3N17A

Crystal stricture of e145q/y227f chitinase in complex with nag from bacillus cereus nctu2
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
326
structure length
326
Chain Sequence
b'LGSKLLVGYWHNFDNGTGIIKLKDVSPKWDVINVSFGETGGDRSTVEFSPVYGTDADFKSDISYLKSKGKKVVLSIGGQNGVVLLPDNAAKDRFINSIQSLIDKYGFDGIDIDLQSGIYLNGNDTNFKNPTTPQIVNLISAIRTISDHYGPDFLLSMAPETAYVQGGYSAYGSIWGAYLPIIYGVKDKLTYIHVQHFNAGSGIGMDGNNYNQGTADYEVAMADMLLHGFPVGGNANNIFPALRSDQVMIGLPAAPAAAPSGGYISPTEMKKALNYIIKGVPFGGKYKLSNQSGYPAFRGLMSWSINWDAKNNFEFSNNYRTYFDGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chitinase A
publication title Crystal structures of bacillus cereus NCTU2 chitinase complexes with chitooligomers reveal novel substrate binding for catalysis: a chitinase without chitin-binding and insertion domains
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Hydrolase
total genus 115
structure length 326
sequence length 326
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3n17A00
1CTNA 1US3A 3VM7A 1K6AA 2V38A 2W91A 4CU7A 4J3VA 3ARSA 1HVQA 1TCMA 1CXLA 2W67A 3MSDA 4GI9A 4PMDA 2WMKA 2UWFA 3GNRA 1EDTA 5BRQA 1VF8A 2OYMA 1CXFA 5D8ZA 4AD2A 1TG7A 2PWFA 3RMEA 1DP0A 3MUZ1 1JZ8A 1WZAA 1W1VA 2YJQA 2PWGA 3WEMA 4AD5A 3GH7A 2BY3A 1FOBA 1UWRA 1W3HA 1CGXA 3VUPA 4ACZB 3W24A 1NARA 1ITXA 1W3LA 3SUUA 4GI8A 3VGEA 1G9HA 3DYMA 3WL0A 3AHYA 5A8QA 1LG2A 3SCUA 1AMYA 7A3HA 5I79A 2X8RA 2J8FA 3KZSA 3CZEA 1UHVA 1GORA 4PTXA 4OBSA 2J47A 5GQBA 3IAQA 5E9AA 1LF1A 2E9MA 2GJRA 3QHOA 2WZIA 5HPOA 2PBGA 3AIBA 1E4MM 4UFHA 5BXRA 3BAYA 2CBVA 2BNJA 3NYDA 4OJYA 1UH2A 3VGHA 3MANA 3DYOA 4M24A 2PI6A 3GH5A 5AC5A 1KBKA 1LJYA 2CBJA 2EO7A 3K8LA 3PZNA 2BHUA 4U3CA 1PIGA 2W66A 1E3ZA 4TTUA 4J28A 2G3IA 4WKFA 1UOKA 1J0KA 3BMWA 1XYFA 3EDKA 4FF5A 2EPNA 5A69A 2WWCA 4W7WA 3W37A 3G6LA 3CH9A 4RL3A 3UR7A 5IDIA 3TONA 3AMGA 4M29A 5AC4A 3WH5A 2YA0A 3RIKA 3ZSSA 1SR0A 4PMYA 4YHEA 3VDAA 4ACYA 3SUTA 4P7RA 5BYWA 3UG3A 1XH0A 4XX6A 1OB0A 1W9UA 5AYBA 1OSEA 2QF8A 1JL8A 1BVZA 1K9TA 4RE2A 3OGSA 4MAVA 1ZBKA 1V6YA 1LWHA 2BXYA 1FHDA 3MKKA 3NUKA 4V28A 4CU8A 4UFLA 2J7GA 3GXMA 1XD0A 5I2UA 2GVYA 5A6BD 2VRJA 1V0NA 4JCLA 2FDMA 1W3KA 2WNWA 5ABEA 1V02A 5GPRA 2ZWYA 2BHZA 4QP0A 3WH7A 3B9AA 4NI3A 2X0YA 3NIYA 1E72M 3MUAA 2WMHA 5KEZA 2FHBA 1KXQA 1LL7A 3UESA 4PCTA 1CGVA 1E70M 3OZOA 2XVPA 4HOZA 5ABFA 3I3EA 3VD3A 3E1F1 3QR3A 3VIJA 3WENA 1MVYA 4PBGA 4WKAA 3VNYA 1EQCA 4GXPA 3ARYA 3CBWA 3OGVA 3HMCA 1WDQA 1JGIA 1VRXA 1KQZA 3GDBA 4W93A 4W86A 1ISVA 2BVTA 4HTYA 1EA9C 5FOOA 2WKLA 2VC9A 4JAWA 1GQIA 2JF7A 3ZQ9A 5I0DA 4JKMA 3WNNA 1MW3A 4W5ZA 1Q4NX 3SCRA 5EB8A 4AD3A 3J7HA 1KCLA 5CGTA 3AMDA 1K9FA 3WEZA 2CNCA 4HZ6A 5D9NA 4JL1A 3CUJA 1HKMA 5CPSA 1R7AA 2CHNA 3VIHA 3WDPP 2QLYA 3AHVA 3SURA 1WP6A 1NWSA 1XSJA 1BSIA 2CITA 3PN8A 2D23A 1VBUA 2UY2A 1J0JA 5A6LA 4IM4A 6TAAA 3U7VA 3M6DA 3ZOAA 2PBOA 3GXDA 1JG9A 1JZ4A 4D72A 1BHGA 2EPLX 2A3CA 4QDMA 4P8XA 5EMYA 2C7FA 5IHSA 2ZUWA 1QHOA 3HJEA 4PSRA 3FHAA 1WCGA 3AHZA 1V3LA 3W82A 1B3VA 4E2OA 1EDQA 5I3DA 5ABFB 2VMFA 3WD2A 5CSUA 1NWUA 1CEOA 2XVNA 1EDGA 2WKGA 3AIEA 1FH7A 1JDCA 4AD4A 1RP8A 2DIEA 5BXTA 1ITCA 1DWGM 1HX0A 2ZOXA 3ZJ6A 1BYBA 4KGJA 3AZRA 1C92A 5CJ5A 1E71M 1VFOA 3AMKA 3WF3A 1CGYA 3L4YA 3WNPA 3K8KA 3T09A 3OLGA 3WMCA 4CCEA 5A8NA 4LYPA 1C8YA 3U5UA 1UA3A 4UQAA 5FKYA 2XIIA 2WM0A 2ZUVA 1VJZA 1BGAA 4MB3A 3RJYA 5LA1A 5LYRA 1B3ZA 4C7FA 2XFRA 4W7VA 2WYSA 4HMEA 3NCOA 1QHPA 4NSBA 1GHSA 1MQRA 1EHNA 1W91A 2E9LA 1G94A 4PTWA 3RM8A 4WIWA 4MJ2A 3TP4A 4QCFA 1HP5A 4LX4A 7TAAA 4MNLA 1RH9A 4M82A 1J11A 4PTVA 1DWAM 4U5KA 4S3JA 1IV8A 3APGA 3I3DA 2D0FA 4WF7A 4N0RA 2BXZA 3EDFA 4LPCA 2YIHA 2NT1A 2ZUTA 1FA2A 2JALA 3F5LA 4HU0A 3VO0A 1UYQA 1UKSA 5CSYA 4Q22A 1VEMA 3GNOA 3FN9A 3ZT5A 4F79A 2XGIA 2VZVA 1HT6A 2JEQA 1RP9A 2XIBA 2X0HA 3N9KA 4YN5A 4AY1A 1WB0A 3WUFA 4X9YA 1V6UA 3AS2A 2NW0A 4MTVA 3CZGA 4A4AA 2ZUUA 1H0IA 4H41A 4MB5A 1ZU8A 1JFXA 1BPLB 2VX4A 1JXJA 4GZJA 3PZVA 1E15A 1E4IA 4E8DA 1MWOA 1E5JA 1NM9A 2VX5A 1C3FA 1XGZA 3OZPA 3VU2A 4Z2IA 3M07A 3CUHA 2OWWA 2WZEA 2ZICA 4ZE5A 3T0AA 1M03A 1CDGA 5A8MA 1MXGA 2ZX9A 2Y8VA 1FH9A 2GJXA 3BH4A 2PWHA 4WLCA 1UD2A 2IUZA 3VINA 1G0CA 4JFVA 5A6AA 3BAKA 3CHCA 1F4AA 4C7DA 1KCKA 3AXHA 3WFLA 1LQ0A 5C8BB 1OT2A 3WEOA 1JAKA 1OM0A 2WLYA 3TTQA 1B1YA 1FHLA 3AIVA 4TVDA 1JD9A 3VGDA 1ISZA 2OWXA 3IJ9A 2XWDA 5A2BA 2YBTA 4V27A 5BWFA 1XH1A 1W9PA 2VTFA 4HU8A 2PC8A 4AC1X 4JL2A 1EIBA 4W8LA 1OIMA 1JYXA 4AZCA 2OSYA 4LXFA 1BG9A 2OLHA 4Y7EA 2WC7A 4K68A 4CN1A 1X6LA 2J4GA 4W85A 2E4TA 1UR9A 4AZ6A 2D1ZA 1HVXA 3THDA 3VIMA 2ZUMA 1Z32X 1UKOA 1TMQA 2YL5A 1UQYA 3QHNA 4D6GA 4PMRA 1MFUA 4CD6A 1UKTA 3IK2A 1IZKA 1GOMA 2GJXB 1LL4A 3W6LA 2J7EA 3O2LA 1E0VA 3VIPA 1Q6EA 9CGTA 4IUGA 3VMOA 3ZSTA 3U7BA 4EAMA 3PBGA 8A3HA 2EQDA 1GPFA 5KZ6A 4HMDA 2XGBA 4UQEA 2FHFA 4OIFA 3AICA 1H3GA 1BF2A 1IZJA 1MXDA 4AD0A 3ZJ7A 4PRWA 3I3BA 2C0HA 5A1AA 3OLDA 4OOUA 4U2ZA 1HJWA 1E0XA 3QHMA 3GXIA 2WPGA 4TXEA 5IFPA 2XWEA 3AZSA 2V3FA 5GNXA 4CN4A 4UQDA 2VNCA 4ZXOA 4W8AA 4J3XA 3ARWA 1TUXA 1BAGA 3WD1A 2VUYA 4AZCB 2DEPA 4UZUA 1W9BM 2WK2A 4UTFA 1TVPA 2XVKA 3ARXA 1NH6A 1J18A 1B9ZA 4U33A 3BAIA 4CUCA 2J77A 2V3DA 4PTMA 3SUSA 3VIKA 1E55A 3UEQA 5A95A 2Y4SA 4JIEA 3WDHA 1HIZA 3TTOA 3SUWA 3MV11 1W1PA 1BLIA 1J10A 1CLXA 3MO4A 1V0LA 1HP4A 1ODZA 2ZXBA 3FNDA 3W6MA 5IXEA 3OLEA 4W87A 1NP0A 1G5AA 3EDDA 3CGTA 3L4XA 1HJQA 4HMCA 4HZ8A 4KGLA 1UG6A 2J7DA 4MB4A 1UH3A 1SMAA 2QPUA 3RPMA 1KR1A 4B3LA 4D1JA 2XM1A 3FAXA 4HA4A 4F66A 4AMCA 1HL9A 1R85A 4ZE4A 3VOCA 4ATDA 4MNKA 1W2PA 4F9DA 2ZUSA 3ZM8A 1KQYA 4P7NA 2YOCA 1DEDA 2IXVA 4AD1A 2J8GA 4W89A 2W92A 5DMYA 3MMUA 1WDSA 3QOKA 3N13A 4W88A 1CZ1A 1X6NA 4V2XA 3POHA 1WDRA 1GZJA 1CYGA 1WZKA 2ZX5A 3AS3A 2GFTA 3EDJA 5DT7A 3NDYA 2WVVA 3ALGA 3TTYA 1D2KA 2WMIA 2VO5A 4H04A 1GOIA 1CWYA 4M81A 2MANA 4QLLA 3U57A 1SYTA 1HKKA 1KFWA 1KB3A 1E4NA 2Z1KA 1BFNA 2VZTA 1L8NA 2NSXA 4H8HA 5LA0A 1JXKA 4UR9A 2VL4A 1PX8A 2GDUA 1E43A 5D9OA 2WWDA 4PMOA 3BAJA 2CCRA 4BQ5A 2O9OA 2A3AA 1UD8A 1B0IA 4W5UA 3O9NA 4Q7NA 1TR1A 1GNXA 4MAZA 4WJXA 3AIRA 1JYVA 4AWEA 3BAWA 3TA9A 1Q6GA 5D9PA 1E9LA 4FLRA 4CD7A 2CERA 4XZBA 1X1NA 1NWTA 1ISYA 3WL1A 3WFZA 4AZGA 2YA2A 3WIJA 3AFBA 1GHRA 1HL8A 1JF5A 4H8VA 2OWCA 3VIIA 3VM5A 4D6JA 1PX4A 5C71A 3WF0A 1CXKA 1EGZA 2DPEA 1JI2A 3AIWA 1J0ZA 1OGSA 1H2JA 4MNJA 5A8OA 3F5KA 5GNZA 3N15A 5A6BA 3K46A 1M01A 3SEPA 5E0FA 2VT0A 2WVVB 1EHAA 4P8VA 2OYKA 4GIAA 1M7XA 2WMIB 2VX6A 2V5DA 4P8WA 1J0IA 1V0MA 2BV9A 2BFGA 2VJXA 2BS9A 3CHEA 5D4YA 2WVTA 3K4AA 3SCQA 1OGBA 1UR0A 4JKKA 3N12A 1D7FA 1XCWA 4TVCA 5FCZA 2DIJA 1VFMA 3MS8A 2JIWA 4NRSA 5M03A 3EMCA 1ECEA 2DSUA 1RPKA 4M1RA 4J7RA 4PSPA 1U30A 2G41A 3AHTA 1EH9A 3BLKA 1JDAA 1VFFA 1VEOA 2FHCA 1G01A 1E1EA 1CGTA 2DT0A 3PZMA 2O9TA 1CECA 2YA1A 2WB5A 3PZUA 4MPKA 2CEQA 3AROA 2V3EA 3FY1A 3L4TA 4J3UA 3N1AA 1WZMA 2V5CA 3AXIA 1B2YA 2X09A 3ZT6A 2DQXA 2J78A 4HOWA 2WZHA 3W27A 5D9MA 2E8ZA 1B3WA 1CENA 1R8LA 5HDRA 3WMBA 2ZXQA 4YHGA 1MYRA 3LPGA 4EANA 3B8SA 1V02E 2ZUNA 4WK9A 1UWQA 1OBAA 3UR8A 2G3NA 2JE8A 2ZE0A 3A4WA 1E6QM 2D22A 1FH8A 4GQQA 2CXGA 1UWTA 4XUYA 2OSWA 2XUCA 2W5FA 4FLOA 1LWJA 1H1NA 1W3JA 3RILA 2VR5A 1KGWA 4QLKA 3WNOA 1C90A 1V03A 3QGVA 1QBBA 3ZR5A 1UH4A 2VOTA 3GNPA 2XFFA 3W81A 1JZ2A 3A4XA 4AXNA 5HOSA 2CPUA 4PMQA 3AMCA 1VEPA 2XHYA 5A2CA 4GO8A 3ARUA 1VFUA 3WF4A 4CN6A 1H41A 3W25A 4CGTA 1JNDA 1B3YA 1B3XA 3RCNA 3IANA 2XG9A 1ZBVA 5DF0A 1JYWA 1SMDA 5A3HA 2FH8A 4M56A 4PMNA 3SCOA 1GQKA 1ZB5A 3ARQA 6A3HA 1UD3A 5ABHA 5DO8A 3IJ8A 2RGMA 5BCAA 4FLQA 1OIFA 3BAXA 3AMLA 4U3AA 4GZIA 1QHZA 4UFJA 3WNLA 3BMVA 1G1YA 2WLZA 1SFSA 3WDRA 1OINA 3NJ3A 4UFMA 3UG4A 2WXDM 4W8BA 4S3KA 1J0YA 4JCMA 3W53A 1TE1A 1OD0A 3W0KA 3WF2A 4AIUA 3PZIA 4FK9A 4LQ1A 3W38A 1GOOA 4FLSA 2D0GA 3CZJA 1PZ2A 1US2A 2G4FA 1V3HA 1PZ3A 1EOKA 2GUYA 4DUXA 5M5DA 1CGWA 3WD4A 1CPUA 2EPMX 3VX0A 2WVUA 3W4RA 4Z2JA 3CZ8A 1MFVA 4M80A 2EXOA 1E6NA 2Y8KA 2ZIDA 1IT0A 1BYCA 4TVUA 3WN6A 1ZL1A 4A3HA 2YBUA 3BXWA 3W28A 4MDPA 3CMJA 4AZBA 4RE4A 3W26A 1M04A 1QW9A 3VGFA 2DDXA 1QI3A 5A8PA 1V08A 1UD4A 1A3HA 1V3JA 4U31A 3OGRA 3AISA 3RO8A 1H4PA 4E4PA 4PMUA 5LA2A 4A3YA 2DGAA 4DWSD 1WE5A 3MV01 4H2CA 3WQVA 3NSNA 3SCNA 2VURA 5FD0A 1BYDA 3DHUA 1Q6CA 1J0HA 3M46A 5ABGA 4D71A 4P7LA 2WCGA 2O9RA 5EBAA 5F7UA 3N17A 2NT0A 1BTCA 5A6SA 3T08A 4EKJA 1TFVA 1ZS2A 1VJSA 3N11A 3TTSA 3CLWA 3SCTA 3CTTA 3AOFA 1BYAA 3N18A 5JIPA 4H7VA 1Q6FA 1AQ0A 3OB8A 2BY2A 4PMZA 1VIWA 1LL6A 2VVSA 2ESCA 4ATWA 4P7QA 1JZ6A 3FAWA 2ZXAA 3BC9A 4D6IA 2J79A 5CLTA 2W62A 3F4VA 1E40A 2J7FA 5EFFA 2DT3A 1E5NA 4QAWA 4MJ4A 5E6YA 1AQHA 3EYPA 1GVIA 1HJUA 3VKKA 2YL9A 2XFYA 3VDBA 1OWQA 2WSKA 2ZX6A 5JIWA 4LYRA 4XV0A 1GOKA 1XC6A 4AZIA 3M7SA 1H11A 4HZ7A 2G8ZA 5TD4A 1J9YA 1V3KA 1E0WA 3VGGA 4TX6A 1MQQA 3WD0A 3PZQA 1NWRA 4NZCA 2PB1A 3SIMA 1I1XA 4DWSC 1VAHA 3WSUA 1JZ7A 1KBBA 3CIVA 2J75A 2XVGA 4Z2KA 4HPHA 1PPIA 1U33A 2XVLA 4DM2A 3ZJKA 3GYCA 4ZFMA 3TOPA 4KH2A 4M8UA 3KWXA 4L4PA 3ECQA 3PTMA 2AMGA 4B9YA 1YQ2A 1H49A 2JFEX 4P8UA 4TX8A 1NOFA 3WQ4A 1NP2A 4OOZA 1D3CA 2VRKA 4PCSA 1XH2A 4MADA 3WH6A 1GQLA 2ZXDA 4QCEA 4R27A 5FL0A 4CD4A 1HJXA 3VVGA 1HJVA 3FHQA 1QNPA 2GSJA 1JYNA 2Y2WA 3UERA 3VIFA 3EDEA 4PN2A 1XRVA 3OA5A 4Z2LA 1J01A 3ARTA 1HKIA 4NRRA 2PWEA 5CXPA 5C70A 1V6VA 1S46A 1N82A 1CXHA 1K9EA 2VZOA 2VCAA 5A6KA 4E8CA 3WBAA 2YKKA 2J74A 3VNZA 3HU7A 1E6RA 1JZ5A 4AIEA 1C91A 4CVUA 4GI6A 3U5YA 4B9ZA 1J12A 1E73M 3AZTA 3WNKA 2D24A 3BCDA 1A47A 3EBVA 4W7UA 2VCBA 4QFUA 5JBEA 3UCQA 2F61A 2HVMA 4D6DA 5HXMA 4D6CA 4U2YA 5HNNA 1BGGA 2D20A 2VRQA 3VD7A 1AQMA 2GDVA 2VVNA 5D8WA 4JZ5A 4BQ3A 4MNMA 2WCAA 4PMXA 2CHOA 3B9DA 1QPKA 4C7GA 2UY3A 5JBDA 5A6MA 4GO9A 4PUEA 3OG2A 4CKQA 4AEEA 3ARRA 4HA3A 1EO7A 1UA7A 1HF6A 5HPCA 5IFTA 1E56A 1EOMA 1W1TA 3AHXA 4F8XA 4D6EA 3FW6A 2EBNA 5CQ1A 2X05A 4CD5A 3IJ7A 4DUWA 1UR1A 1C8QA 5CGMA 3CMGA 1CXEA 2VI0A 3VIOA 3ZJ8A 5CPTA 3SCWA 4HOXA 1B31A 4TOQA 3VGBA 5JUVA 2GK1A 2VQUA 2YLAA 3N04A 1UR2A 3KE0A 5EFDA 5JBFA 1KXVA 2E8YA 2WCSA 3IAPA 3OIHA 2WAGA 2D0HA 1KWGA 3WY1A 3WQ8A 5A94A 2DH2A 1MW2A 4WSKA 2RGLA 3ZIZA 2A3HA 3DYPA 5BROA 3VIGA 4CU6A 3AYRA 2VZUA 1CGUA 4CCCA 2QMJA 1E6PA 1GOQA 3WH9A 3L4UA 1GOWA 3WMSA 3CHDA 1PEZA 3KEHA 4JFUA 1B30A 2GJPA 1C93A 3MU7A 2AAAA 4GKLA 1UWSA 2F8QA 4BQ2A 4W84A 4OBRA 1WKYA 1QI0A 3CHFA 4UQBA 2WANA 1KGXA 4UZSA 3L4VA 2D3NA 3WQ5A 1YHTA 3WD3A 1HKJA 2AOSA 4HA1A 2XYLA 1ZBWA 3FXYA 4RE3A 2Y24A 3AS1A 4B3KA 1PJ9A 1R7OA 4P7OA 4KRUA 1W1YA 2X1IA 3GM8A 1NOWA 1EQPA 1F4HA 1W32A 1MW1A 3L2MA 5I77A 1FFRA 1P6WA 3D3AA 3ZT7A 1DWFM 4CVWA 2GK1B 2E9BA 1DWJM 1V6WA 1H5VA 4TUFA 3CUGA 4BQ4A 2DSVA 1W9DM 3GZAA 1QNOA 3OLIA 4ATLA 3AIQA 4PYSA 1I75A 4BA0A 3VD4A 5BRPA 4IPLA 3THCA 5I6SA 3WDQA 3VMNA 1WO2A 5ECUA 2F2HA 1JNEA 4X0VA 5BXSA 4EK7A 3A6OA 2OSXA 1H09A 3BLPX 2QHAA 1WAWA 2WMGA 3KL5A 1V6XA 2A3BA 7CGTA 5M17A 3RJXA 2WHLA 1GVYA 4JFSA 1W2VA 1UR4A 3RM4A 5I5RA 4Z2GA 2VZSA 1XCXA 2WMFA 5CG0A 4LGXA 2PWDA 4AZ7A 4N42A 4TTGA 2FH6A 2EEXA 1ZJAA 2XTKA 1UKQA 1V0KA 1UKPA 3DHPA 2J7HA 1XSKA 3AS0A 2C8NA 4JHZA 4KRTA 3WH8A 3VMPA 2G3MA 3S2CA 3NSMA 3K4DA 1E6SM 2A3EA 2D3LA 2PF0A 3PZTA 5CPQA 4BF7A 1QNSA 1ESWA 1PBGA 2YL8A 2WHMA 2VCCA 2O92A 4CCDA 3VD5A 1FP8A 1QI4A 3PZOA 1VENA 2BVYA 3WUGA 3RM9A 3T0DA 4BS0A 4NF7A 4F9JA 1L0PA 5A2AA 1UD5A 3B9EA 2QMKA 3K1DA 4D6HA 1KWKA 2VR4A 2HISA 1OCQA 4U5IA 4XB3A 4UOZA 4PEEA 3T0BA 1QBAA 4J27A 3NDZA 4H8UA 4ZENA 3WUBA 2WBGA 4BCEA 1PAMA 1Y7VA 4OUEA 2FGZA 2FGLA 1DWHM 3VX1A 1HNYA 1B90A 2XM2A 3GTNA 3OBAA 3O6AA 2WHJA 1GONA 5CZKA 3VDCA 2JEPA 3PHAA 3BSGA 1KXTA 1V3IA 3L4ZA 1LLOA 1JIBA 3WELA 1QI2A 3MUIA 4UQCA 3SUVA 3A4AA 3NSXA 4JHOA 4L4OA 4AEFA 3T2QA 1JF6A 1DHKA 2CIPA 3CUFA 2B31A 4FMVA 1CXIA 3PTKA 3W29A 1O6IA 3AI0A 3WDJA 2O9PA 3UETA 1HXJA 2YL6A 2Z1SA 6CGTA 2W4XA 3F5JA 3WBEA 3MMDA 3GBEA 1KGUA 3KL0A 3ARZA 2E3ZA 5E09A 1UD6A 3GH4A 3POCA 4GQRA 5M3WA 1U2YA 1CBGA 3DC0A 5FIPA 2DSZA 4IISA 1E6ZA 3KL3A 1W9XA 4X0NA 1VB9A 2YDSA 1QVBA 3LPFA 1NQ6A 2X2YA 1BG4A 4AW7A 3AXXA 1Q6DA 3HN3A 1ISWA 1TVNA 3AYSA 1E4LA 5GNYA 1JD7A 1UZ1A 2WVSA 1MW0A 1BVNP 3VD9A 2EJ1A 1GCYA 1UWUA 2BHYA 3VTRA 1QNQA 1KR0A 1HJSA 2DSWA 4DM1A 1DTUA 3SCPA 1KXHA 5I24A 5E6ZA 4HP5A 1UZ4A 2Q8XA 2XJ7A 1ODUA 1ZJBA 4ML4A 4XZWA 3BSHA 2CESA 4UQ9A 3ZMRA 4DWSA 3K8MA 4ZEPA 2VX7A 3A47A 5IHRA 1H0GA 2G3JA 3PTQA 3VILA 1OT1A 1CIUA 4JFTA 4AYSA 4KWUA 1R86A 1WZLA 5CLWA 5BXPA 4IPNB 3LPPA 1GJUA 2CBIA 4MB1A 1GJWA 3CUIA 2DH3A 1V3MA 2EPOA 1XV8A 1GQJA 2YDQA 3L2LA 4J3SA 3EMZA 3BGAA 1I1WA 3ZO9A 2TAAA 1QW8A 2QPSA 3WKZA 4AIOA 3G6MA 1BQCA 1HN1A 1C8XA 1JZ3A 1R87A 4AZHA 3EMQA 1VBRA 4D6FA 4EE9A 5HBFA 1O7AA 3WF1A 4J3TA 3L4WA 1WNOA 4ZXLA 2CYGA 2CKSA 3AJ7A 1ZBCA 1RD6A 1JI1A 2Y5EA 2ZX8A 4DUVA 2DT1A 3CZLA 2UY4A 4UFKA 2CETA 4B16A 2D2OA 1QNRA 3PZ9A 2CBUA 2OYLA 5DT5A 4GZEA 4AZ5A 1UUQA 1M53A 2WC3A 5DFAA 4YPJA 4JKLA 3RDKA 2JF6A 1TZ7A 4JFWA 4DWSB 3A3HA 3AQUA 4UFIA 3VDHA 4KMQA 3CO4A 1MQPA 2IXUA 3AIUA 1WDPA 3MSGA 4UOJA 1E6XM 4AISA 2VQTA 2J62A 2XSAA 1NOUA 3WQWA 4UOQA 5FL1A 2WHKA 4D1IA 4MDOA 3PZGA 1E1FA 2BY1A 4GINA 3LPOA 4PUDA 1QI5A 4J3WA 1UQZA 1DWIM 1FP9A 2XPKA 8CGTA 2E0PA 3CZKA 3MMWA 3SCSA 1XD1A 4GPNA 1PX3A 2WW5A 2BY0A 4B15A 3CPUA 2W61A 1TA3A 1OGGA 4UNIA 2WSPA 2ZX7A 1CNVA 4CD8A 1OD8A 2WBKA 3UG5A 3GXFA 1EO5A 4OZOA 1GUVA 2CKRA 2WC4A 3QOMA 3ARPA 3WNMA 5A6JA 2E40A 2J25A 1JDDA 1CLVA 3D5HA 3T2PA 4OKDA 5I78A 2EPKX 1W9VA 4Z2HA 2YDRA 1QOXA 3WDIA 4R5EA 1WPCA 3JUGA 3ALFA 1C7TA 2BVDA 1E3XA 2JIEA 2YLLA 4PMVA 1AVAA 5E0CA 4URIA 1ISXA 1XHGA 1K9DA 4HPGA 4QLJA 2J7BA 1XYZA 3WUEA 3ZR6A 2XSBA 2UY5A 4ACZA 2QV4A 5AYIA 3MUY1 1UWIA 3LMYA 5DEZA 4LYQA 1PIFA 3DECA 3II1A 3BCFA 4BZYA 2V3GA 3S6TA 1JFHA 1LG1A 2W63A 1C7SA 2DT2A 2WMJA 3GBDA 1UR8A 1XSIA 4WSJA 3WQ6A 3T2OA 1EXPA 2ZWZA 5AY7A 1TA3B 3ARVA 3VPLA 3SCVA 1FFQA 2J7CA 2DSKA 1GW1A 4WKHA 5E70A 5I23A 4UCFA 1JAEA
chains in the Genus database with same CATH superfamily
1UUOA 4AY8A 3S1XA 2W91A 4Z1BA 1GGOA 5F2LA 1HVQA 4R7WA 1TPUA 2W67A 4EXQA 3CQJA 2OYMA 4IPIA 4OFCA 3V5CA 1LQAA 1CXFA 5AKQA 4IMGA 3TXVA 3IS4A 5D8ZA 4AD2A 1XS2A 3B0VC 3ME3A 1M7OA 2B81A 1EPXA 1JZ8A 2PWGA 3PG8A 2VFHA 4HBKA 3N2TA 3WEMA 1KM0A 2BY3A 4FSAA 1X7IA 4IX2A 2GGGA 1UWRA 3VUPA 4ACZB 3OODA 3VGEA 3N19B 4EXBA 3WL0A 3DYMA 3AXMA 3SCUA 1AMYA 1K1DA 4XZIA 7A3HA 1BXNA 4Q4PA 3KZSA 3CZEA 1GORA 1MI3A 4EPKA 4D8AA 2E9MA 3ANVA 3QHOA 3Q2DA 3VUSA 3MSRA 1EWDA 4AFYA 3UZJA 1KRMA 3DFYA 3VGHA 2FPYA 2PI6A 2HBVA 3OVGA 3W7LA 2CBJA 2HCVA 1OFOA 3VI2A 2ZZ1A 4TTUA 2GJNA 1LT8A 4JIPA 2VFDA 2WV8A 2WKJA 2I5GA 4W7WA 4JIHA 3CH9A 5K9XA 3LG3A 4F2UA 2PDWA 4M29A 1N8IA 3OYXA 3WH5A 4MWAE 1SR0A 4PMYA 2QIWA 4XVDA 2C91A 4JX4A 3LNMA 2YCJA 1OB0A 1W9UA 1XGEA 2FLIA 3EAUA 2QF8A 4GY0A 1VCVA 3DU0A 3H4WA 2QDDA 4QITA 2BXYA 3LZ3A 3W1NA 2FGBA 1NIUA 1J79A 2RDTA 2WNZA 3GXMA 4RR4A 1W3IA 2VRJA 1V0NA 2ABBA 5I09A 2O55A 2RKXA 5DLCA 4ZQPA 2ZWYA 4HHLA 2P76A 4DLMA 4EVZA 1C8VA 3MI3A 5HK4A 2X0YA 5FESA 3LV6A 3P5YA 3MUAA 3LQLA 1WA3A 1FXQA 3WCZA 1ZJHA 2NX9A 3L9CA 3OZOA 4AWUA 1RCOB 1SZNA 2X1RA 2YYTA 1TQXA 3KAOA 3N25A 5F4WA 5I3KA 1Y0EA 3OJGA 4GQBA 3ARYA 4GUIA 4S1FA 3HMCA 1LBFA 1ZRQA 1VRXA 3N9RA 3GDBA 4P5UA 2OQHA 4ZO7A 3CAWA 3UJ2A 2BVTA 2VC9A 2ZVRA 2Z1BA 2V69A 3WLLA 2OEKA 2VYOA 4N4QA 4W5ZA 1Q4NX 1O94A 4AD3A 5T9BG 1LLZA 1W5OA 3S47A 2CNCA 3LLDA 4HZ6A 3NDOA 4JL1A 1PO9A 1I4NA 2QLYA 3B03A 3CC1A 4PA8A 3VNMA 5FI8A 4DNMA 3ONCA 1BSIA 2CITA 2QEZA 2D23A 5A6LA 6TAAA 3NQGA 4ZVJA 3C8FA 3R8RA 5BU6A 2EPLX 1X8FA 3VZXA 1TVLA 3UZYA 1QHOA 3P8JA 1KCXA 3OHIA 3HURA 2NV9A 3MB9A 4PRRA 4C6EA 5ABFB 4TO8A 4HGXA 1Z7AA 4I6KA 2O7QA 1QATA 1KD0A 4N4PA 2H8XA 2ZZ2A 3OYZA 3MKCA 5D37A 4REQA 1R9ZA 2Q71A 1RP8A 1HX0A 1VLIA 4C5YA 3URQA 3W7JA 5LIXX 1LLWA 3NL3A 2HBXA 2G95A 4KESA 4KGJA 3IVTA 3MP4A 2NQLA 1AZ2A 2YBVA 5HMFA 3UXDA 1DJYA 1UP0A 1CGYA 4C6PA 2Z6JA 3HIJA 3WMCA 1EX1A 5A8NA 1RY0A 3F1QA 3GDMA 3M7WA 1YLVA 4AVFA 1BGAA 4WEVX 3RJYA 1TPWA 1N8WA 5LYRA 1B3ZA 1QHPA 1EHNA 1JPKA 4F2BA 2OGJA 6REQB 1U5HA 3CXOA 2R91A 3OVQA 4LCQA 1C9WA 3VKCA 3SRHA 2I17A 3TP4A 4QCFA 3QGAC 2BVWA 4IFKB 2DJLA 3TW9A 3UWVA 3VE7A 3QLDA 4MNLA 1EBGA 4HNLA 3APGA 5FSEC 2AKMA 3TJIA 3V16A 3C2YA 4N0RA 3MWCA 2HRWA 4HQVA 4JTGA 4LPCA 2YIHA 1FA2A 4HU0A 3M4HA 4FXJA 1MUWA 3TYEA 4M0XA 5CSYA 4OV9A 1IHIA 3N6JA 3ZT5A 4F79A 2VZVA 4FNTA 3HQPA 2XIBA 4YN5A 2BSLA 3AS2A 3GFXA 2QAPA 4UTTA 1HFBA 3R25A 1JFXA 1BPLB 4HJWA 2IMRA 3IWPA 3LBOA 4MUPA 2VUNA 5F2GA 1NM9A 2BG5A 2VX5A 4L9XA 3E5BA 2X41A 4IMEA 3M07A 1JULA 2J13A 2MNRA 3DKLA 3CUHA 1KRCC 2IPFA 2WZEA 4ZE5A 3UYIA 3T0AA 2V9DA 1AJZA 1MXGA 4NUWA 4IQDA 2QXWA 3TSDA 4B90A 4CNTA 1EF2A 3PJXA 3KX6A 1GPWA 3BAKA 3CHCA 1F4AA 4DXXA 2Y7DA 4FNQA 3W2MA 3KHDA 5C8BB 1OT2A 3WEOA 4KRZA 1JAKA 1Q66A 2C3ZA 2AKZA 1B1YA 1FHLA 3W83A 1JD9A 4LS0A 1HTIA 1ISZA 1I6NA 4NX5A 5F2MA 3IJ9A 2XWDA 2R8WA 3CQHA 4WR3A 3FGCB 3GTFA 2Z26A 1UC4A 1W9PA 3O63A 1PKYA 1XKJA 4AC1X 4JL2A 3QSRA 1EIBA 4W8LA 1XRFA 5G1MA 2BLEA 3F03K 4AZCA 3UT0A 2OSYA 2WC7A 1TX0A 1UR9A 1HVXA 3THDA 5D38A 1RR2A 2ZUMA 3O7UA 2YL5A 3TH6A 3OP2A 4D6GA 1K8XA 4NX0A 1MFUA 4CD6A 3WQEA 4HK7A 4LALA 1ZP4A 3IK2A 1IZKA 4HVXA 1LL4A 3W7DA 3E3HA 2J7EA 4Q8NA 1E0VA 9CGTA 4GABA 5ENLA 3L21A 3GG0A 2PRMA 3U7BA 3PBGA 4LBUA 4JQAA 2EQDA 1GPFA 4QX4A 4LVDA 4GH1A 3QPYA 1BF2A 2W27A 4IWWA 4HIBA 3KCOA 3H21A 3ZJ7A 2NUWA 4S2CA 2XIQA 4U2ZA 1HJWA 1PS9A 3QHMA 1EKOA 3NQ7A 5IFPA 4A2RA 4DPQA 5D2TA 2XWEA 4CN4A 2Y5JA 4DJDD 4UQDA 4UTKA 4XAYA 4ZXOA 4N6EA 3CEPA 1ZY9A 2YCKX 2DEPA 3TROA 2WK2A 5LIWX 2XVKA 1J18A 1B9ZA 4U33A 2Q3RA 1W5PA 3ENLA 5C9ZA 2PGWA 1RHCA 5A95A 1H7NA 1OFAA 4E0CA 3NAVA 3MO4A 4NZFA 4AHPA 2ZXBA 3NVTA 3A9BA 1UR3M 3M0JA 5IXEA 4RZ4A 3QPZA 4LCSA 1KCZA 3NGFA 4H3DA 1RQEA 1I2RA 3THQA 2FZ9A 1HJQA 5G2WA 2KAUC 1U83A 4DO6A 5D03A 4LAKA 3WK2A 3C2EA 2XM1A 4Q3MA 3HGSA 1HL9A 1TCDA 1XF0A 2ZRVA 2BWGA 4AMCA 3VOCA 1EJSC 2P1FA 3W1TA 4DQWA 1HG3A 3UXAA 1W2PA 3E0WA 2H90A 3TN3A 4S3BA 1DEDA 2R1KA 4MIMA 3W70A 3VXGA 2W92A 2Z6IA 2FPTA 1XYCA 3E0IA 2CFFA 3JZEA 4WZHA 4EAYA 1VCFA 4UCGA 4C1LA 3UP8A 1I60A 4V2XA 3BLEA 4AMAA 4F0HA 3POHA 4C6QA 5FF7A 4QE5A 1GZJA 4XBKA 5CG7A 3EDJA 1XINA 4FO4A 3NDYA 4O17A 3TTYA 2WMIA 4RKAA 1GOIA 1TZZA 4RE0A 4M81A 2W79A 4OECA 1L8NA 3EEZA 3KBMA 3UFYA 4UMBA 1I2PA 2PLMA 4GUHA 3R7MA 2X0SA 1JXKA 3H70A 3WX7A 4S23A 2WWDA 3B3DA 4MWAD 4WY0A 4W5UA 4Q7NA 1YNPA 5EL1A 4RDZA 5CC3A 4AVNA 4K2SA 1XIFA 3BAWA 1ZGDA 4ZB5A 4LB3A 1E9LA 1W3TA 4CD7A 3Q94A 1X1NA 4L61A 4X2PA 5EU9A 3F4NA 3E2QA 1PX4A 3WF0A 2BOGX 3UF9A 3DFTA 1EGZA 1IIGA 1JI2A 1WYIA 4A3RA 5GNZA 3N15A 3M16A 2Z24A 1V79A 2ZA3A 1KA9F 3WLRA 3ZWTA 2VT0A 4EOUA 3UVIA 1H1ZA 3WK0A 2WVVB 3BG3A 2V8ZA 4AHQA 2VX6A 3I6RA 4L4MA 2C19A 1EGVA 1XYBA 4GA8A 2OTDA 2VJXA 5H8PA 3IGHX 1PZ0A 3OBEA 4NZ5A 1OGBA 3CT2A 2JIWA 1S1PA 4L6OA 3C2VA 5M03A 1SZGA 2EG8A 2X7VA 3NQ6A 1DJIA 3G18A 4PSPA 4ADTA 1EH9A 4OBTA 3W85A 1KBLA 1YDYA 3C0JA 1E1EA 1G01A 3BGGA 4IMFA 3ITOA 3QC0A 1CCWB 3FDKA 1X96A 2ANUA 3FY1A 4MWAC 3EZ4A 5LGZA 4BF9A 4S3FA 1B2YA 2A21A 2X09A 4BWLA 3ZT6A 1X39A 4FPSA 4QJ1A 1SGJA 2J78A 5DQPA 2KZHA 5HR6A 1B3WA 1CENA 3GIYA 4MJZA 1XICA 2ZRWA 3LPGA 3ELFA 3TC7A 4J5NA 1V02E 4KCWA 1YRRA 2ZUNA 4H9ZA 4JX6A 3LHYA 2G3NA 2JKPA 2ZE0A 1E6QM 3CWOX 1TJ0A 1FH8A 2CXGA 4QJ5B 1UWTA 4XUYA 2W5FA 3T8QA 1MRQA 3RLUA 4QLKA 3WNOA 3MHFA 2O4QA 1C90A 1QBBA 2VOTA 4HHPA 3A4XA 4PGLA 3K2GA 4GFIA 1FDZA 3QKZA 3BUVA 1R3YA 1IEQA 3OA3A 4J2PA 1H41A 3W25A 1JNDA 4HYRA 1R9YA 2XG9A 1ZBVA 5IOBA 2RUSA 2PDBA 4RLIA 2Q6ZA 5GJPA 3TR9A 2IKJA 3GX9A 4M56A 4PMNA 3SCOA 1GQKA 2YDAA 1ZB5A 3TE9A 1UD3A 4JTQA 1YXDA 1S2CA 1BVWA 1M5WA 3ZVHA 4BJHA 2RGMA 1MDRA 1XIHA 4H9MA 2GYIA 3WNLA 3TZNA 4GNJA 1DOSA 3S9IA 5H8MA 1ZSXA 1CB7B 3MQTA 4L80A 3ANUA 3RXZA 1OINA 3UG4A 4RW3A 3CL6A 1TWSA 3T6CA 3WG6A 1XLIA 3W53A 1TE1A 2WQPA 3Q4DA 3Q65A 3NTYA 3WF2A 1F3EA 3W7CA 4AIUA 3P5ZA 4FK9A 4LQ1A 3NQFA 3VDGA 5LXXA 2YZ5A 3LBMA 1US2A 3ES7A 3MWAA 1T8XA 4I9AA 1PZ3A 1ONEA 4WSHA 3G1DA 4DUXA 4X9SA 3WD4A 2HTMA 3UGRA 4ILSA 3STCA 2EPMX 3W4RA 3ISIX 2Y6ZA 4A22A 7XIMA 3IGUA 1E6NA 1YKWA 2Y8KA 3OEXA 2ZRZA 3V75A 4TVUA 4ZSTA 1K4GA 3CYJA 1WUFA 2FKPA 2J88A 4XIMA 3NQ2A 1QT1A 5E1QA 3CMJA 2W3ZA 2VOMA 1J96A 2HK1A 2DZXA 1M41A 4TV5A 5CPMA 5A8PA 1V08A 2B7QA 3FYPA 3RO8A 1H4PA 4E4PA 4PMUA 5LA2A 4R7JA 1VBGA 4ZO6A 1YYAA 2YCEA 4DWSD 3MV01 4H2CA 3EB4A 4GUJA 1BYDA 3DHUA 4E4FA 3TQPA 3GS6A 3OZYA 4D71A 5EBAA 3LXCA 3FKRA 4ZGYA 3TYUA 2I14A 3PUGA 4L1WA 1WXZA 3ABZA 5MKGB 3CV1A 3G8EA 4ALDA 5LNUA 4JYFA 2NQ5A 1ZS2A 4JTRA 3HG4A 3SCTA 3CTTA 3AOFA 2QCDB 5JIPA 1Q6FA 4Y9OA 4PMZA 3QYQA 2ESCA 4C6FA 3KVLA 4GJJA 2HXTA 3F4VA 3MI6A 2X7WA 1LRQA 4O15A 1EWEA 1E5NA 1TV4A 1S1RA 5E6YA 1KTNA 4HU3A 1AQHA 2QDHA 1GVIA 3I10A 1HJUA 3VKKA 3M0VA 2WSKA 3E6EA 4JN8A 5JIWA 3B04A 1E1CB 1TPFA 3THUA 3MYOA 3GAYA 1T0OA 2ACRA 3RLHA 5LKYA 3HPFA 2BB0A 4DF2A 3VGGA 7REQB 4TX6A 1XUZA 1TKKA 1MQQA 3OBKA 3VFCA 2Y85A 1GVRA 3Q45A 3SRFA 4DWSC 1VAHA 3KHJA 1JZ7A 5EKYA 3CWNA 4Z2KA 4HPHA 1U33A 1PE1A 2XVLA 4DM2A 3W1MA 3U9IA 1S2VA 3TOPA 1QPOA 1WKEA 3KWXA 5FF0A 3ECQA 3LHTA 2AL2A 2PA6A 5D30A 1TPDA 2OOGA 1NOFA 1W6TA 1D3CA 4PCSA 1KNWA 4QCEA 2JBMA 1HJXA 3PBYA 4QS6A 5ABTA 1THFD 4Z1AA 3BPWA 4OGZA 3OA5A 3T78A 3DOPA 1F9CA 2PWEA 5CXPA 5C70A 1V6VA 3BJSA 1S46A 1C9DA 2VCAA 3WBAA 2NV1A 3HBLA 1P7TA 4XBSA 5DELA 3KW3A 3WJWA 3ERPA 4N9BA 1RV8A 3TSBA 3T8LA 2VCBA 2XN0A 5HNNA 1IXNA 2QAFA 3SRKA 4JZ5A 4BQ3A 5T26A 3LRLA 2JKAA 1QPKA 2ASHA 4EPEC 4QEEA 1XIIA 3KTSA 3LI0A 1DIKA 3ARRA 1HF6A 5HPCA 1YEYA 4GY7A 3BK0A 2HJPA 4D6EA 5H1WA 1X97A 5CQ1A 3EX2A 4XAFA 4N02A 3UJFA 6XIAA 2GSEA 3IJ7A 1AODA 2HNHA 4DB7A 2Y0FA 3I4KA 2INZA 1UBSA 1VD6A 3CEUA 3TW7A 4XZMX 3W07A 1QAPA 5XIAA 1GVEA 4XZNX 5BMXA 2WAGA 3RU8X 4QQUA 3TEVA 4LAZA 4HCDA 2HS8A 3NPUA 3CU2A 1MW2A 4XG1A 1H1YA 3OIXA 3V0UA 4CU6A 3AYRA 4FP1A 2ZADA 3QV6A 3W1PA 3GNDA 4E38A 2QMJA 3WQCA 3E2VA 4BR1A 1E6PA 3NL6A 8XIAA 3WH9A 1S2AA 2A6LA 2TPSA 5I3GA 1MUCA 3S1WA 2GJPA 3MU7A 2AAAA 3QQ0A 2ZFAA 2GGIA 1O1ZA 4CQAA 2R1MA 5JU6A 3DFQA 1P0NA 4JY8A 4YMZA 1WKYA 4TV6A 3CHFA 3S46A 3WQFA 3REQA 1FKWA 2D3NA 3WD3A 1HKJA 1OF6A 1ZBWA 1F05A 1L6GA 4Y9NA 4B3KA 1PJ9A 3G1SA 3V36A 3L23A 4GZ7A 1FWCC 2X1IA 2F84A 4EXAA 1W32A 5I77A 3FK4A 4DN1A 2OX1A 2ZDSA 4CVWA 4KIEA 1QCWA 4H9TA 3UPWA 5FEZA 4OUIA 1H5VA 4NI8A 1NDWA 1W9DM 3BWWA 3M47A 1RA5A 3C4UA 2PSNA 3WLOA 4KFPA 5BRPA 4Z0JA 1NELA 3THCA 3VMNA 5ECUA 3Q67A 4YU1A 4XKYB 4Q8OA 2CLKA 2PURA 4EK7A 3VOJA 3AUJA 2IQDA 2PTYA 4BI5A 2QHAA 2A3BA 4ORIA 5M17A 3RJXA 3FOKA 1H61A 1RJQA 1LBLA 3TCEA 2ISFA 3PAOA 3AXKA 1W2VA 3PJUA 1HKWA 6ENLA 4Z2GA 1DE5A 1GYMA 1XCXA 5LIUX 2WMFA 4HNNA 5CG0A 2W0UA 4NZ1A 3CYVA 5T9CE 2PLKA 3HQOA 1GKPA 4N42A 4TTGA 1Y8BA 3W72A 3MZNA 4EPBC 1V0KA 4GY1A 1Q7QA 2J7HA 1TUFA 3SB0A 5E0KA 5JMUA 1XC4A 3S2CA 3VMPA 2DZTA 1GZ1A 3K4DA 2H3BA 3V0TA 3N14A 1NF7A 2PDHA 3W2LA 2HK0A 2YL8A 2WHMA 4C6DA 1VPQA 3KVJA 2D73A 1XDLA 1IGWA 1JQVA 1DHPA 1FTXA 1A5NC 3T0DA 2YGYA 4NF7A 3WK3A 4MPQA 3SIZA 4M1BA 5A2AA 4BEUA 3K1DA 4GOAA 4HPXA 1KWKA 2VR4A 4Z17A 1OCQA 1QASA 3E0FA 1NDYA 1QBAA 2ZC8A 1LRTA 4BCEA 4XVEA 1OABA 1Q7MA 1AH4A 4C6JA 1EEPA 1DWHM 1XG4A 5LNRA 2WHJA 1GONA 5TBOA 1HQTA 1FWWA 5FF4A 1A49A 4IFKA 3M5XA 5EPDA 5CBBA 4QSHA 1KM2A 1JDEA 2XH0A 3DI0A 3A4AA 4L4OA 4AEFA 3P0WA 4Y2WA 3OPSA 3T2QA 3H7UA 3WQOA 2CZDA 3TJXA 2HE5A 3SY8A 1M9HA 3AI0A 2YL6A 2Z1SA 5C9UA 1H7PA 1YPXA 3NOEA 1R2RA 1TV3A 3ARZA 3P7YA 5E09A 4O1BA 2YB4A 1ZCOA 4V33A 4WXZA 1CBGA 4C60A 2REQB 5FIPA 1MUMA 2OLAA 4RXGA 1W9XA 1SFLA 3MP5A 2YDSA 3LPFA 4O0KA 3M5YA 3PFRA 1K03A 5FJIA 1E4LA 4WX2A 3PUDA 1JD7A 1VYSX 4IX0A 2EJ1A 1TMHA 2XIJA 3VTRA 1SSDA 4ZZ9A 3NR0A 3R10A 1HJSA 4AHOA 3IIXA 2AQOA 1DTUA 3QFEA 3CB8A 1L6FA 3TCSA 4HP5A 4JDBA 2DW6A 1UZ4A 3BSHA 1F5ZA 3MC5A 4ZEPA 2F7FA 2VX7A 3A47A 4J35A 3KDOA 1ITQA 3EKGA 1OT1A 1CIUA 4JFTA 4AYSA 1QO5A 2X42A 2XH4A 4KWUA 2GOKA 1DYSA 3FGCA 3EB3A 1XW8A 1UUMA 2Y8UA 4WDWA 3GHRA 2CBIA 4MB1A 1GJWA 2QUUA 3MCOA 4WHBA 3W73A 2EPOA 3B0XA 4CNSA 2YDQA 1GQJA 4Z1DA 3EMZA 4WOQA 4MFDA 2AGKA 2POZA 1BQCA 4DVOA 1XL9A 1JZ3A 5EA9A 4MYXA 1B9BA 4QG9A 1ME8A 3EMQA 3ONBA 2IS7A 3WBWA 5CSSA 4EE9A 2RDUA 1QOPA 4Q8VA 4I7UA 2QUVA 5KMYA 4C5ZA 2CYGA 4O16A 4LV4A 1RD6A 4B92A 3NPXA 4DUVA 2DT1A 3CZLA 2D2OA 3UR2A 3LTYA 2OYLA 3XINA 1E9IA 5FJRA 3RDKA 3TN4A 3D46A 1VLWA 1VPXA 3G24A 4GGHA 3H22A 3CO4A 3E49A 1Y65A 3MSGA 1E6XM 3NA8A 4AISA 2QJGA 1HL2A 2J62A 3R0UA 4K8EA 1NOUA 3QC3A 1TREA 5I3IA 2WHKA 2DU2A 5AHFA 1NY1A 1VHNA 3PZGA 2BY1A 3ID7A 2ZZ7A 3PJTA 3VCRA 4GYKA 3IRDA 2A7NA 4TIMA 1QI5A 3EWDA 4J3WA 2WNQA 2XPKA 3U2EA 3A23A 3C0LA 4S3DA 3M64A 2IQTA 3U2CA 1P0DA 1XLJA 3V1PA 3PBVA 2AAMA 3B0PA 3DUGA 4Y9MA 1I2OA 2WSPA 3AAMA 2PGEA 3UG5A 3UXIA 1AJ2A 1GUVA 3A64A 1F6PA 2NLYA 2PDGA 4L9ZA 3M0ZA 3SGUA 3D5HA 4BI6A 3IIOA 4Z2HA 2DZPA 1P5BA 4LCRA 4A3UA 1LDCA 2POTA 3ALFA 2GUUA 1XQLA 3KOFA 5C7VA 3GC2A 4B91A 4PMVA 1KFKA 2V0TA 2WOQA 3IIZA 4JTSA 4JD4A 3DX5A 3H26A 4Y96A 4GLEA 1MSSA 3AC0A 3KBWA 3U48A 2J7BA 1XYZA 3WUEA 1O5XA 2HNEA 2QV4A 3MUY1 3A5VA 4H6EA 3DECA 4HK5A 2YSWA 2VM8A 3BOLA 1C7SA 3AWNA 2WMJA 2VDHA 4WSJA 3EXRA 1LUCB 1EXPA 1Q8JA 3FKKA 1CB2A 3MZ2A 1GW1A 5E70A 3PC0A 1JAEA 1ZCCA 1US3A 5DRIA 1AFSA 1AD4A 2V38A 2AQVA 2ZZ3A 3GC5A 4DBDA 4JEQA 1TCMA 1CXLA 3MSDA 2GZXA 4PMDA 2OO6A 3F4DA 2WMKA 1IT8A 1EDTA 5BRQA 1VF8A 2QDGA 1TR9A 1TG7A 2PWFA 1L6WA 1ZLPA 3EKLA 1FUYA 3LN3A 5LNWA 3GH7A 3TWAA 1P6BA 1FOBA 1Q3NA 3TYZA 1NARA 1ITXA 2BGNE 4AH7A 4CLMA 1G9HA 5A8QA 4UTLA 3T1GA 1LG2A 3W00A 3D3FA 3DFSA 2X8RA 2J8FA 4EF8A 1UHVA 2G0WA 4OBSA 4KW2A 3W87A 3E2RA 2GJRA 5AECA 1W3NA 3AIBA 4UFHA 1TJ1A 4O57A 2EKGA 1A80A 3TAOA 3ITVA 4NAFB 2CBVA 3VNKA 5HMDA 3TA6A 1UH2A 3MANA 4M24A 2V6AA 5AC5A 3KTCA 1KBKA 3K8LA 5D2YA 1J5TA 4U3CA 1PIGA 2ALDA 4IIGA 4XD3A 3G1YA 2QJJA 4J28A 4WKFA 4WVXA 1J0KA 5AVHA 3BMWA 3EDKA 4ZB2A 3MTWA 3S5ZA 3QN3A 3QMTA 1NSJA 2PDFA 3UXKA 5IDIA 1XYLA 2QVNA 3COTA 5AC4A 4B5WA 3A12A 2YA0A 3HG2A 5DMMA 2CHRA 2G96A 3VE9A 2IPWA 4XZ9A 4FIQA 2CW6A 2XDFA 2GQ3A 4OU1A 4ACYA 4EF9A 3SUTA 4P7RA 4LTSA 5BYWA 4QJ4B 3WMLA 7PTDA 4QHRA 4RE2A 3OGSA 4MAVA 3CTLA 1GKQA 1V6YA 4FNUA 1LWHA 3MKKA 1LOQA 4US5D 2A79A 4CU8A 4G2DA 3FLUA 2GVYA 5HJLA 2NUXA 2YCLA 1N7KA 4LFYA 2GQAA 5GPRA 2BHZA 3EWWA 3B9AA 1RK6A 5E5CA 2WMHA 5DMNA 4O1AA 2OZTA 3CV2A 1EJUC 1E70M 3KOWA 3GHUA 1UPPA 4HMNA 3BVJA 3QR3A 3WENA 6XIMA 3QM3A 3SN1A 4H2HA 2I5QA 1VYRA 3SSZA 9RUBA 4NNCA 3DHFA 3M0XA 1WDQA 1JGIA 4G7FA 2VFFA 4HTYA 4LVBA 3FA4A 4LY4A 3RPTA 3ZQ9A 3GXNA 4JKMA 3T05A 3LENA 2YZRA 4WGXA 4LAMA 1OC5A 1XYMA 4KWSA 3QGKC 3AMDA 3V3WA 3ABSA 2CHNA 3VIHA 3K1GA 1KV5A 3SURA 5AYYA 1NWSA 4JQ4A 2R14A 2UY2A 3KS5A 5JQ9A 2ZRYA 3RN6A 3EWZA 3M6DA 1QFEA 2PBOA 3NZPA 4GRSA 4NAEB 1QW7A 2A3CA 4QDMA 4DI9A 3H2AA 4MVAA 2R94A 4LEFA 4PSRA 1FBAA 1WCGA 3T9PA 3W82A 4E2OA 2PS2A 1D8CA 1EDQA 1GWJA 9XIMA 1RQBA 3MJMA 3D0CA 4JHMA 1CEOA 1UROA 2XVNA 4RX0A 3O0KA 1EDGA 3CO8A 1DXEA 4I8YA 5D02A 1JDCA 1EUAA 5BXTA 1ITCA 1DWGM 3IV3A 2OZ3A 4XKMA 2VDGA 1AJ0A 1BYBA 4UC5A 4HNUA 5CJ5A 1VFOA 4QM1A 1K3UA 4ZQCA 3W7RA 3L4YA 1AA1B 2RJHA 1M7PA 2OMAA 2YFNA 2ZTJA 3HFYA 1OZMA 3U5UA 1ZJIA 2XIIA 2ZUVA 3R43A 4HD5A 3LNPA 2OZ0A 1ITUA 2XFRA 1YNQA 4IIEA 4NSBA 3NL5A 3GW0A 3GLCA 4IICA 5CH9A 3RM8A 3T55A 1YPIA 5C9WA 4UIOA 4HTBA 3W7KA 3NQMA 4PULA 1HP5A 4LX4A 7TAAA 1RH9A 2PRHA 4M82A 1J11A 4PTVA 1DWAM 4TMBA 4U5KA 4S3JA 1IV8A 3I3DA 4IGSA 3H4XA 1E0TA 4RZ6A 4EP8C 1TTJA 1PYFA 3W2KA 2VC6A 3UY8A 2ZUTA 3F5LA 3I4EA 2G37A 3H12A 3KOYA 5C5YA 4REQB 2DQWA 4LOCA 3GNOA 4WRHA 4JTCA 1NF0A 3V7PA 2X0HA 2B7NA 3DHDA 3WUFA 1V6UA 4MTVA 1UIPA 4A4AA 2DY3A 3ABOA 4GIEA 4MB5A 4NJGA 1ZU8A 3URNA 4ZOCA 2VX4A 4WXYA 4UR8A 3PZVA 4QE4A 5AZ1A 1E4IA 4EWND 3TMQA 3TFCA 1MWOA 4RXFA 3UWYA 3M6YA 1E5JA 5F4SA 4PL2A 1C3FA 1VQTA 3O06A 2ZICA 3HM7A 1CDGA 4NP7A 2GJXA 3CH0A 3BH4A 1WX0A 4J3ZA 4WLCA 3QZEA 2IUZA 3TOYA 3VINA 1F73A 2ZE3A 4DEFA 1PKLA 1UIOA 2A7PA 1DJWA 3W1AA 2WPBA 3TTQA 3W01A 3UCDA 3BDKA 3ITGA 4TVDA 3S2NA 3VGDA 4E2BA 5CBJA 1VFHA 5BWFA 1PWLA 1DXFA 4HN8A 2VTFA 1TV8A 4HU8A 1BKHA 4U4MA 1FVPA 1OIMA 2OODA 3SJ3A 4GQGA 2OLHA 4CN1A 3CV7A 3L0GA 3TKFA 4YVPA 4A35A 3LCGA 2D1ZA 3PVFA 3VIMA 1Z32X 1UKOA 3QHNA 4IXHA 1IYXA 4Z1YA 5HA7A 3P0XA 1P0EA 1Q6EA 3R0KA 4YYCA 1FWHC 4ZR8A 3P93A 1AW2A 4UTHA 3ZSTA 1UJPA 4EAMA 3STEA 8A3HA 2ODOA 4L5ZA 1NFPA 4HMDA 7ENLA 3A24A 2AQWA 1ONWA 3RX3A 4OIFA 1EUNA 3RAOA 5I7GA 3GU9A 4IUOA 1UOZA 1FXPA 4AD0A 3P84A 1FWBC 2BOFX 2C14A 1V8EA 3A5FA 1E0XA 5TIMA 4WCJA 3I7RA 8TIMA 5D33A 4J3XA 4AF0B 3ARWA 4AZCB 4GNKB 3ARXA 4KIRA 3LCWA 3BAIA 4CUCA 2FZ8A 2V3DA 3VNDA 1EJVC 3G1AA 3SUSA 2FFIA 3SBFA 1E55A 2D2HA 2FFCA 4L56A 2PDNA 4JPGA 4GYFA 1HIZA 3TTOA 4AB4A 3SUWA 3MV11 1BLIA 1CLXA 2V2HA 3WBYA 1V0LA 4DLFA 1KV8A 1LYXA 3W6MA 4QNEA 1XRTA 3DDMA 3C2FA 2TODA 5AYXA 1GQNA 1NP0A 1G5AA 3EDDA 5L9FA 3L4XA 3C86A 2FZDA 1VS1A 4KT2A 3CIWA 4F2TA 2ZZ5A 1J93A 5LHFA 1PTGA 1UPMB 3GE7A 2QPUA 5I00A 1EC8A 2G5WA 3PNUA 4JIRA 1XKYA 4ZE4A 2A4AA 3DG3A 3TU9A 4MNKA 1QPQA 1HGYA 3ZM8A 1XPYA 4DHGA 3MMUA 2A6NA 5BOFA 1CZ1A 1X6NA 1ZFJA 1WZKA 1CYGA 4JGDA 3AS3A 2HVNA 2GFTA 2QW5A 2J6VA 5DT7A 4M5PA 4JYEA 3HTWA 1S3TC 4YVXA 4H04A 3VC5A 2BDQA 3U57A 3STPA 1E4NA 2VZTA 3LEPA 3S5YA 2NSXA 3W84A 1OFRA 5LA0A 3VAVA 2GQ9A 4JTAA 5D9OA 5IDZA 2FZMA 3BAJA 1OC6A 3HG5A 1B0IA 4JTLA 3DN5A 3QMRA 3IVSA 1GNXA 2PLJA 4WJXA 4GIYA 2E77A 3AIRA 1UASA 3VYLA 2PTZA 1U1JA 4AUBA 1O4UA 4ZO9A 2EG7A 3QY8A 1ISYA 1DPMA 2YA2A 3AFBA 2QS8A 5J5DA 4H6RA 2OWCA 4JEJA 2GWNA 3BE7A 4US6A 1S39A 3AIWA 3QMSA 4BI7A 5I3HA 1H2JA 3LBCA 3LDVA 4TU1A 4XD4A 3SEPA 2YR1A 3TSMA 4GIAA 2IKIA 2WMIB 1D3HA 1LROA 2CWNA 3WJYA 4P8WA 2BV9A 2BFGA 2CC0A 3PSVA 2OQYA 4GYJA 3UVAA 4GKTA 5HUOA 3UG8A 1UR0A 4JKKA 1XCWA 5J04A 2FVKA 3TX9A 2DIJA 1VFMA 3MS8A 4WY0B 1RPKA 3UPBA 4XWUA 3AHTA 2VELA 4JICA 3GDKA 3SO7A 3G3MA 1CGTA 3PZMA 2O9TA 1CECA 4M19A 3WLKX 1WOAA 4MPKA 2WB5A 3PZUA 2CEQA 3G0UA 4O18A 3DFOA 3AROA 1KKOA 2V3EA 1VFLA 3L4TA 2DIKA 4GX8A 2C0AA 3N1AA 4NY2A 2V5CA 1XCFA 3PPFA 3GO2A 1T8QA 4PRTA 2PCQA 1YTEA 3S83A 4HOWA 3C3NA 4LNYA 5D9MA 2NQZA 1MO0A 4IQEA 1R8LA 2Y5SA 3WMBA 1OFEA 5LGXA 1MYRA 4YTSA 1RLDA 4EANA 1OK6A 4WK9A 3BLIA 1OBAA 4ROQA 3TJ4A 5C54A 2C16A 3VCNA 4PUNA 4ZOAA 4C6KA 2D22A 2D2JA 4PUKA 2OSWA 2QZRA 1FHUA 5J5RA 5SWUA 1LWJA 1W3JA 2VR5A 1RUSA 4YXGA 4Q32A 3QGVA 2EPHA 3MVTA 1UH4A 2OU4A 1XLBA 5CPLA 1EZWA 2XFFA 3W81A 4PH6A 2CPUA 4YTUA 3CPGA 1SFTA 4PEKA 1VEPA 2XHYA 3S5NA 3WF4A 1O12A 1EJWC 1L9WA 2ZA1A 1H63A 4MUZA 3NZRA 2H8ZA 3SQLA 1SMDA 1GW9A 1WOBA 2RDWA 3W88A 3VKJA 1ALDA 3SQMA 2OKTA 4V1XA 1OJXA 2GL5A 5F2IA 6A3HA 3QQWA 1S5WA 5ABHA 5DO8A 3OTRA 4FLQA 1OIFA 3GFYA 4U3AA 4UFJA 3UR5A 3BMVA 3O15A 4C6CA 3L2IA 1G1YA 2GUBA 2WLZA 3A3WA 4FZIA 1OFDA 3LERA 1E0UA 2QCFA 4FOUA 2G50A 1N55A 1W56A 5I03A 2WXDM 1B54A 1X7FA 4JYDA 3GDTA 1JPMA 3ANYA 4IQJA 3W38A 4PE8A 3MT1A 1IQ8A 6ALDA 3CZJA 1EA0A 3ZYZA 3IV8A 5M5DA 1CGWA 1M3UA 2Z2BA 3BOFA 3CZ8A 1MFVA 4M80A 2YW3A 3S6DA 3I68A 2ZIDA 5CKSA 3ZXWA 2XZ9A 3A4JA 4I5UA 1BYCA 4LUSB 5HQMA 3WN6A 5B7YA 1REQB 3FEQA 5U4NA 3H7RA 2BOEX 1FCVA 1QW9A 4LUIA 3ATZA 4U31A 5TQLA 3SR7A 2PU0A 2QJMA 3FJNA 4KETA 3H2CA 4KS0A 4BY3A 3UYCA 2G4JA 2DGAA 4DJED 3WQVA 4PZVA 4O1EA 3UA3A 1Q6CA 3M46A 2CLHA 3IJIA 2A85A 2WCGA 3WJXA 4D8ZA 4O4WA 3N17A 2JGQA 2NT0A 1A4MA 1BTCA 3EB2A 1OX4A 4XTIA 5A6SA 3WJSA 4EKJA 1XLAA 5AFDA 4Q8QA 4F0RA 3KRBA 1E51A 3N11A 3B4UA 3CLWA 3PPCA 4YCOA 1VPYA 1BYAA 4H7VA 2I16A 2CU0A 4IMCA 4KWOA 1LL6A 1FRBA 2FVLA 3TV8A 1TWWA 2CWXA 2W62A 1TWIA 2NVDA 5CBIA 4WQ6A 1OF8A 4JTUA 4H00A 1SZRA 3LCIA 4QROA 1FWGC 1P48A 3W75A 1JR1A 1Z42A 1JRBA 3OQEA 1QPNA 1DJGA 4JTHA 3W86A 2YL9A 3GVQA 5DANA 4ML9A 2ZX6A 4LYRA 4XV0A 5JH1A 3HMJG 1XC6A 4AZIA 3WO8A 1R47A 5TD4A 1J9YA 1V3KA 4DJFD 1U1HA 5JXQA 1O5RA 2O7SA 4NZCA 3N29A 2QNEA 2PB1A 4ZQNA 4DJEC 5HATA 2KX9A 3WSUA 2Q8LA 3CIVA 2Q01A 2J75A 5HQEA 5HULA 4JXCA 4RPPA 1SJAA 2NSOA 4MG4A 4KH2A 3N2MA 1KRAC 2Z7KA 4LT9A 1H49A 4DJDA 3A22A 4OOZA 2GGJA 4NIRA 2I56A 1FDYA 2P5NA 4H6KA 4R27A 4CD4A 2NXIA 2GSJA 2QUMA 3WLNA 2Y2WA 1S3HA 3VIFA 1TPVA 4PN2A 4ZTXA 1XRVA 2XIMA 2VEPA 1K4HA 1N82A 1K9EA 3LK6A 4R9XA 1FY6A 4S39A 5IM51 1UZHA 2J74A 4H7CA 4B5XA 2XISA 3S1GA 3KRUA 5KZEA 4GI6A 4B9ZA 4ORMA 1F76A 1J12A 4A8LA 1E73M 1B4EA 4O28A 4LBRA 3VOFA 2D24A 3BCDA 3KFTA 3EBVA 5JBEA 4A6GA 2F61A 3L12A 1WV2A 1LP6A 1EBHA 2D20A 2NXGA 2VRQA 1NEYA 1ZHAA 5JBDA 4PUEA 4DJFC 2AL2B 5AYZA 4HA3A 2NQ9A 1EO7A 1TTQA 1UA7A 1SO5A 5I3JA 1W54A 2CLLA 1DQWA 3BW4A 3FW6A 2HE8A 4ROPA 3USZA 1O60A 1C8QA 1EP1A 3CMGA 5CGMA 3KOXA 2VI0A 4QJ3B 4RW5A 4HOXA 5U7SA 3VGBA 2C79A 2GK1A 2YLAA 3N04A 1UR2A 4CCZA 1GYLA 3TJLA 3D6NA 1WKDA 4JNZA 4C91A 1TTIA 3CJPA 3BZGA 4PUUA 1P7TB 4B5SA 3CHVA 3WY1A 1XDJA 3B4YA 2BP1A 5A94A 3T0TA 4S2BA 1HKVA 4FNPA 2RGLA 2R1NA 2C71A 3ZIZA 4MWAA 2A3HA 3VIGA 1OQFA 1JCYA 2VZUA 3RG6A 1VGAA 4HYWA 1CGUA 3L66A 3UBPC 1GOQA 3R2GA 3M5VA 3CQ0A 1EF3A 3LM3A 3DZ1A 1C93A 4QR6A 1QTWA 1UWSA 1V6TA 2PD9A 3BV7A 4NJJA 4GWEA 4OBRA 2WANA 1SJBA 3PWIA 3WQ5A 3P82A 3M0HA 3EWCA 4DIAA 1K7XA 4RE3A 3TVAA 1R7OA 1BTMA 1DIOA 1W1YA 4TMCA 3GM8A 1MW1A 3L2MA 1P6WA 4L6DA 1RCXB 4LUJA 1DWFM 2Z1WA 1GT8A 5I07A 3RK8A 1V6WA 4PB3A 4TUFA 4XZHA 1R38A 1RD5A 4WUIA 1QNOA 4QTGA 4IP4A 4ATLA 2WJDA 3W7OA 2GVJA 1JCTA 2F2HA 1JNEA 4X0VA 3O05A 1K02A 5IRPA 1U1UA 3IJ6A 2J8TA 1V6XA 2A5HA 7CGTA 2WHLA 2ISVA 3SI9A 5CPNA 3QFWA 4H19A 4E4UA 3RR1A 1UR4A 3DC8A 3RM4A 3P62A 1SQ7A 4DBEA 3NQ8A 4NAEA 5AN7A 1DV7A 3U4AA 2V81A 3REQB 2FH6A 3IIPA 2EEXA 3MBFA 1QWKA 4J2MA 4NZ4A 3LCXA 1SFJA 1LRNA 3TC6A 1XSKA 2C8NA 4JHZA 4KRTA 1V77A 2D3LA 4HZMA 3PZTA 3FEMA 3HGOA 4FXSA 3ZLHA 4BF7A 1QNSA 1ESWA 5H91A 1HUVA 2L5HA 4YVVA 2VCCA 4B3ZA 3VD5A 3GWQA 3IUHA 1VENA 1GJPA 4BS0A 4DWDA 3QH2A 3EX3A 4R33A 4B5TA 1YTKA 1GVFA 1L0PA 3TR2A 4Z1CA 4D6HA 1NU5A 4XB3A 4UOZA 3ITYA 5D05A 1R2SA 3CS2A 4ICNA 4K36A 3NDZA 2OQLA 4FALA 4H8UA 3TFXA 1OHLA 1PAMA 5PTDA 4OUEA 1B90A 2XM2A 1XPGA 4GFSA 3VDCA 1LQ2A 1V3IA 3MJYA 3W7EA 2ATSA 4IL0A 1JIBA 3S9YA 4UQCA 4JHOA 5HNTA 2Z1VA 1S2WA 2PRLA 1A5MC 4GYPC 4FMVA 7TIMA 3PTKA 1TSIA 1O6IA 3W29A 4PCPA 2FTYA 1KRBC 4ZOEA 4Q4RA 1UW9A 1HXJA 4R85A 1XIBA 4UMCA 2INFA 3PS7A 1EC7A 3LHWA 2OT1A 5L6UA 1JGMA 2PE4A 5DXYA 1AW5A 2A0NA 3DC0A 1VR6A 4O1FA 3U2ZA 3MW7A 2R9RA 4IISA 3KL3A 1J5SA 1P43A 3LTSA 2FJKA 3DKJA 3SGGA 2X2YA 2PU1A 1DL3A 2A3LA 3AYSA 3CUXA 2E6AA 2TMDA 1UZ1A 1DJXA 1MW0A 3M0KA 5CJMA 1AMKA 1I9CB 1KR0A 4GI4A 3VK5A 3PWAA 3P74A 4CQBA 5I24A 4Z0SA 4PUMA 4H9UA 3UWEA 2OLSA 1G67A 4ML4A 4XZWA 2P0OA 2ZDRA 2CESA 1YPFA 4DWSA 3KVMA 1JCNA 3W7HA 1KFEA 1H0GA 3VILA 4MLJA 3UW6A 1OYCA 1Q2RA 2CLIA 1R86A 4B5NA 4IPNB 2HPIA 1GJUA 3HFTA 4GK8A 4XISA 4M6UA 3CPRA 5K7JA 4AIOA 4CQDA 1ZALA 1HN1A 5AZ0A 1F3WA 3LX9A 1R87A 4RUBA 3NZ1A 5HBFA 2BGQA 2ZQ0A 4Y6GA 1WNOA 5CAKA 3ZLGA 3NO5A 5KSWA 1ZBCA 5IBXC 1ZP3A 1JI1A 1NQKA 3TAKA 4B16A 1QNRA 3TNOA 3STGA 2OZ8A 4MY1A 2ISWA 5DT5A 2ZYFA 2QJHA 3E38A 4GZEA 4AZ5A 3U6WA 4YPJA 4JKLA 3KS6A 4A29A 3NO3A 2JF6A 4JBRA 4QXIA 1F3XA 1JUEA 4KMQA 4GUGA 2IXUA 3AIUA 1WDPA 4UOJA 4LF1A 4KPLA 3W3OA 3MY9A 3SJNA 2NWSA 4F40A 3WQWA 1UMLA 1VRDA 5FL1A 5DXXA 4UTWC 2NVCA 3HPZA 4Y90A 4IXXA 3GKFA 2UZ9A 1PV8A 1DJZA 1EXBA 2ADAA 4MDOA 4D1IA 3QR1A 4AF0A 3ZLFA 1ELSA 3NNTA 4PUDA 1O5QA 1UQZA 1DWIM 3RFAA 4IPPA 3GIPA 8CGTA 1BSLA 2CZFA 4Q8TA 1DBTA 1OCNA 3SCSA 1XD1A 2WW5A 1ICPA 3V18A 3B05A 3CPUA 1TA3A 4X61A 3W2JA 4S3GA 2HWGA 4CD8A 1OD8A 3DG6A 1EO5A 3WNMA 3QOMA 4RZ5A 2J25A 1XIGA 3MHGA 1KBIA 1Z44A 1CLVA 3T2PA 3IUIA 4OKDA 5I78A 3RU6A 1W9VA 2VENA 3U8GA 1KLYA 2E7FA 3WQGA 3HO8A 3WDIA 3C6CA 5LNSA 2G3FA 3S1UA 3USBA 2QULA 2FZNA 4XO6A 2BVDA 2Y7GA 3TTEA 4C1NB 1ISXA 3IGXA 1G4EA 3UD6A 2QGHA 3DEQA 4GACA 1RBOB 2Z0IA 1T40A 1LCOA 2XSBA 4L65A 1UWIA 1ZENA 5DEZA 4LYQA 1K6WA 3KCJA 3BCFA 1H62A 4Q6XA 4G9PA 2VC7A 3LQGA 4B5VA 3LXAA 2E6DA 1LZOA 4NNBA 4YIWA 1W8SA 4Y9AA 1RK5A 4MZ1A 3RRXA 3VPLA 3QPEA 2PTWA 2C1GA 3HB9A 2X1UA 3O1NA 4ERGA 4IG2A 1GEQA 3IJDA 1D7KA 3ARSA 4JN6A 1W31A 1FCUA 3BZJA 5HMEA 4IIBA 2UWFA 4A8RA 3GNRA 2Y62A 4LAUA 3MDUA 4O4VA 3S6OA 3BJTA 1IXPA 2PDMA 3P80A 2VD8A 3RMEA 4RK8A 2QF7A 1DP0A 2P50A 1W1VA 2WQDA 2E6FA 2VKZG 1BF6A 3JRKA 2HDJA 1W3HA 3M44A 4R9OA 3W24A 1QO2A 1W3LA 1B3OA 1LBMA 4GI8A 4KCTA 4N9EA 3DERA 5I79A 1PHWA 2J47A 5GQBA 5E9AA 3R12A 1LF1A 2VGIA 4IGHA 5K3VA 2PP3A 2WZIA 2XZ7A 3P8IA 4NKCA 1E4MM 3MYPA 5CZTA 5D09A 3BAYA 3NWRA 4AVOA 1XJBA 2BNJA 1FWIC 1S5MA 1Y5WA 3O3RA 3QLLA 4OJYA 3DYOA 1WBHA 3GH5A 2EO7A 3PZNA 4ECLA 4WY0F 2W66A 1E3ZA 4XQ6A 3T4CA 3EX4A 3GAKA 3LHUA 3BGJA 4DZIA 3GYEA 2EPNA 3H23A 1AH0A 2WWCA 3SY5A 5FACA 4RL3A 3UR7A 3AJXA 4Q6JA 1BWVA 1UWAA 4PFHA 3RIKA 4LUTA 3EXTA 2Z00A 2DZUA 4AYGA 3VDAA 3B8TA 1XH0A 3B8IA 1PYMA 4LVFA 2HSAA 1JCLA 1I0BA 1H7RA 1ZBKA 1TB3A 4AX7A 1FHDA 3NUKA 4UFLA 1XD0A 4GJIA 5I2UA 3EPMA 5A6BD 1XLLA 3NEHA 5GJNA 2EG6A 1PUDA 3EOEA 4MY9A 4JCLA 4KFOA 3GRIA 1AL7A 2WNWA 5ABEA 1V02A 1Q6QA 4CQ9A 4QEHA 4QP0A 3WH7A 3NM1A 3NIYA 5DCBA 3F7JA 4UTUA 1WAUA 1AG1O 1PDZA 1KTCA 1LL7A 3GG1A 3UESA 2YYUA 2XVPA 4HOZA 1YMYA 3E1F1 2H9AB 3GD6A 4PBGA 5KINA 2WZTA 3QV7A 2HPMA 4WKAA 3NXLA 3VNYA 5CEWA 2Z27A 4FS9A 4ZO8A 3NQBA 4GXPA 3AYVA 4NHVA 4BHYA 4W86A 4LV9A 1RBLA 4JAWA 3TQ0A 3UXLA 4MKVA 5I0DA 3WNNA 2SFPA 4JX5A 3SCRA 1NFGA 1W1A1 5EB8A 3R89A 2PDPA 2V2DA 3J7HA 4A21A 5HWNA 4ZQRA 1KCLA 3QYSA 5M2FX 1PB0A 2F6XA 1K9FA 3GDLA 4OT7A 4LU0A 2CZVA 4JN7A 4S38A 3WDPP 2QYGA 1YXYA 3AHVA 4QGCA 3FVDA 4U10A 2HROA 1WP6A 1XSJA 3F4WA 4AWSA 4C6MA 3PN8A 3EPOA 1J0JA 2YCLB 1S5VA 3U7VA 3RITA 2DUAA 2YXOA 4DBUA 3GXDA 3W1LA 1JZ4A 1BHGA 5HMSA 4J4KA 5EMYA 5IHSA 2ZUWA 3CNYA 3SDOA 3OO2A 1VBJA 3N6HA 3FJLA 3H7VA 1V3LA 1B3VA 2W9MA 4GQ0A 4NJHA 4Q4SA 4AEOA 3WD2A 1WUEA 1OG6A 1AH3A 3V1HA 1V93A 2Q3OA 2QKFA 3ZZ1A 1XFBA 2WKGA 3AIEA 3M43A 4AD4A 2C15A 2DIEA 4LUSA 4QSFA 2J9XA 4IJBA 2ZOXA 3MSYA 2NVAA 1LORA 5A8GA 2BZNA 2PP0A 3ZJ6A 1SR9A 1REQA 1AD1A 2G97A 3AZRA 1C92A 3WF3A 3AMKA 4M7TA 1KFJA 4R34A 3K8KA 2PTXA 4CQCA 4CCEA 3NXFA 1C8YA 3DXIA 1JRCA 3HQNA 1UA3A 4UQAA 3OZMA 5D32A 2WM0A 4PB4A 1TTPA 3EPNA 2JQXA 2OG9A 4CNNA 4MB3A 4X60A 1EEXA 5AHEA 4XK2A 4W7VA 2WYSA 5GJMA 2Z28A 1GHSA 1G4SA 1W91A 1O95A 2VEKA 2E9LA 1EZ2A 1G94A 4PODA 5AOUA 1EC9A 4KERA 3GTXA 5DRCA 4ZQMA 1XI3A 3NZQA 4MJ2A 4HB7A 4DZAA 2IQ0A 3GR7A 1I2QA 1A5BA 4WF7A 3KP1A 4QS5A 2BXZA 4ZBCA 3JZUA 1TWZA 3UZWA 2JALA 4Q7IA 4Q22A 2PAJA 3RMJA 3B8UA 2YXGA 2XN1A 1HT6A 3G77A 3N9KA 1FWAC 1WB0A 1TV7A 4X9YA 1O66A 2NW0A 4TX9A 2ZUUA 3C52A 4GUFA 2VWTA 5T91A 3FX4A 1JXJA 2DVTA 5J8LA 3QTGA 2GGHA 4S3AA 3ZFHA 4B4FA 3KRZA 4Q4QA 3OZPA 3GVVA 1CLKA 3VU2A 1M03A 5A8MA 3EGJA 2ZX9A 2Y8VA 3RCMA 2QIIA 1G0CA 4JFVA 1F7BA 5A6AA 1QJWA 3PBWA 4C7DA 4DZ5A 3KDNA 3WFLA 1SW3A 1OCBA 4INFA 1N2VA 1MEIA 2DJXA 1SO3A 2WLYA 3CASA 2YCIX 3LGDA 3GIQA 1HW6A 3NEVA 1FCQA 2VD9A 1OFQA 5BZAA 1VCGA 3DENA 5FEWA 5A2BA 3KXQA 4UTIA 3RNDA 3NZGA 3OOQA 4PR4A 4P2VA 4F4RA 3VOHA 1XH1A 3CAKA 2PEVA 1UC5A 2CZEA 2R1LA 3LXBA 2R24A 5AB3A 1JYXA 2R82A 1PXGA 4ZMGA 1OFBA 3HV8A 4Y7EA 1X6LA 4W85A 2E4TA 2VFEA 1P0KA 3H2FA 3NPVA 4IMDA 4PMJA 4E3VA 1AZ1A 1UKTA 4FOJA 3B9OA 3FIGA 2GJXB 2OGYA 3W6LA 1SPQA 3KUMA 4IUGA 3L0NA 2YW4A 4GXMA 1UCWA 3FYYA 1GG1A 3M5ZA 1BD0A 3FJ6A 5KZ6A 4UQEA 3SRDA 1H3GA 2VFIA 3PB2A 5A1AA 3OLDA 1Q7ZA 5K4XA 3PK7A 3LYEA 2WPGA 2HXUA 3AZSA 5AHLA 2V3FA 2YPIA 5GNXA 1P0BA 2VNCA 3B06A 3QV9A 3TN6A 1P1XA 1ME9A 4XAZA 1TUXA 1BAGA 4O14A 3WD1A 2VUYA 3JVAA 4UZUA 1W9BM 2HV5A 3UNDA 4ZODA 1NH6A 4H83A 3EKZA 4MKSA 3VIKA 3N3MA 3UEQA 3I6EA 2Y4SA 1Z41A 1KO0A 1W1PA 2V67A 2A2IA 4C6OA 1ODZA 1ZAHA 1B5TA 2FJUB 3W7QA 2VR2A 4XD6A 4O10A 4W87A 3B97A 1FWTA 4AAJA 4HMCA 1R9XA 3NG3A 1TIWA 5BWAA 4OE7A 1OZQA 1UMYA 4AXKA 3NPWA 4KGLA 5BOEA 1UG6A 2J7DA 5F4XA 1F2JA 3ZWSA 1UH3A 3R1ZA 4G7EA 1SMAA 2VWSA 4FIRA 4B3LA 3BANA 3FAXA 4HA4A 3VZYA 4KEZA 2ZCGA 1V51A 4F9DA 3HQ1A 3P60A 2YOCA 2IXVA 2RAGA 4AD1A 2J8GA 4W89A 3C56A 5DMYA 1WDSA 2Y61A 5G4HC 3N13A 2NQJA 5FSDC 1YADA 2X30A 4LYKA 1EIXA 2ZX5A 4Q8PA 1W37A 3EA1A 1OYAA 4PUJA 1YX1A 1DKWA 4FXRA 3W1QA 1CWYA 4QG6A 1W5QA 4NU7A 2H3DA 1RA0A 3BLFA 3IEBA 1KB3A 3KLKA 2Z1KA 2E25A 1JPHA 2PDIA 3FVMA 4HNVA 5AHIA 1F3TA 2NX3A 4UR9A 1VZWA 4DNHA 2GDUA 3LRMA 4QBXA 4PMOA 2CCRA 4BQ5A 4ZA0A 4QE1A 2A3AA 1UD8A 3GR4A 5C55A 1TR1A 3KCLA 3RLGA 4N7QA 4HCHA 1Q6GA 3AU6A 1L6SA 1K7EA 1VBHA 4FLRA 3B40A 1NWTA 3WL1A 4AZGA 2QDEA 3MO7A 4D8LA 4DO5A 3W2NA 4IFRA 3W1UA 4KWWA 2RFGA 9XIAA 3P3BA 3VIIA 3VM5A 3SN0A 1CXKA 2DPEA 3LB0A 4MZ8A 4MNJA 4US5A 1TJRA 3GQYA 3F5KA 3UJRA 2QCEA 3E9AA 3K46A 1M01A 3DFPA 3EWUA 4K6AA 3HG3A 1BXCA 5FJPA 1EYEA 1JPIA 2V5DA 1ICSA 1EPVA 3OW1A 5I3FA 1V0MA 2VHLA 3BQ6A 2B7OA 1I45A 3CHEA 5G4WA 2WVTA 3K4AA 4HA0A 5LSMA 3N12A 1D7FA 4LVGA 4NRSA 1ECEA 4N9CA 4ZSUA 3GU2A 3BLKA 5ECVA 1VFFA 1VEOA 3GDRA 2FHCA 1F8IA 1NAL1 4I9TA 5HWJA 5T8GA 4NL1A 3BV4A 5EMKA 4GCAA 1YNYA 4JNMA 4IOTA 4DZHA 4J3UA 5AHMA 3INPA 3RUBL 3AXIA 4RNFA 4LRSA 3GG7A 4FA3A 2IPGA 3F4CA 3CUZA 4JOMA 4GBDA 2DQXA 1SZEA 3MMTA 5E9XA 2E8ZA 5CZJA 4DPPA 2BASA 2ZXQA 4LVAA 1W1IE 3FJ4A 3GUWA 2BTMA 1UWQA 5BMWA 1XP3A 2HMCA 3QSTA 3A4WA 2ONEA 4OVXA 4I8DA 4R3UA 2XUCA 2CZ5A 1KGWA 4B2DD 2P3ZA 4TR9A 3ZR5A 1T41A 3DH7A 4H9VA 3EX6A 5D2XA 1JZ2A 5HOSA 2EAWA 4PMQA 3AMCA 1HGWA 5A2CA 1G69A 6PTDA 4CN6A 4CGTA 1B3YA 1B3XA 2PC4A 3RCNA 3C8NA 3H4GA 3RHGA 2UV8G 2QT3A 4XSMA 3EWXA 5A3HA 2FH8A 2I57A 3ZR4A 3DFHA 4HJFA 3IUDA 3GY1A 1IE7C 3PF3A 2FZBA 1TRIA 3NURA 2OOFA 3ARQA 1GK8A 3MDWA 2ZVIA 5EYWA 3E74A 4NZ3A 3G1HA 3BAXA 5D2WA 3A9IA 4GZIA 1QHZA 2VEMA 4YTTA 1VFSA 2V5LA 1SJDA 3WDRA 4UFMA 2ICSA 1J0YA 1GOXA 4H1ZA 2XH7A 1OD0A 3H2NA 3W0KA 2Z7GA 3QQ1A 3PZIA 4YNGA 1QOQA 4FLSA 1QDSA 4IJRA 1POJA 4I6VA 1PZ2A 2FMOA 4NVTA 1EFZA 2G4FA 1VYPX 2PODA 4ERAA 1V3HA 3OQ8A 3W7MA 2GUYA 2RH9A 4IIHA 2WVUA 3JR2A 1A5OC 3QZ6A 3H2EA 3TK7A 1ZL1A 2GVGA 2YBUA 3BXWA 3W28A 1PTDA 2ISDA 4RE4A 2WNNA 1M04A 3M9YA 3VGFA 2DDXA 1LTDA 1A3HA 4QDWA 1OY0A 3WLMA 3AISA 3GXPA 1IT7A 4K37A 3LGEA 4A3YA 1FCBA 1JCJA 4GVHA 3MPGA 1W17A 3N2OA 2BGSA 2CLEA 1J0HA 4ICCX 2F2KA 4P7LA 1KTBA 5AC7A 4BEQA 2Q02A 3RGTA 1DIDA 4LS2A 3DAQA 3MUCA 3ITCA 1ZZMA 4HSOA 1TFVA 4W9TA 5G1TA 1TJPA 4JQ1A 4M6PA 2DW7A 2DP3A 2OXNA 1I8JA 4JR5A 1OADA 5DY2A 1SO4A 4P7QA