARA 3THVA 4X2BA 2E29A 4HRXA 1N52B 2FUG9 1QVRA 4Y2KA 3JATA 3FKQA 1TKZB 4DILA 1RHQB 2OPQA 3QTTA 1G5PA 4OHPA 1RLJA 2PBLA 4I4IA 1P31A 3EC1A 1XD8A 1DEKA 4CYMA 1H7WA 5B7GA 3B1WA 1U1QA 1QO9A 5JG7A 3M1AA 3K73O 1IK6A 2ON6A 5DXAA 3ZQ4A 4O3SA 3BDPA 1RWOB 3OE7A 1FNDA 1IWPB 4OB7A 1YHYA 1J24A 2GMWA 3AVWA 4ZYZA 4U1RA 1B99A 2B5JA 1RI1A 2VF2A 2ZPUA 1CDOA 4ERDA 4YP1A 1UM9A 5JI3E 4XFDA 2FLKA 1TC2A 4GPAA 4D82A 2EBUA 1A96A 5CG2A 4KAIA 4H60A 1FFEA 3DZ8A 2D74B 3S99A 4UTZA 1WXXA 1EFUA 3LQVA 3DLBA 3P0RA 4BHQA 1QORA 2RB7A 4CBVA 4KQ1A 5L7TA 3H65A 1IBLF 4POAA 5B2EA 2CBXA 3CSDA 1RWXA 1I2DA 2QL7A 5IT9A 1GPAA 4NRTA 1WIWA 1JZQA 5AW2A 5JVDF 4WIIA 3PUYA 1GGVA 1H9BA 1QK5A 3HVIA 3HSDA 4HCJA 4YJKA 3VPXA 3AR9A 1IY8A 2Y99A 1HWUA 3RPEA 1AMOA 1EZ4A 5CFQA 4QPCA 1NXPA 3T9FA 5LQDA 3KR0A 3R9WA 4A8KA 2VA8A 2VASA 3CCBA 2VYCA 3BGRA 4QT4A 3DEIA 2GCOB 3IVMA 1CJVA 3EE3A 2AKYA 4G1EB 4DG5A 4IGFA 1N0HA 1CB7A 3AW8A 1S57A 4K0KJ 2J3LA 5JI2E 4ROTA 4V0OA 2I1LA 1WKKA 4GYYA 4C06A 4XVCA 3N2YA 2YIMA 1P9OA 1P91A 1VRQC 4KSYA 2I1RA 5A0YA 3DH0A 5J63A 5JQGF 1GYQA 1U8AA 2BGJA 5KQRA 5KNBD 4DT1B 5CJ2A 4JLUA 3FZ2A 1OASA 4K86A 4RGBA 2XF2A 4XGIA 5GJBA 5AKZA 2H1HA 3AYZB 3GG9A 3HA2A 5HEKA 2XD4A 2VT2A 1ZNQO 4GUAA 1YGPA 3BT7A 2IV3A 1I7QB 3QVJA 3U1TA 3TWOA 3RG6A 3ORFA 4B6JA 1ZA1A 2FMHA 1P3DA 4K2AA 3NAIA 2BEJA 3RG8A 3UDLA 4ZP7A 4PC7A 2ATEA 4TQGA 3S40A 2CVZA 3GDFA 2V7XA 1LH0A 3TWZA 1E92A 2GCOA 3DZBA 4ZDIA 5H4GA 3LNTA 1MA0A 5IJZA 1ZHHA 4HEA9 2YDYA 2OAEA 3A70A 1PYDA 1C4AA 3I4FA 4ERXA 3BFVA 4K3UA 3ECCA 3GX1A 5KO2A 1OY6A 1J4AA 1G8FA 3W9UA 1HIYA 1BLUA 3UH0A 4A8QA 4HGOA 4Y2YA 1I2BA 3HHLA 4DT1A 4U5QA 5JZVA 3UBTA 2V9KA 3F6PA 3T7CA 3ILHA 2H65A 3ABRB 3M82A 4RZ2A 4ECEA 5J1NA 3OMXA 5I9LA 1CS4A 2FWIA 4YCSA 3GJRB 4NI5A 4C9BA 2HV9A 3O9VA 1NRKA 1SVWA 4DWOA 1WV1A 1IBKF 1XKQA 4DM4A 4WNIA 4AK9A 4BFLA 4KXFB 1BUXA 3IAFA 4C6AA 1FL9A 2JEOA 2VJVA 4NIMA 2FR0A 5THXA 2CFCA 2OFHX 5JAPA 1AK9A 3LALA 5FLEX 1HPZA 2O6LA 3UWTA 5C46F 3AF1A 3BDIA 1HHSA 4KXMA 4IINA 2BE2B 1L6IA 1HNZB 2D3WA 1Q7EA 3OHSX 2XMAA 1GFSA 1X7YB 4F4YA 1XA0A 4BNKA 3GFQA 1J8MF 4Q3DA 3OQ1A 3OZFA 3AIOA 3JQ9C 2XMJA 1AXRA 3OLZA 2ODBA 3P5BA 2X3FA 5FI3A 4R3WA 2FW8A 4P7BA 5I7FA 2VK2A 4IFYB 3QVGB 3UKOA 3ZH2A 3N7UA 3OCUA 2GTIA 5CPFA 5JJCA 2WPDA 2XKJE 3CZPA 4BQOA 5F98A 1SULA 1Q8IA 2WYHA 1U0NA 4BMCA 3AOGA 1PJBA 5CLIA 3GPDG 4LC1A 3W5SA 2E89A 4HN9A 5F5NA 2MHNA 4NJMA 2PS3A 5BVGB 4EYQA 5J3JA 2VUTA 3LXMA 3KL4A 4HDKB 4M9SA 1Z5OA 1Z63A 3KHRA 3QJ5A 2DAPA 3QBEA 3PLRA 1AIPA 1YDWA 4WESA 1EHIA 1QIMA 3DRRB 2C84A 1RTHA 4YY3J 3G2NA 3WDLA 5IQ6A 5F77A 4IIJF 2G76A 2X1HA 1U31A 4D57A 4QBUA 3KAPA 2CHEA 1LBSA 3VPGA 5FPSA 4P6QA 4NLTA 4DV7F 2JVIA 4DJBA 2J9ZB 3O03A 2YC4C 1T25A 5TQ2A 2QT7A 1SVKA 4L95C 1QYXA 4YQFA 2CZ4A 4QU8A 3G9CA 3FWZA 4DQLA 4I36A 2W01A 3VVLA 3QNUA 3RIMA 4HX5A 3AUXA 4TV8B 1RBAA 4L8LA 1SAYA 5FLXA 1RKXA 4S0ZA 4NAVA 1KZ6A 3ETCA 5FV7A 3F0TA 5BR4A 2WI8A 3SYTA 3C48A 4FEEA 4HDKA 4KJXA 4F4CA 3TLAA 2OG2A 4MKVA 4BZQA 2W2TA 2JB9A 1Y98A 2RJ3A 3VV2A 721PA 1GTL1 1B7FA 4MI6A 2ZI6A 4HYYA 3FYSA 3GLFE 4C2AA 3ZIAA 4DPKA 2H4ZA 4MV5A 4X64J 2CFRA 4CCHA 1VHWA 5BP7A 1JSCA 3JRWA 3ZZ1A 1HE5A 1I4DD 2BDEA 5GZ3A 1MORA 3KKOA 4UVGA 4EA7A 1RT9A 4U0JA 3G8AA 1HBUB 3BMXA 1OVMA 2VQEF 2W43A 1FSGA 3FBEA 1G2PA 4KB5A 2I33A 3U7HB 4F3KA 4ER5A 1CFZA 1Q19A 2HWUA 4D74A 4EK2A 1GL9B 1I01A 1KVUA 4YS6A 4NWIA 4F9GA 1BRMA 1YQWA 2H3EB 3O2SB 4O63O 4K6GA 4OLPA 3D4IA 5CX1B 1KDZA 1W85B 5GAHU 2BEWA 2Q1YA 2HBQA 4FFRA 3QA3E 1UQRA 3O90A 2EFJA 4E1AA 2W90A 3L05A 3DMHA 2OPRB 3Q12A 4D0SA 1ST2A 2MWMA 3F5FA 4ZK7M 1DAEA 3DBLA 3O47A 1I51B 3K8ZA 3D6VA 3T94A 3N07A 3VC2A 4DWIA 1EFTA 1Q7YT 4FYYA 3LP5A 5JMNA 1XNQF 1SQFA 3DN9A 4RQAA 1U45A 4TZTA 2BN4A 2YVKA 2AOTB 1N0IA 1T1GA 3HP4A 5I9BA 2OBXA 2VT6A 4HT3B 3US5A 5ERGB 621PA 1D6NA 1GPNA 3ES9A 4W7SA 2HMSA 3V7WA 1HBUA 2ZD1B 4XB6B 3T61A 8ABPA 5J2TA 5KG6A 2R68A 5KFZA 2H52A 4PE5B 5JRJA 4RPCA 1TQDA 3WYNA 5K3OA 5J4HA 3OVAA 1B3RA 1WE2A 1VMDA 2YVSA 1EYZA 3UH1A 4ZD6A 4O23A 5AXKA 1OLSA 4LSZB 2IIQA 5SZJA 1E6YA 5IOLA 3VPCA 1WEHA 3FLAA 3MEEB 3RKSA 5KQLA 3N0RA 1K7EB 4U8GA 3P0EA 4LRTB 1FRXA 2RD5C 3IAS6 3VXKA 1UOOA 4AFNA 4M4SA 2D0PB 4FFVA 1JDUA 2W6OA 2BYTA 2WHPB 2P69A 2ZZTA 4PLWA 2RHQB 2WHYA 3LE8A 2AOTA 2EV9A 3OT1B 2VDWA 2D2FA 3GN1A 1GH8A 2ZD1A 3V32A 3NT4A 2HEIA 3H4TA 4ZN1A 1G6BA 1OBHA 3L8DA 1CF4A 4F8JA 3ADCA 1MH9A 5TEVA 1RAOA 7ABPA 3T15A 1HNIA 1ZOTA 4WTYA 2P2LA 4INOA 4LE1A 4RKUC 2X19A 1XK8A 2VCHA 5A02A 3SXUA 1WDDA 3OL7A 2GHWA 4DMLA 4LFAJ 3QUBA 3BGIA 3OLYA 2HM7A 4A92A 2V0NA 4FYDA 3GW8A 2RF2A 2VZEA 1CC1S 2OSBA 3TAMA 5C24A 4HWPA 4K7JA 2P79A 4I4TF 1XR5A 1PO6A 3S81A 1I4OA 2HF2A 1J0EA 4JFRA 2UVRA 1YR9A 4F06A 2C94A 1T29A 4U7TB 4N40A 1XYGA 4N8NA 2WHPA 4CMBA 3K5MA 1F6BA 5IXUA 2GHIA 2QXTA 4ZICA 3U44B 3L0IB 4GPEA 1VQ5S 1HQEB 1Y3KA 1ICEB 4J4TA 4QSMA 3MWYW 2XWXA 3T1HF 2QVGA 1I24A 2FZ4A 2BDTA 3ILLA 1Z15A 3VU9B 3UN2A 4CQLB 4BWVA 1ZL0A 3N7AA 2JVRA 3BGFA 5SY6A 5G0VA 2DFVA 4ZV9A 5IF9A 1FPQA 1LK7A 2EBHX 3S3TA 2XKKA 3U3JA 4DN0A 1ADCA 1PJLA 3GU0A 5AJTA 3L1HA 1W46A 3KETA 1LZKA 4TSKA 5H59A 2IPAB 4CEIB 5FNVF 2DISA 4MUFA 2ST1A 1M75A 4GECA 2HHJA 2O8EA 3QUQA 1UWBA 3QVMA 1S9EB 3P2OA 1DQ9A 4M5HA 5JROA 1W49A 1GZ3A 3DV9A 4A47A 2QRHA 4PCAA 4PEVA 4E6EA 4BMXA 5E3JA 2XMQA 1T6NA 4GZ5A 4YRLA 3MM6A 1NOJA 1OD6A 4X8LA 4ETNA 3ACBA 1YDLA 4KO4S 4CUZA 2RHBA 2AHRA 1G5HA 3L0DA 1UMKA 4CLOB 1QZXA 5JBIA 2CLSA 3HVTA 3Q3JB 2YWDA 1V43A 1I2AA 1E7QA 1T4GA 4TZ6A 3Q7PA 3I12A 2ZU6A 1N57A 3SEQA 4O8CA 4DU8A 3AFGA 2IY8A 2YOHA 3FTFA 4LR7A 1Q84A 4IGEA 2GVDA 3NOCA 1A4UA 4LRBA 2Q3DA 4I9FA 2DBQA 3HYCA 2DXDA 1NAHA 2VL7A 3ZV4A 2NR0A 2YVUA 2IH4A 1ADFA 5EIBD 1KQGA 5EWJB 1WI6A 5C37A 3W5BA 2BKOA 4KTQA 3G8TA 4X9XA 1KYYA 1RZUA 1IVYA 4J6EA 1T1IA 1MX9A 5LA6A 2WOOA 1M0SA 1PCXA 1NC1A 2BE9A 1FD2A 4DNQA 2BBTA 4WK4B 2YN4A 3R5DA 2BJDA 2E5IA 2F3SA 2XMWA 1HNVB 2H51B 3KQVA 4MVJE 1SI9A 2C7RA 4L5YA 4LJ5A 3VHLB 1NK5A 4O0NA 1HORA 2ATCA 3LO3A 3O9ZA 2IBTA 2F65A 3UW3A 3CWCA 3NBZC 1IVNA 5ETPA 3CE9A 5K8NA 4LISA 4B46A 3MBKA 1P77A 2D7JA 4LSNB 1ZD4A 2CQDA 4ZLJA 1AOXA 3I34X 3IA7A 1U7WA 1CVIA 3MT0A 4PSDA 1FWLA 3OPQA 3OZGA 4R31A 1ULBA 3QZ8A 4DSIA 3P1JA 1B6SA 1LNSA 4W1SA 1XG5A 4TY9A 3B1YA 2DRDA 4XGQA 3DTVA 4Q4LA 3SDZA 4F04B 2PQ0A 1XMQB 2ZBGA 4LRCA 2FZCA 4QPNA 1CJVC 2FK7A 1U1NA 1NUEA 2ECPA 4E5VA 1LW2B 3KKFA 1R8XA 1RYDA 4YX9A 2F4VJ 1I5EA 4EKEA 4R6XA 4DS3A 5EHNA 3FWHA 1W76A 1EP4B 3NOOA 4J0JA 3JALB 4CF4A 2LQBA 5K3BA 3GRYA 4I0WB 4DTCA 4ICLB 3Q24A 2A59A 2CVIA 1UAAA 4YRAA 4D26A 3U9LA 4ED7A 4DADA 1SM4A 1XF9A 1IPFA 4ZDJA 3SSOA 4LQ9A 4LSNA 5JSKA 5DGDA 4PPQA 2J5AA 2RMKA 5KX5B 2Z4SA 4C04A 2PSEA 3KZXA 3RSGA 3B8HA 3O8WA 4CQMD 2C4NA 2PHZA 4G67A 3L3BA 3ILIA 5HFJA 2GCEA 2VS1A 5H68A 1A95A 5DGAA 4NOJA 5D51S 3M6MD 3SSRA 5CT6A 3JCZA 2RGAA 3T9AA 2W2MP 1I7PA 3C70A 4PQAA 5JVHQ 3PRKE 4KCGA 1CEZA 3FEYB 3DG9A 3V81B 4MTLA 1WXWA 2HJHA 1YZUA 2XV1A 4ZEOA 2ZRKA 2XHEA 4ZA1A 3SN6A 1SG0A 3HPQA 2AP6A 1NH8A 1CPYA 2IRWA 4DMUB 3D4OA 3M3PA 3DXBA 4HX2A 1N5VA 1AKYA 4ZI5A 3HHLC 3CN7A 3IMKA 3W8GA 1N4AA 4I9UA 4AI6A 1X70A 2FQWA 3V6LA 4KK3A 2PUAA 1T5OA 2G2ZA 1X31C 4CFZA 2C61A 1CS4C 1FEHA 3TK1A 1RAGA 1ZCJA 5H9VA 3JQ8B 1IN1A 5LOVF 1UFRA 2WWYA 3F7NA 1WXQA 1VE3A 1Y6GA 5CABA 1PGNA 3DWFA 4G07A 4RHFA 3EGZA 3VUFA 1M2KA 4K6MA 5ALTA 1SRQA 1OW3B 1RYZA 1VIAA 2NSDA 3ZLUA 3LW8A 2NO6A 4XPEA 2A5LA 5CBPB 4YQEA 1E1RA 1X0FA 4BTLA 1F9EA 3ZOZA 2M88A 1BEUB 2IIBA 1VQOS 3N2GB 3REOA 4LRQA 4D3FA 3TUJC 3IPLA 4U2BA 2XITA 4AWAA 5LQMA 2ONKA 3H98A 3MWKA 4RK1A 2IHTA 2LDBA 4E13A 3R6GA 4DB2A 2FSVA 3LC7O 5JEDA 2FC8A 1NNEA 1PLKA 2AOUB 3MFHA 1FJ2A 3DI6A 3AESB 3RVRA 5LFAA 3FOAA 5DNVA 1DHTA 4BX3A 4RNOA 5K09A 4KLAA 3RH0A 3K2EA 3UWSA 3BMQA 3ZW8A 2GRUA 3VTKA 2CNNA 2P1ZA 5IAJA 2C57A 4P71A 4ZAVA 2ZJPQ 2NXNA 3QIVA 2E21A 2OLJA 3CJ5A 3CRW1 5HSGA 1FW8A 4P10A 1BC6A 3R3HA 3VR3D 3D2WA 1S0VA 1PS8A 5IF3A 3UJBA 3ROEA 4RLHA 1ZI9A 1P8AA 3B3JA 5HQLA 1P6XA 3BDEA 5D4PA 2G9RA 4MUNA 3IL2A 1G8PA 2M32A 4WXMA 4DV2F 4FNAA 1T3SA 2WK4A 3G2PA 4CTKA 3SZOA 4HUQB 4CO3A 3OIUA 4AF8A 3G02A 1H5NA 3KQKA 2CL7X 1YI2S 3C5WP 4RGVA 3CD7A 1OZHA 3U40A 3G96A 1Q77A 4XTTA 3USES 4A3SA 4W7IA 2RKOA 1WJGA 4A0RA 2QKYA 4F4KA 3DAOA 2Q1XA 3HB1A 1BCRB 3MD9A 4RIIA 2CFTA 1Q0ZA 4OYOA 1PL8A 2X0NA 1BWVA 4J9MA 1J0CA 1M33A 1PJ5A 2Y8EA 5F9FA 4ZKEA 1WCYA 3B1FA 3FMFA 4FFOA 3ZHCA 4YP7A 1H2XA 1XK7A 4ZC8A 1VRTA 3UJNA 3JAKB 1HX7A 4LR8A 3G6XA 4YCAA 2OGUA 4DR1B 4NU8X 3GPAA 2WILA 3G9UA 5HBMA 1YTLA 2BCJQ 4KQGA 4DUPA 2EK1A 1JLCB 1Q95G 1I5OA 2CVEA 3E3NA 1VB3A 1DURA 2CCKA 2A8YA 3FEZA 3OBBA 4ZPXA 1RDFA 1GTSA 3WWZA 2QPLA 4N9QA 1GWNA 1SOAA 2UUAJ 4KR3A 1USWA 3H5YA 1C7EA 3TKYA 5BXIA 5I7WA 5A9SB 3BTUA 2LPMA 1E61A 2O2SA 3OKPA 2I6GA 3RSSA 3PD0A 4WDRA 4ZVVA 4G5GA 5LB4A 4P82A 1AXQA 3GDGA 1IOWA 4B47A 2PXAA 3BHMA 3I5XA 3WGYA 3VX3A 1DO2A 5AWFC 3W4JA 3UI3A 4EHFA 2I7XA 3TIXB 1WCXA 4Y3CA 2LBPA 4NPHA 4LJSA 2VCEA 1LLFA 3G85A 4UUNA 3EIFA 2IUSA 4ED9A 2ATLA 2IS4A 3BL8A 3W5YA 3K0CA 1XZGA 3DF7A 5LBUA 1UXOA 1ID8A 2BLNA 4UBKA 1X8LA 3WLHA 1YRWA 4BC7A 4PIVA 4LECA 5AW9A 2BMFA 1YA8A 1RJ9A 2UUCJ 3H5OA 4F2PA 1E2IA 1UFQA 1RT2B 3IE2A 3UYLA 5AOVA 1Z07A 2DFPA 1KDTA 1AA6A 1PBTA 1QQBA 2P78A 1Q0NA 3KQUA 2HHXA 2VP9A 1G55A 3W2WB 3KVOA 2IU6A 1ZH2A 1Q8LA 3PHCA 3FNRA 1UMBA 3HEMA 1HFWA 1E5TA 4WUTA 2Q3HA 4XDDA 1P81A 3H1EA 2IH5A 1FDVA 5TS3A 1JHVA 1RI7A 4CLSA 1CZLA 3L7MA 4HZUB 3LF1A 3WWEA 5FQNA 3WZ2A 4B3TJ 3U3KA 2LCFA 1DBDA 3EWGA 2HSDA 3SCIE 1T1SA 1J2TA 3D6HA 4U9IS 1I4WA 3RYFA 3IV6A 1PZXA 2CNWD 3BXPA 4YECA 3MEGB 3Q6IA 3N8KA 2ZIUB 4JOSA 1EDDA 1TK3A 3EXHB 1WOPA 3KJNB 1SBRA 3NAQA 3T5AA 2AMCB 1G2IA 3KOUA 4JJEA 4P75A 3ZW9A 3PGKA 3VGUA 2X1FA 2QP9X 2DE0X 4XLLA 2BUNA 4GM4A 1RJEA 3ZBPA 3T41A 5EERA 3O8NA 1EETA 1S2OA 3DPUA 2Q21A 2DFNA 3TNFA 3A3PA 3T9DA 4FC7A 2PKYX 2VHEA 4UAGA 1S7HA 1KIAA 3QATA 4E70A 1HK7A 1EK6A 5EHGA 3CUKA 1X92A 4WCFA 2W1BA 3SIPB 2ERCA 2OQIA 1Q20A 2FG7C 5ICEA 2VPYB 3PD1A 4XDYA 3UFXB 1RKBA 3CEAA 2QJFA 4BZWA 4HDOB 5CU7A 1Y0BA 3W3AH 1SUCA 1UMDB 4MPPA 3VSDA 2LE0A 2NO1A 4DN9A 3IOBA 1GQQA 2VPQA 4CMAA 4S1VA 3NH6A 5KFVA 4V19J 4ZRDA 4M53A 1DV1A 2ZDHA 1IPEA 2E66A 3GC6A 4BVJA 4IXMA 5F9MA 2VFUA 4ELTA 5UKDA 1XDBA 4D81A 4XPCA 4HL9A 2EATA 5KYGA 3DGFC 2GEKA 3C41J 5JEEA 2VHGA 3UAVA 4L0DA 1ORWA 4OJNA 5F7ZA 5AM4A 4IRDA 4CV2A 1I94F 4ZIRB 1HG0A 3RDPA 4Z7OB 4ZQIA 5HG0A 2AYGA 1WACA 3FSXA 4EJSA 4RLFA 1FT8A 1Y6JA 1VS3A 4MKAA 3OCYA 3ZD7A 5DHTA 3ZDQA 5LWQA 3IR5B 1JUDA 1WSBA 2HNDB 3OHMA 2XB9A 3GVPA 1ZMTA 4AP9A 1PX0A 5EZQA 2G4CA 1K8YB 4NFLA 1WZEA 3RVBA 5K05A 2C7OA 2IYTA 1C2YA 3N79A 3Q2OA 4O44B 4DA8A 4NOHA 2Z2ZA 2HFKA 4DX8H 4QDOA 2NUTA 4G5SA 1QSYA 4CCWA 4M9RA 5TQVA 2O8CA 2GVDC 3FE2A 2IPOA 5JHHB 1XCMA 4ABTA 1RGVA 2D1YA 3GFRA 1BGXT 3T0GA 2O0KA 1X6VA 4P9NA 4KJIA 1Q2UA 2PLNA 2H6EA 6AT1B 3VFDA 2EFEB 1PUIA 4NBTA 5BWMA 4ZAXA 5GVRA 1PWHA 3V33A 1XCOA 2O2ZA 3QLEA 4R9NA 1P7PA 3UA3A 2QR3A 1L7EA 3FTDA 1COWA 3ZDBA 1UJ2A 3G2IA 4PY2A 3TNJA 3U3OA 3D0RA 5K5MA 1ZIDA 2O2JA 3CX6A 3WLRA 3C98A 2L0XA 2GJ2A 4XIGS 5C31A 4LREA 4PZZA 3W5JA 2JCYA 1M2FA 1E8NA 3SV4A 4UBOA 3EZ9A 3HYTA 1UP1A 2IF0A 1FYWA 2ZNYA 2GK7A 2WSMA 3O8LA 3NTRA 4PHCA 2I0FA 1LPPA 3TX0A 3SS7X 3CJQA 1VIOA 1NLZA 3V4ZA 2IJRA 4DLGA 1P9RA 3KLGA 4MW5A 2NXUA 1WDKA 3PFHA 3DAHA 4WW0A 4ZCIA 1MBZA 2YZ2A 4PG5A 1EGAA 3EZ5A 4IEEA 2QTHA 3EH2A 4F4FA 4EB0A 5KYTA 3KS9A 4HRAA 2MQOA 3RUBL 4KUHA 3LHFA 3IXQA 1AROP 4RMGA 3WXMA 1WRBA 3BJEA 1S1TB 5PGMA 3D1HA 3PSAA 3AM4A 2PD3A 1OREA 2APOA 4WU3A 2MZ1A 1RAAA 2PGIA 4IP0A 3SKXA 3L0PA 4Z2YA 3RM3A 2CJWB 2KLBA 3HUEA 3S1LA 4OG2A 1KAGA 2Z43A 1I2ZA 3PEWA 3BMCB 3W2VA 4X93A 3E5RA 4L57A 3K2IA 1C8LA 1KEZA 4LSLB 3HVJA 2DLNA 5H02A 1R8JA 2QN6B 1ZM7A 3WIUA 1SXJE 1KPGA 1E59A 2EIHA 3V4FA 4DX6A 2QU7A 4DVJA 3EH1A 2A9PA 2MJNA 1L4FA 4IWNA 4QWWA 3VA7A 1ZD3A 3SC6A 2JJ8A 3RFUA 1A50B 2E9RX 2J0WA 1F3OA 3FTQA 3OZUA 2N7CA 3ORQA 3AKYA 3DWEX 4NYZA 4O4JA 2CL5A 2NT4A 2K8GA 2QRVB 4YRJA 3MD1A 2YFYA 1S1TA 1KC1A 5G4KA 2Y2UA 2I3GA 2YWCA 3TAQA 2PUWA 1T8RA 2D06A 1GT91 3CBGA 2Z9CA 5AW5A 2FMTA 3QSYA 4YOEA 3FB4A 2YBVA 1YJWS 3LCRA 4PO3X 1RAHA 1J7KA 3IILA 3BMCA 1SH0A 2J87A 4HSEA 4X8HA 5A3RA 4LX8A 3HCWA 2YWEA 3FHJA 1BU8A 2ZIVB 2QN6A 4UZBA 1X9HA 2Q45A 4N6GA 1EFLA 3DBOB 1NSAA 2DPHA 2D3OR 2Z56A 3SQXA 1SCUA 2I2FA 1URPA 2UXBB 3WL5A 4YMLA 1IHPA 2QX7A 3G0HA 2F43A 4IXWA 1JEEA 1PHPA 5IPFA 5ALZA 1PNQA 1OAKA 1Z0FA 4Y2QA 4UQGA 4UEJA 4XUGB 4JSRA 5CB4A 1DAIA 3I58A 1YQXA 1GZDA 2MR5A 3MWFA 2V7WA 1L8AA 3ZDDA 2XWSA 2JGIA 3LQKA 1JXOA 1MMFB 3VPBA 4E2ZA 2PKQO 3SQGB 3O8OB 4UTNA 1AFJA 3JQCA 2FSVC 1Z6QA 4DLTA 3KLOA 3GILA 4IIYA 2ERRA 4GX2A 3U6KA 1MW8X 1JLGB 3B3AA 4IQFA 2C59A 4Z4FA 4MMXB 1P8JA 3TIIA 1K1QA 2PL5A 3MVEA 1KZ7B 3GUUA 4AAYA 1V8OA 4GX1A 4YC7A 3QK7A 2XXAB 1WA5A 1IM4A 1MV8A 4RIFA 3D6NB 2VDUE 2YTZA 2COEA 3DDSA 1EBUA 3OCZA 5KFTA 4HJRA 1VYAA 2V50A 3V8NA 1KFDA 3AY3A 3ZLBA 1O96A 1RACA 3I05A 4RABA 1JSLA 3W5DA 2AXNA 1I4LD 2HLPA 4RE6A 3RRNA 2NIPA 4QGFA 1BFUA 1GT6A 4PLVA 1QVVA 1GEHA 2Q8PA 1WKLA 4M7RA 2GASA 1ZQ9A 1ZW1A 1T9GS 2FJVA 4RTOA 2RILA 4DJDC 1W0KA 2IXFA 3SQGA 5AFSA 4Q9NA 1Z7GA 4H0CA 3A6FA 3IIJA 2QYTA 4AWBA 4JJ7A 3W65A 4QQNA 3V7NA 4QWMA 1R8QA 1Z6TA 3GMGA 2O54A 5IFMA 2KFZA 2WSSD 1VG8A 1F9AA 4D46A 3DYIA 1V16B 3JARA 2WT9A 3VAZA 1WMAA 2FK8A 3QEMB 1AUDA 2HU2A 3IDOA 4TVKA 1P33A 2ZT6A 2PNJA 4L9RA 2AR9A 1H66A 5ADHA 1IR2A 4WLUA 2DNNA 3EF3A 1KQFB 4IR9A 1AS2A 1N7JA 5FAXA 2R47A 2G80A 3UZUA 4B85A 4FFWA 2ODWA 1R3DA 4OJ3A 1P2FA 2FSGA 3U37A 5DJBA 4M54A 2G67A 2H4YB 4IX9A 5JSUA 4E5NA 1H38A 2GFQA 4LE2A 2QX9A 2PUGA 1XKLA 1M0EA 2VBIA 4NH4A 4ZQHA 4G0XA 1ESEA 2LLZA 4C11B 4G3IA 2ERXA 4HDHA 1JQ3A 1XRJA 1IXSB 4Q3AA 3IJ5A 4Q4HA 3HA5A 5FWDA 1Q1KA 2J9CA 3PXXA 5I7AA 3PKMA 4H18A 3PPYA 2NREA 2VAWA 3DJYA 121PA 3RFTA 1JAIA 3UB3A 2RGBA 5DI9A 2QAGA 4IDCA 4I5FA 5D2CA 2WIDA 1G21E 4IIXA 2FWMX 2Q49A 3HB7A 3LBHA 1XMBA 2P3QA 3HI6A 1WC3A 1NUHA 1R0CA 4KZKA 3F5SA 4CLHA 6ABPA 1JZTA 3M2RB 3AETB 3OFNA 3SSAA 2VZ9A 1CBUA 2M52A 3L1JA 2Q0HA 4JUAA 4QPJC 1DJ0A 4M6WB 4TL8A 3E2MA 5E3HA 3K0CC 5E2BA 2PZMA 3PDNA 2HXSA 1IHUA 4LIRA 4CLXA 1QE1B 1XOIA 4L74A 3N2NA 2ZRDA 2D4HA 4TWIA 3PDCA 4WXPA 4UHKA 1OFGA 5FYQA 2JK1A 4OQEA 2PZKA 4H7FA 5H9FJ 3ZE7A 2F63A 2GA7A 4BO9A 4GL4A 3Q8UA 2C8KA 2Q5FA 4GNRA 2QJTA 2CZQA 3K3PA 3S27A 4BFXA 1ACMA 2GVZA 2C3OA 2ORWA 2PIAA 1DAOA 2D5LA 4FIZA 3C3LA 1EP1B 2CPXA 1GUAA 2C99A 4JYBA 3PC8A 2D6FA 4BMVA 1QGUA 1NZDA 1ZCBA 4WVFA 3KDAA 2OGTA 5BURA 1OV6A 4I3HA 2V94A 1BJTA 3FZGA 2K4MA 3TVDA 2AA3A 4M38A 3H9QA 3MQ2A 2AFVA 3AXTA 5LWHA 1VHFA 4R4JA 2DD8S 1KOLA 4YHHJ 4CKCA 4BLQA 4P2FA 1RIFA 2YVAA 2UUTA 1OQ3A 4PHGA 1X8KA 2HVIA 1ZH8A 4FF4A 2YWXA 3I53A 4PQUB 4KIWA 3UMRA 2OV2A 1AYEA 4MQLA 3FWYA 4XH9B 2KXNB 3F96A 4KLCA 4KQIA 3VPDA 4MS1B 3DLAA 5B4VA 4IZIA 2HMIA 4LF2A 2A67A 3CVYA 2M9KA 4CKZA 3K70D 2P3OA 4ER8A 4MIWA 2KBFA 2A35A 2GKOA 2OP5A 5FR1A 3IP1A 1G3RA 1SC1A 4H2DA 2B94A 3S70A 4B3JA 4Z9BA 4R3NA 3KB2A 1RPNA 1UWVA 4RUKA 2EERA 3CJKB 2ZE8A 2FDRA 3FPSA 4OYBA 4G26A 2P7HA 3KHLA 2HAIA 4JI1F 4LFBF 4ID5B 3PQ4A 2QLJA 4EENA 1NK7A 3E5MA 4WIAA 1LWEB 4KOEC 4NYOA 2SCUB 2GFIA 3N6XA 4ENUA 1VJGA 4WCFC 2HMVA 3ZK9A 2XSJA 4DQRA 5IW8A 3X1XA 3QSIA 5AKIA 3MR5A 1KQSR 5KSPA 4MP6A 1KWKA 2E18A 3RT7A 1EVYA 1LI7A 4MIKA 1UZNA 3HGQA 1VGRA 1QBGA 4H6VA 3CMQA 3U3DA 3N86A 2ZRLA 2V8HA 4BZXA 2P9GA 1TCUA 3BQ2A 1VHLA 5ETNA 2H16A 4AJEA 4E22A 3TBFA 1XTZA 4RTNA 2AZ1A 3PICA 1WU8A 4ALLA 1JHZA 3ROGA 1N33F 3VJMA 1I2CA 1QVWA 3OZEA 1DC5A 3GU3A 3LPCA 4G65A 1X2BA 3CY6A 2W2LD 2RKIA 1TK5A 1HR0F 4PUOA 3KV1A 5FBZA 3VX4A 1KH1A 2JKVA 4II3A 1JTFA 4K4ZA 1IZ0A 2RDMA 1ULRA 2VP0A 2WNSA 4WBNB 4JJGA 5K0NA 2ZWOA 4B9UA 5CK5A 1U09A 4G9GA 4KAXA 3QWUA 4ID5A 1K9VF 4EJSC 4FPRA 3PR1A 1E69A 1L7MA 2CW5A 3AWIA 1FDOA 4ZVGA 4JVMA 1ZGGA 1QDEA 1ZIXA 1F1JA 5CVJA 5ALLA 1KK3A 5C25A 4A48A 2OA0A 3GZNB 4CUJA 1Y4ZB 2J76E 4OV6B 4JYAJ 3MI7X 2QDXA 1IOLA 4HWSA 2KX7A 3DBRA 4R83A 1BHO1 2WSYB 1VQ9S 1KFSA 3HTXA 4UPEA 1QMPA 5IT9U 4R05A 2WAYA 4UHCA 1J1UA 1U9IA 3ZNQA 3F0NA 4RANA 1N3IA 2D41A 2F1RA 3QF7A 4ZOSA 4LYGA 4D3YA 4PPYA 3PZBA 1RRFA 4CO2A 3UWKA 2BQUA 2IOYA 2YKMA 3W5UA 3GLHA 3EVFA 3KG0A 4L27A 4BZZA 1A9PA 5DX8A 4C6TB 5IEJA 2XRMA 1U98A 5DLFA 1HW9A 1XJCA 5AW8A 4J0QA 3A6GA 1P44A 3EG9B 4US2R 2ZM6J 1E0DA 3PEEA 2D5CA 1ND5A 2VJQA 3RAGA 3T12A 1CF9A 1NXQA 5EWMA 2JJ4D 5ELLA 4DREA 4WKNA 3A9UA 3ZDCA 1V6SA 2NUAA 1IE3A 2B6AB 2GETA 1DQAA 2WRMA 3DE3X 4DAEA 2K1RB 5BV0A 4AL5A 1KTQA 2IBKA 3I23A 4Y3UA 1M67A 2IVYA 3DGPA 2C83A 2AUNA 3QIDA 3GVIA 4FJ1A 1V3RA 4KEAA 2QTMA 3T4XA 1ZIPA 2P9JA 2GAFA 3U1NA 2EJCA 3E48A 2MPUA 2HRCA 2DRAA 4YP6A 1UAGA 4DA6A 3K89A 4NLXA 3FRZA 1CEQA 1W6UA 1YLXA 5CH7B 4FFMA 1TKZA 3E7XA 4V0ME 2FG5A 2DWOA 5FIUA 1S10A 1RHQA 1OB5A 2XLCA 4O3FA 4UEOA 1WOOA 1SK8A 1LNZA 1RNLA 3C1UA 4D9IA 3ITHB 1FU4A 1B14A 1TLLA 2J3HA 3EXG1 3TD6A 1R6VA 5AP9A 3OZ7A 5LIRA 4PVDA 3FNIA 1RWOA 1RYNA 5E3QA 3EGNA 5DP2A 4MW0A 2GYWA 4YMUA 2WTBA 3ZQUA 1U0GA 2G3YA 3S6EA 3F6CA 2AJ4A 1DWUA 3BWBA 3GUCA 1EX9A 2EPIA 4RY8A 3RWBA 3R24A 2D74A 4B0OA 1QB7A 1UDRA 2LNDA 1IN0A 3FMBA 1J8QA 1YITS 4DN6A 4TWRA 2XPCA 2FN9A 1SCIA 1E9VA 3WBKA 1LBQA 4BO2A 3DL7A 2WZBA 3QXSA 4PO9A 2CNKB 2P2NA 4XDHA 2P5TB 1RWMB 1R5BA 3EZ2A 3CZMA 3HUDA 4DUZJ 3NWJA 4RPJA 5ALDA 4B9SA 4WH0A 8MHTA 1XPUA 4PWWA 3C6UB 2ZH8A 2HF9A 4K0RA 4MROA 2C0PA 4LF4J 1F6WA 5D77A 4K0KF 4CF7A 5JANA 3LF0A 3IUNA 5TGZA 1Z0UA 4GSYA 1NP6A 4LCEA 3T4EA 1EJ7L 1M34B 3FPKA 2FI1A 3PEUA 1E3JA 4L6V3 4TN1A 4IMIB 2HQ1A 4R8KA 4B3FX 2JJYA 4XOIA 4CMHA 1CYEA 2GILA 1RXCA 1XAIA 2RH3A 4JKYA 1H0RA 3ZCXA 1HYEA 1S3IA 3V9PA 1Y11A 5I4MA 3AX6A 5CHYA 1MZPA 1DJMA 2ZT5A 4NMXB 4WKBA 2DULA 4G63A 2EEPA 4CM7A 2I4TA 1S97A 4I1TA 3ZNNA 4LJYA 1N34B 3G17A 5JADA 3IKMB 4NCXA 3AONB 2CMFA 4KQZA 3RUHA 3ILJA 5COBA 1HBNB 1NMXA 4UM5A 4D8XA 2REBA 4DSJA 2JA2A 3TSAA 3DVAB 1ZA2B 3URKA 1O3YA 1YMVA 5JECA 4M0KA 4C5BA 4OQLA 521PA 5DHAA 1RBMA 3GIDA 3NHYA 1OQAA 1L5LA 1Q7TA 5B0AA 2Z58B 4OXYA 5EJ6A 1KKMA 3NAMA 2OO3A 1K47A 3CD6S 2Y77A 2B7BB 2QL6A 3NUGA 5D01A 3WYFA 3OLWA 3FDFA 1NBMD 3IFEA 4MIEA 4EK9A 3CCWA 4YONB 4O2AF 3D6AA 1V3VA 3KL2A 2B7LA 4ZVEA 2R8GA 3AVYA 3SIXA 1HDEA 5GM2A 2W2KB 4C4TA 4TSFD 3ZU6A 1FF2A 2A58A 3GJRA 4J43A 1ISFA 5I8PA 3H7IA 2W6PA 3COWA 2GO1A 3CWJA 3T5JA 4AKSA 1A77A 3PX0A 1KYXA 2JGAA 3QE4A 1YS2X 1HD1A 1I6JA 3GPBA 2ZM5A 2D7DA 2HA4A 1DAFA 1XZLA 1OWXA 1S01A 3BIOA 3OIDA 1PUXA 4Y1GA 1EDBA 2BEKA 3AL2A 3AI3A 4DANA 3M5WA 4RX6A 3FPGA 4CMCA 2W93A 3LH5A 3WYCA 1IOZA 3CNQS 2JA1A 5DG9A 4MYSA 4N18A 1PCAA 4PLTA 2BE2A 4OYZA 1Z1ZA 2LRHA 5CD4H 1X7YA 1UT5A 2B0CA 2JD2A 1DKMA 1TKXB 3KOMA 4G2TA 5HKKA 2RAQA 5BPFA 3LP8A 4PRYA 4NU5A 1XU7A 4IFYA 3QVGA 4QE3A 4K4YA 3QPUA 5LP1A 4K6KA 1E2NA 1G8HA 4KQ6A 2W2KA 2GBFA 3HEAA 2Q29A 3ZWXA 4ZLNA 1KIFA 4IG3B 3ASZA 1WBJB 3DHNA 1OQ6A 5EGSA 1J5XA 2GOYA 2O57A 1JI3A 2W6ID 4FMDF 5BVGA 3NHUA 1QVZA 4FYKA 3AIKA 1EZZB 4X90A 4D25A 4ZYYA 4CQJA 1BDIA 2HFJA 4YAKA 1JZSA 4YY3F 1J2YA 3SYNA 3W63A 1SKQA 3L46A 4DNXA 5KDLA 3EZXA 2VHZA 1J00A 3K15A 3Q2KA 3DRRA 3K8YA 2COLA 3MHTA 3QOWA 2MINB 4I1OA 2BE7D 2DH5A 4RKRA 4L7QA 1CUBA 2V8VA 1LQ9A 1SB9A 2G7ZA 4H77A 1W94A 4EL0A 2GD0A 4OTZA 5CJPA 4P4LA 3TAHA 5D0RA 3ZZOA 1E58A 2JIDA 4PC2A 2PEHA 1C3XA 2DRBA 1HT0A 2Q3CA 4OHKA 4TV8A 4RWZA 3UOAB 4HGPA 2QAGC 3QENA 4KR0B 3H86A 4IG3A 2AT1B 1EE2A 2YKNB 3BPSP 1XX6A 3L8CA 3R7AA 2ZVJA 5E2QA 1BMFA 3I2KA 3OCCA 3SG0A 1THTA 1KI9A 4MLDA 1ZYQA 3INGA 4QD3A 4X64F 5JCZA 1XZCA 2XI4A 3ANMA 2B8QA 3KB8A 2ZH4A 4RADA 3P0JA 2HDNB 5DM2A 1I1QB 1MWYA 3O1HB 5F4BA 1O94A 4IRUB 3AD8C 3Q22A 4DV1B 3VYSB 4DY4A 1FDRA 1J1ZA 2W2PA 2W9AA 3A04A 4KBGA 4J4BA 1Z9BA 1TL1B 4YP3A 3R3XA 2WIGA 2V0CA 5FJ4A 1LVGA 4RZ3A 3JWIA 4IIDA 3CGGA 2Q5IA 2W4CA 5L9XA 1S2DA 3A13A 3EMVA 2GVZC 5JLJA 3EYAA 4RTRA 3GYBA 4LCJA 2H3EA 2QTGA 4X92A 1FNXH 3PC8C 4EH1A 1V25A 5CX1A 5FYDA 1W85A 4TTSA 3MRTA 5IAEA 4FM9A 2ORED 5KKCA 4NMLA 4ES3A 3MCAA 2XY4A 3RFCA 2R4TA 1J2JA 2OPRA 2QW1A 3N2KB 2FVRA 1SJRA 3G2MA 1ZI8A 4U9UA 3O0TA 1CQWA 4ZU6X 1YVRA 1I51A 3SICE 3ZHTA 4NHEA 4DQIA 5E8JA 3KKQA 5CD4A 3U09A 4HAUA 2P9ZA 4IICA 2V3WA 1CUAA 5KT5A 4YP5A 3D3BJ 3VC3A 3L1VA 5KC9A 5AM3A 1Q82T 5AVRA 3BOSA 4WXWA 5CNIA 1TNDA 5K14B 1DTEA 1PT6A 1NNI1 3FUYA 4XQ9A 1ADBA 4HT5A 1Z2PX 4LXHA 1UFOA 3F9CA 3KJIA 4OA5A 13PKA 3L8ZA 3W9HA 5D3KA 5BSTA 2OPBA 3NHWA 2IUUA 2ZH2A 1O03A 4DYHA 3AHHA 5DN6D 4BNJA 1AGPA 3GFSA 1G20B 1KZ9A 2RIPA 4LSZA 1CQMA 2XGPA 3AFOA 1R6YA 3JSRA 3LUDA 4FN5A 2EJUA 3MEEA 4ZOCA 3UT6A 3TQQA 1FDAA 3L2OB 5JAUA 1KFKB 4X84A 1JR3D 4A6XA 3CZQA 3DLCA 3FDZB 3WO1A 3VYUB 1F48A 4P0TA 4NEHB 3P9PA 1T5DX 5U47A 4PQEA 4RH1A 4ZV7A 2E0IA 3M2PA 2C54A 5ALHA 3G2LA 1PT8A 4WZQA 1E66A 5H81A 4HT7A 1CEEA 4ZP1A 4AKGA 3OT1A 4GQBA 2AEFA 1K86A 1K7XB 2WIAA 2AR7A 3NWPA 4E94A 2I62A 4F50A 2FJXA 3EB9A 3TDNA 2AWNA 2BI4A 5DQIA 1E2BA 3NT5A 4NBRA 3HO6A 1JDPA 1I80A 2O50A 4YCDA 4DA4A 1MROB 4D9NA 2BEUB 1RAFB 2UXCB 4PCUA 4INAA 4LFAF 2YHAA 3TW4A 4R0VA 4TYPA 2DFKB 2CJBA 4IEIA 5ARCA 2YVLA 3HFZB 2QQ5A 3RW7A 4LBWA 1IZZA 2J6UA 2WU0A 2PJRA 1KOHA 3UXHA 1U0SA 2CXNA 3JZAA 3PA6A 2CK3D 4NWBA 2PSJA 3L95X 3AP3A 1IN6A 4IJ5A 1R9JA 4PHTA 3HR7A 4F0JA 2PD4A 3KQQA 1HTBA 3ZYZA 1WSVA 3H4MA 2JAHA 3NWBA 3TI7A 3OKAA 3KSZO 1VJRA 2OCLA 4KWCA 2EYQA 1M0TA 1NJWA 3UANA 1NK8A 3U44A 1HQEA 4B6FA 3EXEB 1ICEA 4LDNA 2PJUA 5KFBA 1KI8A 5CYQB 4NEGA 2EZTA 1IBSA 4QVGA 5FL7A 3IEIA 1A8UA 5KVCA 3DD1A 3VU9A 4CQLA 4N01A 3A8EA 1AGXA 4OQNA 2ODQA 2W58A 4TYWA 1U9IC 4FYMA 1RCXB 4FHCA 4IIBA 1U1KA 4QIGA 2RHOA 5AQ1A 3ICLA 2K06A 2NO4A 2M98A 2PZAA 4AF6A 4ALKA 4TQAA 1HQUB 1ZJWA 3O8CA 1TYAE 2QRGA 4CEIA 2XYPB 2RB5A 4WFNQ 2RBEA 3NBMA 2EDAA 2DECA 3PJGA 3RJMB 1TKDA 1N5RA 3N74A 2LMIA 1QANA 5K0CA 4QRIA 3RVQA 1S9EA 2VPZB 3UYKA 4DL5A 2ILYA 4JYPA 1WMFA 3UMMA 3KK0A 1AQ6A 3MG9A 2A9QA 3VAHA 1ODCA 3ELHA 4EY4A 6PFKA 5A3SA 1ZXBA 2EBGA 1T9XA 1WELA 4PFKA 1VXOA 3Q87B 2BL4A 2MDTA 4EITA 4LIWA 1NJ5A 5FR2A 4J1NA 4PR3A 2COUA 1PGOA 2AKAB 5KUTA 1ODFA 1NYQA 2DP4E 1JMVA 4DQVA 4CLOA 4Q4AB 5BQOA 3DKRA 2P11A 3E9MA 3UWOA 4CMGA 2OHJA 2XM3A 1U2RA 4BDPA 3CW9A 5L3VA 2A5JA 4BL5A 2E9TA 2OEPA 3BWCA 1TVRB 4OHUA 5CB6A 3O5TB 1ZK3A 1DPGA 2H9IA 2EEYA 1HQUA 1HC7A 2XYPA 3ZJ4A 5CA0B 1IN7A 5BUSA 1MGPA 2JW5A 4X61A 1H73A 2WD9A 2JFQA 3TLZA 5EE9A 5EWJA 2QC3A 4BO5A 1FRVA 2HA2A 1QHFA 1T0IA 3HCCA 3CR3C 2R8YA 1X74A 1U7OA 4LDAA 4JJZA 1R4MB 2VJKA 4KXNA 4IFIA 1HNWB 3P9RA 4KL8S 1XERA 5HN0A 2VSYA 9LDTA 3Q8SB 1E3MA 1HNVA 5IBRA 1JMYA 2H51A 2H4JA 3UJAA 4CDGA 4ZYWA 2C5SA 3T7SA 2PA0A 3FUUA 3Q86A 5K01A 3CN9A 4UQPA 3USZA 3I4PA 3LT0A 2V3VA 1XN9A 4DLNA 2R751 3MS2A 4PFSA 2IQIA 2GSWA 5HAOA 4QR1A 4O6VA 1EE9A 5IVHA 1O08A 2IODA 2B36A 1FSSA 1Y63A 3GJQB 3QWPA 1XDWA 1SU7A 1RQLA 4LF7F 2PS1A 1HWKA 1Z0JA 4D41A 4ES1A 1P5FA 4RUCA 4C3UA 4WT7A 3UD3P 3QT5A 2ZI5A 3GJYA 3LL7A 3OKCA 1NT4A 4MWSA 2PMKA 2P6UA 3R5XA 4PG4A 2CFIA 5HIKA 2LA6A 1DUSA 4F04A 3N4WA 4ZQBA 1CR4A 3C1AA 1FXWA 1KI1A 3MD3A 4EG3A 4V0SA 1VJCA 2ZB7A 4LRYA 3UIEA 2F4VF 1HMVB 4RWXA 3ITNA 2A92A 4O4HB 2V1XA 3G1TA 1LW2A 1RDRA 1J5OB 4Q6BA 3PXGa 1EP4A 4TYQA 5B57C 3JALA 2FGJA 2BKVA 4I0WA 1SBCA 3BORA 4ICLA 4ROSA 3QU5A 2Z1MA 1QSSA 3FUTA 2ZSHA 1Z4OA 4DMCA 2EAUA 1SEVA 2DH8A 1JKJB 4V2IA 5DDQC 1NU4A 3NEKA 3NXZA 1Z75A 2O23A 2X4DA 5KX5A 2YDXA 3TVKA 4B3HA 2J7KA 2JHCA 4JXJA 4AP5A 3T6BA 5CFRA 4Q7JB 4TM8A 3PWKA 2ZT7A 2FUEA 1NWHA 4DAOA 2I7DA 1KU6A 4Y9DA 4PYIA 1Z4LA 4PX3A 2Z2IA 1JJIA 3W1YC 3MECB 2E1PA 3V81A 1T3TA 4JV5F 4V02A 5C1IA 5EKXA 2HBRB 3QGHA 1NQTA 3JQMA 1QQAA 3GIJA 1AW0A 1TVMA 1XN1A 1QYDA 4N12A 3G1UA 1S6PB 1GA6A 1KO7A 2BHLA 3OM9A 3A10A 5GGXA 1O2DA 3VC7A 1YH3A 5MFZA 1U7UA 1XPRA 1RWWB 2O7VA 3GLUA 1XWLA 1VSBA 3BH7B 1DDOA 1L3CA 2R62A 3JQ8A 4RBTA 2BGIA 2OL4A 1T05B 3ZPXA 2XQJA 5AR1A 3IVGA 3FCAA 1N0VC 2V4JB 4MJXA 3GLKA 2PUTA 4PHHA 1B93A 3WS7A 1F8YA 3I1YA 2WAOA 1II9A 5CBPA 2J0SD 3FWPA 2AYZA 4YEAA 4DW8A 3BBLA 2XZDB 5KS2A 1HT1E 5ETMA 4F36A 1P74A 1EDZA 3N2GA 5FXMA 1RYEA 3MJ4A 5CFZA 3VR0A 1P9QC 1ECFA 4LOIA 1YZHA 3N2EA 6GPBA 5I7UA 2YXNA 3ZZZA 3TYXA 4NYJR 3SQOA 2JLBA 1DZ5A 5ELXA 3MBIA 3Q40A 2M1ZA 5CXUA 4U00A 1TL5A 2AOUA 4B3CA 3HB0A 3AESA 2O3QA 2PX2A 2XTJA 1XZKA 4DA7A 2O07A 3N0WA 1FX1A 4U67Q 1Z2OX 3L06A 1I3NA 1N36J 2Z6AA 1NVVR 1L7PA 5KNLA 3ZHBA 3UK1A 3J80Y 5H5JA 1N2SA 2WZ1A 2ANBA 4XRGA 2PUDA 1T3OA 2HF7A 2H1SA 2ZOSA 2P90A 1RC8A 1SNYA 3Q8XB 3VHXB 4TY8B 4CM1A 2LCIA 4BB9A 5IFLA 4WRRA 2YZ7A 3DCJA 4LK3A 3HY3A 4CO4A 3T3HA 3AP1A 1P62B 4LQDA 4RESA 2XLBA 5CTJA 4ER0A 4F0MA 2H1WA 3PIOQ 4HUQA 2CL6X 4Y6IA 3QTBA 1YL6A 4KPUB 2XNCA 1RFLA 4LZJA 4FD3A 5F64A 3BRCA 4UMFA 5CA1F 1PAUB 1E7WA 5JWHA 1X7WB 2QE6A 1KORA 3NYWA 1MAVA 4KVFA 1IKXB 2XDQB 1BCRA 3RUDA 5B5SA 4LYHA 5GADU 4OATA 4TXJA 3EVZA 3ID6C 3FH0A 2J0QD 5EZYB 2QUJA 3ZWOA 5BMOA 1HE8B 3SHQA 3TLCA 4RGYA 4JYZA 5A6VA 5D0EA 4EO6A 3JAKA 5BW8A 1ONBA 3EXFB 1UJ6A 3U80A 4Q9AA 5FEUA 1BHQ1 3T3OA 3LP0B 2PK3A 1N48A 4JI4F 2V6FA 3H9UA 1O94C 3G8BA 1JXEA 3GB9A 3WWPA 1G4UR 3ZDZB 1JLCA 1H1LB 3FN4A 3UJ7A 4MMZB 4DLVA 3AW9A 1KYVA 3ZX4A 2UUAF 1LEOA 2DGUA 4DGQA 4OYIA 4B40A 4WP9A 4EL5A 4HNTA 4KPUA 2PO7A 3OTOB 4NBUA 3EE6A 3OC0A 1KH3A 1OYVA 1I2MA 2WP0A 2QTBA 1Z2NX 1KYIA 4CIAA 2NS1B 3FMWA 2RK6A 2A14A 5A9SA 5JC1A 3IQXA 3HNOA 5BV2P 2AF3C 2HCTA 5HBRA 1CUUA 1TVCA 5JAZA 4IR1A 2QVYX 3UDCA 1D2MA 3ITKA 1YFZA 4HP8A 3BGWA 3MAAB 4N4AA 5EHZA 1AKEA 3FCWA 1JYEA 3LLUA 2MJUA 2IYOA 2N3ZA 5KMGB 1UAYA 3DZFA 4NEYA 3AB3A 3AF0A 4HDNB 1F4VA 4BO3A 4JLOA 5LYJB 4DG9A 3A32A 3I28A 5HJ7A 1J9EA 3CYFA 1ZG3A 1WPGA 3DLGB 4I2VA 3JAWB 3N1UA 3DMFA 4CLYA 1GLVA 5EKDA 2CYCA 5THQA 2DITA 1PSWA 1E6LA 3NGMA 5C7LO 4HWOA 2I8CA 3UG6A 1M1XB 1RT2A 1RQ7A 5IDYA 1BOFA 1FVQA 2QYCA 3MOIA 1V26A 2FXIA 3W2WA 2WJPA 3W62A 4GSLA 4MQMA 4J3NA 1EWTA 4USUA 1W59A 4WZBB 4GZMA 1XEAA 3ODPA 4RVOA 3VF0B 3NUZA 2GF2A 1BN6A 2HO4A 1LQ2A 1IZYA 1EJ2A 1ZOOA 1ITPA 3UXEA 3TAPA 2PH7A 2QD5A 3K5OA 1ZKMA 2GJ8A 4F96A 1XZBA 4HZUA 5BSVA 3G71S 4USVA 4R81A 1UBGA 4UULA 3HHEA 4HVTA 3IERA 2W48A 2AMJA 2G9NA 4BJ1A 3NAGA 1RXOB 3AUSA 5I3PA 5JBNA 5ITVA 1OWMA 3ENZA 1IXZA 5ICGA 4HAZA 3Q8QB 3UNGC 4DPWA 3M6IA 1IG3A 1WOMA 2R8XA 4KIAA 3T9BA 1Z2LA 3MEGA 3AF4A 1DTQB 4YUZA 2WYUA 3EXHA 1T5HX 5M2UA 4R6WA 3KJNA 2XB2A 2BJ9A 4XCXA 4AY2A 3B2NA 4WE1B 3LAKA 2WSFC 1F4LA 3BRQA 3ZD9A 4RGQA 1IBRA 3D3NA 1CHNA 4UUMA 4GKJB 4RSMA 1L7XA 4DV4J 4Y6RA 1U81A 4FMCF 4QU0A 1PK8A 4EJ6A 2NPIA 4RUHA 4J49A 3C8YA 1L8LA 2I1WA 4QQ8A 4B2PA 2DUNA 1G66A 4II2A 4IF4A 2VXOA 2J07A 4AXBA 3HWRA 1U9JA 4QM7A 4NPAA 1QIFA 4WK6A 3SYRA 2X40A 4WUVA 1F5AA 1G8KA 4FGKA 4ZVFA 3T5GA 5DBOA 3NGUA 3TL6A 4CE6A 1R0YA 4B34A 2RBGA 3SIPA 2F8SA 1VI2A 1L4GA 5E95A 1RZRD 2ZKUA 2VPYA 1WB5A 1GAWA 3UFXA 4BQIA 1VE7A 3IUJA 2AW5A 3WTBA 1OX6A 4PQYA 2ET6A 4X41A 1UMDA 1C9KA 4ANFA 4XIUA 4DXDA 3MPUB 1EP9A 4D9JA 2OMEA 2XRFA 1Q83A 4WE1A 2QUZA 5F8IA 4OUDB 3HLTA 3KCNA 2WSBA 4WGFA 2VYNA 3IIEA 3C6TB 2Y0SD 4WOCA 2ASVA 3PNPA 5LZ4A 2AN1A 1M8PA 4KMMA 3SJCA 2BFOA 2AW3A 3KHSA 3WMEA 4R40A 3OO1A 1ZP6A 1G2EA 3S2GA 1OROA 4TTRA 3C8MA 4QSHA 4ZIRA 4OYRA 1D8ZA 4YXWA 3X1WA 3CSUA 4OBXA 2V6GA 5HF6A 1QAYA 4JK3A 4IGKA 3AF2A 2EU8A 2AGQA 3OCVA 1RJDA 3ZTRA 2B9YA 2PZLA 5JJ5A 3LF2A 1GD1O 1QK3A 3IR5A 3G2JA 2HNDA 1XBTA 3D4LA 2ZIXB 2OESA 1KDNA 1VOMA 2WVJA 4YN3B 2HV8A 1BQMB 3THSA 3IIKA 1WC4A 1FKAF 3GJSB 3COSA 1SK9A 3G5LA 1OXUA 1SCAA 2G82A 1WXGA 2W8BB 4O44A 4B8WA 1PO7A 4Z0HO 2Y3IA 3C3YA 1P29A 1EI9A 3LX8A 3K32A 1X38A 1N5QA 4MITA 1Y5IB 1F51E 2OCBA 4ZPWR 1ZJJA 2Q9BA 6AT1A 2NNLD 5CPBA 1NG9A 3AVOA 4U6QA 1D4ZA 2I9SA 3GL9A 1SHKA 2AJBA 3KRTA 1H72C 1SIBE 2FLNA 2ZRCA 2XLKA 1GU7A 5AQEA 2Q46A 4NRDA 4WWHA 5ER9A 3T5PA 1FS5A 4PTYA 4QXRA 1NMQA 1QIEA 1UR5A 4N7RA 2B82A 2CZGA 2DHEA 4XD2A 3TQIA 3WX0A 3W3AA 3Q8KA 4BEVA 2X0FA 4K6CA 5CT4A 1UBHS 3QEAZ 1U90A 1QM5A 1T9DA 5H70A 4ZVRB 2UXDF 1FP1D 1A5ZA 3HDSA 4H0NA 2Q6KA 3ACDA 1N7GA 1RSZA 4K4UA 2ZPAA 2IDKA 1P45A 4TS4A 2AC2A 3IBCB 2PAFA 4MULA 4LSWA 1NW9B 3JYLA 4IJKA 3BILA 1IXYA 1R50A 2QN9A 3QMPA 2FEMA 2EOAA 3EA5A 3ENKA 3OFSA 3TM5A 4O8ZA 4ANEA 3PCTA 3DZHA 1G5RA 3LWNA 4L3VA 1XDDA 3UAGA 2K87A 4ETXA 5FPPA 5CDSA 4FMPA 1ZAVA 4AE5A 1MJHA 2XMZA 3M1LA 1BO6A 4NRUA 3LQYA 5B36A 2F4NA 3V2HA 1WKVA 2XT0A 3GH3A 4MKZA 5EWEA 4RS4A 1FWKA 1Q1AA 3D8HA 4DPYA 1S02A 5LXTB 2A6OA 1ACLA 2Z8XA 2VFVA 3ZDXB 3AV3A 2CJWA 4LMAA 2F3QA 4L72B 3DRSB 1GKIA 1U2SA 2HLTA 2IOFA 5CHCB 4D9GA 5H9FK 3CX7A 2BJ3A 1ULUA 2FHSA 2TYSB 3SR4A 1BMQB 4LSLA 3AF3A 3TVZA 4D3HA 2OP0A 1HQDA 4FFDA 1UK8A 1CUEA 1M2EA 4XR4A 4CEHB 3GBSA 1AGRA 3C7AA 4DR4B 3W2IA 2D00A 3VNVA 3PI6A 2O1XA 3UAYA 3FTPA 3TUIC 1DXQA 1WORA 4KIUA 2YW9A 3UTDA 3KYBA 3R75A 2BM1A 4EY3A 2EGUA 3ETOA 4B4WA 2C0QA 2QRVA 1RT3B 3NNNA 2ZJOA 4OJKA 5JZBA 2W2OA 3I1JA 3A2KA 2HWXA 3JSMB 3L5OA 4UY85 3BD8A 2VA9A 3HCOA 1WZUA 4DQDA 1E6UA 2WD7B 4MGZR 1TF7A 1NRXA 2XIQA 2XHZA 2RGRA 2XW6A 4DR5J 1LLQA 1BD4A 1GQOA 2X0EA 4FK8A 2F64A 3D54A 4GI5A 1QAJA 2HQIA 4IHJF 1BA3A 1K27A 3QVUA 2JVJA 1AB6A 1FYDA 3A6HA 2KYXA 1G7TA 2L9NA 2MSCB 4AUEA 2QT1A 3ZV3A 1DKUA 1R9NA 4JX8A 3B70A 4NZ0A 1PX2A 2Y0BB 4KGVB 3KLEB 4DL4A 4R9VA 3GJTB 1IY0A 4GZ3A 4ATNA 4EZEA 4O3PA 3AVUA 4JVSB 1NJFA 1V3UA 2WM9B 3PPIA 4AW9A 3T95A 3TA1A 4H6XA 3MJSA 1NJZA 4P7GA 3AVPA 5EJ9A 4KQEA 3VMFA 3DYAB 4GWGA 2OLKA 4AO7A 4MGHA 2ANCA 4HQRA 1WF6A 3MAGA 3KK2B 2NT3A 2CLFB 3QPBA 2P68A 1JN0A 3ANXA 1N2EA 5DDOC 4AL7A 2HW3A 1EK0A 2R4FA 4HHJA 2QT9A 3O8OA 2WK1A 3BGLA 1XQ6A 1Z13A 2V68A 5TMPA 3QFCA 1WHVA 3GEBA 5CM2Z 3HHKA 1JLGA 2EEZA 4UVDA 1E2DA 5C8XA 3PFBA 2QZJA 1RAEB 4DHWA 5KWSA 1DTSA 2XXAA 3NPMA 2AEMA 2RCYA 1R0RE 2XAUA 4HTFB 2Y0BA 3B9PA 2VOEA 4XQEA 5BYJA 4BB0A 1WC6A 1T7PA 3OLQA 3C3DA 1PFUA 1KO5A 2CJFA 1KPIA 2HSWA 1PT9A 1GPBA 2I4RA 3TIGA 4OH7A 2PYZA 5FULA 1XHFA 1G6Q1 4F9TA 4B76A 3CCJS 2AZXA 4M8KA 4B9NA 2BFEB 1RWQA 2WG2A 3ZWDA 3GNSA 1FRKA 2MKHA 3DFEA 4MWOA 5A2QU 1PNRA 5C1BA 3JXOA 5JFGA 1LC3A 3N58A 3IHWA 4S1TA 5K8UA 2JC1A 1GADO 1JT2A 4LBYA 3II6X 4V38A 4XX0B 3DMNA 3A3YA 1P1HA 3Q8YA 1V16A 4M63A 1E7MA 2PWYA 4URSA 2OCXA 3QEMA 2Y67A 2RUGA 1PR1A 1ZR4A 1O77A 2D0IA 3EPPA 2RU9A 4M76B 1ONPA 3GXOA 3LPMA 2J7PA 2B7CB 2HJ9A 2QU8A 4I2QB 3JQAB 1F2DA 4G6ZA 3UENA 4OHWA 5KFAA 1KQFA 2X2PA 3KDNA 4F4XA 4KH1B 4OQJA 3M1IA 4CLWA 3EGDB 5BWNA 4GVBB 2EP8A 3BF4A 2H4YA 4FNOA 2OGZA 4AMYA 3WAKA 1NQAO 4QFBA 4MVWA 3OO0A 1HTWA 4L50A 4JI0J 2LXFA 4U7PB 4QASA 2V9CA 4C11A 3LUFA 1AXGA 1XC9A 3WK6A 1VLHA 4HG2A 2FOIA 2QUIA 5AUQA 1Z12A 2LDYA 3SQMA 3Q2IA 4XXHA 4XX0A 1ULHA 3B78A 2G4LA 1D2HA 4YXFA 3S1AB 1RSCA 1LXNA 4NOKA 2YRWA 1Q22A 4QNMA 2KDOA 1JR2A 2QRZA 3A25A 2JRSA 2Z5GA 1DDGA 3M49A 4Q1EA 3FYCA 1LPSA 4HTJA 1E79A 3M4JA 3UHAA 2B4AA 3R76A 4QAJA 1CUGA 3M2RA 3AETA 3H2LA 3G0OA 3R3VA 4FB4A 4MQFB 5JJIA 1A1SA 2G5CA 4M6WA 2EHDA 5DLYA 3IQFA 1VE6A 4EO4A 1VPTA 4A6DA 4YAFA 4XCQA 2PFGA 2JLEA 4AJJA 4EAQA 2W2NP 4XGKA 1A9QA 1LOUA 3VPFA 2A9KA 3PRHA 1QE1A 4KXLA 4MR9B 3VQTA 4L2IB 1M1KT 4XKJA 5SYNA 4BU0A 4USJC 1NU8A 4QFMA 3VH1A 4BOYA 4MWDA 3E58A 4R2WA 3WKBA 4E15A 4DBLE 2DTJA 1JFVA 4OAPA 1YFKA 4EFMA 2YWHA 1XRSB 4JCCA 1BWRA 3WE7A 2XQKA 5M29A 1MHTA 4MQ4A 2DGTA 3ZCPA 3FHTA 1UK9A 4KDFA 3A6EA 3VTFA 2NVUB 1Q44A 2V5HG 4QICA 3SMZA 3Q4GA 2XVYA 4ZVHA 2R5WA 3G82B 3R1HA 1PGJA 2PT7A 2IHNA 4WY2A 1ZJ6A 4QDJA 1CQPA 4F46A 5IMBA 4CIYA 4PXBA 2ZHBA 1NMSA 2FMKA 2F1JA 4B4OA 2I6UA 4ND2A 4A4DA 5G40A 4ZHQF 2ABWA 3RUEA 2Z5FA 1X87A 2O20A 1T6XA 4JI7J 3LDUA 4LTDA 1JQ5A 2YMMA 3IQGX 3QPCA 3Q3GE 3C8UA 2KG0A 2YPYA 2A30A 3A1DA 1IJEB 2MSEB 5TPZA 5E1OA 1YO6A 2HHHB 4PQUA 4E30A 4B2LA 4DVGA 3LXUX 3EXHC 5CRIA 2DT5A 2XUKA 4AX8A 2IP2A 3L7KA 4MS1A 4F38A 3D2LA 1MMDA 3PCXA 1YZTA 4Z8XA 4A15A 3ZJ5A 4TNOA 3H1PA 3MJDA 4NE9A 4CH0S 1IHYA 3INRA 4K9SA 2IHYA 5G1PA 4Y0VA 4X4VA 4B43A 4BU1A 1E2JA 2JFVA 1GN9A 1QUFA 3P0FA 3ZK8A 2PA3A 4M60A 4UCWA 3JTOA 4KBIA 4WK1A 4YQZA 1FBTA 3CJKA 2P3SA 1N3BA 1R6TA 4WFZA 1E6MA 2C4HA 3AUTA 3MM4A 3ZZPA 3CKKA 1Q1ZA 1YS7A 2ZJQQ 3TZCA 3SLKA 4G5HA 3B5IA 2PRSA 4MH0R 1MC1A 3WGOA 1HT3A 3C97A 1EVQA 4TKLA 3H20A 3I72A 2BZGA 2ZANA 1LWEA 1QVAA 2SCUA 2FE4A 3D6FB 3DWGA 5ALMA 5AJXA 4S3MA 1WUTA 2Q3MA 1BDJA 4TWAA 2ROEA 4IQGA 3G0BA 1LDBA 4BJ6A 2V4QA 4O4LF 4HB0A 2ZHAA 1L4KA 2KU7A 1G42A 2BT4A 2FEWB 3CFYA 4B48A 3IGFA 4GLJA 4ARBA 2XMUA 1P1IA 3RRKA 1MO3A 4M21A 2OMLA 2AMFA 5CYJA 1VQNS 2R60A 3ASVA 3QLTA 3RAJA 2HK3A 1Q5VA 2Q27A 3E9CA 2JX2A 2GTHA 3TEHB 2ZTUA 1TA4A 3C3BA 1C0KA 1JNRB 4JNKA 5LDHA 1RZVA 2JFXA 4WBNA 3L9ZA 1U0BB 3IAS9 3TW6A 4OJQA 4ZO8A 3NAZA 1Z4KA 2I76A 4ENWA 2B34A 4U6SA 2OO4A 3KO8A 4BE9A 1R0WA 3RU0A 4F3RA 2UYGA 2QIOA 4KN6A 3CF0A 4BVFA 4MGIR 3C6ZA 2BBEA 4JYAF 5KTSA 1ZICA 2QMYA 1XZFA 2WF7A 3KWJA 3K9QO 4I5IA 2JKZA 5FD8A 3DE6X 1ZMXA 5K99A 3SY8A 3GZNA 4YI5A 4OV6A 1Y4ZA 2ARKA 1LFWA 2EVZA 1IZ8A 3H2UB 1YK9A 5K8MA 3BX1A 2BHRA 4JAVC 4UCXA 6NULA 2PUEA 1YSCA 2GD6A 2ACYA 1H8ED 4OU4A 1HLPA 4BLVA 1EINA 3ITEA 1WS6A 3T38A 1TIKA 1OTXA 4AD8A 3VU3A 4DR3B 4DI6A 2ZH3A 4ZVKA 1U8EA 5HROB 1XN4A 4JBWA 3KYCB 5FFNA 3L04A 1FYXA 3UMFA 2A1TS 1HEIA 1D0VA 3UAXA 3LGNA 3LT1A 1A5BB 2I54A 3BE6A 3RKUA 1U4NA 3NJ4A 4Y6GB 1AE1A 5B09A 2HMYB 5FQOA 4C6TA 2NYIA 2ZM6F 2I8EA 2AUTA 5GONF 3M5PA 2JDIA 1B6RA 1Z6PA 2VDJA 1MB9A 1VKOA 4JS0A 3EG9A 4HR7A 1I4EB 1ESNA 3ZVNA 3GUVA 1N8KA 5LQRA 3VKGA 5J1TB 4A1FA 4RNFA 4YV7A 2WNHA 1OR8A 3LX4A 2B6AA 4RR5A 4X7BA 2K1RA 2HGZA 3GXBA 4PM4A 1EK2A 3LQ4A 2R8ZA 3E4DA 4JHLA 3VR6D 2IPXA 3RYIB 3SBDA 1GG9A 5BYKA 1X1CA 1RKJA 1VL6A 4D3ZA 2PL9A 1XZEA 4J37A 5HKBA 1S12A 3CRZA 3A8KA 1RLIA 3CJRA 5I3QA 5HROA 2R1TB 1VQ7S 4PEOA 4FKZA 4LZPA 4YJGB 1Q6ZA 3BAFA 4Z53A 1FUKA 1QBKC 1NDCA 1UBSB 3HCEA 1T8PA 4QQRA 3NHRA 3PFWO 4N0DA 2Z4RA 1TMOA 5BV7A 5L51A 2C9OA 2FVYA 5DHQA 3Q88A 4IM7A 3ITHA 5BSUA 4LVNA 1L7DA 4J91A 3LLVA 1T8YA 1NVDA 5CAEB 2R85A 2VB6A 4Y65A 3ZE1B 2ZJ3A 2P9QA 3AI7A 3CZ9A 4DIEA 1ZK0A 3F46A 1M1HA 3DT6A 4HWTA 4DLAA 5EE1A 3FGPA 3LBAA 1S4FA 1R18A 2VT3A 4IDHA 3FM9A 5HIAA 5ESDA 3D02A 5HFNA 3LAWA 1H6BA 2FTKE 4CTOA 4L9WA 5DYWA 3RYIA 1N9KA 2FWNA 1BYUA 4D6XA 4D6YA 2XZWA 4ZQFA 5ADZA 1FTCA 5CXTA 2ZWMA 4TUYF 1OHHD 2HFNA 4HFNA 3DTYA 1EBBA 2FLWA 2P6OA 3TOXA 3CF5Q 3CZ4A 4ESVA 2CNKA 3Q9NA 1S1UB 2GAAA 3T35A 1RWMA 4LUCA 4WZZA 3PFEA 3M1VB 1JJBA 2PH1A 1S7CA 4I9HA 2MJLA 2JFBA 3BV8A 2NTNA 1ZGAA 4FJ0A 3FETA 3GLGB 3VVTA 3UV3A 2PFFB 2MOKA 3QWHA 3C6UA 1HOTA 4LC9A 2NYVA 2BFWA 4WINA 5DLPA 3T5CA 1U6ZA 4HI0E 3OI7A 2Z2YB 2IM1A 4RW7B 2TS1A 4OLBA 3T19A 3EPIA 1QHSA 3RABA 4F4ZA 4V1CB 2E5LJ 1M34A 3U26A 4I4BA 4A23A 4ZPAA 3FZNA 5FLXU 3VR1A 3HCXA 5IN4A 4CLTA 1FNOA 1NQXA 5DOZA 3WRWA 3RARA 3F7OA 2X5JO 3HKEB 1ST3A 4CLFA 4CT8A 4UTGA 5BWLA 9RUBA 3TQOA 3U19A 1ZBTA 2VQSA 2EL7A 4NMXA 3G2KA 1OSDA 5IWAB 5H83A 3E9YA 3PNYA 3NHAA 2H1RA 4QLAA 4LZWA 2QS9A 4C89A 4ARCA 4CIBA 3OXFA 2ZJ0A 5ITHA 5C5DA 3RRJA 4WJZA 3LY8A 4DL6A 1OY1A 4ECYA 4BQPA 1HBNA 3GJ3A 5KOYA 3FK4A 3QOXA 5EXDA 2O3TA 1EX6A 3DVAA 3HJHA 1XFDA 2A1IA 1OYOA 1ZA2A 3H4DA 2VICA 3KX2A 1OH5A 1L3KA 5AYVA 5K0EA 2Z58A 3KJZA 5FRDA 5G3YA 2Q66A 5A5GA 5GAJA 3KVVA 4W5JA 3CHYA 3MCSA 2B7BA 3DHXA 1VKJA 1OZFA 3SSSA 2W11A 1ULAA 1ZUD1 2Y1WA 3GONA 1DBRA 4U2KA 1QJHA 4BV8A 4W5RA 4GKBA 3DVLA 3A6JA 2BVZA 4BMYA 3T5DA 6CHYA 3GF4A 1XZDA 5FI5A 4GEKA 3X1JA 2O5CA 4C01A 3I9LA 3U60B 3KTAB 4KO0B 1AKVA 4IR7A 1GSHA 3MUFA 1EFAA 5FOVA 3U7IA 3V1TC 4MDEA 1H2BA 1X39A 4U5XA 4ILMA 2DNZA 4L4RA 3OUYB 4CTNA 5D3MB 3WNZA 4MZDA 3PITA 4M89A 1NDQA 2FN3A 2AQIA 1Z73A 3PYXA 4IH4A 4DR2B 1H2TZ 5CB0A 3WRVA 3KQHA 2YWJA 2JZNA 2ZKLA 5L46A 5D3ZA 3ROXA 1ELOA 5DDIP 1AKNA 4Y2XA 1JALA 1NJYA 1UJMA 4JMPA 4Y9UA 4AD6A 1TKXA 3DFIA 4DLZA 2X5NA 5HJ2A 4ZGGA 2PSZA 3M9NB 2R3SA 3VSCA 2WM2A 1QXSA 3PF8A 1TUGB 2CKMA 3WHKA 1WVMA 3EQ9A 5FTKA 1A69A 3TYTA 2DOKA 3WNCA 3IH5A 2CHQA 2CWDA 3R3ZA 5EIAA 4CF3A 4ILRA 1HF3A 4BNIA 2HPUA 3PVZA 3H8SA 2MSSA 3DOLB 3EGXB 1XNRB 1C7ZA 2IZ0A 4BV2A 2U1AA 1O6XA 4RYDA 4IIGA 4C4RA 3CMCO 1EZZA 3RYCB 1R7RA 4R84A 1JB1A 1JNXX 4W1PA 3ORRA 1UM8A 4MMOA 5ULLA 4D7AA 1J8FA 2DBRA 1R0ZA 2YX1A 4V03A 1R66A 4F6CA 2MQLA 4YRZA 4XVQA 2MINA 1MX1A 4OM7A 1WG8A 3TLMA 3NTUA 3BRSA 3QLVA 3CTMA 1F3FA 4N56A 1LJ8A 4B3SJ 1TCCA 5DNAA 3QMQA 1Y8CA 1HWLA 3PE6A 3T7JA 7YASA 2B4UA 1N2OA 4Y2AA 5BSEA 1QCCA 4PZEA 2DHGA 5GAGI 2EQBA 4YHBA 2QL9B 1Z7WA 2DBZA 3TZXA 3EBLA 4B31A 4DSZA 4KR0A 2DUMA 4BTEA 1M73E 1QE5A 2AT1A 3NWEA 4JY7A 2QWXA 2YKNA 3EGXA 3VR4H 3FDSA 1IY9A 5D8DA 3UOWA 2QTFA 3ESDA 2XOKA 1NKVA 2RC5A 4IYJA 2FX5A 2OUGA 5HO4A 3LAMA 5G02A 2R6R1 2NUHA 3IOMA 1U63A 2R5FA 2CLMB 1VLMA 3G2XA 2A9FA 4KWHA 1BA2A 5BYAA 2XMBA 1KI4A 2G5GX 1RQ0A 2KJWA 4WLNA 2J1LA 2WLTA 2B4QA 4F25A 3EXYA 1D1SA 1EUDB 3DBVO 3M6XA 3Q85A 5BR8B 2WVHA 4DCPB 3CXCR 1PR4A 4RNCA 1VIYA 1TL1A 2KE5A 2RKWA 2XUOA 2E1MC 5HF8A 1ZS9A 2J48A 4BMZA 3KWMA 3TTWA 4KI0A 5CVDA 4GO7X 3F6EX 5JDIA 3ESXA 1FFWB 4R7GA 3HCRA 2I55A 1W0JA 4BGVA 2NSJA 4G56A 3WLLA 3DL0A 4FW8A 3DE1X 2O05A 2A9RA 4DOZA 4C76A 1W9MA 5L8VA 5EPEA 4DUYB 4RU1A 2MSTA 4I6JA 3AUUA 2J30A 3KAQA 1T8WA 4XDGA 4L76A 1TI7A 3N2KA 4M99A 2HRTA 2SKCA 3PUIA 1SUBA 2KZMA 2HHCA 3D3WB 2WJIA 2Z8QA 2FZLA 1FA9A 1AQLA 1YU9A 3LUJA 3TLXA 4MYHA 2LKDA 4TV9B 4INZA 2UZ1B 1JJCB 2JI4A 3BSAA 5K14A 4CM6A 3IP5A 5CYFA 1FQOA 1Z7YA 3A1CA 5G53C 4DQQA 3L18A 5J9FA 4JZYA 1BS2A 4RW9B 1HA3A 3X1DA 4AMVA 3CLSC 3LLSA 2Y9MB 3D6UA 4NE9C 1AS0A 2RHWA 1G20A 4MK7A 2EFYA 1KY5A 1NB2A 1H3FA 2Y1EA 1ENZA 2VPTA 4ZZ0A 3IEPA 2ZIGA 3M2VB 2L9DA 2ZJ6A 3KJQB 2PU5A 4D4HA 4WI1A 2CF5A 2GWHA 3M4NA 2I22A 1XZJA 4GLBA 1P4SA 1IM2A 1GK8A 5SUHA 3FDZA 5A4DA 2FZ5A 1XQYA 1ZLYA 4E46A 2YNMA 4S12A 2FFHA 1U1PA 3E27A 4IPTA 3DQQA 2QA2A 2NTEA 1FTRA 1S9HA 4JA2A 2X1MA 5EMJA 2RIJA 3WIBA 1KHWA 1BXKA 1HYHA 4IYRA 3KOOA 2NSBA 5KWIA 2QRLA 1F20A 4DV6J 2WSLA 2IYFA 1XIVA 5KU7A 1N78A 2DMRA 1MROA 2WPNA 1FLVA 2BEUA 1RAFA 1FUIA 1DX9A 4QR0A 3U7GA 1DUVG 4TROA 2OTCA 4AWXA 2BMDA 3CLUC 1ECGA 2BPOA 1RPAA 1SC6A 2DX7A 2XWPA 3TD9A 3W2TA 2HF8A 3HVKA 4W5HA 1CYDA 3KJQA 5KYYB 2BGRA 4UD2A 3R3JA 1JIJA 5C18A 4DV5J 2RDJA 1R0SA 4UDYX 2A57A 4RJVA 3EIUA 2PSDA 1DKRA 2VWPA 3FOEC 1J5PA 4PO1A 4L51A 4RMHA 4F91B 4WFAQ 5CM8B 5JIBA 5DKFA 4JDUA 1U7LA 5IYZF 1DL5A 4LYFA 2P65A 4NZ9A 1KC8T 1WD7A 3LD9A 4LPKA 1AC5A 1AUOA 2FLPA 3EXEA 3ZHZA 3HSSA 5CYQA 4Q4JB 2HBZB 2CT8A 1DRUA 2FW9A 3TXXA 4ECSA 3ZVKA 4AECA 1M2OB 1OTYA 3GG0A 2JLAA 5IQQA 4IO1A 4WFBQ 2V7PA 3LHSA 2ENUA 1R6BX 3BIWA 5F0WA 4K81B 3OSNA 5C8DA 1X7HA 2J9XB 2ZBVA 3ESRA 3WGTA 2E9ZA 3KLNA 2YIJA 4JEMA 1D9ZA 1V37A 4WFQA 4MPJA 2J33A 4BDTA 1MJNA 4C20A 2X41A 3RJMA 5AVQA 4BRWA 4ZT4A 4BPBA 5KYYA 4XARA 3OSUA 4L85A 5FUVA 4DRZA 2VPZA 4GX0A 2H2DA 4EUNA 4IV8A 1Z26A 2IV7A 1NK0A 4H7HA 4TXNA 5D86A 3TJ9A 1Y4AE 4M8LA 1V47A 3EAGA 5H0IA 1VMAA 5F4ZA 4DJ5X 4ZPBA 2IMWP 10MHA 2ISQA 1BKSB 2C4KA 3I9NA 2XMTA 5AESA 1QYIA 1TLTA 4DXAA 4XJTA 1V7CA 2G4VA 3QWIA 5L8RC 3KWLA 3F6RA 4Q4AA 3AHFA 1QU3A 3K5HA 3KB6A 3IOCA 3L8YA 2YWBA 4OXKA 4I50B 1ZIYA 3L8EA 4XDCA 5B64A 1TVRA 1W88B 3VRHA 3TOVA 4LWZA 4IUBS 5CURA 5L9NA 5AVKA 1YDFA 4HNHA 5A8KB 3STWA 5EJIA 3MAHA 1PSZA 5CA0A 5MF6A 1SXHA 2I4LA 2L3MA 4C0BA 3M70A 4UE6A 1EB8A 2VF4X 3CVOA 4DBVO 3EWSA 1KMIY 4ZI7F 3OHPA 5E1DA 2I7TA 3M6LA 4HDAA 2P3LA 4TQUS 3PKIA 1R4MA 1RHUB 4ZO9A 3IP6A 2J5BA 4TSRA 1MO4A 1EFRA 2H59A 4O0MA 3GLHE 3W9JA 2Q7DA 2KH9A 2BJHA 1IEQA 5B55A 4R1UA 1U9YA 5HX7A 3CT6A 3TJAA 5C35A 4K9QA 4CETA 3BC1A 1D1QA 1R88A 4LKRA 4MW6A 1DLOB 3D28A 4WX2B 1XVVA 3FR8A 4KPFC 3OOJA 1ZUIA 1NT2A 2H0QA 3K5NA 3TP2A 5LDDC 2WD8A 2AG8A 1SH3A 3BFPA 4HQ6A 3I2GA 3MFQA 4O2LA 3ZHOA 3TIVA 3M8PB 4E5PA 5A8KA 4BKMA 1A97A 3D64A 1LDNA 3R97A 4IH7A 3GJQA 1VOTA 3KFWX 1NUAA 4FI3C 1EVIA 5J2UB 1WG4A 1QH8B 1J6UA 2LCWA 1C7IA 4ZMSA 2Y1LB 3GEIA 2GYUA 5ELMA 6FDRA 1IIBA 4L4UA 3ELBA 4Q3CA 4KHPJ 1E32A 3RU2A 2QB5A 2IZ7A 2RK3A 1PEYA 1NURA 1C2TA 3MTKA 4OD0A 2R7OA 4G1UC 1HMVA 7AT1B 4O4HA 3U7QB 2IJGX 3C15B