3N15A

Crystal stricture of e145q chitinase in complex with nag from bacillus cereus nctu2
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
326
structure length
326
Chain Sequence
LGSKLLVGYWHNFDNGTGIIKLKDVSPKWDVINVSFGETGGDRSTVEFSPVYGTDADFKSDISYLKSKGKKVVLSIGGQNGVVLLPDNAAKDRFINSIQSLIDKYGFDGIDIDLQSGIYLNGNDTNFKNPTTPQIVNLISAIRTISDHYGPDFLLSMAPETAYVQGGYSAYGSIWGAYLPIIYGVKDKLTYIHVQHYNAGSGIGMDGNNYNQGTADYEVAMADMLLHGFPVGGNANNIFPALRSDQVMIGLPAAPAAAPSGGYISPTEMKKALNYIIKGVPFGGKYKLSNQSGYPAFRGLMSWSINWDAKNNFEFSNNYRTYFDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase A
publication title Crystal structures of bacillus cereus NCTU2 chitinase complexes with chitooligomers reveal novel substrate binding for catalysis: a chitinase without chitin-binding and insertion domains
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 115
structure length 326
sequence length 326
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n15A00
4U5IA 1LWJA 4QP0A 4HA4A 3VDBA 2W92A 3BXWA 1OBAA 4UQEA 3GNPA 3L4ZA 4P8XA 3AIWA 4P7RA 1KFWA 1JIBA 4JAWA 1HJQA 1BVZA 5DT7A 3RILA 1A3HA 1CGVA 3ZT6A 4MPKA 1JYWA 4B3LA 1RH9A 4WJXA 1HF6A 3MU7A 2O92A 5C70A 1TE1A 1PPIA 4YN5A 5A2AA 4WF7A 1UQYA 3UERA 5A8QA 1HX0A 4PTXA 1UYQA 2YL8A 3W25A 3OGSA 2VRKA 2DQXA 1GOKA 1W9PA 3AS1A 1V3JA 5BROA 3W82A 2O9TA 2XGIA 5CSUA 1Q4NX 2GJRA 4LYRA 1LLOA 1UOKA 4J3UA 5BXTA 3FN9A 2BY3A 2E40A 1PX8A 4AZCA 1V6VA 3WBEA 3VINA 1KBBA 2XG9A 1JXKA 2FHCA 2XWDA 2YA2A 2XSAA 3MUIA 3BAIA 3AMDA 4YHGA 4Z2LA 5A95A 3WD1A 4PTVA 3MMUA 2D3LA 2WMHA 3ARRA 1H4PA 1VBUA 3OA5A 1BGGA 1BLIA 3ZR6A 1KWGA 3L2LA 2F8QA 1TUXA 1EOKA 1ODUA 4AY1A 3WH5A 4S3KA 5CGTA 4FLQA 2XUCA 3VUPA 1B9ZA 5FCZA 2C7FA 1W32A 1G5AA 2CBIA 4U33A 1R85A 1XRVA 3F5JA 1JF6A 1UG6A 3ARZA 2VR5A 4W88A 4OIFA 4D6FA 3WL1A 4M80A 1CGWA 2WW5A 2J7BA 1R86A 2BFGA 1H0IA 2E4TA 3GXFA 2JF7A 2YOCA 4Q7NA 1V0KA 4AIEA 5EBAA 4PYSA 1GOWA 1L8NA 3UR7A 3QR3A 1F4HA 4DWSD 1NWTA 4PMXA 4UQ9A 6A3HA 4H7VA 4DM2A 3TTSA 4FLRA 4QCEA 1J01A 1JDAA 3FW6A 4E4PA 2BHZA 3WSUA 4W7UA 1WNOA 1CGTA 3AFBA 2XVPA 3ZJ6A 3VMNA 4UFIA 2BV9A 4KGJA 1GQJA 2WPGA 1MQPA 2QMJA 3AROA 3OGRA 4KRUA 3VIGA 3WDRA 2RGLA 2WHMA 1WPCA 4UQBA 1EO5A 1E6QM 7A3HA 3WQ5A 1GHSA 4D6CA 2BVDA 3OZPA 3KL5A 4BQ4A 4B9ZA 5TD4A 5I5RA 1XH1A 1R8LA 3SCWA 4ATWA 1J18A 5BWFA 4AZ5A 4F9DA 4UOQA 3VM5A 1B3XA 2A3EA 2WWDA 3EMZA 4D6DA 1AMYA 2YA0A 3D3AA 1HT6A 4PMYA 3VNYA 2EBNA 1VFOA 1B1YA 3BGAA 2J7HA 3S6TA 2VI0A 3WH9A 2CERA 1UA3A 4DWSC 4DUVA 3L2MA 4HU8A 2QPSA 1JAKA 4D6HA 4C7DA 1UD2A 1KQYA 2F2HA 2VRQA 4JFUA 1ZBKA 3SUVA 1UH2A 1GNXA 1BYBA 5C8BB 1OT2A 4AZCB 5A8NA 9CGTA 4U5KA 3A3HA 3ARUA 1HKMA 3W81A 3THDA 1ZBVA 3T08A 4V27A 1E71M 4J7RA 4W85A 1XCWA 4R5EA 4Z2HA 2G3MA 1TR1A 3W24A 4GQRA 3WD2A 1UWQA 1GVYA 1HNYA 5E9AA 1NQ6A 4OZOA 5A2CA 3UG4A 3PZTA 2ZUNA 4XX6A 2DH2A 3WMCA 1CBGA 5DO8A 2JEQA 2J75A 5ABFA 1KR0A 2VL4A 2D20A 4JL1A 1ZS2A 3GNRA 3UETA 3MV11 1E4LA 4M29A 3EDDA 1UR8A 2WWCA 4MB4A 2TAAA 3MMDA 1UWRA 3K8KA 2BVYA 4H8VA 1VF8A 4BQ2A 3MS8A 1U33A 2D1ZA 2J77A 1UD6A 3ZM8A 1QNQA 4QAWA 4EE9A 5HPOA 1CLVA 3CUHA 3GZAA 2JEPA 3W6MA 3KZSA 1UKTA 4GZJA 5E09A 1X6LA 2JF6A 2VCAA 1EHNA 3PZQA 5LYRA 3WF3A 1M04A 4GO9A 1OGGA 5FIPA 2WHKA 1ZBCA 2GUYA 2ZUSA 1VAHA 2W5FA 3AIEA 2DSUA 3U5YA 3EDKA 3ARTA 2JE8A 4AZ6A 2VURA 1VJZA 1B90A 3CMJA 1LL7A 2WMKA 2WZEA 3EMCA 3OGVA 4X9YA 2F61A 3AXIA 2EXOA 3VTRA 1W3LA 1TG7A 1EDGA 2B31A 1CXLA 1U30A 2J7FA 2YL5A 4PN2A 1ZJBA 1JZ2A 3N15A 4U2ZA 5AY7A 2YBTA 2OSWA 1QNRA 2D23A 1HVQA 3M6DA 2E0PA 4EK7A 1GUVA 3ARVA 1KGWA 1ODZA 1XYFA 2GVYA 2WCAA 1EH9A 4JFTA 5A6SA 4JFVA 1GVIA 2IUZA 3AIRA 1E5NA 5CPSA 4W5ZA 1UD3A 4XV0A 3VGFA 1NWRA 2PWHA 4GO8A 5LA2A 4PMQA 5BXSA 3AMGA 1W9BM 3VD5A 4L4OA 5M3WA 1XC6A 1H41A 3II1A 4EKJA 4TX6A 3AXHA 1E0WA 2ZX5A 2CKSA 3N9KA 2J62A 3GDBA 1KCLA 3EYPA 4KWUA 3BC9A 1GQKA 2CYGA 4WK9A 1XSIA 4WSKA 1EQCA 2CETA 1M53A 1VENA 1TFVA 4ACZA 4OUEA 3ARYA 1UKOA 3WL0A 5HDRA 2XFRA 8A3HA 2DSKA 3WD4A 3ARXA 3AOFA 1J12A 1N82A 3NSXA 4HMDA 1TA3A 1SMDA 4RE4A 5CQ1A 2FGZA 5EMYA 4AD0A 5LA1A 4D72A 4ZE4A 2ZX7A 4U2YA 3GYCA 1LG1A 4J3SA 1DP0A 1E3XA 2YDRA 2WVVA 4PMRA 4MAZA 2EPMX 4JCLA 2CXGA 1UWUA 4UQDA 4H8UA 5ABFB 4ATDA 3WD0A 8CGTA 4A3HA 2WBGA 3BH4A 1E6ZA 2OWCA 4JFSA 2X09A 5CPTA 1DWAM 3U7VA 5CGMA 3IK2A 3BAYA 2PF0A 3WDPP 4TVUA 3G6MA 1KWKA 2ZXBA 4TX8A 4JIEA 2G3JA 1TZ7A 5A6JA 4ML4A 4MADA 4CCEA 4HP5A 2G4FA 2VOTA 2OLHA 4PMUA 1K6AA 3CZ8A 2E9MA 1K9TA 4B15A 1CNVA 3HJEA 3SCOA 1KXTA 1V6UA 3O9NA 1AQ0A 4GZEA 4J3TA 1GQLA 4W93A 2UY2A 3WUEA 3QHMA 1ZB5A 2VMFA 3ZJKA 2XIBA 3CIVA 2GJPA 3I3BA 2OYKA 4PBGA 3CGTA 3N04A 3ZT7A 5A94A 4AZGA 2O9OA 3UCQA 4MB3A 1Q6EA 1E55A 3PZGA 2QMKA 4AIOA 2D0GA 2PB1A 1J0KA 1V6YA 2WZIA 2XVNA 2DPEA 2XVGA 1V08A 3WUBA 1DWJM 1JF5A 1NP2A 5CLTA 3WQWA 3A4WA 2VQTA 4P7LA 3WUFA 4IISA 2ZX6A 3WFZA 4FK9A 3OBAA 4E2OA 1CGUA 3W26A 1C8YA 2CITA 4MB1A 1W2VA 4CD4A 1G94A 2XVKA 1B2YA 5CZKA 1GOMA 4WKFA 3TP4A 3HMCA 2EPKX 4ACZB 1JDDA 1NOUA 4OBRA 2VCCA 2PWEA 5A3HA 2JIWA 1TA3B 3M07A 2D0FA 1XD1A 1S46A 2ZUUA 4MB5A 4P8WA 1QNSA 2X05A 4J3VA 1CTNA 4H04A 2WVVB 4GQQA 3WQ4A 3E1F1 3NYDA 2HVMA 4UFMA 3L4YA 2ZWYA 5GNXA 4CVWA 1H49A 2ESCA 2V3FA 4V2XA 5A69A 5IFPA 2PBOA 4NI3A 3DC0A 1GZJA 2ZUMA 1WP6A 1W3HA 3T0DA 4YHEA 1D3CA 5E0FA 5DMYA 1E4IA 2XPKA 1ZBWA 1K9FA 1EHAA 3SCPA 3KE0A 1J10A 1ZJAA 1C91A 1K9EA 2W67A 3QOMA 5GPRA 1QHZA 2Y24A 2YL9A 3GTNA 3GBDA 1WB0A 1W9DM 1KGXA 4JCMA 2DSVA 2BXYA 3ZR5A 2D2OA 2WMFA 3CTTA 4BS0A 2YBUA 2J4GA 1E0XA 1E9LA 1B30A 3DECA 3AZTA 1B3YA 2W66A 1CXHA 3B9EA 2AMGA 1VEPA 4IUGA 3B9DA 3MO4A 1RD6A 1GCYA 2ZUWA 2W61A 3PTKA 3FHAA 4ACYA 2OWXA 5I24A 1J0IA 3GH7A 3L4TA 3NCOA 1OM0A 4MJ2A 4H8HA 5A6LA 3VOCA 4CU6A 3EDJA 4WIWA 1EDTA 1BG4A 1UA7A 3FHQA 4HOXA 2A3BA 1WE5A 2WM0A 1JL8A 4C7FA 3CHDA 1H0GA 2QPUA 3RM4A 3N13A 1ISXA 2GJXA 3OLEA 5D8WA 4GKLA 3VVGA 1C7SA 3W28A 2DH3A 3ZSSA 5EFDA 1XHGA 4X0VA 2V3DA 3ZOAA 1CXKA 1SR0A 1TCMA 4W8AA 4GI6A 4PEEA 1B3VA 1VEMA 4KRTA 2W63A 3I3EA 4LQ1A 3POCA 3PZVA 3VKKA 4E8CA 4LX4A 1CECA 1UKPA 1H1NA 4W86A 1WZLA 4J28A 4H2CA 1VBRA 5AYIA 2CBUA 1LWHA 2Q8XA 2PI6A 3MUZ1 3VM7A 3OLIA 1FHDA 2EEXA 2NSXA 2WXDM 3WELA 3AICA 1X1NA 2WVUA 1BPLB 4R27A 3AS2A 4Z2KA 1BVNP 1KR1A 3WDIA 4HZ8A 3SURA 2PWGA 3K1DA 1EXPA 1FOBA 3WEZA 3IJ8A 3OIHA 4MAVA 1NWUA 4AZBA 3EDFA 1FH8A 3TONA 4TTGA 4K68A 5A6BA 4CUCA 3MMWA 2QF8A 4W8BA 1J0HA 2XIIA 3CMGA 1JZ5A 3CZLA 2J7GA 2ZICA 4JFWA 1EIBA 4CU7A 1DWHM 3ALGA 4HZ7A 4ZE5A 2ZX9A 4L4PA 4MJ4A 3WNKA 3WNLA 2DSZA 4CU8A 5DEZA 2VT0A 1WZAA 3W4RA 3PZMA 4WLCA 4AW7A 4HTYA 1OIMA 1UR1A 1EGZA 1WDPA 4GPNA 3N17A 3LPGA 3WIJA 3K4DA 2XM2A 2CESA 1NOWA 3PZOA 1WKYA 3CZKA 4ZFMA 3WNPA 3AS3A 3WQVA 3CUIA 5A2BA 4UCFA 5LA0A 1J11A 5AC5A 2YKKA 1JZ7A 3BLKA 3K46A 4RL3A 4LPCA 1IZKA 2VRJA 5M17A 5DT5A 3SUWA 4B3KA 1B3WA 5GNYA 4Z2JA 2XTKA 4HU0A 2XGBA 2DIEA 5JBFA 2O9RA 5JBDA 3VX1A 4P7OA 1QW8A 5KEZA 2WLZA 3VNZA 3VGHA 3VDCA 4NRSA 1HJUA 4H41A 1B31A 3BSHA 1NM9A 4AZ7A 4CN1A 4D71A 3NDYA 3RDKA 4GXPA 3ARSA 4URIA 4GI9A 3GBEA 1QI4A 3THCA 4CN4A 2J74A 2ZXQA 4PUEA 2FHBA 2CKRA 2WZHA 3A4AA 3APGA 3TOPA 3VDAA 3AISA 1JDCA 1GOIA 3AZSA 3NJ3A 5A8MA 1OT1A 1PZ2A 1E6PA 1MW1A 1L0PA 2WVSA 1TVNA 2WSPA 1R7OA 1FHLA 2XHYA 3PBGA 1CPUA 2FDMA 1WAWA 2WAGA 1CYGA 3WNOA 4KMQA 3O6AA 1NH6A 2D3NA 4OJYA 4RE3A 1E70M 4BQ3A 4MDPA 1XH0A 1OSEA 2DT2A 4M81A 2WHJA 2GK1A 4ZEPA 4M82A 5DFAA 1HIZA 4V28A 1KGUA 3T2OA 1MFVA 4UFHA 1KQZA 1PIFA 2QLYA 3AYSA 3VIOA 3AZRA 1D2KA 1ISVA 2IXUA 3WQ6A 4AYSA 3VGDA 1UQZA 2BY0A 2O9PA 4MNMA 3FAXA 3MUY1 3VIJA 3VMOA 3OG2A 5CSYA 3WF1A 2ZOXA 2J7DA 1V0LA 5I6SA 1JAEA 2OSYA 1BTCA 4NF7A 1PBGA 2OWWA 1V3LA 1US3A 2VZOA 4PRWA 4TVCA 1VB9A 2OSXA 3LPOA 5AC4A 4DM1A 1H09A 2CBVA 1XD0A 1H11A 1JZ3A 5HOSA 1ISWA 1UR9A 3MSGA 1QVBA 2G3NA 4AEFA 1GQIA 3A47A 1MQRA 2W91A 2UY5A 3VIHA 1AQMA 3ZIZA 2EPLX 5A8OA 4BQ5A 2XSBA 1JD7A 1EOMA 3CHFA 5GQBA 2VR4A 4QCFA 4AZIA 4FMVA 4LGXA 3W0KA 2EPOA 3B8SA 1J0JA 4AISA 4GINA 4HPGA 3N18A 4GZIA 3HN3A 1AQHA 2J8GA 4KGLA 2ZUTA 5A1AA 3VX0A 2J47A 5CG0A 1I1XA 1E6RA 1QI3A 2V3EA 1M7XA 3TTOA 5BXPA 3VILA 4RE2A 2GDUA 2X0HA 4D6GA 3AHXA 1MVYA 5FL1A 1TMQA 3AS0A 2OYMA 3IJ9A 4GIAA 1G0CA 1R87A 5AYBA 1OIFA 5FKYA 2WKGA 4BA0A 2CNCA 2OYLA 1GJWA 2XWEA 4UFJA 1P6WA 2WLYA 2BVTA 2ZWZA 3AHYA 3L4XA 2D24A 1WZMA 1EQPA 4W5UA 5HXMA 3ZMRA 1TVPA 3CHEA 4TVDA 3SUUA 3WH8A 1QNPA 1FFRA 1HJXA 1OWQA 3EMQA 3DHUA 4AD3A 3WMBA 5D9PA 2ZXDA 3W27A 3RM9A 3U5UA 1E6NA 3VD3A 2WCSA 4QDMA 1HL9A 2VX6A 5M5DA 3IJ7A 4QLKA 5EB8A 1VIWA 3PTMA 4UQCA 4WSJA 1C8QA 1QBAA 2GK1B 1VJSA 1E15A 1HKKA 3FAWA 4GI8A 3QOKA 3ZQ9A 1JZ8A 2WMJA 2J7CA 1YHTA 2WANA 4HOWA 4IM4A 2XVLA 1NWSA 1E56A 2WHLA 3WENA 2DGAA 2ZXAA 1XCXA 2PWFA 1FP8A 1AVAA 3WUGA 1OD0A 1UZ1A 1WDQA 1UWSA 2Y8VA 5A6BD 5I3DA 3F4VA 1IZJA 4M56A 4OBSA 2DDXA 5D8ZA 1WZKA 3EDEA 2FGLA 4UZSA 1W1YA 4IPNB 3LMYA 1ITCA 2WC4A 3GXMA 1I1WA 3WD3A 1MW3A 1ITXA 2WCGA 5I77A 1Q6GA 4PTWA 1V0MA 4D6EA 4W87A 4A4AA 1BFNA 4ZXOA 3VDHA 2YDQA 3PTQA 3AI0A 4QLLA 4AC1X 1LQ0A 1UD8A 1C8XA 2DIJA 3TTYA 1LL4A 2VVSA 1JI1A 3W37A 1WO2A 3OLGA 2D22A 3RO8A 3BMWA 1GJUA 1DWIM 4MDOA 1JG9A 2X2YA 4IPLA 1HKJA 4OOZA 1BQCA 1A47A 2VNCA 3T2PA 2EO7A 4N42A 4E8DA 3BMVA 2VJXA 2RGMA 3BCFA 5A6MA 1JI2A 3T0AA 3GM8A 1OB0A 2E8YA 2Y4SA 1OINA 2XFFA 4EAMA 1R7AA 5ABHA 1GORA 1BYAA 2QHAA 1J9YA 5BCAA 2ZE0A 2QV4A 1JNDA 4AMCA 3DHPA 1CWYA 5E6YA 4UOJA 2CHNA 3BSGA 1E3ZA 1KXVA 3T2QA 1BYDA 3UR8A 2YA1A 2JFEX 1E73M 4CGTA 1D7FA 1HKIA 1GHRA 1HJVA 4UZUA 1RPKA 4F66A 3CZGA 1ISYA 3VU2A 4EANA 1V3HA 2E3ZA 1IT0A 2BHYA 4WKAA 1UH3A 4TXEA 2EJ1A 1JYVA 3AMKA 1CXIA 4TOQA 4AIUA 3N11A 1SFSA 1OCQA 1V3MA 2UY4A 3AIQA 1MW0A 2WB5A 4Y7EA 1PAMA 1W91A 5A6AA 2WSKA 2BXZA 2VCBA 4OOUA 5IFTA 3U57A 3FNDA 1ISZA 4NRRA 1O6IA 4UQAA 3BAXA 1LF1A 1C92A 1UZ4A 1Q6CA 3AMLA 1QBBA 1W3JA 4LYPA 1W1PA 4KH2A 1UHVA 4BF7A 2HISA 2DEPA 3BAWA 3DYPA 5BYWA 3MANA 3CUJA 1NOFA 4JKMA 1E43A 1W1TA 4CD6A 4W89A 3UG5A 4U3CA 3AJ7A 3VD7A 4CCDA 4D6JA 3VIPA 4C7GA 2AOSA 2VC9A 1VRXA 1LG2A 2GFTA 3WF0A 3QGVA 1BHGA 1E0VA 1E6SM 1UUQA 2YLLA 4CD8A 3WF4A 3VGBA 2X1IA 3PZIA 5I79A 1E72M 3NDZA 2CCRA 4B16A 1RP8A 1JZ4A 3WDHA 1CZ1A 2BNJA 4CVUA 3OZOA 1PZ3A 4PMDA 1GONA 1ZU8A 3WF2A 2X8RA 3SUTA 5GNZA 3NSNA 5HBFA 4HPHA 3QHOA 2YIHA 3NUKA 3DYOA 4FLSA 1BSIA 1HL8A 2JIEA 4HA3A 4XZBA 3RIKA 3RJYA 2E9BA 3SCUA 4F8XA 5F7UA 1FH7A 4D1JA 6TAAA 2VZVA 3W6LA 3AHZA 4CD7A 3FXYA 4M8UA 4A3YA 2VTFA 2YL6A 1RP9A 2V5CA 2C8NA 1WDSA 3WQ8A 1MYRA 3VPLA 2FH8A 3VIKA 2VVNA 1C93A 1UR2A 2CHOA 4B9YA 1UWTA 2EQDA 3ARWA 1OGSA 5CJ5A 1UD4A 4PTMA 1QHPA 3SCNA 4Z2IA 1E5JA 3AHTA 5M03A 1WDRA 3CBWA 2PBGA 1M03A 1E1EA 3S2CA 5JUVA 1I75A 5JIPA 2WC3A 4PCSA 1CXEA 3CLWA 1F4AA 1CENA 1EDQA 3VGGA 5CXPA 3WY1A 2NT0A 1Q6DA 1ECEA 1H5VA 4BCEA 3SUSA 2XFYA 1YQ2A 5IXEA 3AIBA 2CPUA 3IAPA 3B9AA 1MW2A 4TUFA 1EA9C 1JGIA 2DT1A 2WK2A 3WDQA 3ALFA 2WBKA 3BLPX 1J0ZA 1CDGA 1E40A 4BZYA 1FH9A 2BY1A 3AIVA 2ZX8A 3AYRA 3W29A 4AZHA 4AD4A 2GJXB 3QHNA 4W84A 2YLAA 1FA2A 3WNMA 4F9JA 1OGBA 1WCGA 4P8UA 4ATLA 1V0NA 2AAAA 4HMCA 1OD8A 4S3JA 1B3ZA 2X0YA 3GNOA 7TAAA 3UEQA 3RCNA 3ZO9A 3VGEA 1ZL1A 2A3HA 5IHRA 1BG9A 1UKQA 2G41A 2VUYA 1SMAA 2J78A 3ZT5A 2E9LA 1UR4A 3VIMA 5KZ6A 3KL0A 4D1IA 4AEEA 1CLXA 1G01A 3MUAA 4DUXA 3GXDA 3W38A 2CIPA 5I78A 3WMSA 3MKKA 1W9XA 4F79A 1V6WA 1PX4A 1JYNA 1XGZA 2UWFA 4U3AA 5HNNA 3RJXA 3CHCA 3IANA 4XZWA 5I0DA 3VIIA 1UD5A 2WMIA 2BS9A 5ECUA 3AXXA 4CKQA 1W2PA 1Z32X 1MFUA 3ECQA 3WEOA 1B0IA 4PCTA 1JD9A 1JXJA 3CH9A 5CLWA 1US2A 4M24A 1ESWA 4JKLA 3SCTA 3VD9A 1PEZA 2VX5A 3WBAA 5I2UA 3BCDA 1DHKA 3ZJ7A 3KWXA 3RPMA 3SCVA 4JL2A 1HJWA 2DT3A 2G8ZA 4NZCA 3PZ9A 2YJQA 2C0HA 3L4VA 1QNOA 5FOOA 3VD4A 1U2YA 1BYCA 3KL3A 3SIMA 4UTFA 3MV01 4LXFA 2WMGA 5BXRA 3N12A 1CEOA 1XH2A 5FL0A 2EPNA 1QOXA 2CBJA 5EFFA 1MWOA 4JHOA 1H3GA 5BRQA 5ABEA 2WNWA 3ARPA 1DWFM 2W62A 5ABGA 3GXIA 2UY3A 3ZSTA 3LPPA 4AD1A 1JYXA 4X0NA 3T0BA 1V3KA 3T09A 1C3FA 1K9DA 3AHVA 5BRPA 3PZNA 4OKDA 1PIGA 3HU7A 4HA1A 1SYTA 3K4AA 3PZUA 3ZJ8A 1J0YA 3CZJA 2J7EA 3F5LA 2G3IA 3ARQA 2ZIDA 4HOZA 4PSPA 3G6LA 3A6OA 4XB3A 5E0CA 5IDIA 4PUDA 5CPQA 1KCKA 2NW0A 4QLJA 2GSJA 3WDJA 4DWSA 2Z1SA 1QHOA 1W9VA 1DTUA 1V02A 7CGTA 2A3CA 3WN6A 2VO5A 3RMEA 2YDSA 3KEHA 1QPKA 1QI2A 2A3AA 3WFLA 4MNLA 2WC7A 4PMVA 2PWDA 6CGTA 4QFUA 1VEOA 5I23A 1E1FA 2VX4A 1KXQA 2VZUA 1VFFA 4PMNA 1O7AA 2WYSA 2FH6A 2Y8KA 1CIUA 2IXVA 1HP5A 1MQQA 2V5DA 4M1RA 5C71A 2XJ7A 1IV8A 5D4YA 4AWEA 1X6NA 2VZTA 1KB3A 3TTQA 4UR9A 3CZEA 2FHFA 4UFKA 1G1YA 4UNIA 3W53A 1KXHA 3WEMA 1HJSA 3A4XA 3WH6A 3J7HA 3CUGA 1W9UA 1BF2A 1GOOA 3OLDA 4J3XA 3SEPA 2GDVA 3GH5A 4FF5A 2BY2A 1E4MM 1QI5A 3OB8A 2XM1A 4J27A 4HZ6A 3M46A 4WKHA 1LL6A 3PN8A 3BAKA 3TA9A 3WH7A 3NSMA 2WMIB 1HP4A 2Z1KA 3LPFA 2MANA 1FP9A 4CCCA 3CO4A 4P7NA 4DUWA 2DT0A 1QI0A 4HMEA 1GPFA 1JFHA 1HN1A 1E6XM 5A6KA 4LYQA 4PMZA 1FFQA 4PMOA 4PSRA 1XSJA 4J3WA 1NARA 4NSBA 3AQUA 1W1VA 3VIFA 3IAQA 1HXJA 1MXDA 3PHAA 1QW9A 4FLOA 2CEQA 3UESA 1DEDA 3WKZA 1Y7VA 3FY1A 1H2JA 4AD5A 4ZENA 3UG3A 4MNJA 1DWGM 1V6XA 5E70A 1BGAA 1V02E 1V3IA 2V3GA 1HVXA 4JZ5A 3CUFA 2BHUA 4Z2GA 1NP0A 1PJ9A 4JHZA 3U7BA 3D5HA 1LJYA 3O2LA 3MSDA 2NT1A 4Q22A 3WNNA 2ZUVA 4W8LA 1VFMA 4ZXLA 1V03A 2WVTA 2E8ZA 3CPUA 3N1AA 4D6IA 1G9HA 5HPCA 1VFUA 4YPJA 1C7TA 4JKKA 5JBEA 2Y2WA 1GW1A 2VX7A 3M7SA 3SCSA 5FD0A 2W4XA 3DYMA 3RM8A 1PX3A 1JZ6A 3EBVA 2DSWA 1KBKA 2VZSA 3K8MA 2XYLA 3SCQA 4P8VA 4TTUA 4UFLA 1XYZA 1CXFA 5E6ZA 1XSKA 3VMPA 4MNKA 3SCRA 2J25A 5D9OA 4XUYA 1GOQA 1BAGA 4W7WA 1CGXA 1XV8A 3GH4A 3JUGA 4P7QA 2D0HA 5D9MA 4U31A 1MXGA 3BAJA 4UOZA 4DWSB 4CD5A 1W3KA 2PC8A 3I3DA 1JNEA 1UKSA 3NIYA 3VO0A 1Q6FA 2VQUA 5DF0A 1JFXA 1EO7A 1M01A 3F5KA 1UR0A 1CGYA 3AIUA 4W7VA 2WKLA 2V38A 3K8LA 2Y5EA 5JIWA 1UH4A 4AXNA 4CN6A 2J79A 2JALA 3L4WA 1C90A 3POHA 5IHSA 1E4NA 5D9NA 3AMCA 2J8FA 4AD2A 4N0RA 3L4UA 5A8PA 1UWIA 4MTVA
chains in the Genus database with same CATH superfamily
1VS1A 3NDOA 1WAUA 1EJVC 3C0QA 3BXWA 3N25A 2RUSA 3UWQA 3L4ZA 3TN6A 3AIWA 3NZQA 3RRAA 1EWEA 2GZXA 4D8LA 1JYWA 3QTPA 3LLXA 4JN7A 4NASA 2P50A 3PSWA 3KS6A 5D09A 3UERA 5A8QA 1G4SA 2PD5A 4PTXA 2VFGA 2EG6A 4YTRA 1UYQA 4NL1A 3OGSA 2DQXA 2XIQA 1JULA 4JTAA 2O9TA 3P74A 5CSUA 3PAOA 2POTA 1LLOA 4J3UA 3MP4A 4RV3A 5JXQA 4LT9A 3HFYA 3QN3A 1KBBA 2XG9A 1JXKA 4YHGA 4Z2LA 4O1FA 4BHYA 5A95A 2C19A 4NKCA 4PTVA 3MMUA 2D3LA 3Q67A 3SI9A 3WLJA 3VOJA 3W1UA 4DELA 2QDDA 3V1PA 1XLGA 1X8FA 1VBUA 3MI6A 3OA5A 4IP7A 4UCGA 4HSOA 1BGGA 1BLIA 3ZR6A 1TWWA 1TUXA 4HNUA 4AY1A 4S3KA 5CGTA 4AHOA 1B9ZA 5FCZA 2C7FA 3KVKA 3LHZA 2R91A 3T07A 1W32A 4X3ZA 4ASTA 4MLJA 1POKA 2CBIA 4LU0A 5J8LA 3E5PA 1JF6A 4W88A 4HGXA 4M80A 3HG4A 2EAWA 4HT3A 1H0IA 4X2PA 2E4TA 2IKIA 1K4GA 4GKTA 3KBNA 2I16A 2GQ8A 2TODA 3ONCA 4Q7NA 1P43A 4FX7A 1V0KA 2HMCA 3TMLA 4AIEA 5FJPA 3UJRA 4PYSA 2W6RA 1VQTA 1F3EA 1GOWA 3B97A 3LZ5A 3QR3A 1F4HA 3LB0A 2VHLA 1KV5A 2ZKMX 4DWSD 3H7RA 4KERA 4H7VA 3AUOA 1HGYA 1W17A 1FWGC 1J01A 2BHZA 4IMFA 1WNOA 1WXJA 3UWWA 3RYSA 1CGTA 2CZDA 1T7LA 4FEZA 4LAMA 4V15A 3KAOA 1MQPA 1O1ZA 2QMJA 4Q8QA 4KRUA 1RALA 3WLLA 1CT5A 2A7PA 2H3BA 2O56A 1E6QM 1R6WA 1Q66A 1A80A 1GHSA 4Q4RA 1UB3A 3EWCA 3S2JA 5TD4A 5I5RA 4PR4A 4YYCA 4IL2A 2ZZ7A 4Z1DA 3SCWA 2HROA 4AZ5A 3SFKA 2PDNA 1B3XA 4D8ZA 2X1UA 3D3AA 4ADTA 2XN2A 1OFDA 3BLFA 4XO6A 4WDTA 1GWJA 1YBQB 1ZRQA 3BGAA 3M5VA 1UA3A 2IQTA 3R8HA 4GMEA 4C7DA 3C2FA 1UD2A 1KQYA 2VRQA 1ZBKA 4G5DA 2JKEA 3BV4A 1GNXA 3KTCA 5I3FA 4B4HA 4ZCWA 4MWAE 1BYBA 4ERGA 1L6SA 4AZCB 2PGFA 4E0CA 2PDHA 1K77A 2JQXA 3NPVA 3MSYA 3KRBA 4QJ3B 3LG3A 1E71M 5DLCA 4W85A 2OZ8A 4AC7C 3I4EA 4YXGA 4GQRA 1MZRA 2QF7A 5E9AA 3TR9A 5A2CA 3PZTA 2I14A 2ZUNA 3TN3A 3WMCA 2QIIA 4IIHA 5DO8A 3G1HA 3CXOA 4LF1A 1NF0A 1UIOA 1PL9A 3GNRA 3QRHA 3LD5A 3NZPA 2VC6A 4GY0A 4M29A 3EDDA 2RHGA 5CZSA 3FX4A 3K8KA 3QF0A 1DKWA 4HZMA 4H8VA 3GS6A 4BQ2A 3W1MA 2D1ZA 3ZM8A 4QAWA 3QR0A 3S5NA 2FB3A 1T5AA 3NQ8A 4GXWA 1HO1A 1UKTA 1X6LA 4IGHA 4NX5A 3H7UA 1SJAA 3OVQA 1ZBCA 3V16A 1Q6LA 3K1GA 3RLHA 1N2VA 3AIEA 3E0VA 3GU1A 4OBTA 1IE7C 3H2FA 4PBFA 2DY3A 2BGQA 3GNNA 5HMDA 3OGVA 2CWNA 3VTRA 1TG7A 2Z2BA 3LCGA 4RW3A 1CXLA 1U30A 1A4MA 4N9BA 5HWJA 3K13A 2YL5A 4XO7A 3W2JA 1FWSA 4RDWA 2PDGA 2OSWA 3LSCA 1QNRA 3G8EA 3H26A 1HVQA 3UGVA 2E0PA 3P0WA 4XZMX 2YCKX 4JFTA 2VFEA 1GVIA 2IUZA 3HQNA 2HQAA 3L21A 1RJRA 4GO8A 3UWUA 7PTDA 5LA2A 1XX1A 4PMQA 1XP3A 3VD5A 4L4OA 4ORIA 5M3WA 1H41A 3II1A 4O52A 4EKJA 2FGBA 2VFIA 5PTDA 1KCLA 5F2MA 1OG0A 3KOYA 2CYGA 4WSKA 2CLOA 4ACZA 1VGAA 2DSKA 3SRHA 1SSDA 1G69A 1J12A 1N82A 1T99A 1TA3A 1SMDA 5EMYA 3CT2A 4CEUC 2HE8A 4J3SA 2G0WA 1XIMA 1WQ5A 3BW4A 1LCOA 1P48A 2CXGA 4A8LA 1UWUA 4H8UA 4PUJA 2OG9A 4ATDA 2XIJA 4GJJA 3EOLA 3TNOA 1Q45A 5HULA 4W9TA 3RRXA 3SQSA 3BV7A 2WBGA 4G9PA 3MZNA 2OWCA 4JFSA 1K1DA 3P14A 5LIWX 5CGMA 5FF2A 3VOGA 3WDPP 2E6YA 4UUIA 5HUOA 4H83A 1KWKA 2C16A 4DIAA 1WUFA 1J5SA 4QAIA 1TZ7A 1AW1A 3WBWA 4N4QA 1GEQA 4PMUA 5BWAA 4GY7A 2ZCGA 3CZ8A 3EOOA 4E4UA 4B15A 4GGHA 3SCOA 3LTSA 1HFBA 1XBYA 4GZEA 4HSHA 3QHMA 2XIBA 3I3BA 2GJPA 1A3XA 2OYKA 1GZGA 3CGTA 3M41A 5A94A 3LV5A 5G2IA 3KVMA 3KRZA 3UJ2A 2OCZA 2OLSA 1LM1A 4PH6A 1W5OA 1LOSA 1Q6EA 2QDHA 2E28A 4IQJA 1EP1A 1EF2A 1NJJA 3BQ5A 3SY5A 5H8PA 4A3QA 1V08A 1WKEA 1SFLA 3UPBA 2GJLA 1NP2A 3KBSA 3A4WA 4JYFA 2ZX6A 3O07A 4O54A 2PTDA 4J4KA 3U6WA 1CGUA 4K2SA 4C6OA 2QJJA 3PULA 1S2UA 2YW4A 4XD5A 2CXEA 4GQGA 4TIMA 2EPKX 4BR1A 1NOUA 5H91A 1K70A 4UIOA 2R14A 2JIWA 4GQ0A 1RQHA 3CQKA 1SO5A 4WDWA 4MB5A 4P8WA 1TTIA 2J9XA 5GVJA 4Q8WA 4J3VA 4QDWA 2ATMA 2PD9A 1DJGA 2D2HA 1EP2A 4H04A 1QPOA 1W5PA 4TO8A 3FVDA 3WQ4A 3NYDA 2ACQA 2QUUA 5EY5A 3L4YA 2ZWYA 4CVWA 1K8XA 2V69A 2NQ5A 4AVNA 3BOLA 3GIQA 2ZUMA 3KZPA 3NEHA 1D3CA 5E0FA 1RLCL 1E4IA 2HS6A 2XPKA 1EHAA 4Q8UA 4LJ3A 4H7CA 1J10A 1PKYA 4LUYA 5F4SA 4B2DD 1OFRA 1LRNA 3S46A 3G77A 4QQ3A 4IUOA 5HANA 3GC2A 3KRUA 5F2IA 2YBUA 1E0XA 4O28A 3DECA 1PXGA 3AZTA 2GJNA 1B3YA 3SIZA 1CXHA 3NL5A 1I2OA 1RD5A 4IUGA 3B9DA 2C1HA 3L23A 4KPLA 4RJEA 5EMKA 3PVFA 3MJMA 4M7SA 3NOEA 3CL7A 3B04A 2KX9A 1VBHA 4AYGA 4RDVA 1JUBA 1MNSA 2WM0A 3QQWA 2QPXA 3RM4A 3OLEA 4BJHA 3WBXA 1G7VA 4HCHA 3GU2A 2ICSA 3VVGA 5FSDC 2DH3A 5F4XA 3PANA 4B5VA 5EKYA 5DY2A 2DZWA 4FZIA 4HK7A 1OYBA 3ZOAA 3ZR4A 1SR0A 1TCMA 3H2NA 4L5ZA 3RXZA 4RDZA 4RR4A 1XDJA 2W63A 4IJRA 3FJNA 2B7PA 1CECA 4LAZA 4HQVA 1WZLA 1H1ZA 4IGNA 1W1B1 1SVDA 2G4JA 1SZNA 2PI6A 1XFBA 4AHPA 4IT1A 2HBXA 4QS5A 5CC5A 1HTIA 4R27A 3AS2A 4Q8TA 1XQKA 1TE6A 4Z2KA 1A50A 5KINA 2FZBA 5DXXA 4OT7A 1EXPA 5AFDA 3IJ8A 3OIHA 1R3QA 3QMRA 2PU1A 3FS2A 2JGYA 5CSRA 4TQTA 4CUCA 1F73A 3Q94A 3MMWA 4ZR8A 3DERA 4W8BA 3W7PA 3UVIA 1XRFA 2Y7GA 3BLLA 1YTKA 3UP8A 1EIBA 4CU7A 2R1LA 4JIPA 2E09A 2ZX9A 2O0TA 4L56A 1EBHA 3WNKA 1KFBA 1YW1A 1F5ZA 4X9SA 2VC7A 4QG9A 3PWAA 1WZAA 2Z7GA 3C4UA 3W4RA 3PZMA 4XUGA 4GNKB 4HTYA 2GYIA 2RKXA 4IQEA 4GPNA 4A35A 3UR5A 2XM2A 4H6QA 3W01A 3VC5A 2DZTA 2ZYFA 3MVIA 3BG3A 3CZKA 4ZFMA 3WNPA 3AS3A 3VKDA 3WQVA 3RGTA 3DBNA 3BJFA 3E2SA 1XIIA 4GA8A 5LA0A 5AC5A 3Q2DA 2YKKA 1TPFA 2DVTA 5FJJA 1HL2A 4R9XA 2VRJA 1OX6A 1B3WA 5GNYA 1IYXA 4LNCA 4HU0A 1ZNNA 4PUNA 5JBDA 1DJNA 5K4XA 4KIRA 1H5YA 2DVUA 4NRSA 1F74A 1B5TA 2YCLB 4M5PA 1H50A 4DF2A 4F2UA 3IIXA 2FPYA 4F0SA 1XLBA 3NDYA 4GUIA 3S1WA 4GXPA 3APYA 2PWVA 2CKRA 1XFCA 2E1WA 3GG7A 3LXCA 3TOPA 1T6MA 4DJEA 3AISA 1GOIA 3NJ3A 3TW9A 1PZ2A 1E6PA 4Q8PA 3TUUA 1L0PA 1TVNA 1ME7A 1FHLA 3SQMA 1EA0A 2YCIX 3MZ2A 4GVGA 4ICCX 5LNSA 4PUMA 1T40A 3GWQA 4MDPA 1EIXA 5FSEC 3MKCA 1XH0A 2DT2A 4M81A 2WHJA 4V28A 1KGUA 3T2OA 1N8IA 3U4FA 3VIOA 4CCZA 2IXUA 2ZA3A 3H2EA 2G5WA 3UZZA 4UR8A 2X1RA 4MNMA 1NELA 3MUY1 5G1MA 1QWKA 1Z41A 3ITTA 3QV8A 3OG2A 2ZOXA 3UQNA 3WYZA 1AFSA 1J2BA 3CMFA 3JZEA 3K2GA 2OSYA 1FXQA 2OWWA 5CGQA 3FA4A 1US3A 4LV4A 2C6QA 5CAKA 3SRFA 2OSXA 2FZ9A 2V81A 1H09A 5IRPA 1Y0EA 1H11A 5HOSA 3F7JA 5AHIA 4UTTC 1PV8A 2G3NA 1TPDA 3RHGA 2WM1A 4K8EA 1TRIA 5L9FA 4Y9MA 3UD6A 2UY5A 1SU5A 1AQMA 2GOKA 4EP8C 1TJPA 4S3BA 2L5HA 4GH3A 2XSBA 2PEVA 4ILSA 4QCFA 3OVGA 1XLIA 4LGXA 3SY1A 1D7KA 3DFNA 3P93A 4AISA 4GINA 1LDCA 3LRLA 4GZIA 4RNIA 2ZUTA 3VX0A 3HG5A 3LRKA 4O1CA 2VEFA 3B3DA 2CLIA 3LBCA 4Y9PA 5LXEA 4PRRA 2OZ3A 1XLCA 2IKGA 4OECA 4N2YA 1DJZA 4GG9A 5E0KA 2GDUA 2CHRA 1TWSA 1W0MA 4QSFA 3N19B 5BOOA 3IJ9A 3V4BA 4GIAA 3TWBA 3CHVA 3C56A 1OIFA 5FKYA 1S2AA 3N9RA 3BL3A 1GVFA 4E6MA 2WLYA 3AHYA 2ANUA 1SJBA 2QCDA 1KRMA 1QNPA 1ALDA 4A8IA 3GR7A 3DHUA 2QJIA 3CUXA 3F2CA 3W27A 1E9YB 2DZXA 1UMYA 2Z1XA 3W2MA 1VIWA 1L6WA 2HJPA 1VJSA 3U3HA 3DX5A 4GI8A 5M2FX 1VRDA 3C2YA 1CX9A 5FF7A 4MWAD 1QK0A 3RUBL 4RZBA 4HHMA 1NWSA 1E56A 1S5VA 3WENA 3EB3A 1TV2A 3EWDA 2GVGA 1G6CA 4QE4A 2DIKA 4DPQA 3E38A 3C2OA 4R88A 1AVAA 1OD0A 1UZ1A 2FFIA 3KLLA 4NVTA 1WDQA 3QV6A 1WKDA 2Y8VA 1RBAA 4ENLA 2DDXA 5D8ZA 4K37A 3S1UA 3MQTA 4XVDA 1W1YA 2WNQA 5CJMA 4AVOA 4AF0A 3UG8A 2WCGA 5I77A 4PTWA 4D6EA 2QEZA 3PWGA 2GVLA 3NQFA 3H2MA 3PTQA 1KM4A 1L8PA 3TV8A 2O7QA 4HNCA 4FNQA 2V82A 1FBAA 4WEVX 3VAVA 3C6CA 3GIYA 4GFIA 3SSJA 3QSTA 1XBVA 4AU0A 3W37A 4O1EA 3BMWA 1GJUA 3HPZA 3BW3A 4LUTA 4IFRA 1HKJA 4H3DA 4O1BA 4C6JA 4LB4A 1A47A 2V9DA 4IJBA 9XIMA 2H90A 1IXQA 4E5TA 1VBGA 1AW2A 5K7JA 4J2PA 4UB9A 3T0AA 3PFRA 3GM8A 4YTUA 2UZ9A 4DJDA 2HXUA 1R7AA 2VOMA 2Z2AA 2XU2A 3KOZA 4XTDA 1JNDA 3MO7A 4RPPA 2A7RA 1VCFA 5CBIA 3BSGA 2OGYA 1IEVA 1KXVA 3T2QA 3HM7A 3UWZA 1PCKA 1XLEA 3MCMA 4CGTA 1HJVA 4UZUA 2OPJA 4ZTYA 2ODOA 4EANA 1TREA 1QRQA 1EB3A 1UH3A 4XBKA 4K7YA 1JYVA 3ES7A 2Y70A 3THAA 3N11A 2OQHA 1FKXA 1RA5A 4LFYA 3R10A 3RX3A 2BXZA 3L68A 3KDNA 4OOUA 3W1LA 3LCXA 5IFTA 1ISZA 1O6IA 4UQAA 1LF1A 4XTIA 4GVHA 3OHMB 3SGUA 3EWYA 1H7NA 3WK1A 1M3UA 5K3VA 5T26A 1GT8A 5TAOA 2ZA1A 2HISA 4Z0JA 2DEPA 3BAWA 2AGTA 2NQLA 3O16A 3CUJA 4JKMA 4ADUA 3UG5A 2QV5A 5BU9A 4GJ1A 3VD7A 1VRXA 3R7MA 5JVLA 3QGVA 3GAKA 2VP8A 4CD8A 4EIVA 3B9NA 1W3TA 1TSIA 5I79A 1W8GA 1F07A 5EU9A 1VJIA 2QR6A 4C6PA 1JZ4A 4CVUA 2BNJA 3S3GA 1ZU8A 4EPBC 2C1GA 1THFD 3NSNA 3QHOA 1P6CA 4L9XA 3DYOA 1TCDA 4S3FA 1HL8A 3P80A 4QNEA 1FWIC 2QKFA 4DYKA 3RJYA 1JPHA 4F8XA 1FH7A 4D1JA 3W6LA 3AHZA 3LV6A 3A23A 4M8UA 4A3YA 3I7QA 2YL6A 3PPCA 4S2CA 4ZL1A 2FQIA 1WDSA 3KP0A 3G1FA 3BK0A 3VPLA 3V75A 1KM2A 5FJOA 3VKJA 2PS2A 4X60A 1UWTA 2EQDA 4DUOA 3ARWA 4B90A 3DI0A 1T8XA 4PTMA 3FEMA 3W7GA 4PL1A 3MHFA 4GFSA 3E74A 1WDRA 2XH0A 2HE5A 5AYXA 1E1EA 1I45A 4PCSA 3L0GA 4M6VA 2CLEA 4JNYA 3VGGA 1BSLA 3W7MA 2Z1VA 4H9MA 1F6YA 3WY1A 3O05A 4DAIA 4BCEA 5C54A 1NDYA 1OADA 5HK4A 3E6EA 3OVPA 2CPUA 1SJDA 1QFEA 2ZA2A 3NXLA 5DMLA 3TC7A 2VDIA 2CFFA 1KD0A 2DT1A 4OV9A 4M1BA 3QFEA 1J0ZA 1E40A 3UY8A 2QW5A 3TX9A 3AIVA 4JTQA 3I6TA 1EXBA 4MUZA 2GGHA 3T81A 4CNPA 4F9JA 4K38A 1P7TA 1VLIA 1Q4WA 2MUCA 2ADAA 3R94A 4ATLA 3QMSA 1RVKA 1V0NA 2AAAA 4HB7A 1OD8A 4GIRA 2Y85A 4LC6A 1TX0A 4HVXA 4PGLA 5G4WA 4E3VA 4DO4A 2OOFA 2A3HA 1RPXA 1BG9A 1SMAA 1GTEA 2E9LA 2AL2B 1UR4A 2C0AA 1S1RA 3KL0A 4AEEA 4H9XA 4H1ZA 5KMYA 2Y6ZA 1TQJA 3G1XA 1G01A 3W1AA 1QK2A 3D0CA 4MFDA 4Q3MA 4HNVA 3W38A 2CIPA 3WMSA 3MKKA 1W9XA 2VWSA 1KM0A 3KCJA 3SJ3A 1AH0A 2FVLA 1JYNA 4DHGA 5AVHA 3VOHA 5HNNA 3LCWA 1G67A 1XKYA 4D2JA 2BS9A 1UP3A 4PODA 1U1JA 1W2PA 3N29A 3MWCA 3WEOA 4AWTA 1B0IA 3P2VA 2W9MA 4M24A 3R8GA 3UA3A 4POCA 4MY9A 3VD9A 3EOSA 5D03A 1PEZA 4BF9A 1XDMA 4IJCA 3ZJ7A 4KETA 3KM8A 1PYMA 3SCVA 1HJWA 2G8ZA 4NZCA 3PZ9A 1OFOA 3LM3A 5D32A 2F6XA 3IJDA 3KL3A 3SIMA 4RNFA 2WMGA 3FDKA 1X8CA 1PB0A 3N12A 3U2EA 5FL0A 4GI4A 4KCWA 2CBJA 4ZO7A 1H3GA 2V5LA 4O13A 2YSWA 1DWFM 2W62A 3O0FA 2BZNA 1SO3A 1BKSA 1V3KA 4JN8A 1C3FA 1K9DA 3AHVA 3PZNA 4JEJA 5HMSA 4IZGA 3HU7A 3RN6A 5AVNA 4FIRA 4F0RA 4OUIA 1BXNA 4KESA 2J7EA 3ARQA 5BOEA 3G6LA 3MP3A 5IDIA 1EJRC 3DKJA 1BWVA 2DW7A 1KCKA 2NW0A 1SPQA 4QLJA 1XM3A 2Z29A 4ROPA 7CGTA 3USZA 4ZGYA 2A3AA 4O4VA 3WFLA 5I02A 4OFCA 3QY7A 1WDWA 4MNLA 3T4CA 1IQ8A 2PP1A 5I23A 3IV3A 3WJSA 3WMLA 4AG0A 5JQ9A 4LEQA 5C55A 3GY1A 3REQA 4PMNA 2A21A 3BURA 1KBLA 2IXVA 2FZNA 4FX6M 3SY8A 3QBUA 3R43A 2FHFA 4UNIA 3W53A 3WEMA 1PO9A 1GOOA 3TDFA 3OLDA 3GH5A 1E4MM 4ZZ9A 3E0WA 3OB8A 3IPWA 4WKHA 3M46A 2OZTA 3B8DA 3W7IA 1HP4A 3TW6A 1OFEA 1QI0A 1R3WA 1JFHA 4ZOBA 3O3RA 4PMOA 2ZRVA 5IBXA 2A3LA 3VIFA 3IAQA 1HXJA 5AB3A 1DEDA 5G1TA 3TIMA 1H2JA 3O8AA 4MJMA 4AD5A 5B7YA 4MIMA 5D05A 1BGAA 3W2LA 7ENLA 3VZXA 2NQZA 4JZ5A 4Z2GA 2XIOA 1YTDA 2E25A 2DJXA 5BZAA 4ZQCA 3IJ6A 3PK7A 3WNNA 4IG2B 3C0SA 1K02A 2ZUVA 2V5BA 5REQA 3HGOA 3CPUA 3N1AA 1G9HA 2PSNA 1FWNA 1MUCA 2Z4GA 1GW1A 1Q6OA 1JCJA 4GUHA 3DHFA 3GU9A 2CZ5A 2XDFA 3SCSA 5EMJA 2W4XA 4G8TA 3E2QA 5I09A 3SCQA 2YCJA 1XINA 4UFLA 1XYZA 5E6ZA 1YXCA 3ITGA 3VMPA 5JH2A 9RUBA 2JK2A 2PGRA 1BD0A 3HQOA 4GYPA 3F2BA 5D9MA 1W54A 4U31A 1MXGA 3TFCA 3AU2A 4QJ1A 3R89A 1UBPC 4UOZA 4DWSB 1OFPA 1W3KA 2PC8A 4KCTA 4WSHA 2I17A 4HBKA 3NIYA 3ANUA 4HJFA 1V5XA 3F5KA 4MKNA 1UMLA 4W7VA 2WKLA 3TEVA 1ZGDA 3RPTA 3K8LA 2Y5EA 5AHFA 5JIWA 5D2WA 2QCDB 3TSBA 2J79A 3L4WA 4L9ZA 1C90A 4QHRA 1OJXA 1GK8A 3V36A 1E4NA 4N0RA 1LWJA 3HGJA 4FXSA 1VBJA 4IPIA 1OBAA 4BI5A 3GNPA 4AB4A 3OQ8A 4ZODA 1JIBA 4JAWA 1A5KC 1GYLA 3K4WA 3RILA 2GUBA 3QKZA 3BPWA 2G96A 2NVDA 1U22A 1F05A 1HF6A 3MSRA 3MU7A 5CPOA 3ERPA 2BMBA 3TSDA 1TE1A 3URAA 5A2AA 1UQYA 1P0DA 3QW3A 1HX0A 3OYXA 1RA0A 2X1SA 1I2NA 1TJRA 4C6FA 1DE5A 1T96A 1TV5A 1EC8A 2VRKA 4WRHA 4UNLA 3PSVA 3BLOA 4O15A 4LYKA 1XG3A 4DRSA 3B40A 4LYRA 1UOKA 3OODA 4C6IA 3IWPA 4F0KA 4NNCA 1QWGA 2X1TA 4DJFA 5EBUA 2BODX 3PR2A 1CB2A 2V8ZA 2YA2A 2XSAA 3MUIA 5LIKX 1QUMA 3S2LA 1AL8A 4E38A 4MM1A 3WJZA 1KWGA 3MVTA 3LNMA 4DO6A 4J5NA 1P0KA 1UC4A 4S3AA 1QPRA 2V0TA 4U33A 4S1FA 2Z2UA 5EYWA 3F5JA 1F7BA 4DBEA 5CG7A 2P0IA 4OIFA 1UR3M 2XINA 3WL1A 4H2HA 1MZHA 3LA4A 1FWJC 1RY8A 2P0OA 2E77A 5DRCA 3P81A 3XINA 2JF7A 2YOCA 1WOBA 1DQXA 5EBAA 1AJ0A 4IHCA 1L8NA 4MF4A 4GACA 5LNUA 1NWTA 4UQ9A 6A3HA 3TTSA 4TV6A 3C2RA 3RFAA 4JTFA 1JDAA 3EKLA 4UFIA 5G4EA 3GNXA 2WPGA 3AROA 2Y5SA 3WDRA 2RGLA 3GDLA 1EO5A 3VC6A 4JPGA 4H00A 3GYEA 4D6CA 2BVDA 3EGJA 3OZPA 3G24A 1R8LA 2X2GA 3NPUA 1D8CA 5BWFA 4UOQA 3VM5A 4WGHA 2A3EA 3EMZA 5AC6A 1AMYA 1HT6A 4PMYA 3VNYA 3CLMA 4G7EB 2EBNA 1VFOA 1MEHA 3S6TA 2VI0A 2CERA 3UZ5A 4DWSC 4HU8A 2P3ZA 2QPSA 2ASHA 3ITXA 1R38A 2IS7A 3UJFA 2ZTJA 3RF9A 4IMCA 3DBPA 4JFUA 3NM3A 1XIFA 3TVAA 2Q09A 1H62A 1OT2A 2Q3RA 5A8NA 1GZ1A 2REQA 4U5KA 3UJEA 3A3HA 3ARUA 1XRSA 3W81A 3THDA 1IT7A 4V27A 3P3BA 2JKPA 1XJBA 3W3OA 4R5EA 2G3MA 3W24A 4DBUA 4DXKA 3ZWSA 1GVYA 1NQ6A 1KNWA 1BXBA 3UG4A 3GHSA 1S5NA 2J75A 3UZYA 5FEPA 2VL4A 2D20A 4O0ZA 4JL1A 3CV6A 2PDYA 4H8NA 3G18A 3O15A 2V2CA 1BF6A 3H22A 1X98A 3MV11 1UR8A 1Z7AA 1FKWA 4CNOA 4YYFA 3EA1A 1UWRA 3AXMA 3CNYA 2NSOA 3EWBX 1VF8A 1M6JA 5D33A 1BRLA 1YNPA 1UD6A 3HA1A 1QNQA 4C1LA 5HPOA 4LSBA 5I3GA 1CLVA 1FDYA 3CUHA 2JEPA 2DUXA 3W6MA 3CQ0A 4GZJA 5E09A 4JY9A 5EMLA 3M5YA 2VCAA 1Q5MA 3ZXWA 1M04A 2R1PA 2WHKA 2ZUSA 2W5FA 3U5YA 3EDKA 4YWIA 4UWMA 2VR2A 1T8QA 3UT0A 3AXIA 1TELA 2EXOA 4NXSA 4UBPC 4WUIA 1TJ2A 1BTMA 3W70A 4LRTA 1GEHA 5BNKA 2CLFA 4DVOA 2Y62A 2GQ3A 1XG4A 4PN2A 1ZJBA 3N15A 4GIYA 5AY7A 3W00A 3UCDA 3H70A 2NX9A 3M6DA 5DCBA 4EK7A 3NGJA 3ARVA 1KGWA 1ODZA 1TMHA 1PZ1A 2KZHA 4JFVA 1E5NA 4W5ZA 1DBTA 4WXZA 2RDTA 4XV0A 1NWRA 1SSGA 3GVGA 5BXSA 4XZLX 1VH7A 2YZ5A 4PBEA 6REQB 4WHBA 3G3MA 1RK6A 5LSMA 1E9ZB 2ZX5A 1Q65A 4F0HA 2EPHA 3N9KA 2ZTKA 2J62A 3GDBA 3EYPA 2J13A 2VGFA 3H8AA 1EEXA 1XSIA 1TFVA 4DJDC 4C6EA 1UKOA 2DORA 2YFOA 1VFTA 3ARXA 4WCJA 3AOFA 4C6NA 2WKJA 4DN1A 2A2IA 1GKPA 3L7RA 4HIBA 3A5VA 2ZZ1A 4AD0A 3QSRA 3OA3A 4RZ4A 5LA1A 1O95A 1JPKA 2YDRA 3CM4A 5I7GA 4Q4KA 4LUSB 2EPMX 4B3ZA 4JCLA 1GQNA 3LEPA 3QYQA 2ZRWA 4UQDA 5ABFB 1FWFC 2HTMA 1H7PA 4JBRA 4MFEA 3B0PA 2FFCA 4J9JA 2ALRA 1OZMA 4FAMA 3CEPA 2E1DA 3U7VA 4RE0A 3QY8A 1KTBA 1FWRA 3BAYA 2XH2A 1X96A 4TVUA 3VNJA 4RX0A 3LYEA 2O55A 3C0LA 2ZXBA 2QXWA 3RMJA 1TWDA 2G3JA 5A6JA 5MF5A 3CB3A 4PRTA 4MADA 4Y8FA 2B7OA 4CCEA 1OHLA 2RAGA 2DW6A 1VFSA 1ECQA 2E9MA 1K9TA 4PB3A 1KXTA 1XRTA 2QULA 4QITA 1GKRA 4U28A 1IEXA 4JEQA 3G8RA 4J3TA 3BOFA 4IICA 2VMFA 4LNYA 4WY0A 3TN5A 3ZVHA 1SM9A 4QXIA 3N04A 3ZT7A 3P67A 3LI1A 3CASA 1VHNA 2O9OA 3BLEA 1BKHA 2YXOA 4IIDA 3UCQA 1EZ2A 2XH4A 4LV9A 4W4QA 1F76A 1GGOA 4MB3A 4HNNA 1QW7A 1E55A 4R34A 4AIOA 1LWIA 2PB1A 1S39A 2OEKA 1Q7ZA 2WZIA 3EA2A 2DPEA 3UZXA 3ES8A 1JF5A 1Y5WA 1WV2A 5CLTA 4P7LA 1LOLA 4IISA 3WFZA 1Y65A 3RLGA 4FK9A 1A0EA 1C8YA 2CITA 4MB1A 3TYEA 2XVKA 5BOFA 2OZ0A 4DF1A 2VDHA 1JDDA 4UTWC 2PWEA 1NFGA 2D0FA 5AECA 3BZGA 1PSCA 3WLOA 2Z27A 2X05A 3KVLA 1MEWA 1UCWA 1LUCA 4QEEA 2WVVB 4DI9A 3E1F1 2HVMA 3OW1A 1W56A 1XLHA 1IEIA 5A69A 3UBPC 5IFPA 2PBOA 2Y5JA 1NQKA 1FVPA 4NI3A 2NZLA 4I7VA 3DC0A 1DIDA 4YHEA 3B9OA 2OB3A 4CQCA 5HJLA 1FDZA 1KFJA 1M7PA 1R3YA 2Y24A 3ABZA 3GTNA 3GBDA 1FWHC 1W9DM 4LVFA 1FX6A 1KGXA 4I9JA 3BVJA 3CPRA 1MUMA 2BXYA 1IWBA 2C14A 4NAEB 1ONWA 7XIMA 1V79A 3CTTA 1VCVA 3UYCA 3VNLA 4Y96A 5AC7A 4OE7A 1B30A 1RCXB 3T78A 3LZ3A 5CAHA 4LCQA 3MUCA 1ZAJA 1RD6A 3ZWTA 4FIQA 4K8GA 1I6NA 4HSNA 4YTQA 2WNNA 3B05A 1I2RA 4ACYA 1FY6A 2B4GA 3P0XA 4FA3A 5MKGA 2OWXA 4IFKA 1J0IA 4DLFA 3GH7A 1EUNA 4AX7A 3NCOA 1OM0A 4TX9A 2RFGA 1SO4A 3VOCA 4DXVA 4CU6A 3EDJA 1BG4A 1UA7A 4HOXA 4TU1A 3VZZA 3CWOX 5CEWA 2A3BA 4C7FA 1R2SA 1Z8AA 5K9CA 1PDYA 2QPUA 3N13A 4N6FA 2R9RA 2GJXA 3M0HA 2Y7FA 1D3HA 5TF0A 3ENLA 1C7SA 4O18A 5LIYX 2C13A 3QV9A 4X0VA 4ZFCA 3CYJA 2D73A 2ZZ6A 4W8AA 4UMBA 4RUBA 1JJKA 4GI6A 1D3GA 4L1WA 2PRMA 2CLPA 4QG8A 5L6UA 1B3VA 4QS6A 2PDCA 4HNLA 2Z00A 3BWWA 4XSLA 5G5IA 3VKKA 4E8CA 2OKOA 3LLFA 1KKOA 3H23A 4P5UA 1SR9A 1A0DA 3HJZA 1LWHA 2Q8XA 4WZHA 1OY0A 2V68A 3U2OA 3MUZ1 3VM7A 5M1TA 3A21A 4AIBA 3TC6A 3WELA 4KKXA 3VOIA 2R82A 2WVUA 1BPLB 3TK7A 4ZA0A 3WDIA 2PWGA 4G7FA 3W7DA 3K1DA 1FOBA 1XDLA 4C1NB 4Y2WA 4C1KA 1NWUA 3R0KA 4AZBA 1FH8A 2VENA 4K68A 3W7RA 1O4UA 3P61A 3O6YX 3CV2A 2QF8A 2XIIA 2GVJA 4FR6A 2PCQA 3CMGA 2OKTA 3EA3A 1GJPA 2BOFX 2ZICA 4FNTA 1DWHM 1YPIA 1XGEA 4MJ4A 3WNLA 4CU8A 2NLIA 3LENA 5DEZA 4NZ4A 2VT0A 4GOAA 4HJWA 3RITA 1UR1A 1JDEA 1WDPA 3LPGA 4CNNA 2B81A 1V8EA 2FVKA 3JU2A 4RKAA 2CLKA 3NXFA 2VEKA 3A24A 1OFBA 1MO0A 1J11A 4A6GA 4NNBA 3K46A 1IZKA 3IACA 4CQ8A 1S2CA 5DT5A 3SUWA 4Q6JA 5HATA 3CAKA 4Z2JA 1VKFA 3E3HA 3W73A 4L9YA 4F40A 2HNEA 3LXBA 1QW8A 3IIVA 5KEZA 3GB6A 4TMCA 3H4XA 3C8NA 4FP1A 3VDCA 5FA5A 3T4WA 1HJUA 4H41A 3BSHA 2C79A 4YJ5A 4AZ7A 4CN1A 4D71A 1S5TA 2FZMA 5HJYA 5JU6A 3T44A 1O5RA 3GBEA 3ZS4A 2AKZA 3RU6A 5C9WA 4JTLA 4PUEA 2WZHA 1JUKA 1H1YA 1E1CB 3A4AA 1KLYA 4NXKA 3VDAA 3WBYA 2YZRA 2EG8A 4KBXA 4H19A 1OT1A 5I00A 4LF2A 2D69A 1MW1A 4WR3A 1R7OA 1UJPA 3MYPA 3K5XA 1LRTA 5DANA 3PBGA 3STCA 1MXSA 5TBOA 4MWAB 4KMQA 3KP1A 2NVCA 5U4NA 1FRBA 5FJTA 1E70M 1PHWA 3N73A 3T55A 4ZEPA 1TVLA 3I6EA 4M82A 5DFAA 2Q8LA 3KOXA 2QLYA 3AYSA 1SW7A 3LHTA 4JIRA 4MMWA 4KWVA 2ACSA 2WJDA 1UQZA 1NIUA 4OGZA 3VE9A 4A2RA 2PMQA 2BY0A 2O9PA 3FAXA 2A7NA 4NIRA 2Z1WA 5HA7A 1EL3A 4EPEC 1IXPA 3BOXA 4PFHA 5CSYA 3S83A 3WF1A 2J7DA 4IOTA 4PL2A 1TRDA 5I6SA 1LTDA 1JAEA 1IEWA 4NF7A 4DNMA 3D6NA 5DQPA 1V3LA 4XD4A 4HYVA 2ISDA 3M16A 3LPOA 4X61A 2E67A 4ZO9A 1JZ3A 2NQ9A 3ME3A 1UR9A 3N4FA 3MSGA 3SBFA 2FKPA 3PJWA 1QVBA 2E6FA 1B4EA 4EX4A 3C2VA 2OO0A 4DB7A 3A47A 2VDGA 7TIMA 3PPGA 5A8OA 3A9BA 3KOFA 4NJJA 1TV4A 3CHFA 4MY1A 5GQBA 2VR4A 2G95A 3EZ4A 1YDYA 4AZIA 1EEPA 4QDPA 1TTQA 1J0JA 1VCGA 4HPGA 3N18A 4JYEA 3HN3A 2J8GA 3WK3A 4WQ6A 2CLLA 2A6NA 1OYCA 2OT0A 1QI3A 1ENUA 3GNDA 3TTOA 3G1SA 5CH9A 5DXYA 1F3WA 1SFTA 4JQ2A 4FALA 1YDNA 2X0HA 5FJIA 1TMQA 1XLAA 4M3PA 3F2DA 5AYBA 5I3IA 2PAJA 2BVWA 3G5EA 4E2DA 2WKGA 4RXGA 2ZE3A 4L80A 1SFJA 3BJSA 5IM51 3NWRA 2XWEA 4UFJA 2QNEA 5AKQA 3OO2A 1YRRA 2QAFA 4F3HA 2D24A 1EQPA 1TVPA 4TVDA 5C9UA 1FFRA 3CAWA 4GNJA 3WMBA 5D9PA 3UGRA 4QROA 2PTWA 2O7SA 4Q4QA 3CO8A 4N9CA 1LORA 4QDMA 1N55A 4LS0A 1HL9A 2B0MA 3FJ6A 4FXRA 4QLKA 5EB8A 5C7HA 4JN6A 1QBAA 2GK1B 1Z9AA 3BZJA 3LCIA 2DV0A 1HKKA 3MWAA 4K3ZA 4GVFA 3ZLHA 3I7SA 1YHTA 4HOWA 2DFAA 2H8XA 1NU5A 3R5EA 1KM5A 2ZXAA 2PF8A 3LOTA 2PWFA 4RNJA 2X30A 1FP8A 3M9YA 3LGEA 3AU6A 3GW3A 5DBTA 4A8RA 5BU6A 5I3DA 4XD3A 1HUVA 1IZJA 4M56A 3TA6A 4IQLA 2OOGA 1EJSC 1Z42A 4US5A 5HINA 3PUGA 1ITCA 3GXMA 2HEJA 4I8YA 4OWGA 1Q6GA 5IDZA 4FXJA 4JIQA 1V0MA 2V5JA 1XS2A 4A4AA 1DXIA 4ZXOA 3QY6A 3AALA 4MWAC 4AC1X 1VFLA 5RUBA 2DIJA 4EPDC 4REQB 1R3VA 1K8YA 1YDOA 1Q2RA 2VVSA 1JI1A 3I6RA 3ZYZA 3IGXA 3OLGA 3WJXA 1KFLA 1YEYA 3A9IA 1SZRA 2PE4A 4MG4A 2OELA 3M44A 4OOZA 1BQCA 2OT1A 3T2PA 5BRBA 5C9ZA 3FGCB 4E8DA 3KBWA 4RXFA 2VJXA 3BCFA 3R58A 3PBVA 3M0YA 4C5YA 5EA9A 1V77A 4ZB2A 1OB0A 2E8YA 3W7CA 3LY0A 2QVNA 2QHAA 4G6CA 2DVXA 2Q71A 3OEXA 1BEUA 4LEFA 5H1WA 1FQ0A 4AMCA 1JEZA 4H9YA 3QGKC 2V67A 4JTKA 1R47A 2CHNA 1KM6A 2ZDRA 3V35A 1XIEA 3UR8A 1QR7A 3ABRA 2JFEX 1E73M 2C15A 1D7FA 1HKIA 3PY2A 4DJED 2FMNA 4XKYB 2A5HA 1X97A 3CZGA 3VU2A 2FTWA 4J2MA 1V3HA 3H6OA 2E3ZA 2BHYA 4OQVA 4YNGA 4TXEA 3AMKA 1CXIA 8TIMA 2WNZA 1SFSA 5B80A 3P6LA 5AHEA 5F2LA 5C6MA 3DG6A 4R9OA 4Y7EA 5A6AA 3OP2A 3PNZA 4IMDA 3VFCA 2I9EA 3M5XA 1Q6QA 3U57A 4NRRA 5K9XA 4AVFA 5EGRA 5C2XA 5SWUA 1XLDA 1C92A 1UZ4A 2VWTA 1UC5A 1NFBA 1UHVA 3N2MA 5BYWA 3MANA 1Q3NA 3TZNA 1W1TA 4IX2A 3TC3A 1XBXA 4CCDA 4D6JA 3VIPA 3DG3A 4C7GA 2VC9A 2PLMA 1BQGA 1E6SM 4TMBA 1RHCA 2HK0A 3MDWA 3PZIA 3OQEA 2CCRA 4B16A 4X22A 1A0CA 1CZ1A 4KS0A 3OZOA 3C61A 5KETA 1BWLA 1GONA 3WF2A 1TWIA 3MI3A 3NUKA 2JIEA 1O60A 2QCFA 4J1OA 3VUSA 2IPWA 4JQ1A 4ZOAA 4HHPA 4GUGA 4HHLA 1XLMA 3S42A 3P5ZA 1DPMA 4NAFB 6TAAA 2OGJA 4QSHA 1JCLA 3T7VA 4CD7A 1RP9A 1SJCA 1M65A 5KITA 2KAUC 3W7OA 2VVNA 1C93A 2CHOA 2EKGA 1OGSA 5CJ5A 3LNPA 3RO6A 4IIFA 3Q37A 1Q7MA 3KX6A 3EX3A 2VKZG 4BWLA 3AHTA 2X16A 1IWAA 2SFPA 2MNRA 4G1KA 2EJAA 3W7KA 3MMTA 2A79A 1I75A 5JIPA 3FV9A 1CXEA 3CLWA 1XR2A 3VNIA 1W1ZA 4MOZA 1CENA 1OFAA 4GYJA 5HWMA 2WJEA 3GC4A 4LBUA 3SUSA 2XFYA 3GG0A 4K7VA 5MKGB 2PLCA 4YL2A 5HR7A 3ABOA 4TUFA 1EA9C 4NZFA 3CEUA 3WLHA 2PU0A 3S0CA 3TWAA 3BLPX 4WXYA 4S2BA 3CIWA 2WJZA 1EYWA 2BY1A 5CPMA 3AYRA 1O66A 3FJLA 4FNSA 3S6OA 4AZHA 2GJXB 3GG8A 3M1ZA 2YLAA 4L1GA 3MP5A 1FCBA 3WLMA 3BG5A 2IPGA 4WY0F 5CKSA 2BOEX 1NEYA 3QR1A 4B5TA 3QQ1A 4P8UA 4NZ3A 3PWIA 1YX1A 4ZQOA 3CL8A 4HMCA 3ZZ1A 6PTDA 1OZQA 4HK5A 3W7LA 2YYUA 3TJ4A 4Z08A 2VUYA 2J78A 2NUXA 3FYPA 1IR1A 3JRKA 3MTWA 5KZ6A 4D1IA 3CK5A 2V5KA 4DNHA 4ZB5A 4GLEA 3E49A 4DUXA 3IK4A 3GXDA 5DN1A 3VCRA 3W7EA 3R2GA 2BWGA 2G97A 2UWFA 2HBVA 4U3AA 1ELSA 4YWSA 1UD5A 5E9XA 4IQDA 4FO4A 4U10A 2ZVRA 3IIOA 3AXXA 4CKQA 5LHEA 1JD9A 3M0VA 3TOYA 3CH9A 1US2A 3SCTA 3ZLGA 5K4ZA 3NL2A 1W5MA 5C0QA 1ITUA 3SR7A 5U7SA 4JL2A 2DT3A 4ZBCA 2X0SA 3W75A 2AMXA 2AQOA 2C0HA 3L4VA 4H7ZA 4DJDD 4XAZA 1SZGA 3N2XA 4QR6A 1FWDC 2Z26A 1N7KA 1U2YA 2FVMA 1BYCA 3TCEA 3QPZA 3IRSA 1ONRA 5AN7A 3OZYA 1XIGA 1K6WA 3R0DA 5EFFA 1ML1A 1AUSL 1ZQ5A 2BX7A 1OCBA 2J6VA 1AQFA 2PFHA 3GXIA 3FOKA 2UY3A 4NU7A 3ZSTA 3TLQA 4X0NA 5BRPA 1PZ0A 1AW5A 1VZWA 3PZUA 1R46A 1J0YA 1S5WA 2ZIDA 1GVRA 2Y63A 3H55A 4XB3A 1XISA 3V5OA 2GQ9A 4PUDA 4HD5A 4S3DA 4BI7A 1XW8A 2Z1SA 2ISFA 2WQDA 4LS1A 3E0FA 4JTDA 2A3CA 3RMEA 4EF8A 4BKNA 2YDSA 3KEHA 4LVAA 3GDMA 2WC7A 3P8JA 1JCYA 1KXQA 2QAPA 3TW7A 1O7AA 2WYSA 2I1OA 3UNTA 2FH6A 2X40A 3N2TA 2Y8KA 3CQIA 3FKKA 2E6DA 1KB3A 3TTQA 4AHQA 4I3GA 3TH6A 3QLLA 1G1YA 4UFKA 4JD4A 3N6QA 3WLQA 5HMFA 1KXHA 3KVJA 3A4XA 3DXIA 3TXZA 3CUGA 1W9UA 3CUZA 3GVQA 1OX4B 2YPIA 4J3XA 2Y61A 4BF5A 2XM1A 4J27A 1RZMA 1LL6A 5AYYA 3TA9A 5AZ0A 3W07A 2WMIB 3LPFA 1R5YA 2MANA 3CO4A 4HMEA 2JKAA 1GPFA 4YCPA 4ZQRA 5A6KA 4AH7A 4KWSA 4LYQA 3ICJA 3NQMA 3QKEA 1MXDA 1QMLA 3PHAA 1QW9A 3EXTA 3H54A 1XLLA 1Y7VA 3CL6A 4A05A 3FY1A 3H2AA 4MNJA 2AAMA 5FAGA 3AC0A 1V02E 2PODA 2V3GA 1ADDA 2Q3OA 1NP0A 1LYXA 1PJ9A 3C3UA 4KEMA 1U5VA 3WLKX 3NO3A 4LS2A 2PURA 4ZSUA 4Q22A 3I65A 3THUA 3T40A 2WV8A 3W86A 4W8LA 1TB3A 1M41A 1TYGA 1H7RA 2E5DA 3AAMA 3NZ1A 4MYXA 1PUDA 5HPCA 2GPTA 1S1PA 2Y2WA 1IWPA 1QT1A 4DO5A 3M7SA 1TTPA 4IGMA 3DFTA 3CPGA 1I8JA 3RX4A 4R3UA 3K8MA 1LBMA 4P8VA 4TTUA 1ZP3A 1CXFA 1UP0A 1XSKA 4MNKA 2YXXA 4M7TA 4NHVA 4Q33A 4XUYA 4N7QA 4Q4SA 1YTEA 3UZJA 1F8MA 4W7WA 1XQLA 4YVXA 3JUGA 3TZFA 3L66A 4UC5A 4GISA 3BAJA 1Y8BA 3GUGA 2RH9A 4XAFA 3I3DA 1JNEA 4Z0SA 3EB2A 3VNMA 4WJ8A 1UWAA 5A5WA 1Q6FA 5GJMA 1J8VA 1EGMA 1ADSA 2A4AA 4I5XA 4F48A 3DZ1A 3KDOA 3SRKA 1CGYA 3URBA 3AIUA 1I0BA 5F2GA 2GDQA 4M6PA 1UH4A 5JMUA 4AXNA 3HMJG 4CN6A 1QCWA 2JALA 3S1XA 1DXEA 3POHA 4US6A 4J40A 4AD2A 3AMCA 2W3ZA 5A8PA 3HPXA 2W92A 4KIEA 3L5LA 4P8XA 1LOQA 1BVZA 1UP2A 5DT7A 1A3HA 3ZT6A 1KFKA 1UPMB 3HPAA 4MPKA 4B3LA 2Q01A 4WJXA 5HNUA 4JX5A 1OX5A 3MC5A 2BXVA 2O92A 5C70A 4NQ1A 3E9AA 2FLIA 1PPIA 4YN5A 5BMXA 4WF7A 2ZC8A 4DZAA 3LRMA 2YL8A 1YBQA 3W25A 1M5WA 2R24A 4LC8A 3B4YA 1GOKA 1W9PA 2OO6A 3SQLA 1PIIA 5BROA 2XGIA 1SQ7A 3LU2A 1Q4NX 2GJRA 1W1A1 3FN9A 2WPBA 4HYWA 4AZCA 1V6VA 2LLEA 4UTIA 1ZZMA 2XWDA 4UTUA 2FIQA 3BAIA 4YIWA 5C9RA 2BGSA 3RLUA 3LSBA 3I7RA 5KZDA 1G4PA 2WMHA 2WSQA 2F8QA 1EOKA 3NG3A 2ZRXA 1KFEA 3PFMA 3OJGA 1M9HA 1QOQA 5AZ1A 3DFHA 3ITYA 4GGBA 1DJQA 1UW9A 1UG6A 1W6TA 4D6FA 3CS2A 1CGWA 2VEGA 2E6AA 2J7BA 2BFGA 3COTA 4BI6A 1M1BA 4ZO6A 1TPWA 1TZZA 5T91A 1N8WA 1GG1A 7REQB 1FHVA 2QJMA 2VELA 3UR7A 3HTWA 4YCOA 3WQCA 3S8HA 2AL1A 3VNKA 3ELFA 4FLRA 2VD9A 3VCNA 2PTZA 3PAJA 3G3DA 3FW6A 1LBLA 3AFBA 2XVPA 3P5YA 1XICA 4MHBA 1L6FA 3U9IA 4ICMA 2PTYA 3ABQA 1GQJA 3G1RA 4LVGA 2IPJA 2HXTA 2YR1A 2HV5A 1R3RA 3TQVA 3P62A 4UQBA 3WQ5A 2Y1HA 2ZRYA 3C2EA 2QCCA 3KL5A 4JXCA 3P60A 4BQ4A 1XC4A 4B9ZA 1QPQA 3W1XA 4EVZA 4ATWA 4N9EA 2PC4A 5C9XA 2WWDA 4MLRA 2YA0A 4RLIA 3WQPA 4AX6A 4GXMA 3TQPA 2YB4A 5ECVA 3B8IA 4DUVA 1H7XA 1JAKA 4GYKA 3W1PA 1GYNA 4OV4A 4KRZA 3KBMA 1UH2A 1Q2SA 3BGGA 3AYTA 3UVAA 5LGZA 1A5SA 2CZEA 5C8BB 1JRCA 3JVAA 4AQLA 2NV1A 5EL1A 9CGTA 4O0QA 1HKMA 2GUUA 2VEPA 1ZBVA 1DIOA 4A29A 2F6KA 3CB8A 4J7RA 1XCWA 4Z2HA 3EX2A 1A53A 3GHRA 5HNTA 1HNYA 4OZOA 2I56A 3U2CA 5DCDA 2DH2A 1CBGA 4JX6A 2JEQA 3QMTA 1O5QA 4B91A 4XBJA 1VPYA 3V1HA 1E4LA 3TR2A 3D47A 3LK6A 4MB4A 3MMDA 2P1FA 3WLRA 2BVYA 1DJYA 3MHUA 4PCFA 4GC4A 3A13A 3WLNA 1X1OA 4LB3A 4E3TA 2J77A 4A22A 2ZRUA 4HU4A 4QNWA 3NQ6A 4RCXA 3STEA 5D2XA 3GR4A 3LQGA 3KZSA 1EJTC 1EHNA 3PZQA 5J5DA 4H6RA 4O11A 3LHYA 3Q58A 5FACA 2ISSA 5FIPA 1IIGA 2GUYA 1VAHA 2DSUA 4LWWA 3ARTA 2JE8A 3IV8A 2VURA 1VJZA 3TAOA 1B90A 3M4HA 5GJPA 3UWEA 3CMJA 1LL7A 1XYMA 2WZEA 4HPNA 1W3LA 4C6KA 1T0OA 1EDGA 2DUZA 2FDSA 1O5XA 3DIPA 4BEQA 3STFA 2J7FA 2FZDA 1DL3A 5D2YA 1TV7A 4X63A 3EKZA 3ZVIA 4K39A 1KA9F 4HKPA 1GUVA 2FTPA 3H53A 4Y90A 4NJHA 1XYFA 1EH9A 2Z25A 1VC4A 3LHUA 5CPSA 2NQJA 3DDMA 4EWJA 1EJUC 1UD3A 1R0MA 3FK4A 2PWHA 4GIEA 1IT8A 3LHVA 4HHHA 5LKYA 4TX6A 3AXHA 1E0WA 3QH2A 1VD6A 2PDQA 1EX5A 2CKSA 3IIPA 2NV2A 1GQKA 1KKRA 1I2QA 3R0UA 3DKLA 1LT7A 1VENA 3WL0A 2XFRA 8A3HA 4AEOA 5I3JA 2ISVA 5D30A 3KHDA 4HMDA 5HAOA 5CQ1A 3Q65A 3PBYA 4ZE4A 2ZX7A 3IJIA 4U2YA 3GYCA 1LG1A 3OVRA 1E3XA 4C6LA 4PMRA 1FWTA 4XZIA 3P8IA 3EB4A 1DE6A 1JCMP 2OU4A 1EWDA 4XAGA 1ME9A 2NX3A 3WD0A 2WJFA 1K7FA 1R9YA 4AUBA 2F84A 3BH4A 3MB9A 1E6ZA 4ADSA 2X09A 3MJYA 3NQEA 2PF0A 3G6MA 3GDRA 4DPPA 3VABA 5I3HA 4JTRA 2XFWA 3GFYA 4TX8A 3LTPA 4JIEA 2B7NA 4F0MA 4GCAA 2OXNA 4HP5A 2G4FA 2VOTA 4S23A 2OLHA 1K6AA 4JTTA 4WOQA 3N4AA 4JIIX 3HJEA 1V6UA 3TFXA 5K9DA 1AQ0A 1F8IA 3CQJA 4W93A 2UY2A 3WUEA 3ZJKA 4LVDA 4PBGA 3LBMA 2ZC1A 2OEJA 3R11A 4L6HA 3O6DA 3I68A 1UJQA 1BWKA 2D2GA 1QOPA 1Q7QA 3OU8A 4Z1AA 2PA6A 4DEFA 3VI2A 1DQUA 2QMKA 1J0KA 3CWHA 1V6YA 2OX4A 5HQMA 2XVGA 4I7UA 3WUBA 4F2BA 4O4WA 3UFYA 3WQWA 1YMYA 3W72A 1IGWA 4WD0A 1JQVA 5IOBA 3LBOA 5FF3A 4UTTA 4LOCA 3OBAA 4E2OA 4XAYA 2NXHA 1W2VA 4CD4A 1G94A 1Y5VA 1B2YA 1ZJIA 5CZKA 1GOMA 3SO7A 2INFA 4WDUA 3TP4A 3HMCA 4ACZB 5HQEA 1NTHA 3A64A 5A8GA 2G50A 4OBRA 2VCCA 2X7WA 2ZFAA 4PULA 1TA3B 4JTGA 3V0UA 2R1NA 3G0UA 5T9BG 1IXNA 4JGDA 3VA8A 1QNSA 4JICA 2ZZ3A 3RG6A 1CTNA 1FCUA 5HWNA 4GQQA 3VXGA 3PNUA 2FYMA 4H4IA 1B57A 1I2PA 3SJNA 4NZJA 4QTGA 1H49A 2ESCA 4V2XA 3LN3A 1QU4A 4Y6GA 4JQAA 4F0LA 1GZJA 3TAKA 1OC5A 3T0DA 1P0EA 3B8VA 4IXHA 3ATZA 5DMYA 1ZBWA 3L5AA 1AL7A 2VC5A 3R79A 2I5GA 3IS4A 3SN1A 1K9EA 2W67A 3QOMA 4XWUA 2V2DA 1QHZA 2C18A 3EWXA 1WB0A 3CT7A 4C5ZA 5AHNA 4LAKA 3FSUA 4JCMA 2DSVA 2QCLA 4L4LA 3ZR5A 2NV9A 1PDZA 3HBLA 4ZO8A 1RY0A 2BG5A 3L9CA 4EWND 1RK5A 3B9EA 4RZ6A 3IARA 2IKHA 3MO4A 2B7QA 4O8RA 5H8UA 3PBMA 2FMOA 1GCYA 2ZUWA 2W61A 3FHAA 5I03A 2W0UA 3T8LA 1J4EA 5I24A 4PUWA 1FDJA 2INZA 2Y0FA 4PB4A 4MJ2A 4H8HA 5A6LA 3FSTA 1DJXA 4B5XA 5I06A 4WIWA 1EDTA 2ACRA 5CSSA 1JL8A 2INEA 4I6KA 4PZVA 2EHHA 1ISXA 5D8WA 4GKLA 2CLMA 2YCLA 3ZSSA 3U0HA 1XHGA 5FEXA 1QTWA 4LCRA 1O68A 2V3DA 4IPJA 2VGIA 1CXKA 3EOEA 4O19A 3HB9A 1NDVA 4PEEA 4QGCA 1VEMA 3I3EA 2BGNE 3POCA 3FCPA 4LH8A 1UKPA 3B0XA 4W86A 4J28A 1NFPA 4H2CA 3S5SA 4Z42C 1VBRA 5AYIA 1YE6A 3IJLA 2CBUA 1Z44A 3LQLA 3BUVA 3FJ4A 3EWUA 2EEXA 1P0BA 3BSMA 2H3DA 3GTHA 3G1YA 3M0JA 1BVNP 3UWVA 4HZ8A 1XLJA 3SURA 2NWRA 2J66A 4QISA 1U1UA 1L2QA 2F7FA 3MBFA 5CZTA 2E5BA 3H12A 4MAVA 1HQTA 3EDFA 5LXXA 1US0A 1O94A 1DORA 4AFYA 5A6BA 2Z6JA 2J6XA 4WX2A 4J3ZA 1UASA 1L6YA 4D9PA 1KFCA 3ITLA 2J7GA 4JFWA 3ALGA 4HZ7A 2R8WA 3S9IA 1GG0A 2DSZA 4UR7A 5AHLA 3S9ZA 1RBLA 1JDFA 1TWZA 4WOZA 1DQWA 3W7NA 3M64A 1XBZA 4WLCA 3S5YA 4KT2A 1OIMA 3MW7A 4CEXC 1EGZA 2V6AA 3E12A 3K4DA 1LP6A 3LI0A 4C6CA 3MHGA 1XIJA 2V2HA 1EBGA 1NOWA 3PZOA 1WKYA 1NDWA 1Z48A 4H9VA 1NY1A 4I5RA 3NVDA 4AXKA 1GVEA 5A2BA 4UCFA 1DIKA 3SB0A 3WCZA 4RL3A 1K8CA 3HPSA 4B3KA 4A3RA 2XISA 3LS9A 4JTEA 1KW1A 2XGBA 3QJAA 2DIEA 4XVEA 3VX1A 4P7OA 2XSXA 4E2BA 2WLZA 1A5NC 3W84A 2QUTA 3BMXA 2I5QA 4V1XA 4TV5A 3WX7A 1NM9A 7ODCA 4C6DA 1AG1O 1IR2A 3RDKA 4URIA 2WZMA 3THCA 3GK0A 3A3XA 2ZXQA 1B9BA 2FHBA 2YFNA 1YADA 3L12A 1DXFA 1JDCA 3AZSA 4GUFA 5A8MA 5D02A 3IRDA 1TV3A 4CQ9A 5KSWA 1ZJHA 2WVSA 2WSPA 1GVOA 2XHYA 4AMAA 1CLKA 3SGGA 1Q85A 2WAGA 1CYGA 3WNOA 4DZIA 1WBHA 2FJKA 2W79A 4OJYA 1XPGA 3DGBA 3C3NA 4BQ3A 3FXGA 5LZLA 2Z28A 1J6OA 4CQAA 1MFVA 4UFHA 1KQZA 1PIFA 1ZY9A 1TPB1 3W83A 1E0TA 1D2KA 1ISVA 1HW6A 1YXDA 3KOWA 2CWXA 1ZHAA 5LGXA 1JCXA 1IGSA 3VIJA 4JX4A 4C60A 1KM1A 1V0LA 2R6OA 3M0XA 2ABAA 1AA1B 1BTCA 2ZZ4A 3FDGA 2VZOA 4XIAA 4PRWA 4TVCA 1VB9A 4DM1A 1QO5A 1TZ9A 3U4AA 1WBJA 1UUMA 4AEFA