3N17A

Crystal stricture of e145q/y227f chitinase in complex with nag from bacillus cereus nctu2
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
326
structure length
326
Chain Sequence
LGSKLLVGYWHNFDNGTGIIKLKDVSPKWDVINVSFGETGGDRSTVEFSPVYGTDADFKSDISYLKSKGKKVVLSIGGQNGVVLLPDNAAKDRFINSIQSLIDKYGFDGIDIDLQSGIYLNGNDTNFKNPTTPQIVNLISAIRTISDHYGPDFLLSMAPETAYVQGGYSAYGSIWGAYLPIIYGVKDKLTYIHVQHFNAGSGIGMDGNNYNQGTADYEVAMADMLLHGFPVGGNANNIFPALRSDQVMIGLPAAPAAAPSGGYISPTEMKKALNYIIKGVPFGGKYKLSNQSGYPAFRGLMSWSINWDAKNNFEFSNNYRTYFDGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of bacillus cereus NCTU2 chitinase complexes with chitooligomers reveal novel substrate binding for catalysis: a chitinase without chitin-binding and insertion domains
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
molecule keywords Chitinase A
total genus 115
structure length 326
sequence length 326
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n17A00
1FP9A 1UH3A 3A4AA 1KXTA 5HPOA 1QI0A 5KZ6A 1X6LA 3OLIA 4JKMA 4CVWA 1AQ0A 2GJPA 4XZBA 1JZ3A 1CYGA 3QR3A 5D9OA 1QNQA 3RDKA 5A1AA 1CXFA 2WVTA 1GOMA 1QI5A 1V6WA 2EO7A 1CXEA 1NWSA 5I77A 5E70A 2E4TA 4Q7NA 2W63A 2DT3A 1J0YA 2J8FA 2BY3A 1XRVA 1ITCA 4W85A 4TOQA 4U31A 1QW9A 1WNOA 3B9AA 1Y7VA 2WYSA 1KXVA 1UR1A 3AMDA 3FNDA 4E8CA 3VU2A 2J7BA 1JL8A 3PZNA 3QOKA 1US2A 4AZIA 3VTRA 3FW6A 4JHOA 2PWEA 6TAAA 4BQ3A 3N13A 5CSUA 1VENA 1UD5A 4N42A 1OGGA 4UFIA 2GFTA 4GIAA 1GOIA 1UZ4A 1R87A 2A3AA 1UUQA 3O2LA 2PWGA 4PMDA 1QBAA 4JKLA 4DWSD 3II1A 3AMGA 2VVSA 4B16A 3WDIA 5IFTA 3PZMA 2GJXA 2E9MA 3AMCA 4U3CA 1XD0A 4XB3A 5I23A 3JUGA 2QMJA 1LWHA 3ALFA 5FL1A 1BF2A 3MUIA 3I3BA 1ESWA 1HX0A 3AS3A 4OIFA 2IUZA 4FMVA 3MV11 3CO4A 1VRXA 3BGAA 1E5NA 3W37A 2ZXQA 1B3VA 4MB5A 4HOXA 2GK1B 1I75A 1V08A 1XHGA 1GONA 1JF5A 3CIVA 3VMNA 1KCKA 3SUVA 3NIYA 4P7QA 4W7VA 3ARSA 1DWGM 2BY2A 1MFVA 5LYRA 2BY0A 4BQ4A 3WF3A 6CGTA 4MDPA 4TX6A 1BAGA 3QHNA 2YKKA 5JIPA 3L4XA 3O9NA 1LWJA 4OBSA 2DGAA 1HJWA 3M6DA 1WAWA 4R27A 4ZXOA 2FH6A 3M7SA 1B31A 1CXIA 2UY4A 1XC6A 2NSXA 1V3KA 4JCMA 3SCUA 3FAWA 1E71M 1H0GA 3K8KA 3VD9A 1XSIA 3AI0A 3SIMA 3OGSA 2A3EA 1Q6GA 2XJ7A 1IV8A 3VD5A 2XVNA 2QHAA 3WUEA 2WLZA 3WFZA 2DSZA 1SFSA 1W9DM 1C7TA 5A3HA 2GJXB 3KE0A 2VX6A 4NRRA 3VGEA 2JIWA 2EPNA 4HZ8A 4AD0A 2WMJA 5JUVA 3CUHA 1J11A 2DT2A 1NM9A 1QW8A 3VVGA 1HP4A 4GPNA 1QHPA 4ZEPA 4NF7A 4B9YA 4E2OA 2O9OA 5JIWA 3PBGA 2OSYA 1FP8A 4LYQA 4L4PA 3UESA 3EBVA 1VFFA 1E6NA 2XFRA 1UR0A 3AS0A 1BVZA 5BXRA 2W67A 2OYKA 3UERA 3CHCA 4A4AA 2G3MA 1FFRA 1MW3A 2VCCA 1L0PA 3O6AA 3TOPA 3T0DA 3ARPA 3BAIA 3WDHA 4JFWA 1KCLA 1PX3A 1J01A 1TFVA 2EXOA 1TA3B 3UG3A 2ZUUA 1H1NA 3WNLA 2Z1SA 4WF7A 4FLRA 4EKJA 1DEDA 5C71A 4M82A 4P8WA 1JZ7A 4ZE5A 2ZX6A 4OJYA 5A8MA 1UR8A 5A8NA 4WK9A 2V3FA 3ARWA 2W5FA 3WQVA 3L4TA 4GZEA 4U2YA 1JD9A 2WXDM 4FLSA 4HOWA 3MUAA 2BS9A 3VGGA 1L8NA 2CYGA 3W28A 1GPFA 3WL0A 2OWWA 3ZJ7A 1JZ2A 3F5LA 4S3KA 3T09A 4D6CA 1K6AA 1KWKA 4HMDA 5A69A 3WN6A 4Z2JA 3SCVA 1GOOA 1LQ0A 2VUYA 2CKRA 1UR4A 1NWRA 1UD6A 2EPMX 3VMPA 3AMLA 2J7CA 3DYMA 3AHZA 2BHYA 3WF4A 1OGBA 3F5JA 1ZL1A 3SEPA 2CHOA 4WIWA 4AZ6A 1IT0A 3VUPA 1GNXA 4UTFA 3CUGA 3ZR6A 4IUGA 1EOKA 1GHRA 1W2VA 3FHQA 1VJSA 3G6LA 5BROA 4CU6A 4GI9A 3GXIA 4EAMA 3U7VA 4DUWA 1E40A 1PX8A 3A4WA 3VM5A 1E6XM 4AD3A 3EDFA 2ZUTA 3WD1A 3CMJA 4AZ7A 5IXEA 2WZEA 1NH6A 4JHZA 3EMQA 4QLJA 1D2KA 2VZUA 2OSWA 5I78A 4CCEA 3CMGA 1V03A 2X09A 3BAJA 1VFUA 2DSVA 4PN2A 5LA1A 2WANA 4BCEA 3AYRA 1VBUA 2E0PA 1C90A 2J77A 1RP8A 1TE1A 4L4OA 1W1PA 2J78A 3EMCA 1AQMA 1E6ZA 2XVKA 2V38A 1CTNA 5CLTA 1OCQA 1E0WA 1GZJA 2VX5A 3AIWA 3SCWA 4HMEA 1TA3A 2ZXAA 1E4MM 2EQDA 2EPKX 4IISA 1XH1A 3VD4A 5BCAA 4WSJA 1EIBA 4UFJA 1UH4A 2O9RA 1OSEA 3PZVA 1HNYA 3NUKA 4P7RA 1LLOA 4GO9A 1QHOA 3FN9A 3M46A 1ZJBA 4QLKA 2V5DA 2CPUA 2W61A 1GQLA 1BGAA 1ODZA 1K9FA 3VDBA 2GVYA 4CGTA 2J4GA 4JZ5A 3FAXA 2WMHA 1H2JA 1W1VA 4MB1A 1ZBWA 3WEMA 1JGIA 2WLYA 4M24A 1BG4A 4UQDA 4UFKA 4AEEA 7TAAA 5CJ5A 1HKJA 4OOUA 5I2UA 1JYVA 2YDQA 1V3MA 2YL6A 1KQZA 2CBUA 1G0CA 1V0KA 4V28A 1JYNA 3ZT5A 1HVQA 4GZJA 3GH4A 2C7FA 3DHUA 2W62A 2VMFA 1CXLA 1TVNA 3MMUA 1V0MA 1JYWA 4W93A 1FFQA 4C7DA 1Q4NX 2WSKA 4CCCA 1JXJA 5CLWA 2Z1KA 5EFFA 1B3WA 2WHJA 2DT0A 4AYSA 3N12A 1RPKA 3VM7A 3NSNA 4ATDA 5CSYA 3DHPA 2X05A 5M03A 1GQKA 1ISWA 3WD4A 1CLVA 5GNZA 3AHVA 2WWDA 4MPKA 1BG9A 3PTQA 4CU8A 2DT1A 2G3IA 3W38A 2NW0A 1FOBA 2NT0A 1Q6CA 2CETA 3W81A 4MNLA 1UD8A 3WH9A 4CN4A 1J0HA 1P6WA 4HPHA 2BHZA 3MO4A 5FKYA 1B90A 4P8XA 5CPSA 3GDBA 2ZX5A 3VIIA 1XCXA 2VVNA 2XPKA 3D5HA 2ZUSA 4MJ4A 3WBAA 1NARA 1KR1A 1QVBA 4PYSA 4GINA 1ISVA 3GXMA 3HJEA 2FDMA 2VOTA 3BLPX 1LG2A 1XGZA 2X0HA 4PTWA 2VQUA 4OZOA 1V3IA 1U33A 3RM4A 1A47A 3PN8A 2YJQA 3WEZA 3T0AA 1NQ6A 2DDXA 1WZLA 1H11A 4WKHA 4BQ5A 4LXFA 3LPPA 5GPRA 1QI4A 3VIFA 1GW1A 2WMGA 4U5KA 3VIOA 5D4YA 4XV0A 5A6MA 4DUXA 2YL9A 1WZAA 2FHBA 4V2XA 3WF1A 2WHKA 2HISA 4TVCA 5DEZA 3WQ4A 3MSDA 4JFUA 1H3GA 1UWRA 4PTMA 3FY1A 2W4XA 2G41A 2AMGA 3WUFA 2J7FA 1LL7A 4W86A 1VFOA 3L4YA 2D0HA 1XSJA 4AW7A 4UFLA 1G9HA 2ZX8A 3AXHA 1UQZA 1V6YA 1H4PA 1OM0A 1WCGA 1UKOA 2ZUMA 3K4DA 3DYOA 5FCZA 3OG2A 2QLYA 4PSRA 1QOXA 3UG4A 4X0NA 4H04A 1Q6DA 5DF0A 1QBBA 4ATLA 2E8ZA 3N18A 5BXSA 1WDPA 4BF7A 4AZBA 3PZQA 3VDCA 3OLDA 4Z2LA 2XFFA 3AXXA 4F66A 1QNPA 4HA3A 4UR9A 3FXYA 4KGLA 2A3BA 4CUCA 3VNYA 2Y8VA 4RE3A 2GSJA 2EBNA 3DYPA 2D3NA 5A8QA 3ZJ6A 3UEQA 4WLCA 1UKTA 5AY7A 4H8VA 3EDEA 1UR2A 2YLAA 4JL1A 1CLXA 4N0RA 3TONA 1SMAA 5BXPA 4AD5A 4IPNB 4RL3A 3W25A 3AROA 2GK1A 2ZX7A 2J25A 2XVGA 1XCWA 4M81A 3WDPP 1CGTA 2DH3A 2FH8A 5A6BA 5CPQA 1R7AA 1D3CA 2CERA 1PAMA 2VRQA 2ZICA 1NWTA 3GH5A 4PUDA 5AC4A 3N15A 3GM8A 4W8LA 3W4RA 1K9TA 1PZ3A 4H8UA 2WC3A 1JYXA 4PEEA 2Y8KA 1KXHA 4AZHA 2FGLA 2J7HA 1BYCA 4LYPA 1DWJM 1PPIA 3SUSA 3RILA 1XH0A 1ZBVA 3CH9A 4P7OA 1CBGA 1ISZA 2ZWZA 1BSIA 4HZ6A 4GI6A 4WKAA 2QPUA 5CQ1A 1JNDA 3WUGA 1DWHM 3AHXA 3GBDA 2VI0A 4AMCA 1V3HA 2ZX9A 4AZCB 1O6IA 3VGFA 3WMSA 2A3HA 2WHLA 2ZXDA 4HU8A 3VILA 3ARVA 3CUJA 1CGVA 4KWUA 3WMBA 3VX0A 5LA0A 3MMWA 7CGTA 1HIZA 3AIVA 3BC9A 4D1JA 5ABEA 1UWUA 3U5YA 1E0XA 4XUYA 2XUCA 4AD4A 1B3YA 3AOFA 7A3HA 2VR4A 5A6LA 2IXVA 4TX8A 1QPKA 2CITA 2CEQA 1KR0A 4P7LA 2J7EA 1DTUA 1EH9A 1MYRA 1EDTA 3WH6A 1RH9A 2F61A 4GI8A 1G94A 1HN1A 1LJYA 1M04A 1BFNA 1BYBA 1EHAA 4GKLA 2CESA 3K8MA 4FK9A 3VKKA 3EDDA 3CBWA 4ATWA 1JZ5A 3D3AA 1V0NA 1PIGA 1EQCA 4KRTA 1W9UA 2G3NA 5A6KA 4D6EA 4M1RA 4AZCA 1ECEA 1JDAA 2OWCA 3ARXA 2YA1A 1R85A 5HPCA 3N04A 1KBBA 1CGWA 5A2AA 2WM0A 3TTQA 1I1XA 4BS0A 3VGDA 1W2PA 4B3KA 2PF0A 5A94A 4F9DA 5I3DA 1YQ2A 1JAEA 3AHYA 4TTUA 5CG0A 4IM4A 2WVVB 9CGTA 1E3XA 4UQ9A 1N82A 1WE5A 5IHSA 3OLGA 5AC5A 1UYQA 1ISYA 1C93A 2VRJA 4YN5A 5HDRA 1WB0A 1ISXA 3TTSA 3SCSA 1IZKA 3ZT6A 1XD1A 4TVUA 3IAQA 3RM8A 3T2QA 4HA4A 1B1YA 1NOWA 4M80A 5CZKA 3AXIA 2F8QA 3WENA 4UNIA 1OGSA 3CUFA 3MV01 2V3DA 3BXWA 4EE9A 4MTVA 3AZSA 3UETA 1UA3A 2XM1A 5E6ZA 5AYBA 2YL5A 3UR8A 1CENA 3VIMA 1B0IA 4HPGA 3EMZA 5HOSA 1FH8A 1QNSA 4B15A 3BCFA 1DWIM 2V5CA 3UCQA 4J3VA 5D9NA 4C7GA 3GBEA 3GXFA 1HJSA 4GZIA 1B30A 2B31A 2CCRA 1KWGA 2CHNA 2D20A 3VIGA 1V3JA 3FHAA 2D2OA 3CUIA 4QLLA 1C91A 3L4VA 4FF5A 4A3HA 2VQTA 4QCEA 3RM9A 5FIPA 1FHLA 3BCDA 2VC9A 1I1WA 4M29A 1UKSA 1J9YA 5E09A 4CD6A 2VJXA 4NRSA 2Y5EA 1PX4A 2V3EA 3WDRA 3CLWA 2WMKA 3NCOA 3CZLA 2WMFA 3N17A 1UD2A 1EXPA 2WVVA 1ZU8A 2G4FA 4X9YA 1DWAM 4QAWA 3W6MA 2VZVA 4MB4A 5DMYA 4DWSC 4MB3A 5DT5A 4UOQA 5JBEA 1VBRA 3BLKA 5GNYA 3QHMA 3TP4A 2YIHA 4EK7A 2ZUVA 3NSXA 4PBGA 3BH4A 2XGIA 4M56A 1GOQA 3WQ5A 3EDKA 4NI3A 3IJ8A 4E8DA 1B2YA 5CGTA 2XSAA 4U33A 1US3A 1KQYA 2DIJA 1GQJA 3U5UA 2XG9A 3MUY1 4UZSA 1WKYA 2YA2A 1MQPA 5M5DA 1FA2A 4PTXA 4QFUA 2WKGA 2PI6A 3DECA 3N9KA 3K4AA 1ITXA 2EPLX 2C8NA 4J7RA 2XHYA 1ZB5A 2J75A 4CU7A 1UD4A 1E55A 4D72A 2Y24A 1JZ6A 2VO5A 3AISA 2WKLA 1W9BM 3GNRA 3VDAA 2QV4A 1V6VA 4UQAA 3K46A 1GHSA 2VZTA 5I5RA 3PZOA 1Z32X 4F79A 4MNKA 4ZFMA 3NDYA 4Z2KA 5D9MA 1VFMA 5A6SA 2GDVA 2YOCA 1XYFA 1GOWA 4U3AA 2CIPA 1UKPA 4UZUA 1EQPA 1CEOA 1DWFM 3VX1A 3M07A 3L2LA 4FLOA 4HTYA 1W32A 2DPEA 3EYPA 4GQRA 5BXTA 4W8AA 4J3SA 2V3GA 4Z2HA 2E8YA 5E0FA 4ML4A 4W88A 4ZXLA 3N1AA 2BVTA 1V02A 2BHUA 1QI3A 1HKIA 5A8PA 3AIQA 1S46A 3ZO9A 3THDA 1UR9A 5I24A 3WF0A 3WELA 1BPLB 1JDDA 5C8BB 5E6YA 5FD0A 6A3HA 2VURA 1KFWA 4UQBA 2BVYA 1JFHA 1V02E 3WD3A 1SMDA 2ESCA 3WKZA 4PCSA 3PZTA 1RP9A 3U57A 4YHEA 2UY2A 1HKMA 1OD8A 2WZHA 4PTVA 1H49A 4NZCA 4P8UA 4J3TA 3WDQA 3CGTA 1M7XA 1MVYA 1G1YA 1QNOA 1TR1A 4ACYA 3ARRA 1R86A 2VL4A 4UFMA 1HJXA 5BYWA 3CTTA 2WVUA 3S2CA 3NJ3A 2D0FA 2BV9A 3WEOA 1BTCA 3UR7A 1B9ZA 3KL5A 2QF8A 1HT6A 5M3WA 3ARYA 1VEPA 4AIOA 1E4LA 2A3CA 1EGZA 3MSGA 4V27A 5IFPA 1UQYA 4CCDA 3AFBA 1DHKA 1V6UA 2UY3A 3PTMA 1BQCA 5I0DA 1JZ4A 1EO5A 1V6XA 2WMIA 1PJ9A 4AZ5A 4MADA 1XH2A 4W8BA 4LGXA 1JIBA 5D8WA 3T0BA 3A47A 4CD4A 4ZENA 3MKKA 3WY1A 1MXDA 3VMOA 1NWUA 1IZJA 2CBIA 4XX6A 3CHEA 3PZ9A 1EO7A 1OWQA 4KMQA 2WWCA 3GNOA 1TVPA 1VJZA 4TTGA 1G01A 1EHNA 3VDHA 4J27A 1OB0A 4JIEA 3KL0A 3WH5A 1CXHA 2JFEX 3MUZ1 1E43A 1J10A 1VEMA 2ZUNA 1GJWA 3MU7A 5TD4A 1CNVA 1HL9A 3WQ8A 4GO8A 2X2YA 3T2OA 1CXKA 2JALA 1OBAA 1WZMA 3WD2A 3NSMA 1U30A 2D3LA 1GUVA 1OIFA 3OIHA 1EOMA 1WDQA 2MANA 1H09A 3GZAA 4PCTA 4NSBA 2FGZA 1UZ1A 2DSKA 4JCLA 1JXKA 1HP5A 5AYIA 3WF2A 5A6BD 3AIUA 4TVDA 2GDUA 1TUXA 4DUVA 2EPOA 1JG9A 2ZWYA 2GJRA 2EEXA 1J12A 2HVMA 3AS2A 4J3UA 5GNXA 1OT1A 3F5KA 2JEPA 2D24A 3GYCA 3KEHA 4OBRA 1UKQA 1BYAA 3ARQA 2D1ZA 4H41A 3VOCA 4QCFA 4UQCA 5BRQA 2OLHA 2O9PA 4HZ7A 4E4PA 4F9JA 4MNJA 5HXMA 2YDSA 2D0GA 2YA0A 2WC7A 1KGUA 3KWXA 1BGGA 3W24A 1MFUA 5ABFB 5GQBA 1CGYA 4Z2GA 1A3HA 3ZQ9A 2OYMA 4RE4A 4DWSB 3S6TA 1E9LA 2GUYA 2VR5A 3PTKA 4PMXA 4LQ1A 2E9LA 1WZKA 3APGA 1CGXA 2DH2A 3SURA 1M03A 4JFVA 1OIMA 4MNMA 1KGWA 1WDRA 2WCGA 4KGJA 4UFHA 4OOZA 3CHFA 4P8VA 2VX4A 3KZSA 3MANA 3LPOA 5IHRA 1DP0A 3F4VA 1LL4A 1C8XA 3ZT7A 1VIWA 3TTYA 5FOOA 5EMYA 3CZEA 4AIEA 2VZOA 3PHAA 3BAXA 1JI1A 2JF6A 2PBOA 4W89A 4YHGA 3G6MA 1ODUA 1W3HA 4CN1A 4PMRA 4AD2A 2J74A 4AISA 3L4UA 3AMKA 1AQHA 1EA9C 1GQIA 2J47A 1NOUA 4W5UA 2JEQA 1E6RA 2ZE0A 2DQXA 3WFLA 2XSBA 4W5ZA 2Y2WA 1QNRA 2UWFA 1GCYA 3L4ZA 3AYSA 1OD0A 5E9AA 4ACZA 2X8RA 4S3JA 1W9PA 1GJUA 2BY1A 4PMVA 3HN3A 3WSUA 3ZR5A 3SCPA 3CHDA 2XIIA 4AZGA 1WDSA 3ZSTA 2BXYA 3VIKA 3MMDA 2O9TA 2XIBA 1TZ7A 3CZJA 4LYRA 4MAZA 1C8YA 3WNMA 2W91A 3UG5A 2EJ1A 2XVPA 3POHA 3ALGA 1VAHA 5KEZA 2YL8A 5EB8A 3OZPA 3BSHA 1ZBCA 1H5VA 2WNWA 3RJYA 1PBGA 5A95A 3J7HA 2ZXBA 1JF6A 1FH7A 2PWDA 5C70A 3VIJA 4Q22A 4JL2A 4MDOA 2VCAA 3BAKA 4AY1A 3VINA 4QP0A 3ZMRA 4Y7EA 2OYLA 2D23A 4PUEA 4XZWA 3HU7A 1W3KA 3SUWA 3VD3A 1CPUA 2CXGA 3BSGA 1JAKA 4H7VA 4LX4A 3B9EA 1ZJAA 3L2MA 3WD0A 3POCA 1Q6FA 4F8XA 1J0JA 1W9VA 4MJ2A 2CNCA 4K68A 1X1NA 1J18A 3MS8A 4UOJA 1V0LA 5ECUA 3VO0A 1UD3A 2DEPA 4DWSA 1UA7A 4HU0A 1MWOA 3VGBA 1E72M 1E56A 1JNEA 3IK2A 1MW0A 2BNJA 3BAYA 2O92A 4UQEA 1QHZA 1E73M 3WBEA 1CWYA 3AIRA 3WDJA 3ARZA 2PB1A 3SCQA 2WSPA 4U5IA 3CZ8A 2J7DA 1XV8A 1C3FA 3IJ7A 4OUEA 4JFTA 3LPFA 2WBKA 3B9DA 1XYZA 4AC1X 3IANA 2QPSA 1R8LA 4W7WA 3RIKA 3ZOAA 1LL6A 4D6GA 1RD6A 3WQ6A 2X1IA 1TG7A 8CGTA 4D6JA 1J0KA 3DC0A 1JD7A 4D71A 4KRUA 3ZSSA 1CDGA 5A6AA 4B9ZA 1VB9A 3TA9A 3AICA 4CD8A 3AZTA 1E15A 4TUFA 5LA2A 1W3LA 2BXZA 2AAAA 1D7FA 2PBGA 5JBFA 3QOMA 1E4IA 1WP6A 4PMOA 3T2PA 1MQQA 4UCFA 1HXJA 2OWXA 1OT2A 2WK2A 3SCTA 4J3WA 3HMCA 3WL1A 4AXNA 2XWDA 1OINA 3IAPA 3QHOA 3SCOA 1FH9A 2XM2A 2JIEA 1O7AA 5A2BA 2CBVA 3I3EA 1J0ZA 2J8GA 2QMKA 1E6PA 3U7BA 3CZGA 1GOKA 5CPTA 1MW1A 5DT7A 1YHTA 3W0KA 2FHCA 4WSKA 2VRKA 1MW2A 3OA5A 4AEFA 4A3YA 2VNCA 5D8ZA 1W1TA 1UG6A 2J79A 3RCNA 1VEOA 3AIBA 2VT0A 3RMEA 1PZ2A 2WVSA 4YPJA 4CD5A 2G3JA 1HJQA 1H41A 5HBFA 3WH7A 3A3HA 2WW5A 3WIJA 2WHMA 2VCBA 3OB8A 4J3XA 3AS1A 2DSUA 3ARTA 4OKDA 3WNPA 3BMWA 4D6IA 1KBKA 2X0YA 1M53A 4D1IA 3THCA 4ACZB 1B3ZA 4M8UA 3NYDA 3LMYA 1BYDA 1UWSA 1ZBKA 1B3XA 2VTFA 1E70M 2E3ZA 3SUUA 4DM2A 1HJUA 4GXPA 5DFAA 2BVDA 2G8ZA 1CGUA 5EBAA 4U2ZA 1HVXA 4W7UA 1AVAA 3K1DA 1UWTA 3T08A 3AZRA 3SUTA 2J7GA 1PIFA 4HOZA 1UWQA 1J0IA 4BA0A 4R5EA 4QDMA 3IJ9A 4KH2A 4HA1A 3VIHA 4LPCA 1JI2A 3OLEA 3WNNA 3WUBA 5I6SA 1C7SA 3W26A 1E6QM 1H0IA 4AD1A 1Q6EA 4CVUA 5A6JA 1E6SM 2WBGA 3QGVA 3W29A 2ZUWA 5IDIA 3TTOA 3OBAA 1K9DA 2WB5A 1W91A 1NP0A 1E0VA 2J62A 1GVIA 4W84A 3W27A 3ZIZA 4DM1A 3SCNA 5CGMA 4W87A 5FL0A 1CECA 2YBTA 4AWEA 4HMCA 2WZIA 4J28A 1TMQA 1HKKA 2W66A 5DO8A 5HNNA 1HL8A 4JKKA 3OGVA 1UH2A 3E1F1 2XFYA 4D6DA 1C8QA 1XSKA 1C92A 3PZUA 3AIEA 2RGLA 4MAVA 5ABHA 2DIEA 2FHFA 3GNPA 5BWFA 5CXPA 3AQUA 2PWFA 1W9XA 1U2YA 4PSPA 4C7FA 4PMUA 1UOKA 4CKQA 5EFDA 4PMNA 3AHTA 1QI2A 4B3LA 3GTNA 2F2HA 2YDRA 5JBDA 3K8LA 2ZOXA 1SYTA 1BLIA 1R7OA 2XYLA 3ECQA 5E0CA 3CZKA 2XVLA 2PC8A 4TXEA 2BFGA 3VGHA 2ZIDA 1WO2A 3AJ7A 3GH7A 1PEZA 2AOSA 4JAWA 3BMVA 3WQWA 1BHGA 3N11A 2Q8XA 2YBUA 2XGBA 1JDCA 1V3LA 4ZE4A 3L4WA 2DSWA 1W3JA 4BZYA 3KL3A 4PRWA 3PZGA 3A6OA 4RE2A 4EANA 2IXUA 2WCSA 1JZ8A 1JFXA 3GXDA 1SR0A 5BRPA 4GQQA 1MXGA 3EDJA 2WC4A 1GORA 1BVNP 4URIA 1X6NA 1CIUA 5F7UA 1NP2A 1KB3A 2OSXA 2D22A 5A8OA 1W1YA 3ARUA 1EDGA 1FHDA 1EDQA 2WPGA 3NDZA 3WH8A 4PMZA 2TAAA 4X0VA 2E9BA 3PZIA 3RJXA 3WMCA 4D6FA 3OGRA 3A4XA 3WNOA 2XWEA 5M17A 4WJXA 2W92A 4P7NA 1E1EA 2JF7A 3VNZA 3VPLA 3ZJ8A 2YLLA 1LG1A 3LPGA 4CN6A 4UOZA 1UWIA 4JFSA 3VD7A 1AMYA 1E3ZA 2CBJA 5D9PA 2PWHA 8A3HA 4HP5A 1G5AA 1HJVA 2NT1A 2WCAA 1F4AA 3I3DA 2RGMA 1E5JA 2Y4SA 2VZSA 5ABGA 4PMYA 1CZ1A 2E40A 1UHVA 3W53A 4H8HA 3VIPA 4H2CA 1NOFA 1GVYA 2UY5A 1TCMA 3CPUA 2WMIB 3SCRA 3ZM8A 4BQ2A 4CD7A 1VF8A 1HF6A 3W6LA 2WAGA 3WNKA 1KXQA 3ZJKA 1E4NA 2JE8A 4FLQA 5ABFA 1ZS2A 4Z2IA 1KGXA 2VX7A 4D6HA 4AIUA 1E1FA 3BAWA 3RPMA 5I79A 4WKFA 4PMQA 2CKSA 2C0HA 3W82A 1MQRA 1LF1A 1WPCA 3RO8A 2XTKA 1M01A 3OZOA 5A2CA 1F4HA 4IPLA 1K9EA 3B8SA
chains in the Genus database with same CATH superfamily
1AMKA 3OYZA 3HF3A 5HPOA 1QI0A 4JTFA 4LS0A 1VRDA 4Q6XA 4Q8QA 1GG1A 4YS1A 1BWVA 4Y9MA 1JZ3A 3CMFA 3QYQA 5D9OA 1QNQA 4C1NA 3NZGA 1RCQA 1QOQA 3GAKA 3QKZA 1CXEA 5I77A 4GY1A 4Y2WA 5DRCA 1M7JA 2DT3A 2I14A 2W63A 1J0YA 4MLJA 2J8FA 1VQTA 3VNLA 3UPMA 2ZRVA 3V36A 2OT0A 4E8CA 4XUGA 3VU2A 3PZNA 1A5KC 3QOKA 3UR5A 3G8RA 3W7NA 2Z1VA 1KRBC 1AW1A 1V8EA 3FW6A 4JHOA 4DYKA 4O52A 3BK0A 4LB4A 4WDXA 1FCQA 1VENA 3TAKA 1OYAA 6ENLA 2QJNA 1GOIA 1JEZA 4IXHA 5GJPA 3RXZA 1QBAA 4DWSD 5J5RA 1DJQA 1E0TA 3LQGA 1DKWA 2CLHA 1RK5A 3VC6A 3W7LA 4AHPA 2OQYA 1YEYA 1EA0A 3T40A 2ZTJA 3TXZA 3HQ1A 4XB3A 1WDWA 2FVKA 4DBUA 1MRQA 5H1WA 1GZGA 1LWHA 3MUIA 2XSXA 1ESWA 3AS3A 1H7XA 4XKMA 3GDMA 1S2AA 4Q8WA 4WDTA 3MV11 3CO4A 1QW7A 1E5NA 1B3VA 4MB5A 2CW6A 5KSWA 1Q8JA 1RJRA 2GK1B 3WLQA 1V08A 1XHGA 3HMJG 4F2UA 4YNGA 3DENA 3TW9A 4O11A 3VMNA 1XLHA 4DJFA 4QSFA 3W1AA 5BW6A 1DWGM 3WQOA 1HZYA 4FHAA 1R3QA 5LYRA 2B4GA 3WF3A 3W7IA 4MDPA 1BAGA 1HKVA 1XLAA 2X7WA 3QHNA 2NQHA 5LSMA 1UJPA 2X1TA 4F2BA 3LGEA 4DJED 4R27A 1LRQA 4ENLA 1GTHA 4CNTA 5DMMA 1KBLA 1DQXA 1CXIA 3FKRA 1BXBA 2C91A 4H9TA 4JCMA 3FAWA 1E71M 3IUIA 3K8KA 3SN1A 2XJ7A 3ITTA 3GR7A 3WBYA 1A50A 4MJMA 2DSZA 5C2XA 5AVHA 1XINA 3U2EA 1ONWA 4LUTA 1C7TA 2GJXB 3VGEA 1K7EA 3B8WA 4CLMA 4JTKA 3DDMA 4HTBA 4GQ0A 5TAOA 3UU0A 2A7PA 3RX3A 4GPNA 3VZXA 1OFRA 5TBOA 2OTDA 1QK2A 3PBGA 4L4PA 4IPJA 4ZB0A 4YU1A 3SECA 4O4WA 3EBVA 4WHBA 2XFRA 1FWAC 2I17A 3W1NA 5BXRA 2QGYA 2OYKA 3UERA 1Z7AA 6XIMA 5HWMA 3ORWA 4A4AA 1MW3A 3IGHX 3BQ5A 3O6AA 3TOPA 1DJIA 1Q6LA 3ARPA 3H26A 3BAIA 1KCLA 3L23A 3M0MA 4Q4RA 1PX3A 1LUCB 1TFVA 2ACRA 5J8LA 3TYZA 2ZUUA 1I4NA 3WNLA 2QJHA 4P8WA 3BW2A 1UUMA 4HYVA 3PVFA 3WLKX 3W2LA 4GGBA 5A8NA 3NEHA 3MTWA 5F1VA 1XS2A 4WK9A 2V3FA 4C1KA 1AH0A 2O7SA 2GQAA 2QIWA 4FLSA 1YLVA 1ZQ5A 3GC2A 3W28A 3NPUA 2NWRA 3VKAA 4IUOA 3TJLA 4XTDA 3MVIA 3F5LA 3EEGA 4P5UA 1XG3A 2W3ZA 1UZHA 2C6QA 3OZMA 1UR3M 2CKRA 1UR4A 3BLLA 1QJWA 3W85A 2BHYA 3WF4A 3SEPA 5HJLA 1M1BA 2HV5A 3ZR6A 4IUGA 2NX3A 3HPFA 3GXIA 1OY0A 3BLFA 1TV4A 1PX8A 3GDTA 1KRCC 3VM5A 2YZ5A 1ML1A 4RUBA 5HQMA 3CH0A 4AZ7A 1PDZA 2OB3A 2WZEA 4AXKA 4JHZA 5E9XA 3EMQA 2EG8A 2OSWA 5I78A 3CQKA 4C6KA 3S6OA 1V03A 2X09A 1VFUA 2OQLA 5BZAA 1S2TA 1XPGA 4JY9A 3TU9A 3CQHA 3P67A 1RUSA 1W1PA 2YYUA 4PCFA 3W2JA 3SZ8A 4RX0A 2O56A 3KRBA 4RDWA 3PB0A 1E4MM 3DHDA 1UMYA 3O6DA 4IISA 1JPMA 2OMAA 4WSJA 2VFHA 4MMWA 1HNYA 1LLOA 3DEQA 1WUFA 3VKJA 3M46A 4LS2A 3EKLA 1TYGA 1BGAA 1ODZA 1S2CA 3ATYA 1QNVA 3N2BA 2GVYA 4CGTA 2V8ZA 4IP4A 4WCJA 4DYJA 4KCTA 1JGIA 3RAOA 3NL6A 5CJ5A 3E74A 1OJXA 1JYVA 3QVQA 1EYWA 4GG9A 1G0CA 4V28A 1JYNA 4DJFD 1HVQA 3GH4A 3A5VA 2C7FA 1WBJA 3M43A 2HQAA 3URNA 4GXMA 5FJPA 1JYWA 3N9SA 4S3DA 1O5XA 4C7DA 1OFDA 5CLWA 2PDQA 5EFFA 1LLWA 3HG4A 2R1PA 2WHJA 2REQB 1I2PA 1NF0A 2ATSA 5FACA 1RPKA 3VM7A 4GMEA 3DHPA 2B7PA 5HUOA 2E1WA 2Q09A 3H7RA 2WWDA 3SJ3A 1FRBA 1WOBA 1KV5A 1MXSA 1G69A 3TNOA 5CZ0A 1FOBA 2AGTA 4RNIA 2PEVA 4UMAA 2NT0A 4WDUA 1EX1A 2ZVIA 2CETA 1GOXA 4F0SA 3WH9A 4DYEA 2GDQA 4CN4A 3QV8A 1GYNA 1KM4A 4HPHA 4JTSA 5CPSA 1OFAA 1M5WA 1DIOA 2GZXA 2VVNA 4HK5A 3TR2A 2XINA 4MJ4A 1HGWA 2RHGA 2C1GA 3VC5A 1KR1A 4Q4KA 1QR7A 2FDMA 3BLPX 1SO6A 4X2RA 2VQUA 5BRBA 2YXGA 1AD4A 4J1OA 1A47A 1UP0A 3VXGA 3T0AA 1NQ6A 2KZHA 2V0TA 1H11A 2QPXA 2VD9A 3VIFA 3ABXA 4E2VA 1DPMA 5D4YA 1Q4WA 4S1FA 4FNQA 1UZDA 1RZMA 4S3CA 7TIMA 4YYFA 3C2FA 4LYKA 3W7QA 3LG3A 3NYZA 2G5WA 4IGNA 3XIMA 3V35A 3WUFA 3GRIA 1LL7A 1VFOA 4JNYA 4XVDA 4XD5A 1V6TA 2VDHA 1XSJA 4AW7A 1L6FA 1TKKA 4H9MA 3EA1A 2R1MA 2J66A 2FMNA 3R6IA 3LCWA 2DZXA 4ZB5A 4QAIA 2QLYA 4PSRA 1QOXA 3MUXA 1O94A 3NXFA 1A5SA 3EX1A 5DF0A 4I5RA 1GKRA 1N7KA 2NV2A 4K7YA 2NLYA 4O1AA 4BF7A 4AZBA 1A0CA 1XRFA 3PZQA 1X39A 3AXXA 4LAKA 1WUEA 1QNPA 3F03K 4I9TA 1K8YA 1GW9A 2GSJA 2WNNA 2D3NA 2NX1A 1VLWA 3UEQA 1UBPC 4IOTA 4E0CA 1G4SA 3TONA 1SMAA 2DUZA 3W2MA 5HMFA 1ZALA 4MZ1A 4XAYA 5IM51 4KWWA 4KWSA 2XVGA 4A35A 1XQLA 2FH8A 5A6BA 5CPQA 1QFEA 3M0JA 1D3CA 4FB7A 1JCMP 3KOYA 2PS2A 4PUDA 1W6TA 3V1HA 5I3FA 4W8LA 4FXJA 2WC3A 1JYXA 5CZSA 2OKTA 1B54A 2Y8KA 2AL2A 3IEBA 3WJYA 2J7HA 1PPIA 3CS2A 3QXBA 2Q8ZA 2AL1A 3SUSA 4MVAA 4IMEA 1TTIA 1EEPA 5HR7A 1PS9A 3RILA 5KZEA 3CH9A 2R1KA 4Y6GA 1RVGA 4DBWA 2RDWA 5ECVA 4V1YA 3C2EA 3MVTA 5CQ1A 1JNDA 2YFOA 3AHXA 2E5CA 2YSWA 1KLYA 4QG9A 4X9SA 5G2WA 4H01A 4QE1A 3G18A 3O6CA 1TJ1A 4YTUA 4Q6JA 3VX0A 3MMWA 1EF2A 1S5VA 1NVMA 3AIVA 3BC9A 5ABEA 1SPQA 4X2PA 4DXVA 2XUCA 4JTUA 3HQOA 1B3YA 7A3HA 1XLBA 1ALDA 2VR4A 4Q33A 2PWVA 3LZ3A 1KR0A 2QJIA 4ZQRA 4JTCA 1EH9A 2QUMA 4LVDA 1IWPA 2F61A 3ONCA 4GI8A 1G94A 4G9PA 1H7OA 1LJYA 1BYBA 5F4SA 2TMDA 1N55A 3QY6A 2CESA 2QUTA 1LWIA 4AG0A 3CBWA 1DYSA 1P6CA 4QBXA 3D3AA 1V0NA 3OO2A 4KRTA 1W9UA 1V4YA 4FPSA 4JTRA 5PTDA 2H8ZA 5A6KA 4YL2A 2INEA 4M1RA 4NT0A 1ECEA 2OWCA 3W7RA 3TTQA 3T07A 1I1XA 3F2BA 4BS0A 4JBRA 4ZO8A 2PF0A 5I3DA 1YQ2A 1JUEA 5L6UA 3AHYA 3FEQA 1JR1A 3B03A 4O13A 2WVVB 1N82A 4MWAB 1WE5A 1QWKA 3RPTA 1Z9AA 1UYQA 1C93A 2QDGA 1GVOA 4YN5A 3QFEA 1WX0A 4IIHA 3TTSA 3DGRA 4AQLA 1IZKA 4HA4A 4HSNA 3CUXA 4M80A 3WJSA 4J35A 4O10A 4UNIA 5I06A 3MV01 1NTHA 1REQB 2OQHA 3AZSA 1HGYA 2C18A 2FFIA 1GG0A 5AYBA 5FSDC 1D8CA 2QUNA 3UR8A 3VIMA 2FQIA 2BOEX 2J6XA 4C6BA 3OZYA 4B5TA 1DWIM 2V5CA 4S3FA 2WZMA 3MCNA 3S5OA 2FJUB 4JN7A 4Q3MA 3EPOA 2ZRZA 3WX7A 4D9PA 2ODOA 4ICCX 3CQIA 4JIRA 3AAMA 1V3JA 3FHAA 3CUIA 1VPYA 3LYEA 3L0NA 4UB9A 1Z42A 1J4EA 2O0TA 2A85A 4QCEA 3KBSA 3E2QA 4Q8PA 1FHLA 4J5NA 4NQ1A 3LNMA 1FWRA 4B5SA 1UKSA 1EGVA 3RMJA 3NAVA 4GGHA 5E09A 4CD6A 3NOEA 5AKQA 4DF0A 3GG8A 1NFPA 1E9YB 1OCNA 1V51A 3WDRA 3QYSA 2WMKA 4HB7A 3N17A 1UD2A 5IBXA 4NG3A 3QLLA 3B4YA 1EXPA 1ZU8A 4X9YA 2P5NA 4QAWA 4S39A 5CAKA 2Y63A 4UOQA 1MEIA 3RX2A 3QHMA 3CL8A 4XWUA 3N29A 1JUKA 1LT8A 3BLEA 2CLLA 2ZUVA 1BKHA 3NSXA 2Z6JA 3DERA 3UG8A 3PNUA 2F6UA 1YW1A 4NI3A 1B2YA 1X7IA 1KQYA 1PHWA 4GE8A 4NKCA 3VKDA 1PYMA 3H7VA 2G37A 2YA2A 1A5OC 4ROQA 2WKGA 1W17A 2PI6A 3HPSA 4JXCA 2XHYA 1ZB5A 5LXEA 4CU7A 1M68A 4AEOA 2P3ZA 1PE1A 3C2RA 4D72A 3SSZA 1JZ6A 1ZRQA 3GU2A 1FWCC 1W9BM 3DHFA 2QV4A 1V6VA 4DRSA 2QUUA 2VZTA 3IGXA 4F79A 3TQ0A 3M9YA 2HZGA 4DF1A 5D9MA 1PCKA 4O57A 1IT7A 2HPMA 4O4VA 2VDGA 2NUYA 2CIPA 3D47A 1DWFM 2Z28A 4DY1A 2PDBA 4GQRA 1VBJA 1KFJA 2VWSA 2O55A 5E0FA 3R4IA 4ML4A 4W88A 1IYXA 4NVTA 1V02A 4NNCA 1TTQA 4JX4A 3M5YA 3ZVHB 3AIQA 1S46A 3DN5A 4HK7A 3WF0A 3GUGA 5L9FA 4NY2A 5E6YA 3TIMA 1ZY9A 3B8VA 1KFWA 4A29A 3WD3A 1JQXA 2X16A 1KV8A 3WKZA 3INPA 1TPVA 1RP9A 1HKMA 3R43A 1KM1A 4DJDC 1XBYA 3SGGA 4P8UA 3CGTA 4K2SA 3CYJA 4BKNA 3H2CA 3VZZA 4ACYA 3CAKA 2GVJA 2PDGA 3ARRA 3WO8A 1R86A 4PODA 3P7YA 1TZZA 3W9ZA 2FPVA 5EBUA 3WEOA 4DPQA 3KL5A 2QF8A 3CV2A 3ARYA 3VCCA 4V27A 3S5NA 3C0QA 1NQKA 3I6RA 5IFPA 4S3AA 1V6UA 2UY3A 2ACQA 3PTMA 1F6YA 3IJIA 3P62A 3RYSA 1W3NA 4MADA 2VM8A 1BRLA 5BU6A 4G8TA 1JIBA 3ENLA 4QDPA 5DX7A 1FXPA 2HS8A 3I4KA 3LRMA 1DE6A 2CBIA 3NL2A 4DXKA 2F7FA 3M0YA 4KMQA 3TROA 1S3HA 2WWCA 4TTGA 1G01A 4DNMA 1DJGA 4J27A 3MBFA 2PRMA 1E43A 2PRLA 3Q94A 1VEMA 1VYSX 2ZUNA 3QMRA 3GVGA 3MU7A 3CIXA 4YVVA 3RITA 2WQPA 5TD4A 1CNVA 3EOSA 3T2OA 1OBAA 1WZMA 3NSMA 4B4HA 1XRSA 1EC9A 1GUVA 2E5BA 4DZAA 1WDQA 4PCTA 4NSBA 2F2KA 2VD8A 1JXKA 2IKJA 3THQA 5A6BD 3AIUA 1TUXA 1KFEA 3OODA 3MP4A 2QVHA 2GJRA 1H62A 1J12A 2H6RA 3AS2A 1T96A 3F5KA 3PTDA 4KFNA 4XD6A 3GYCA 1TWSA 3LERA 4OBRA 3ARQA 4DELA 4EWND 3TSMA 4QCFA 3C3NA 5BRQA 2P88A 2YDSA 2F38A 1W8GA 4H19A 4AU0A 4D8LA 1TTPA 1A3HA 4M19A 3GG1A 3PTKA 3APGA 2HPIA 2IQTA 4FX6M 4Q4QA 1TWWA 4KGJA 3PBWA 3RU6A 2A5HA 3MANA 3FJ4A 2Y62A 5IHRA 1IEXA 1LL4A 3IVTA 1LT7A 3ZT7A 3B04A 3MHGA 4HNNA 3CV7A 1O66A 1IXPA 1EP1A 4DI9A 1XIEA 1Y65A 2DFAA 3MCOA 3MCMA 4FO4A 1ADOA 1EWDA 1JI1A 2QAFA 1W3HA 2GGGA 1VBGA 2J74A 3L4UA 1AQHA 2FJKA 2VEIA 4Q4OA 1G67A 1A3XA 4I8DA 3HPXA 3VCRA 2XSBA 1Z6KA 3G1DA 1VCFA 4WGXA 1QNRA 1UP3A 1F3TA 4NU7A 1Q6RA 1U5VA 4RK8A 1W9PA 4ILSA 1OF6A 3GDKA 3CHDA 2P3EA 4WQ6A 5KETA 4HNCA 3VIKA 2FZBA 5HJYA 2O9TA 2XIBA 3DAQA 3CZJA 3VE7A 1S2UA 5EB8A 1WV2A 4K1GA 1DJYA 3TH6A 1ZBCA 4KT2A 4EF9A 3W87A 1TPWA 1I45A 5A95A 1HW6A 2GVLA 3KW3A 2VCAA 4GC4A 3A5FA 4Y7EA 3BV4A 4PUEA 2NQLA 3UVAA 4JIIX 4IJRA 3BWWA 5CPOA 3MHFA 3A22A 4PZVA 3L2MA 5D05A 3DCPA 4F0MA 1Q6FA 2EKCA 4HQVA 1W9VA 2CNCA 1X1NA 4XVEA 5CC6A 5ECUA 3URBA 4UOJA 3VO0A 1K3UA 1LLZA 1ZUAX 4K8HA 2XIJA 1MWOA 1E72M 1L2UA 1SU5A 3GZ3A 1THFD 5IBXC 7PTDA 3WBEA 2VUNA 3NQEA 4BK9A 2PB1A 1IQ8A 4RLIA 2Q01A 3RX4A 3ITYA 3MT1A 1XV8A 5FEXA 2DZSA 3QZ6A 5REQB 4U28A 4XTIA 4UIOA 4O28A 5CSSA 3VZYA 3WLTA 3B9DA 1XYZA 3GVQA 1R8LA 1Z89A 3ZOAA 3TFCA 3MYPA 2YCLA 4D6GA 3LCHA 2X1IA 3DC0A 5HULA 2YZRA 1P0NA 3W07A 1PZ1A 1VCVA 3T44A 1XG4A 4BHYA 4RZ6A 4H6EA 1VB9A 2Y8UA 3AICA 4CD8A 3T81A 1XP3A 3E2SA 2BXZA 2AAAA 4M7TA 1D7FA 2VC7A 4AVFA 5DBUA 3ES7A 5HMEA 4X60A 4J3WA 3LHVA 1P5BA 3TVAA 4ZOBA 1EF3A 2WPBA 4IPPA 4LBSA 3WL1A 4AXNA 4LSBA 3M4HA 3GFZA 5KZDA 2XM2A 3M7WA 4PRTA 3DFQA 4FR6A 4N9EA 2QMKA 1E6PA 1QT1A 1UIOA 3U7BA 3CZGA 1XBZA 4QQ3A 4ZB2A 1L9WA 2JKAA 1I60A 3MI6A 5T26A 1Q85A 3L65A 1W1TA 2J79A 3RCNA 1VEOA 2QDHA 3G5EA 4J4KA 4DB7A 2WVSA 4CD5A 2G3JA 3ZZ1A 1HJQA 3S42A 3FKKA 3A3HA 2WW5A 3WIJA 1QK0A 3CWOX 1IR1A 3H4XA 1M53A 3THCA 1B3ZA 4M8UA 2WO5A 4JHMA 2PDPA 1BYDA 3RLHA 4PCNA 4GRSA 1RK6A 1HJUA 4GXPA 1N2VA 2BVDA 5EBAA 1GVFA 1E9ZB 4WXYA 3SSJA 3WQEA 2C16A 4R33A 1ZJHA 4B2DD 3KTSA 1PIFA 1JCTA 3OVQA 3N6JA 3DG6A 2QW5A 1KC7A 3C86A 1JI2A 1E6QM 1H0IA 2A7RA 1DQUA 5C6MA 3CQJA 1OCBA 2WB5A 3OG3A 1E0VA 3UYIA 4H9YA 4W84A 3BOXA 3ZIZA 5FESA 1CECA 2I5GA 3KM8A 2YBTA 1D7KA 1ENUA 4AWEA 2CZVA 2WZIA 5DO8A 3GG7A 1UH2A 2RKXA 3U2ZA 4GNKB 3MZ2A 1XSKA 1C92A 5F1UA 3PZUA 3AIEA 3NL5A 2FHFA 1FWIC 5BWFA 5JMUA 2GUUA 4AVNA 3W84A 1U2YA 3H8AA 4PSPA 1TELA 3EB4A 4INFA 1UOKA 3QLDA 3HV9A 5BU9A 3AHTA 3DH7A 3S46A 4B3LA 4UTMA 3C5QA 1SYTA 1Z69A 4LU0A 2RDUA 2IKIA 2NV9A 4JAWA 3BMVA 2YBUA 1V93A 2XGBA 4KBXA 2JK2A 2DSWA 2KAUC 3QBUA 2OU4A 2VYOA 1TPEA 4RJEA 4RE2A 3PSWA 2WCSA 2A7NA 2VFDA 3BGJA 1JZ8A 3EDJA 4URIA 1D8WA 4GYPA 1JGMA 1DQWA 3LDVA 3F7JA 5J04A 4H7CA 1ITUA 2CZEA 3ARUA 3TCSA 1FHDA 3GVVA 2WPGA 2CLKA 3WH8A 1E0UA 4X0VA 3PZIA 2NQ5A 3WMCA 3OGRA 3A4XA 3WNOA 1IXNA 3NQVA 3ANVA 2GQ3A 1R3YA 2W92A 1E1EA 4XIMA 3VPLA 4QG8A 4JFSA 3TN5A 2HNHA 3LS9A 2PRHA 4MFEA 2PWHA 3OIXA 3MUCA 2PGFA 3TNBA 1O60A 1NDWA 3FEMA 1HJVA 2WCAA 2RGMA 1S3TC 1E5JA 2VZSA 3WLPA 3P82A 4JTIA 3P8JA 4N6FA 5ABGA 1LORA 3KVKA 5IDZA 3UZXA 3TA6A 1GVYA 1K70A 3O6YX 1VF8A 3EWUA 1KXQA 3M5ZA 1F3EA 5H8UA 4AMAA 5E0KA 1WQ5A 2GGIA 4CQ9A 4NUWA 3H4WA 4A2SA 2VX7A 4D6HA 4AIUA 1HKWA 4HZMA 3HO8A 3M16A 4WKFA 4HHPA 2ZYFA 2Z2UA 3W82A 1LF1A 3W1RA 2C14A 3MYOA 2XTKA 1M01A 3E5BA 1ZAJA 3U2OA 2PDLA 3SDOA 3T05A 3DBNA 3TFXA 2PDNA 4XSLA 3A4AA 1QATA 2QCHA 3QSRA 4ZQMA 2P76A 4JKMA 4CVWA 3BOFA 4MWAE 4AHQA 5GVJA 2OJPA 4XZBA 3V16A 4YTQA 1NWSA 4HT3A 3PFRA 5E70A 2BY3A 2FPYA 4W85A 4XZNX 3TW7A 2QYGA 1RXOB 5ENLA 2JGYA 4U31A 1QW9A 1RLCL 2WYSA 1UR1A 4OBTA 3FNDA 3DBPA 1OQFA 2J7BA 1JL8A 1US2A 1TPC1 2WNZA 4AZIA 2VC5A 1JCNA 1AH3A 3QW4B 2PWEA 1IEIA 3W7HA 5MKGB 4N42A 4IXXA 4UFIA 4GIYA 4QJ5B 2GFTA 4J3ZA 4AY7A 1R87A 1UUQA 3O2LA 2PWGA 4F0LA 2O7QA 3AMGA 3PS7A 1W1ZA 3AO0A 3HGRA 3WDIA 2PCQA 3PZMA 1P0EA 3PR2A 3W76A 3QQWA 3NURA 2QMJA 1ADSA 4AX6A 3ALFA 5FL1A 2AGKA 2I56A 2BGQA 4OIFA 5F2GA 3B3DA 3KS6A 4LALA 2C1HA 3BGAA 3W37A 4HOXA 1I75A 1GONA 4XAFA 4KWVA 4P7QA 3SRDA 3ARSA 4KWOA 3NOYA 4GNJA 2BY2A 4IZGA 6CGTA 1VIZA 1XDJA 2PU1A 1KTNA 3TSBA 2YKKA 5JIPA 3EEZA 2F6KA 3HZ3A 4R85A 2QCCA 2DGAA 1HJWA 1TJ0A 3TAOA 4ZXOA 2FH6A 1TRIA 3M7SA 3UWYA 4WSHA 1DL3A 2ON3A 5C2CA 3IUHA 1GEQA 3WLLA 1MEWA 3W71A 3S2JA 2GGJA 1GVRA 2WLZA 3PSVA 3L12A 1ZPTA 4O1BA 4GIEA 2VC6A 3BG5A 4LUIA 3S83A 5A3HA 4ZODA 4HZ8A 3P81A 4GYJA 4GJ1A 2QJGA 3GIPA 3UWEA 4I6KA 2GJLA 3W1QA 3B0VC 1QW8A 1WOAA 1R3VA 5DQPA 3APTA 3SAZA 4ZEPA 1SSDA 4B9YA 2O9OA 2B0MA 5JIWA 4TV6A 1FP8A 4KQNA 3R79A 5K2ZA 1XGEA 1JPHA 3TK7A 1VFFA 1UR0A 1PUDA 2W67A 3GS6A 3CHCA 4CNOA 2G3MA 4O1FA 1JCJA 3V4BA 2VCCA 1L0PA 1KM3A 1RVKA 4ZR8A 1G7VA 4JFWA 3UWWA 3FCPA 3T55A 5I02A 1AJ2A 2EXOA 3B06A 1XX1A 2Z1SA 4WF7A 5M1TA 3NZ1A 1FWFC 3CASA 4DWDA 2YCLB 1XLEA 5A8MA 1AZ2A 1P48A 4PL2A 3ARWA 2W5FA 1XIMA 4K39A 4TV5A 2POTA 4GZEA 2I9EA 1Z3NA 3CEPA 2BS9A 3VGGA 1L8NA 1TV3A 3L5MA 1T41A 3W1MA 5AB3A 4S3KA 2EF9A 1K6AA 3O05A 4FNTA 2PLKA 3E0IA 1A0EA 5FAGA 3SCVA 1GOOA 2F9RA 2OZ3A 1MDRA 4XZ9A 3Q58A 3G1FA 2GLKA 3F5JA 1ZL1A 3NXLA 4WIWA 4AZ6A 4FS9A 4JQ1A 4YCOA 3CUGA 1GHRA 5BROA 2BODX 3VNIA 4GI9A 4EAMA 4MLRA 4LUYA 4NX0A 3A4WA 2C19A 1E6XM 2XZ7A 1H61A 4AD3A 3EDFA 3MA8A 1Q65A 3U9IA 1UW9A 3B97A 4QLJA 2VZUA 4LUSA 2R14A 1JCLA 4CCEA 2A6LA 3BAJA 3CPRA 4K36A 1KBJA 1RJQA 5LA1A 1OFBA 2WANA 3JR2A 4Q4MA 2YB4A 3R11A 4BCEA 2XZ9A 3AYRA 1EJXC 3DI0A 3W7PA 1R3TA 3EWDA 4F0RA 1C90A 3ZLGA 2YYTA 2J77A 1RP8A 1TE1A 3WJZA 4JYEA 5MHBA 1K02A 2DJXA 4ORIA 1CTNA 5LNRA 1G7UA 1OCQA 1E0WA 1GZJA 3S1VA 5LIXX 3SCWA 3PULA 2QCFA 5K4ZA 2EQDA 1R30A 3VD4A 4PUKA 1XH1A 4NX5A 1XFCA 5BCAA 2AKZA 4MWAC 3G77A 1EIBA 1QXLA 4WOZA 5HAOA 1UH4A 3PZVA 1OADA 4AFYA 3NUKA 2Z1WA 3LGGA 4MYXA 1XKYA 1EBHA 4QLKA 1OZQA 2V5DA 2CPUA 3BE7A 2W61A 1B3OA 5DY2A 4UTKA 1K9FA 1W37A 1D3GA 3P0XA 1T7LA 4JTLA 2J4GA 4JZ5A 1RSCA 3FAXA 3NQCA 2WMHA 3IIOA 1H2JA 4G5DA 3W74A 2ISVA 2YB1A 2WLYA 4NAFB 2PLJA 4PB5A 1ME8A 5I2UA 1V3MA 3N34A 4IP7A 3OVGA 1KQZA 3QV6A 1V0KA 1BD0A 2VMFA 4HMNA 3RCMA 1TVNA 5LNUA 4OVXA 4W93A 2PP1A 1YYAA 1R0MA 3C2VA 2HBVA 2WSKA 4CCCA 1XLFA 3S3GA 2DT0A 5AC6A 1QO2A 3N12A 3M0XA 2EG6A 3F2DA 1B57A 3WD4A 1CLVA 4AUBA 5GNZA 1TWDA 5JQ9A 1BG9A 3PTQA 4XZLX 3B9NA 3IV3A 2DT1A 2NW0A 2VP8A 2YCJA 4RKAA 3G0SA 3N3MA 4MNLA 1J0HA 1P6WA 2BHZA 4PUWA 1R3RA 2Y89A 3FYYA 3A9BA 3GDBA 2ZX5A 3VIIA 3LHWA 2XPKA 3D5HA 2ZUSA 4EXQA 1XR2A 4QXIA 3HPAA 4YWIA 3TOYA 4PYSA 5D37A 1ISVA 2E09A 2VOMA 4IJBA 3REQB 1LUCA 1XGZA 4JTTA 4JNZA 3M41A 3STFA 1F76A 2ADAA 4C65A 3AJXA 3RM4A 3M0VA 3UZWA 2DDXA 5G4EA 4WKHA 4LXFA 3LPPA 4H7ZA 4ML9A 1QI4A 3KOWA 3C8FA 3HGOA 3SM0A 4NI8A 1DORA 4AVOA 4XV0A 4DIAA 5A6MA 4DUXA 1KW1A 5CH9A 5I3IA 5FI8A 2EPHA 1RBOB 4GVGA 2E7FA 1LP6A 5ABTA 3S6DA 4JFUA 1H3GA 1SO5A 3U3HA 2NSOA 4PTMA 4XISA 1Q66A 4DBSA 7ODCA 2AMGA 3MI3A 4W86A 4L80A 5C9WA 3L4YA 4IICA 4GFSA 1G9HA 3WQFA 5HQLA 3AXHA 4QROA 1H4PA 2X41A 3K1GA 3CC1A 4Z1CA 2FZMA 1UKOA 4F40A 3K4DA 3D3FA 3LV6A 3UG4A 2VGFA 1C29A 2G95A 3S8HA 5LIYX 3IARA 1UB3A 2E8ZA 2VFFA 3N18A 4C6LA 5BXSA 1WDPA 3LQLA 4ECLA 3EWCA 4Z2LA 3NR0A 3WBWA 4UR9A 3FXYA 4UTTA 2A3BA 4CUCA 3VNYA 3NQ2A 3DYPA 3GC4A 1J96A 5A8QA 2J8TA 3ZJ6A 1UKTA 5AY7A 3EDEA 1UR2A 2YLAA 1ONEA 1CLXA 1AUSL 5BMXA 2XH4A 2X2GA 5BXPA 3BPWA 3I4EA 2EHHA 1AL8A 3NQAA 2GK1A 2ZX7A 3UZZA 3FDKA 3LBCA 2PGRA 1PAMA 2VRQA 1NWTA 2NXIA 1ZAHA 4FIQA 3KLKA 4XBKA 1SFLA 4H8UA 4C6MA 4PEEA 1KXHA 4AZHA 2UZ9A 3W7CA 4LYPA 3HIJA 3NG3A 4O50A 4PFMA 1X8FA 1XPYA 3E5PA 3KBNA 4RE0A 1Y5XA 2WNQA 1ZBVA 4P7OA 3EX2A 4LUJA 4H00A 1BSIA 4HZ6A 3DKLA 3ABZA 3S5YA 3WUGA 1DWHM 2BXVA 3AXMA 3WK1A 1V3HA 2ZX9A 3VGFA 4LBUA 2OOGA 4LUSB 3MP3A 1P1MA 2A3HA 2WHLA 2ZXDA 3VILA 1CX9A 3QKEA 2AKMA 3GKFA 5LA0A 4HPNA 4IIDA 1HIZA 1W5OA 5FJUA 5KZMA 1ECQA 3U5YA 4XUYA 1E0XA 4US5D 4ZA0A 3AOFA 2A2IA 1QPKA 2OZ0A 1MDLA 4GYKA 5CZTA 2PZ0A 1N8WA 3BMXA 3QTGA 1BFNA 2OLAA 3V3WA 1EHAA 3HG3A 4FK9A 3K2GA 1JZ5A 5DANA 4HN8A 3VKBA 1DIDA 4Y90A 2FVMA 1Z8AA 4AZCA 4RNJA 1HL2A 1BQGA 3NM3A 4O18A 3SR7A 1CGWA 5A2AA 2WM0A 3CU2A 1OEPA 2C13A 3A4JA 3PF3A 3WLMA 1E3XA 4C91A 1SGJA 2HXUA 1ISYA 4AYGA 2VRJA 2H90A 2QR6A 1U1HA 5G1MA 4TMBA 5D02A 6ALDA 1G6CA 3DFSA 4AHOA 1F3WA 1YADA 3IAQA 3RM8A 3H22A 1JJKA 4Y9NA 5CZKA 4HYWA 4JQAA 3WLIA 4LNYA 5LNWA 1OGSA 4IPIA 3EZ4A 1A5CA 4EE9A 2PMQA 3UETA 3F4WA 1UA3A 3ZS4A 4Q8MA 3T78A 1RLDA 1YNPA 2ZDSA 1CENA 1B0IA 4HU4A 3TV8A 5HOSA 1OF8A 5AYXA 1KKRA 1W0MA 3EB2A 3BCFA 3UCQA 4J3VA 4C7GA 3GXFA 3VOJA 2Z27A 2B31A 1W54A 3LBOA 2CCRA 4X22A 4I7UA 3UR2A 4L6DA 1KWGA 4H9VA 4WEVX 1A4LA 3EKGA 3LZ5A 3CYVA 2E6AA 4GISA 5TF0A 4DLMA 3NQ7A 3IJQA 2E1DA 2Q8LA 2VFGA 3UJSA 1VYPX 4QJ1A 3RM9A 1SZGA 3OQ8A 4IFKB 1MMFA 1S5TA 1I1WA 1PYFA 4HCLA 4K8EA 1J9YA 5HJXA 5LIWX 2A1YA 4RZ4A 2VJXA 2Y5EA 3XINA 3P80A 3YPIA 1W5PA 1F61A 3CLWA 2J9YA 4L56A 3GY1A 4E2DA 1UOZA 1OX4B 1UCWA 1NFGA 4POCA 2WVVA 3T1GA 3K5XA 1T40A 2CLIA 2G4FA 2JKEA 1CT5A 3DZ1A 3W6MA 4DWSC 1QUMA 4MB3A 1VBRA 1GTEA 5GNYA 5DN1A 1ME7A 2HSAA 3HTWA 2YIHA 4PRRA 4PBGA 4A8NA 4MG4A 2ZZ5A 4M56A 1J6OA 1GOQA 1O5RA 1SJBA 4HSOA 3JZUA 4NNAA 3WLNA 4C5YA 1QWGA 1YTKA 4U33A 2W79A 4DBEA 3URAA 2D69A 3U5UA 3MUY1 4UZSA 1WKYA 2DQWA 1WYIA 4PTXA 1OG6A 4I9AA 3K4AA 5AYYA 2EPLX 4J7RA 1ZP3A 1WKFA 4LAUA 2C0AA 1IE7C 3CL6A 3UWUA 1K1DA 4EP8C 2CWXA 3NPXA 2QULA 4RR4A 4TU1A 3AISA 3C0LA 2DZWA 4UC5A 3EX4A 4UQAA 1NIUA 4AF0B 1WXZA 1PDYA 2DW6A 1A5BA 3C8NA 4MNKA 4ZFMA 4HSHA 4Z2KA 4IQDA 2GDVA 1IHIA 4M51A 5FEPA 1G4EA 1TMHA 7REQB 1I0BA 3FXGA 4EAYA 1TV8A 3UZYA 3VX1A 3L2LA 1W32A 3EYPA 5AHNA 5BXTA 2V3GA 3TYCA 4Z2HA 2B7OA 1XIHA 3SJNA 3JVAA 1JUBA 2BVTA 3W1XA 2BHUA 1QI3A 2X1RA 1L6YA 4U4MA 5HK4A 1UC5A 2D73A 3M0LA 5GJNA 5LXXA 1R3WA 4AX7A 3THDA 1UR9A 3MSRA 4Q8NA 1DE5A 3ZVIA 1JDDA 2H9AA 5FJRA 1U1JA 4H6KA 2G4JA 4UQBA 1R9YA 4HGXA 2R1NA 3PPCA 1V02E 2ESCA 5HNRA 1WXJA 3I68A 4PCSA 3R8RA 4NJKA 1KCZA 2UBPC 2UY2A 1KFLA 2FMOA 4AY8A 3I65A 1M7XA 1MVYA 1G1YA 3I7QA 3MJYA 1RQHA 4UFMA 4C90A 4I3GA 5BYWA 2WVUA 3NJ3A 4ZOCA 1LOLA 5M3WA 1VEPA 2R1LA 2A3CA 1YE6A 3WQCA 5CZJA 1V7AA 4DO6A 4JDBA 3BARA 3SB0A 4PC8A 3PC0A 3AFBA 1DHKA 3T4CA 1BQCA 1EO5A 4F3HA 1GEHA 4AZ5A 5FAJA 2Y70A 1XH2A 1F07A 4DXXA 4MY8A 3T0BA 3A47A 4L4MA 1K8XA 2QQ6A 4CD4A 3WY1A 1EJTC 4OFCA 1IZJA 4MPQA 1EO7A 2NQZA 2QDDA 3LCLA 1G4TA 3G24A 4YTRA 4OE7A 3WCZA 5CPMA 4WY0B 3GNNA 1FCBA 1EHNA 3USBA 1OCJA 3XISA 1OB0A 3M44A 4A21A 1CXHA 2JFEX 3H2NA 2VEFA 1BKSA 2BWGA 1HL9A 2W6RA 4GO8A 3KP1A 1CXKA 4IMGA 4GJIA 3WD2A 4WX2A 4GVFA 3E38A 3N4FA 2FGZA 3EKZA 3G1XA 1N8IA 1MUWA 1VHNA 2DSKA 2E68A 2PTWA 3P93A 4JCLA 3MBDA 4TVDA 1OK6A 1AQFA 4DPPA 1SZRA 3PAOA 1OABA 1FX6A 4HPJA 2X42A 4XBJA 1Y8BA 2D24A 3KEHA 1UKQA 1BYAA 2YW4A 4OTKA 4H41A 1VD6A 4UQCA 2O9PA 2OXNA 4MNJA 2BVWA 5EPDA 2D0GA 3W83A 3ZLHA 4GYFA 1BGGA 2BOFX 4AB4A 2OYMA 3DG3A 4DWSB 1SJCA 2VR5A 3QF0A 2GL5A 4LQ1A 1X98A 3SFWA 3EOLA 1CGXA 2DH2A 3ABSA 3V0TA 4JFVA 3BLIA 3I6EA 2WCGA 2I57A 4OOZA 3EWWA 3BJFA 3P6LA 3SIZA 4L6HA 2EAWA 4N9DA 1DP0A 2XIMA 4E38A 2LLEA 1VIWA 3TTYA 4HNLA 2OO0A 3NO1A 4XAZA 4EOUA 1ME9A 3TZNA 4AF0A 3BAXA 4YHGA 3USZA 4PMRA 5JH1A 1C9WA 2W27A 2ALDA 3R94A 3JRKA 2JEQA 1XW8A 1QTWA 3WFLA 3FYOA 3PK7A 3W88A 4W5ZA 1GCYA 3L4ZA 2V30A 1OD0A 4ACZA 4HNTA 1LM1A 2GWNA 4HN4A 3OVPA 1WKDA 3VAVA 1GJUA 2BY1A 3HN3A 3WSUA 3N14A 3FV9A 3KOXA 4AZGA 3LRKA 1X8CA 1SZNA 1TO3A 2BXYA 3TYEA 3MMDA 4ES4A 4LYRA 1OFEA 4KIEA 4MAZA 3UG5A 1S1RA 4O0KA 4E8GA 3POHA 2XU2A 2YL8A 3QY8A 4E6MA 3TE9A 2CLMA 1H5VA 2WNWA 3RJYA 3TJXA 4GCXA 2PDIA 3NWRA 3VIJA 4Q22A 4JL2A 3U2CA 3FJNA 4I5XA 1EEXA 3NQ8A 3VINA 2XISA 1IIHA 5G5IA 1FHUA 4JX6A 2INZA 1W3KA 3SUWA 3GHTA 4DN1A 4FXFA 3IV8A 3KTCA 1JAKA 3CEUA 2A6NA 4LX4A 3B9EA 1O95A 1Q2SA 3MW7A 1RY0A 2C3ZA 1XC4A 1JNEA 1MW0A 4B90A 2BNJA 3IUDA 1O68A 5D2XA 5HWJA 4ZSUA 3S2LA 1NY1A 1CB7B 3GVRA 2IMRA 1CWYA 3AIRA 3IWPA 4NASA 4DZHA 3WDJA 3I7RA 3SCQA 4ZQCA 1YTEA 1LOSA 5F4XA 3N2MA 1C3FA 2OGYA 3IJ7A 3QW3A 3VE9A 1C8VA 1EJ7L 3LHZA 1M3UA 3DFHA 2WM1A 4L64A 3NQDA 4L1GA 2QPSA 4NJIA 4W7WA 5H2ZA 3RIKA 2XN0A 3W22A 3NZRA 1TG7A 1J0KA 3IIXA 4D71A 1RQEA 3R58A 4KRUA 5D32A 1CDGA 1SQ7A 1EPXA 4LVBA 4B9ZA 3KX6A 3KUMA 2ZRXA 4XD4A 4TUFA 2WJZA 2PBGA 4HPXA 1WP6A 5AN7A 4LAOA 4IP5A 4UCFA 4ZTXA 3SCTA 1J93A 2V68A 1X97A 3E6EA 5BWAA 3UZJA 2XWDA 3IAPA 5C9RA 5CKSA 5BOEA 5A2BA 1TPH1 3UGRA 3I3EA 2J8GA 4QIUA 2PURA 3UP8A 1DJWA 3U4AA 2E25A 1ZNNA 1LDCA 1K7FA 1RAKA 5DT7A 3W0KA 1NDVA 5EMMA 5FF3A 4A3YA 2VNCA 5D8ZA 3UD6A 2FB2A 3AIBA 3V5FA 2VT0A 2BX7A 2ZRYA 3OBKA 4M3PA 2GVGA 3RMEA 1PZ2A 4YPJA 1RCOB 1KM2A 2VCBA 1FWEC 4J3XA 4GD0A 4W4QA 3WNPA 3BMWA 1KBKA 3GO2A 4ACZB 3NYDA 3MMTA 3LMYA 1E70M 3SUUA 4Z08A 6TIMA 2GYIA 2HK1A 4QRNA 3K1DA 3AZRA 3BO9A 3OP2A 4RDYA 3W75A 1UWQA 4M6VA 1OYBA 4QDMA 3IJ9A 1Q2RA 1ONRA 1DJZA 4HA1A 1TSIA 4LPCA 3WNNA 4UTLA 1C7SA 3ITCA 3E2RA 5RUBA 4WRHA 4CQCA 2NVDA 3QGVA 2ZUWA 4N4QA 5IDIA 1K9DA 3GUWA 2E67A 4JTAA 2HROA 3CB8A 3LLDA 4QR6A 1GYMA 2J62A 3W7GA 5EL1A 4DM1A 4QGCA 3GDLA 5FL0A 4UNLA 3LXCA 1TMQA 1Q45A 5HNNA 2PSNA 3OGVA 3W7KA 1LTDA 3S4TA 4ZOEA 3BLOA 1NDZA 3LTPA 5CJNA 5ABHA 2DIEA 3GU9A 5AC7A 3UPBA 1US0A 4UCGA 1M7OA 4CKQA 5EFDA 4UXDA 4GKTA 4IFOA 1XYMA 2YDRA 3CIWA 3K8LA 3W70A 3PPGA 2B7QA 3ECQA 5E0CA 1P7TB 2ZIDA 3HG5A 1PEZA 1UIPA 1Q7QA 1A5UA 2AOSA 1BHGA 3IVUA 2I1OA 1GVQA 1SJDA 3OQEA 1V3LA 3DFPA 4ZE4A 1M7PA 3L4WA 2P8BA 3KL3A 5B7ZA 3PZGA 4K3ZA 1K7XA 1S5WA 2A21A 4GABA 1W1IE 1AK5A 3GTXA 4WVXA 2WJDA 3VYLA 4GQQA 1MXGA 4GJJA 2PWUA 3EAUA 1IIGA 4JYFA 1ZFJA 1CIUA 3ME3A 1XM3A 2D2JA 2OSXA 5MKGA 4FXSA 1EYEA 1OX6A 1SW3A 3BG9A 3NDZA 2ZRWA 2TAAA 4GUGA 1WKEA 3ITOA 4OU1A 3GKAA 3MSYA 4NNBA 3WLJA 2IPWA 3BJTA 4J9JA 4MJZA 2NQ9A 2JF7A 3VNZA 2QGHA 2OEJA 4GH1A 5D38A 3LPGA 3ERPA 1UWIA 3MY9A 4RZBA 1E3ZA 3MKCA 1A4MA 1EJRC 3PFMA 4HP5A 4R88A 4H1ZA 4LWWA 1G5AA 1PTGA 2H3BA 4N9CA 3NPVA 5HWNA 3QPYA 4BF5A 4FR1A 4HK6A 3GTHA 5EA9A 1CZ1A 1JRCA 3EWYA 1BRLB 4H2CA 2Y0FA 1RQBA 4H6QA 4XSMA 3CPUA 2DORA 4GZ7A 4FAMA 3S1GA 3KHDA 1UUOA 3DESA 1PCWA 3GIYA 3ZJKA 1FWWA 2JE8A 4A3RA 4JIPA 4NZ3A 1F73A 1J5TA 3HB9A 3PBUA 5FF4A 1XICA 4IJCA 1E1FA 3RPMA 2VENA 4PMQA 4ZGYA 4PULA 4Z0SA 4BY3A 1WPCA 4EVZA 2IPFA 3NQ6A 3RO8A 1I6NA 4OUIA 3OZOA 1K9EA 3LI0A 1SW7A 4PBFA 4DZIA 3B8SA 3N2OA 2JGQA 5A6TC 1FQ0A 1XIFA 5H91A 1VYRA 4LC8A 5DMNA 2OKOA 1FP9A 4PR4A 4B5XA 3GHUA 4MKSA 4CNSA 3A3WA 1K8CA 1GKQA 2J13A 5KZ6A 2FTPA 1X6LA 3WMLA 3BW4A 2Z4GA 4NJJA 1CYGA 1I8JA 2ZBTA 3QR3A 3L9CA 4QG6A 3RDKA 4QE5A 4ERGA 5A1AA 5KITA 1CXFA 1GOMA 1QI5A 4Q8VA 1V6WA 3SY5A 2E4TA 4IMDA 4Q7NA 3NGFA 8XIAA 1ITCA 2BSLA 3PBMA 3LEPA 4GX9A 1DXEA 3RR1A 3B9AA 1KXVA 3P61A 1H7WA 3TR9A 1JQVA 3VTRA 2QCDB 4IX0A 1V77A 5FJJA 4GIRA 3TN3A 3W02A 1UD5A 1SZEA 4GIAA 3GXNA 1EXBA 4UTWA 4H8NA 4WJ8A 5LGZA 4PMDA 4TR9A 3B4UA 3WLHA 4ZVJA 2TODA 3HV8A 1UC4A 4O17A 3FGCB 2VGGA 4LVAA 4AWSA 3UVIA 2E9MA 3AMCA 4U3CA 4YWSA 1HO1A 1YXYA 4XO7A 5I23A 4PGLA 3JUGA 4NL1A 3NFUA 4E4FA 3FDGA 3FFSA 2Y6ZA 3GAYA 1HX0A 3CT2A 4JTEA 5DCEA 2IQ0A 4F0KA 3BANA 4FMVA 1J2BA 3W7EA 4G7EA 3L66A 1A0DA 4A3QA 2ZXQA 1TQJA 2NX9A 4QJ4B 1VJIA 2BGSA 1ZP4A 1JF5A 3OEXA 5CCZA 1T8XA 3DFTA 5FF0A 1KCKA 1XUZA 3R8GA 3PPHA 1XYCA 3H54A 4W7VA 4C6DA 4MIMA 1X1ZA 3NVDA 3JZEA 1MFVA 3W1TA 4FZIA 2BY0A 4L9ZA 5HQEA 3VA8A 3UQNA 4HU3A 3QN3A 4TX6A 3AU6A 1FDJA 3O9NA 4CEXC 4CNPA 4OBSA 5AHMA 1A53A 2FPTA 3M6DA 5DELA 1DJXA 3GB6A 1B31A 4IQLA 3LGDA 2UY4A 1XC6A 3ZVHA 2HVOA 3LMZA 4CQBA 2NSXA 1TREA 1V3KA 3VCNA 1H0GA 3VD9A 4ADTA 2E5DA 1XSIA 3SIMA 3OGSA 2PLMA 3H70A 3UNDA 4OHQA 4IG2B 1IV8A 1W5MA 4NZ1A 1TE6A 2OEMA 2XVNA 3VD5A 1ZSXA 3WUEA 3QZEA 5TNVA 1GT8A 2DIKA 1SFSA 1U5JA 4IMAA 2ZE3A 3KE0A 2EPNA 3EOOA 2WMJA 5JUVA 3W7JA 5AZ0A 1PSCA 3CUHA 3JS3A 4TX9A 1IWAA 2DT2A 3HM7A 3TC3A 4H2HA 1NM9A 2CLEA 3VVGA 3KZPA 2H8XA 4ZBCA 4NF7A 2HXTA 4XZHA 2L5HA 2OSYA 2BMBA 4LYQA 1U83A 1Z48A 3JU2A 3T0TA 1YPXA 1O5QA 3UWVA 1JCXA 1FFRA 2Y61A 5FEWA 3PJWA 3T0DA 4V15A 3M0IA 1OFPA 3DU0A 3QPZA 4L65A 4C1LA 4JD4A 5CPLA 2NVCA 4QTGA 4DUOA 1TA3B 3UG3A 2R6OA 3GXTA 3N4AA 3A23A 4FLRA 3U8GA 4EKJA 1XKJA 4ZZ9A 1EBGA 4M82A 4LNCA 1JZ7A 5C55A 1YDOA 4H83A 3V5CA 4OJYA 1UR8A 1KRAC 1A3WA 4S38A 3RPDA 3PWIA 1N8FA 3CAWA 4U2YA 1JD9A 2PZNA 4HOWA 1TV7A 1RD5A 1O1ZA 4IQEA 2OWWA 4C6OA 4Z17A 4HNVA 5AHFA 4IT1A 9XIMA 1KWKA 6XIAA 3H2EA 5A69A 3WN6A 4Z2JA 3UXIA 2BG5A 1TCDA 3ABQA 3TYBA 2OFJA 4OWGA 1I2OA 2J7CA 3TC7A 3VKCA 2PDXA 1OGBA 2CHOA 1YXDA 1FWJC 1IT0A 2PTZA 5AHIA 1GNXA 1EOKA 1W2VA 3FHQA 1VJSA 4CU6A 5C0QA 4IMCA 3U7VA 1D3HA 1R3SA 4IL0A 5LNSA 1E40A 1NFBA 1OVDA 1SSGA 2Q02A 1VPQA 3WD1A 1WDDA 3CMJA 3GYEA 2Z26A 5IXEA 1F5ZA 3BUVA 4M7SA 1JRBA 4TQTA 4IMFA 2P8CA 3LU2A 5F4WA 3BW3A 3FLUA 1L8PA 2DSVA 3CO8A 4PN2A 4CQDA 5H6HA 4ZL1A 4A3UA 4JTGA 1DIKA 2ZA3A 1W1B1 2E0PA 5CGQA 5DXYA 9RUBA 1H60A 3C61A 4L4OA 3R25A 2J78A 4AH7A 4K7VA 2XVKA 1E6ZA 2E6DA 3V7PA 5CLTA 1XQKA 4JYDA 3AIWA 3R0UA 4I7WA 3MO7A 2GUBA 3IIPA 4RPPA 3UJFA 2ZXAA 2QZRA 2EPKX 3W6YA 4GWEA 1WBHA 1OSEA 1T8QA 6REQB 4RW5A 1QPNA 3ZXWA 4GUIA 4GO9A 1QHOA 3GFXA 4XAPA 3N25A 5LZLA 1GQLA 4IHCA 3VDBA 1QRQA 3ITVA 4O19A 3KRUA 3BOLA 1AG1O 1W1VA 4MB1A 1ZBWA 3WEMA 1JVNA 3LRLA 4UQDA 4L61A 1HKJA 2YDQA 4NIRA 5C54A 1BEUA 2CBUA 1BSLA 1EKOA 4O0QA 3ZT5A 4GZJA 3L7RA 2W62A 1X38A 2YCIX 3KCJA 1MEHA 3NQMA 3D0CA 1AW2A 1LZOA 4Y9PA 4J40A 3U6WA 1FFQA 1OC6A 5AECA 3EA3A 4K37A 3GQYA 3EPNA 4DJEA 3ITXA 1EZWA 2Z1KA 1B3WA 1YDVA 4GNVA 3Q67A 3PUDA 1F3XA 1TJ2A 2DZPA 5CSYA 4GACA 2X05A 2Z25A 1GQKA 3BG3A 1ISWA 1X1OA 7REQA 2ACUA 3E9AA 3AHVA 3Q37A 1EJWC 1DHPA 4CU8A 3TN6A 3APYA 3TSDA 2G3IA 2A4AA 2AMXA 3W38A 4ERAA 1XIBA 4N7QA 3N6HA 2ZA2A 1JULA 1Q6CA 1DVJA 1MUMA 3URQA 3HPZA 1B90A 1QDSA 1XJBA 2VEKA 1XCXA 1R6WA 3R7MA 3V75A 3PUGA 4A2RA 3WBAA 1FWDC 1NARA 2QCEA 3WFAA 3R5EA 2WJEA 4GX8A 3G1HA 3NNTA 4QS5A 3VFCA 2X0HA 2FIQA 4OZOA 3W2NA 3LCGA 1R46A 1U33A 4E3VA 3PN8A 2RJHA 3HOJA 2R24A 2YJQA 3WEZA 4LCRA 1F6KA 3W7DA 5GPRA 2PGWA 2WMGA 4U5KA 3E3HA 3VIOA 2F6XA 1VGAA 3B8UA 3S2MA 2YL9A 3GTFA 9XIAA 1AW5A 2FHBA 3R0KA 2I5IA 5F2MA 1YNYA 4V2XA 2WSQA 2HISA 3M0ZA 3CL7A 5DEZA 1JPKA 5LHFA 3L21A 1UWRA 4OQVA 2G41A 2V81A 2J7FA 4OGZA 4G7EB 5DY3A 2NXHA 3ID7A 1T6MA 3T9PA 4R7JA 1VR6A 1UQZA 2ZZ4A 2PU0A 2BP1A 2V82A 4N6EA 3FSTA 2ZUMA 5T91A 3ATZA 5FCZA 1RY8A 5FF7A 4MF4A 3L5LA 2YFNA 4H04A 4X0NA 1F05A 3PWAA 1R2SA 1QBBA 2GJNA 4QSHA 2Y5SA 3SGZA 4JPGA 3VDCA 2Z29A 1IGSA 4HA3A 4KGLA 3E49A 3R1ZA 4V1XA 4OT7A 3FJLA 2Y8VA 4RE3A 2EBNA 2YBVA 1GVSA 2Y5JA 5AYZA 3H53A 4YCPA 4H8VA 4ONVA 4N0RA 3C3UA 1LQ2A 1MUCA 1KCXA 4GCAA 3LD5A 2P1FA 8RUCA 4RL3A 4WD0A 3W25A 2KX9A 3AROA 2C71A 3QGKC 2J25A 1XCWA 4M81A 2DUXA 1EJUC 4W9TA 4OV4A 3T4WA 1KKOA 1R7AA 3LHYA 4XKYA 5BOOA 2CERA 2ZICA 5AC4A 3GH5A 3W4RA 5C7VA 1K9TA 2VR2A 1BYCA 8TIMA 3WBXA 1DWJM 2ZC8A 2OT1A 2XN1A 3UXDA 2ICSA 5I3GA 2DZUA 4PMJA 4QNWA 1ISZA 3NA8A 3GG0A 4N02A 4EXBA 4WKAA 4KW2A 1GGOA 3AUOA 3GBDA 2VI0A 3QFWA 4AMCA 1PKYA 2G3FA 2HS6A 4AZCB 1O6IA 4IQJA 4ZMGA 3CUJA 1MO0A 3DC8A 2V69A 7CGTA 1NSJA 2OLSA 4KEMA 4D1JA 2WSRA 2ATMA 4S3GA 1UWUA 1XISA 2G0WA 4O12A 2C15A 3T0CA 1RHCA 2GGEA 1R38A 2IXVA 1FY6A 4EWJA 2CEQA 5JXQA 2J7EA 5EMKA 1DTUA 1EDTA 1RH9A 3NL3A 3BQ6A 1QCWA 1FKXA 3S9YA 4DJFC 3QPEA 1HN1A 1M04A 3UXAA 4H9ZA 1O5KA 4NYYA 1XLGA 4N2YA 2G3NA 1BVWA 3N6QA 1VC4A 4D6EA 1Q7MA 3ARXA 2QXWA 1YXCA 1KBBA 3HBLA 2X1SA 3AYTA 1KFCA 3STPA 3VGDA 3QZAA 4B3KA 2R8WA 4F9DA 1E51A 1JAEA 2HK0A 1XCFA 3H12A 3UXLA 3MDUA 3OLGA 2BB0A 5HDRA 4E3TA 1OG0A 1WB0A 3ZT6A 4TVUA 1B1YA 2NZLA 3LTSA 5FJIA 2V3DA 3BXWA 3EWBX 5JU6A 4QE4A 2DZTA 4LW7A 4HPGA 5REQA 4FALA 3BLDA 1FH8A 2ZVRA 1RBAA 1QOPA 3GBEA 1S2VA 4NJHA 1B30A 3E0FA 2CHNA 1PKMA 3LCFA 1GPWA 3VIGA 5AVNA 2D2OA 4R9OA 3MHUA 3SFKA 5FIPA 5CBBA 4JNMA 2Z0IA 1IZCA 5FEZA 3BCDA 1LQAA 5FJOA 2RFGA 1PX4A 3O7UA 4L1XA 4KFPA 4FF7A 2ZDRA 1FDZA 4XD3A 3CZLA 4ALDA 2VZVA 1OYCA 4XIAA 1TJPA 3BLKA 1AJ0A 3W3OA 3JW7A 4UTIA 3LENA 4HHMA 1SW0A 1X7FA 3BH4A 3IK4A 3WQ5A 1TRDA 2Q3OA 5CGTA 5JVLA 2H3DA 4C6NA 1US3A 3RN6A 3LTYA 1EIXA 3M64A 3LHUA 3S47A 3C6CA 3PUEA 4A8RA 1CI1A 5K7JA 1KO0A 4ZO7A 1FA2A 4QFUA 3WK0A 5DLCA 3DECA 3N9KA 3KVJA 1ITXA 4GQBA 2BOGX 4RPQA 2J75A 1PKLA 1E55A 2INFA 3DXIA 5G2HA 3UFYA 4CNNA 4EIVA 1XLLA 2Y24A 4H9UA 2W0UA 3VOIA 2VO5A 3IJLA 3RRXA 3GNRA 1H7PA 2VEMA 3EX3A 3SO7A 1GHSA 5I5RA 3PZOA 5FF2A 4B92A 1AJZA 5AFDA 4QISA 3W72A 4BI6A 1HG3A 4UZUA 2TRSA 1EQPA 1CEOA 2Z7GA 1BTMA 3VNDA 4HTYA 3CT7A 2DPEA 4J3SA 1GKPA 1JPDX 5EY5A 3SY1A 2FZ8A 4A6GA 3KWSA 4QEHA 4ZXLA 3HFTA 1SVDA 3N1AA 3PWGA 5LGXA 1HFBA 3R13A 4GY0A 2V5LA 1H5YA 4ZO9A 4FX8A 4KF1A 3WYZA 2PDMA 2VFIA 3M5VA 1BPLB 3TLQA 4BWLC 2CXEA 2ZTKA 5C8BB 4L7ZA 1ICPA 3KHJA 5FD0A 2QNEA 1Z44A 2VURA 4GUJA 4NAFA 2BVYA 1JFHA 1IXOA 1MNSA 1SMDA 4ROPA 3PZTA 4MYAA 3PBYA 4EPEC 3PBVA 4PTVA 3MKVA 1H49A 3VK5A 4NZCA 4J3TA 3WDQA 5HNUA 1TR1A 3C4UA 2V2DA 2DVTA 2VL4A 3A64A 1HJXA 3CTTA 2ISSA 3SBFA