3N1UA

Structure of putative had superfamily (subfamily iii a) hydrolase from legionella pneumophila
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
SLNTEIEMNELLEKAKKIKCLICDVDGVLSDGLLHIDNHGNELKSFHVQDGMGLKLLMAAGIQVAIITTAQNAVVDHRMEQLGITHYYKGQVDKRSAYQHLKKTLGLNDDEFAYIGDDLPDLPLIQQVGLGVAVSNAVPQVLEFADWRTERTGGRGAVRELCDLILNAQNKAELAITGYLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, HAD superfamily, subfamily III A
publication title Structure of putative HAD superfamily (subfamily III A) hydrolase from Legionella pneumophila
rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
total genus 60
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3n1uA00
3DNPA 1QQ7A 1WR8A 2HF2A 3RF6A 2YMLA 2C8LA 4NFLA 3EPRA 4OD0A 5ALGA 4EX7A 4Y2RA 1SU4A 5AW3A 3KDPA 2IOHA 1Z4MA 3ZU6A 3KZXA 4BEVA 4FE3A 1Z5UA 4L57A 4J03A 5AVZA 2YMPA 1S8OA 3NRJA 2G08A 3L7YA 3WKDA 1XP5A 4EZEA 3P96A 4GIBA 4L6AA 2FPXA 2WM8A 2FDRA 3QU4A 4F72A 3HLTA 1KYTA 5AVYA 1QH9A 5IT4A 2R8EA 2C4NA 3QNMA 4Y2XA 5A3RA 1RQLA 2HI0A 4BX0A 3W5BA 1CR6A 3K1ZA 5AK4A 3SHQA 4AS3A 3ZVLA 5ALRA 2P9JA 3NIWA 3U7HB 3UMGA 2YFYA 5AK3A 3NANA 3R9KA 1Z88A 3N28A 3I28A 2Q4TA 5ALWA 1Z4IA 5ALZA 2EATA 2ZBEA 3ZI4A 4DCCA 1IWOA 1U7PA 2MU1A 1YJ5A 4CF4A 2EARA 2QYHA 4HGRA 1O03A 3QU2A 1RLMA 5ALLA 4O8CA 3R4CA 1NRWA 2GO7A 3L8GA 3N5KA 2HDOA 5ALMA 2C9MA 3KC2A 4CF5A 2VKQA 3UMBA 3KOOA 3WK7A 1J97A 2R8ZA 2EAUA 3L5KA 3DV9A 3ZVNA 2WFAA 1YS9A 3EWIA 1Q92A 4KYTA 3E58A 4Y2UA 2JAOA 4BYGA 4DW8A 1ZRMA 1Z4JA 4YIHA 3L8FA 2BDUA 3PGLA 3SKYA 3L0YA 1XVIA 1Q91A 5AK6A 3KD3A 1ZS9A 5A3SA 2HF7A 4KNWA 3A1EA 2B1QA 5AKKA 3AR4A 5IS2A 3EF1A 3PCTA 4B6JA 3ED5A 2NO4A 2OA0A 4C4SA 2YMQA 3M9LA 4Y3UA 5ALSA 3EF0A 1WVIA 1FEZA 1N9KA 2O2XA 5AKHA 1LTQA 1O08A 4MUMA 2FPRA 1U7OA 5AIAA 3AR6A 5ALKA 5AVVA 2OBBA 3R09A 1VJ5A 1X42A 1ZRNA 4YGYA 4HGNA 5AI5A 3U7EB 2HX1A 1TJ5A 3ESRA 4Y2YA 1T5TA 5AKJA 2CN1A 2JARA 2Q4RA 2WHEA 5ALFA 4BNDB 2B0CA 3BA6A 1JUDA 3ESQA 3QYPA 2AGVA 1RMQA 2GHTA 1T5SA 3E84A 5AVSA 2G09A 3WK4A 3I1YA 1ZD4A 4C4RA 4UMFA 2HCFA 5AKYA 4MWOA 1VJRA 2OYCA 2HSZA 4XOUA 2WF6A 3QX7A 2P27A 3BWVA 2R8YA 4AS2A 3VAYA 4BX3A 4NV0A 4RETA 3DDHA 5AIBA 3B9BA 4UAVA 5ALXA 2W43A 3N1UA 3WGVA 3L0CA 1CQZA 2I7DA 5ALOA 4EELA 4QJBA 3QGMA 2CFSA 3OPXA 2FUEA 4DWOA 2ZBDA 3DAOA 3FPSA 3FPBA 2P11A 4C4TA 4ZEWA 4XE5A 5AW7A 4EENA 4L6CA 4YCNA 3WK9A 3M1YA 3QUTA 2RB5A 5AKZA 5AKLA 4RESA 4H1WA 2ZXEA 1RKQA 1Z4LA 2CFTA 4KX5A 4I9FA 4Y2TA 1WPGA 5AW4A 1L6RA 2CFRA 2WF7A 1MH9A 2FI1A 3I76A 3W5DA 2FUCA 2YMMA 1RMTA 3AR2A 3RFUA 2GHQA 2FEAA 3QXGA 1J8DA 5AHXA 4HGQA 4NWIA 4FFDA 4KNVA 3OCVA 1TJ3A 1RDFA 1Z4OA 5ALEA 5ALQA 1ZD3A 1F5SA 3CNHA 1RRCA 5ALNA 2I33A 4OHFA 4BNDA 2B82A 2JAUA 4F71A 3AR7A 3MPOA 5AI8A 5JJBA 5AESA 2FPWA 4G63A 3AR3A 4OFZA 3NAMA 4UU0A 1YV9A 1Z5GA 4Y2QA 2YJ6A 3PGVA 4Y2PA 5ALPA 3ET5A 4UATA 4Y2SA 2W4MA 3N07A 4YIKA 1N8NA 3S6JA 4G9BA 5FP0A 3ZTYA 2IOFA 4BEWA 2HEGA 1ZOLA 3FGOA 4I9GA 1RKVA 3OCXA 3WKCA 1AQ6A 3IJ5A 2PR7A 3U19A 5AI6A 1U02A 2NO5A 5AVTA 3L8HA 3U26A 5AKEA 5AM4A 2YJ3A 5ALUA 4UAUA 4HGPA 3OTQA 1S2OA 1TA0A 2FPUA 3QUCA 1K1EA 4UARA 4J2TA 4FYPA 2B30A 4CE6A 3U7GA 2B1RA 2IA5A 3FZQA 3I6BA 4UMEA 2G1AA 5AW6A 5AW2A 1EK1A 1L7PA 2ZBFA 3AR9A 2YJ5A 5AW5A 3W5CA 5AVQA 5AK5A 3ET4A 5AICA 3UMCA 3NASA 3OCWA 3SD7A 1Y8AA 2HOQA 1RLOA 4CF3A 1NF2A 5AVWA 3L1VA 1LVHA 3OCUA 2W11A 2NYVA 1QQ6A 4EEKA 3A1DA 5T41A 1TE2A 1Z4KA 5AKGA 2I6XA 2ODAA 4UMDA 5AI0A 3HYCA 3NUQA 2AMYA 1RQNA 4JB3A 2RBKA 3B9RA 3FM9A 2QLTA 3ZWDA 4UU1A 3WGUA 5AW1A 2YBDA 3CZ4A 5A3QA 2WF9A 1RC8A 2IYEA 2P69A 2JAWA 5E0OA 4DFDA 3TLMA 3UM9A 4EX6A 3N8GA 3AR8A 5AM2A 1RKUA 2FPSA 4UM7A 4KN8A 2IOFK 2ZOSA 3F9RA 3QUBA 3B8EA 3L0BA 3IB6A 5ALVA 2G80A 2PKEA 2Q5EA 1XPJA 4GXTA 4HYTA 1QQ5A 5ALYA 5AKXA 3IRUA 2JGAA 1Z4PX 3WK8A 4CNQA 1RMYA 1Z4QA 4YH1A 4AP9A 3E81A 4Y2JA 3MC1A 3QLEA 2D2VA 4HAIA 5ALJA 4UASA 3QU9A 5AM0A 2R8XA 5IT0A 1U2TA 2HHLA 4XQ0A 1YNSA 2AH5A 3A3YA 2B8EA 4YCLA 2ZBGA 4YCMA 5AM1A 1WZCA 3NALA 3ZTWA 2B8JA 2YN4A 3D6JA 3SMVA 1YMQA 2BDEA 1EK2A 2AUTA 4ZEXA 2OM6A 4E88A 3FVVA 2MSNA 1L7MA 1PW5A 2X4DA 4UM5A 3ZX4A 5ALTA 1SWVA 3PDWA 2PQ0A 2RARA 1VFPA 2HO4A 2WF5A 1RLTA 3OCYA 4UW9A 1YDFA 4NABA 5AVXA 5AW8A 3J7TA 4Y2VA 3MMZA 2C8KA 4QQFA 3SF0A 2G06A 1SWWA 3ZWKA 3QU5A 3ONNA 3SLRA 2G0AA 3ZW7A 4BBJA 3WKAA 3ZVMA 3A1CA 3AR5A 1L7NA 5ALHA 1TJ4A 1L7OA 5AM5A 4BKMA 1ZD5A 3GYGA 4ZEVA 4HGOA 4IFTA 4NAVA 2G07A 3U13A 1QYIA 3QU7A 3W5AA 5AKIA 1ZD2P 2BY4A 5AVUA 3ZUPA 2ZG6A 2I54A 3E8MA 2RAVA 1L8OA 3L8EA 3WK6A 5ALIA 1Z4NA 5AM3A 5AVRA 1ZJJA 4OCZA 5AI4A 2GFHA 2GMWA 2YJ4A 5AI9A 3OCZA 3KBBA 2I34A 5AW0A 3WK5A 1L8LA 4UMVA 2O9JA 3U7FB 4KX3A 1U2SA 2WF8A 4IG4A 5AW9A 2YY6A 3L1UA 3WKEA 1NNLA 5ALDA 3MN1A 4BX2A 1T9ZA 2DQSA 1RPZA 3ZX5A 4JDPA 3WKBA 3QUQA 2I55A 4XPZA 2C88A 4PNHA 3SKXA
chains in the Genus database with same CATH superfamily
1Z34A 5ELMA 3IHLA 4YP6A 1W19A 2X77A 4XVUA 1QCZA 2Q3BA 1W48A 4LHYA 2FOLA 4MW0A 2P9TA 3KB6A 3WRXA 1QYWA 1KARA 2PYIA 1GPYA 3Q9UA 4EX7A 2O20A 3WGKA 4H0NA 1XLUA 4F97A 1IN7A 3OCJA 2EKQA 4CIDA 1AQUA 1HTBA 3I5MA 4N7BA 1UK6A 4JLKA 2FSUA 4J3FA 2YV3A 1NLFA 5E3HA 4WUTA 3SNHA 4XYGA 2YZNA 5AVZA 1S8OA 1U9IA 2GZ3A 4ND2A 4D4KA 2Y27A 3PQ5A 3EIWA 1NF3A 1IK4A 1OXBB 2Q4BA 1EDOA 1KE1A 1P6QA 1PSZA 4DV6B 1WW2A 5IJXA 1QBGA 2XYQA 5HE8A 1MAHA 3SVTA 2G4LA 2Q1SA 4R68A 5EIBD 1N2ZA 1OC4A 3AIMA 3V2GA 1WXQA 1X14A 3K96A 3NAGA 4CM9D 5C3MA 4LOAA 2JAPA 3GNSA 4D5EA 5JFTA 1LB1B 1AB5A 3S27A 3KXIA 3W5BA 5FTKA 2OLKA 5HW0A 3E9CA 3IPRA 4PM4A 5FV7A 1W0JD 1ZGHA 4Z54A 3PNQA 3ZVLA 2C8JA 4CDMA 1VPWA 3OLVA 2VSQA 5ALRA 3C5WP 5EZYF 3LLUA 3JQFC 2IYXA 1RJEA 3HRIA 2JHPA 4LC9A 1NX6A 2IY9A 3G8DA 3R24A 1I14A 2VPXA 2XE8A 3KQOA 4Q6WA 3STHA 2CLSA 1L5MA 1PIWA 3CEJA 2B20A 4GBMA 3OE7D 5IBRA 1H8ED 1UQUA 2ACVA 3GT4A 1FF9A 1WQ1R 1X7WB 3CNQS 3PHCA 1H4QA 2OHJA 3OFND 1VE1A 1YGYA 1J1ZA 1NLMA 3W7VA 4TRNA 5BWMA 3TRHA 1Z62A 4JJIA 3M9XA 1K7SN 4FKMA 2JB9A 3BJRA 4R5HA 1L4YA 4ZFNA 3ANSA 1AXGA 1DJQA 4U6QA 1Z63A 2I6GA 4PPFA 4QUGA 1A71A 3QKTA 1R0XA 1XQWA 3T0GA 4AMZA 3AVYA 4F4JA 3AESA 1IBRA 1F1BA 1MIOB 2G5TA 1LVUA 4MQ5A 3TL6A 4JBLA 2PMBA 3MTBA 3OZIA 1PWHA 4WT7A 4QE3A 4RJLA 4G3XA 3LE8A 4H4DA 1JLLB 2ERXA 2H1FA 2HSWA 1GARA 3W6ZA 5IM5A 4MQFA 1TTPB 2X4LA 2PRIA 3Q3JB 5TXGA 1MNAA 4KYTA 4Y2UA 4NZMA 4W5WA 5A04A 3L07A 4OBBA 1KI2A 1X87A 4GZMA 2BFPA 4FR5A 4XD7D 4E2YA 1TTHA 3SZGA 4JL5A 4AN4A 1YJBA 5FUWA 1FYDA 4R9SA 5AUNB 4YXFA 1THGA 4NRDA 4MPPA 3UHPA 3WL6A 1O97D 1QBKC 5BUCA 2UKDA 3L8YA 4C1BA 2E21A 4YHHB 4IMIB 1U7DA 2C2HA 5JDIC 4J9UE 3GGCA 4MVWA 4BBPA 1ISRA 2HHAA 3TD6A 2OA0A 3WIBA 3JALA 4P38A 3H4MA 2JLAA 4Q7KA 1W4LA 4TQGA 2NZJA 3AHGA 4ZODA 5IJ9B 3QE9Y 3KEFA 1SXJE 5CRIA 2X14A 4E5DA 4RD2A 4M1TA 2C9CA 1U7OA 3PE4A 4OH1A 5DHQA 4MUYA 5AVVA 5FPYA 4AWAA 1QF7A 3AQ4A 3QKUA 4KQ2A 1FBTA 1SHJA 2IZOA 1VLVA 3EZLA 5KSYA 1KE2A 1C2YA 4AN1A 5CA0F 2BFBB 2CFCA 2OO5C 4J0HA 4CMKA 1V5EA 2EZ8A 1WEKA 5AK0A 1Y5IA 4W5QA 1OXXK 3K35A 2ZI3A 1T1RA 2AE2A 4HDQB 1FRNA 1EX9A 1MBZA 3QOFA 4D6XA 1Q57A 2CL5A 3VH2A 3E0QA 1VIYA 2REQB 5K8UA 3LYAA 5JC1A 4RJIA 2WFLB 1U81A 3RD5A 2GHTA 2JI9A 1N2BA 1Q74A 5KTRA 1T36A 3ND7A 3G7NA 3ZD7A 1P0MA 2ID4A 4HVAA 4RPGA 5HPYB 2LDBA 3Q4GA 4QELA 2IBTA 4BJ5A 4E46A 2HCFA 2VR1A 3O0DA 3RYTC 1NWCA 1BGXT 2Y9PB 3KAQA 4MQBA 1GGVA 1P4RA 2DPLA 2UUOA 5TJHA 1VRWA 3H3XA 3SYRA 3LUGA 3U7QB 3UWSA 3F7NA 3KELA 1T4GA 2X2PA 5G0TA 3O3NB 3N75A 3FJYA 4WLUA 1QQTA 2R8YA 1WDMA 2EJBA 2WPNA 3D2AA 5DLYA 1KVUA 1V9CA 4CQNA 4UTOA 1HTTA 3OESA 1ORTA 3IXQA 3AVWA 2BLLA 2P7HA 3LUKA 1NQOA 4ANFA 2GJ9A 3B9BA 3I58A 1DUSA 1T2FA 2ZCVA 1MB4A 2D2FA 3U0BA 2GJ8A 3S2IA 3KSRA 5C1OA 2BHLA 3EZNA 4PLWA 4GLLA 4M36A 1KFEB 1EZZA 3CM0A 3FR8A 5ALOA 4IYJA 4RZ2A 3RW9A 4BX9A 5FLXA 5CDTA 1T5OA 2CFSA 2PUWA 2FUEA 4JP5A 2ZBDA 1C30B 1PL8A 4L8VA 5HF5A 3TZHA 4YRBA 3LT2A 4WY2A 4B4WA 4PBTA 3AHEA 1JR3E 1IAQA 2O2YA 1YZNA 2OXTA 4DDUA 2O2CA 1ECLA 1SD5A 1WSWA 3WWEA 4YV2A 2HRCA 2OP1A 2D8MA 1MIHA 1KR5A 3OCCA 2CBZA 2J3EA 3JD4A 4GPBA 5EMNA 1B6RA 3FYSA 3KWMA 4ZAVA 5LUAA 3THWB 3OLCX 1VP9A 3K1YA 5JMWA 1KKMA 2FK8A 2CNNA 1KZ1A 1VE6A 1Z4LA 3W2TA 2GN4A 1BWQA 4I9FA 1WPGA 2YV4A 5JASA 3VKVA 2CMDA 4U0JA 1XJWA 3P9PA 1XK6A 5C2JB 3VR2A 1QH0A 2O54A 1IHDA 2X15A 1Z39A 3F71A 1JLKA 4XCVA 1UXHA 5THQA 1ZSYA 1EAYA 2XNKA 3DZDA 1CVRA 4Q48A 4QIHA 4UHFA 1T8RA 4X45A 3RWBA 5DGDA 2CCJA 2R47A 3AV3A 1DKPA 3NIDB 3T5TA 1N36B 5CYFA 3KE9A 4ZVOA 2GCEA 2YKGA 1XCGB 3ZI0A 4HQNA 4LYAA 1JV2B 4DLKA 1HPLA 1WKBA 2COEA 2CXRA 4GKJB 5TQ0B 3DOCA 1DX6A 3Q0IA 1XKXA 1EGAA 3LWNA 2W2TA 2MSLA 4CTOA 3CX6A 2A9OA 2EFCB 4G41A 8ATCA 1XTQA 3NFRA 3NCTA 1NUAA 1E2JA 3DE0X 3GGSA 4NJMA 2QRUA 3ORYA 3NAMA 5B7GA 3FGPA 2RGWA 1GKYA 4WOPA 3R9IA 1JKJA 1UZNA 4Q9HA 1NTRA 3IVXA 3OTHA 4KV7A 4X3PA 4AYTA 3F5MA 3G2OA 3K0CA 1V26A 3HV0A 4XXHA 3DMHA 3JD2A 2HWYA 5EN4A 1NYQA 3N07A 4KL8S 2Z3VA 5DK4A 4REQB 1QFYA 2I1WA 2LCIA 5E1BA 4KHPB 4LGMA 4UCQA 3NM5A 2HTEA 2ISQA 3D3WB 4Y9TA 3RJ5A 2EU8A 4F2DA 5B4VA 5L45A 4FC6A 4ZT4A 3QYAA 2O0MA 2QTNA 1NPDA 2WU3A 4YDHB 5DTEA 5B3AA 1M75A 3E0XA 4R1MA 3HDVA 5KWSA 4EY6A 3EXIB 1AQ6A 1XYGA 4LVUA 2PR7A 3TS1A 1E2NA 4FX2A 5LU8A 5AVTA 4U02A 5I5EA 4UNQA 4OHWA 5DHUA 4CLHA 2NV6A 4PIVA 3WAJA 5KC8A 2AXQA 3QY9A 3PJEA 2COUA 4RCYA 2IXFA 2FUNB 3LV8A 3KZNA 1USGA 5TQVA 3OETA 1BZYA 2PRZA 4BAUA 1P33A 2CLKB 4HNGA 5IBCA 2D1YA 4I50A 2V0GA 2JKVA 3RFTA 2ALJA 1RQRA 1LBIA 3AYZB 1L3BA 2EHJA 1FC0A 3MRTA 4UD6A 1FFYA 4Y6OA 4O4LA 3L0DA 3K2IA 2JI8A 1MH1A 4RPKA 4HWRA 4UMEA 1BU8A 1JQEA 2WMOB 3DL4A 1FFXA 4B34A 3SOZA 1KMCA 3AWDA 3AR9A 4GGOA 1JXQA 4QUHA 5AICA 4AY3A 4JKIA 1B76A 4QNMA 5JANA 4MROA 5FI0B 3CX8A 4Z49A 1FX0B 2WFMA 2MHCA 1JX6A 3ZZMA 2Y99A 4QU9A 3VZQA 1E77A 4ZJPA 3RU3A 3AFGA 4JIGA 1S2MA 3GRKA 1IJBA 1IJFA 1S2NA 1XTRA 4D41A 1IH8A 5K3EA 5I4BA 2F59A 4Z86A 2IQ5A 3H9BA 1NBOA 4Q93A 3D31A 1YA8A 1LV8A 2ODAA 3F3KA 4UMDA 1W44A 4RKEA 1L5HA 4NMLA 1WDWB 4AJEA 1TMKA 2BEJA 2PAAA 2CT8A 2EQAA 3UJ7A 3HKBB 4KTVE 2QD1A 3H5OA 1RQNA 1TU3A 2AV6A 2RBKA 4AN0A 4BUCA 1OWNA 1BRMA 3H9JA 1CU1A 4OB7A 4OHPA 4B76A 5EKUA 3WYEA 4Z3OA 1UKVY 4EKIA 3R3ZA 1QCYA 2RD2A 2X8WA 3IMFA 2H3EA 4K2HA 4NNPA 3VI4B 1P5JA 2C3PA 5J5VA 4YAIA 3GJSA 3AHCA 5C8YB 5KYXB 2VSYA 3LT4A 3MUFA 4R9RA 4WE3A 4B7CA 3ECAA 1DBPA 2CJFA 4YJFB 5E0OA 4KSCA 3ANXA 4OOEA 4YRLA 1AQLA 4RA9B 1YQTA 5LWHA 2JLSA 3TQIA 4V0SA 1JQJC 4P3OA 4S2UA 1D2HA 3V7YA 4QA9A 1IOWA 3AH8A 4AZTA 2BC9A 3L0BA 2W0MA 1UC5B 2B4AA 3FLMA 1NM5A 2PKEA 2VDRB 1GTJ1 3JTEA 1PW7A 3VU0A 4AP5A 3JQFA 3GNLA 4NP6A 5ALYA 4DDKA 1Z4PX 1MW9X 3IQHX 3WR5A 2W2QA 2H0AA 4CKEB 2F3SA 3LP8A 5B55A 3T7TA 5K1ZA 4DV7B 4RTRA 2VHZA 4B6FA 4YAGA 2O2HA 3TAUA 4CUKA 5JG7A 2INGX 2ZWMA 4GQIA 1EG2A 3ON5A 1UM8A 1IXZA 3BTUA 3LUHA 5ALJA 2YFQA 1UH5A 3BJMA 1NZDA 3PBKA 2R8XA 3PL5A 3VR2D 3EUFA 3HV2A 1TQ6A 2HBZA 2C82A 3N6RA 1VE9A 4RABA 4N8SA 4ZU3A 3TH5A 3C5EA 2G25A 2ONJA 2VHQA 1LWNA 4IQ8A 2XAAA 4KKXB 1WZCA 4WA7A 3T8YA 4Z0PA 2ECKA 5F7XA 4BLVA 1NJGA 1RHMA 2B8JA 2WHQA 3I9OA 1GA1A 3P2MA 1YQEA 1T0UA 2I67A 4I3FA 3OT4A 4K9MA 1XQ1A 2QTRA 4PYKA 2RGAA 3ZE8A 1G6Q1 3EEBA 4HP8A 3LLCA 1HX7A 1PI3A 3DVAA 3IQZA 2AUTA 1V8BA 1WXHA 4K46A 3W5UA 1DMSA 4C01A 4BTVA 1KMIY 1VJTA 3OZCA 3SM9A 3I2KA 3PYXA 2OV4A 2VTDA 3IBSA 4MOWA 3T12A 2IS1A 4KVAA 4AY6A 4EPWA 1PFWA 1SWVA 1RACA 3MCVA 4LJSA 3LUDA 4JUAA 2PAFA 4MGYR 4D8VA 3QIAA 1EUDB 2FSFA 1TM7E 4CM5A 1RLTA 4KWTA 2LRHA 3V4VB 4ZA2A 5LQAA 1JG7A 5HQTA 1XZMA 4BFLA 4EMBA 4Y2VA 3CGWA 5DK6A 2X13A 3MWLA 4FK8A 2JGRA 4PZDA 3ZZTA 2ZWOA 1WUJS 2DJIA 1EK5A 3HFGA 3O1HB 3EGCA 3OKPA 4HRAA 2ZB3A 3FTFA 1UANA 5JDIA 3RYIB 1VLMA 5L7TA 4QKQA 4XRRA 3R76A 3K53A 4N8DA 5HRUA 3RT7A 1NRIA 3EC2A 4EG7A 1CQJA 4OLBA 3DF7A 3H6HA 3CZPA 4KXVA 3FB4A 1UUFA 1WP9A 3KDSE 3AI7A 2WKSA 2C0QA 5CLHA 4AZ3B 2IU0A 3V3TA 4V1CI 3VOBA 3ZE1B 2VLIA 4QBKA 1A7KA 1V11B 4ZEVA 1RHJA 3GC6A 3IUBA 1FUEA 2PFGA 3IPCA 3BJZA 2DC1A 2XRMA 1ORRA 1GR0A 3IOYA 1BJTA 4K0RA 4W8GA 1FFWA 2OO5A 4XH9B 4D81A 4E5KA 4TLLB 1F2DA 1OLSA 3TSYA 3OG9A 2R65A 3C97A 3DMYA 3B70A 5FADA 3INRA 2YHUA 2OG1A 3T9BA 1LPBB 1VKHA 3DT9A 2WUGA 1I2CA 4V0QA 4XJTA 2GM3A 1SIWA 4IV0A 4K1LA 3HUDA 4FFPA 3DONA 4IILA 4B5LA 3SZLA 5AI9A 4N47A 2IXTA 2QSUA 2PX0A 4NV1A 3WLTA 3ICEA 5AW0A 2NP7A 2Q5FA 5BR8B 1EI9A 1YDEA 3CWZA 2A5DA 4GNKA 4Y0NA 1NNSA 3CS3A 4DR1B 5AD1A 3UV7A 5FLYA 1R4MB 3I2JA 4Q9KA 3TX6A 3VPCA 2W42A 1AV7A 3GD5A 4LV8B 3DZJA 2XD9A 3PUIA 3AFOA 2BI8A 3LSYA 5C34B 3Q9SA 3WE7A 3ZHVA 4DV2B 1KEVA 4KDCA 2P65A 3QVMA 3HDTA 4HTFA 3HZOA 1G7TA 2YWFA 2ODBA 5EG5A 5F2EA 3RVKA 3N76A 2A9PA 5I9NA 1PO7A 3EMVA 3FYUC 1HG1A 5IM4F 5MF6A 4KDRA 2VQFB 2W2VA 3BRWA 3LPAA 1RYBA 4BBZA 1E0AA 4AYXA 3NYIA 1RADA 2O0HA 4Q3OA 1TEVA 3C3JA 4F8EA 1P2BA 3DO6A 2YZ7A 1CHNA 4L8LA 2A5JA 4MVJM 1ATIA 1BKDR 4E7PA 2A3NA 3N2KB 3RKUA 3CUYA 1XLWA 5BSFA 2CV1A 5EXTA 1IRXA 1LBTA 3DOJA 1BX3A 4JD5A 3R7WA 3PEEA 1GYQA 4G1FA 3WYBA 3DLPX 5A6SB 3JD0A 3MJSA 4N6NA 3U40A 4BC1A 3VYRB 4Y7CA 3USCS 2Q3FA 1AOXA 3C14C 3EY9A 5K0ZA 1CUXA 1N2OA 4BQQA 1PDWA 5IMBA 4NBSA 4QVIA 1NYTA 4UD2A 3HL4A 5UKDA 4ESHA 2PBZA 2RGDA 2BLNA 1Q95A 4JC8A 1EUZA 4BV8A 3QU4A 4JI6B 4FN4A 2CC2A 4BIIA 3AIIA 3EEQA 1VCNA 1EX1A 3SF8B 2C4NA 1HGXA 1WL8A 2VOEA 3B60A 1A98A 4XDGA 2PGLA 3QX8A 1OI3A 4Q0MA 3IVGA 2HI0A 3HABA 4RWEA 1KMHA 1FDRA 3CKMA 5EWLB 4CV3A 1FCJA 2XGGA 2X8AA 3G7UA 4LPKA 4AS3A 5LJLA 3CH6A 1F4PA 2I62A 1VLHA 5EJ2A 4G4SP 4US0R 4DUGA 4D92A 1QIHA 5LOVA 4OIFA 5E2AA 2NUAB 1XD8A 2PMDA 3FY4A 4JVMA 3OPNA 3ECCA 4GYYA 2DFTA 1M1ZA 2A3RA 3WMXA 3I6IA 1M10A 2WYIA 2BVNA 2PSDA 3JVDA 5TLSA 1Z2OX 2E4VA 1I3OA 3TNFA 4XARA 1RPJA 5KAPA 5TSDA 3LBHA 5JT1A 2NU8B 2EP5A 1RQPA 1RP7A 1SXJC 1KEKA 1M2EA 1O9HA 2NIPA 4B4KA 5ADVA 1NN0A 1SXGA 2AF4C 3ONWA 4HGRA 1DJPA 1ZKDA 3OQOA 3LUAA 2GN9A 2V7TA 3CXUA 3HQ4O 5B37A 2COKA 4O5OA 2RHOA 2VAMA 5SY6A 3WFZA 1AF7A 1ZJ6A 2Q9AA 3LUBA 5AXCA 2Y1WA 1YQGA 2YYSA 4GWGA 3T1QA 2E0IA 4ZOBA 2R8ZA 4DLSA 4DS3A 5IG2A 4O4HA 1P80A 3GHYA 3T9AA 4EHBA 3DV9A 4I3GA 2JIQA 1P72A 1DKRA 1KI7A 1N75A 2JATA 2Q41A 2JAOA 2X0RA 2ZRNA 3G6WA 3NH9A 4IM7A 1Z75A 5DP2A 1ORVA 3IV6A 4HAVA 2ZRDA 4X60A 2QTBA 2VA9A 3ED1A 3AFIA 1QV9A 4QM7A 3O4JA 4QODA 2J07A 1QZTA 3RM3A 3L18A 5EWMB 4GX2A 1M1NA 1WV0A 2V8BA 1VIDA 1F38A 4LZPA 4MS4A 3UJBA 1CJBA 1VMKA 4S1TA 3GROA 3EXEB 3TQFA 1J2RA 3LK7A 2H29A 3GFBA 4EPXA 2HRQA 1UJBA 5ITZA 1SQ5A 4QU0A 3OWXA 3JQAA 1OV4A 3P0FA 1ZH8A 2IHNA 2BGNA 2JCGA 3MCAA 2WVAA 1GQFA 1VCHA 5JY6A 4PYRA 2BUBA 1WVIA 2WR8A 1XZJA 1K7FB 3C3DA 2V0NA 3N3AC 2NTVA 3O21A 3ZWAA 5KX5A 1LK7A 2FPRA 2WT8A 3I42A 1GPWB 3GP5A 1C7FA 1JEYB 1QC5B 1MVLA 3DC2A 5H4GA 1X42A 2XYHA 1W6UA 3NHYA 5FQNA 3NPMA 4A91A 3E18A 1FS6A 3WLAA 3VU3A 3ETNA 5CA0B 5JSZA 3ZV4A 4D9MA 1OIWA 4MLCA 2KWIA 3WHKA 1XTJA 1PT8A 3E7FA 3DOFA 4M1MA 4GP9A 4QEZA 4ALIA 2CN1A 1Z16A 1AHHA 1MOQA 2OXFA 2W2KB 2X2EA 2ZUUA 3D3JA 3FMVA 4J1QA 1RBQA 4LRYA 4EDFA 4ZREA 2XX3A 3C8MA 1GNPA 2X0DA 1U28C 3EZFA 1C80A 3KLPX 3M0EA 3TNJA 1SMKA 5HUJA 2CDCA 4HGYA 3UW1A 4PZ0A 5JLJA 1LU9A 1Z36A 5IC5A 4M8LA 4ACAA 2FQQA 4Z4GA 4OGWA 5L9AA 1AN0A 3LF1A 2GEBA 3BRWD 1GILA 4JH0A 5LLSA 4AUMA 3BFJA 5H9VA 1KFKB 3D7RA 2C04A 1ZIYA 2HHJA 2PH1A 2PT7A 3DZFA 4Q39A 5TMDA 2NUTB 4K03A 1T5LA 2FCAA 5AKYA 1T25A 5LQMA 1DKUA 1VJRA 3UMYA 3RS3A 3PQ8A 4YV7A 2O4UX 3HDGA 4GMDA 3FYDA 4FFVA 3VYUB 5C52B 3BSFA 3DPSA 1KVSA 4D9JA 1N6NA 4BX3A 4IWXA 1T9CA 4D02A 5FBLB 3K9FC 2J7KA 4J91A 3MAGA 4MGIR 1GZ4A 4OB6A 4P5EA 1QDLB 2O07A 2Y2VA 3LY9A 1KZYC 5CDUA 3DOUA 5ALXA 3N1UA 2PVSA 1YZUA 5BR1A 2XE6A 4YAKA 2CJPA 1E5XA 1W59A 5CA1A 2X7HA 3MS4A 4Y6PA 5CNKA 4HH1A 3RTCA 7YASA 1YC5A 2VJNA 2AI3A 1AUVA 1QK3A 4AJ2A 4E30A 1Y63A 2NVOA 2V7GA 2QN3A 1M7BA 4IKEA 3VHLB 4O25A 3SIXA 5FWXB 3FPBA 3KO8A 4AJHA 3WADA 5JXIA 3C85A 2CB0A 4PZUA 1ESZA 2JNWA 4XE5A 3X2FA 3U4HA 1MO3A 1KS2A 1Q7CA 2OBFA 3GRFA 4TLMB 1LDEA 1F06A 1NVTA 4OXIA 4R0VA 2UV8A 3WK9A 4WJLA 4BGIA 5IKMA 4ZQCB 5BUQA 5AJUA 1Q1GA 4EW2A 4ED9A 3JAMA 1MKYA 1N3YA 4A0FA 5HRAA 5FT9A 1XMOB 1GWNA 2V3CC 3EIXA 2I80A 2V8OA 4WACA 2IZ6A 2ICAA 4IDNA 5C9ZA 1B2LA 3HVJA 2YS7A 3UJHA 2F3PA 3VR1A 4QDOA 2NXNA 4LY3A 3AP3A 3I76A 3MQ2A 4D9IA 4JENA 2VK1A 4YI5A 4OLAA 2MYPA 1PZFA 4JZKA 4YJ3B 2NYRA 3KVNA 3QXGA 3SS9X 2XGJA 1V3QE 3HBNA 4LX0A 4EBBA 3ZE9A 4K7JA 5LZ7A 1URPA 1ODFA 1Z4OA 2VDMB 3Q2IA 4EIWA 4MRMB 5C1DA 1F51E 4EHLA 3NWPA 1PR2A 2W2MA 3U39A 4TRMA 1UQTA 1XCJA 4IH4A 1Y1KE 2JAUA 4FNOA 2ZCUA 1U9JA 1M1YA 1KEEB 1ZMTA 5EZSA 5CYOA 1NBHA 3STTA 2XKJE 1L7RA 3UJDA 1XRSB 1ULZA 3AVXA 3MMSA 3BL6A 2VDLB 4W82A 5IYZF 3EA4A 1GAXA 2HT6A 1O96A 4IQFA 4Q7JB 4ZDWA 1Z5GA 4Y2QA 2NPOA 3SZMA 2ENUA 1BHO1 3ET5A 3LHIA 4Y2SA 3VKGA 4RZIA 2ZJZA 1QWSA 1QGUA 1UWVA 5E4YA 2PVPA 3B2NA 5AVOA 2P9HA 3S68A 3U1BA 5MHTA 5BMOA 1N8NA 4GWLA 4PNZA 1QB7A 4EI9A 2GPYA 2YIVX 2RGXA 1ENYA 2CSXA 2IHJA 4DEXA 1ZMRA 3ZQUA 3BFXA 1B2RA 5A4DA 4GC5A 1XCBA 2F00A 2Q9BA 3ZTYA 1OI4A 4OKIA 2UXCB 3EDYA 4BEWA 4XVQA 3CUWA 1LLUA 1R0KA 5JE8A 1NW4A 1WOMA 3UAGA 2CZGA 1ZW6A 2FSVC 3IVMA 1E2LA 3GIWA 4MUIA 1ZWKA 4CM3A 2AS0A 3MMPA 1HLGA 1UK8A 1GU0A 2GN1A 3IQGX 3JQAD 3USZA 2DB3A 3IKLA 4L51A 1Y8RA 1QHHB 4FEEA 1QV7A 4H7JA 1XXHB 2DQZA 2GWRA 2IW1A 2WUEA 1E9AA 3EISA 3GOQA 3OUZA 4JI1B 2VPQA 2ACKA 4IIBA 4W9MC 1UODA 3QPWA 4LDNA 4OAPA 4M55A 3WBBA 5AQ1A 1QNLA 1TA0A 3PXAA 4V02A 4HKTA 1T6ZA 4MMYB 1IZ0A 3QUCA 1T4DA 1Q0PA 2NO7A 2OO3A 3OEHA 4YMGA 1N9GB 2EW1A 3H0EA 3RUHA 2WJJA 4GD3Q 3TR6A 4AJPA 3L2OB 5EJAA 5BN4A 3EOBI 3LVRE 5LU9A 1P19A 1T26A 2ZUCA 5AW6A 4NU8X 5FHRA 4ERXA 1FRVA 4DXHA 1Q19A 1ONNA 1BAPA 2PUDA 4I55A 1JLHA 3OZAA 1R5OA 4IIEA 1FNDA 3UKJA 1PJ4A 5E8JA 3FMPB 3FYUA 1MX1A 5DIFA 1PE0A 3GFGA 3HEAA 1XZGA 4K1XA 4LRSB 4MUAA 5EWJA 5A9TA 4Q4AB 4ZV4A 4R16A 2JFBA 3BMXA 3GFVA 2CLFB 4BB5A 4YQFA 5J1SB 1WBBA 5D86A 3LRTA 1UXGA 3SFVA 3INYA 4FHCA 1P0CA 5T3YA 2D6FA 3OZXA 1I4DD 3C3XA 4RF3A 1SUDA 2BSAA 2EX0A 2IELA 2RC6A 3T3DA 3ZLJA 3E5RA 1V7PC 1NW8A 2AX3A 3RHTA 1EUYA 4NBKA 1O2DA 3TVTA 3JQ7A 2HIGA 5AMXA 5IX8A 3LNTA 3WJAA 1YK1A 1HEYA 2JBWA 4BX8A 2J9RA 4E07A 1NJSA 4QUAA 2I6XA 5DKFA 4YUAA 2AFRA 3K16A 5G0VA 4EG4A 3CR3C 2CMKA 5DFAA 3SQLA 3L7LA 4FONA 1Y9EA 3GJZA 4HF7A 4KW7A 2BTQB 2P5UA 2XYPA 3Q87B 1K0FA 3H18A 3DMNA 5CT5A 3HCPA 3GOHA 7GPBA 1DKMA 3D3QA 1YBFA 3E3LA 5IXYA 3E9DA 4Z8XA 5GWXA 1RSZA 4C04A 4ZCPA 3AJAA 4TXNA 3C7KA 3WWYA 3D9QX 3V8EA 5B53A 5TF0A 2DFKB 2OUIA 3DTNA 1C8VB 4G2NA 3AR8A 1RKUA 1O6FA 3NR2A 1DTWA 4IHAA 1W1WA 3SEAA 2VS1A 5AVJA 3BFPA 5J23A 4FT4A 4KN8A 3ZCQA 5JCZA 4J1NA 1T9KA 2XITA 3CF0A 4LJ6A 1QV6A 5DO9A 6ABPA 1DRUA 1K8QA 5EA2A 3I83A 4YMWA 3LVBA 4RCVA 4ND8B 3LGAA 4PC3A 4Q3BA 5KYKA 1MQSA 1OTYA 2EZ4A 1Z7YA 4LIPD 3S2GA 1AGPA 2IYPA 1KYWA 5G4KA 5JNSA 4KTTE 1Z7BA 3NVAA 4FUQA 2LXNA 4ND6A 2BBOA 2GYUA 4AXXA 3A4LA 4G0UA 3MK31 1RXCA 4RH3A 2FE4A 3UEOA 1GLVA 4C4YA 2Z1MA 3A3YA 3CLKA 1GTSA 5BWLA 4B3TB 1GJRA 1W5FA 3UUWA 1FSPA 2HXGA 4HJRA 1OV6A 4PIPA 1W75A 2GN2A 1Z0KA 1UZUA 3BRQA 2HO5A 2NZXA 2R6R1 3D8TA 3HCCA 1CUJA 2AFHE 3KUDA 1OTXA 3LYHA 1LSOA 4KI0A 4KZKA 4RTOA 1U3DA 2BZ0A 3BILA 3K6JA 3L4KA 5EFOA 4OK6A 1YTUA 4A8TA 2R7NA 2D1FA 1V2HE 2NXEA 2BGUA 2R96A 4JVSB 1DQNA 2P79A 2G72A 3DBLB 3SJAA 1KXJA 1NJFA 1X1CA 4MUEA 1C3VA 3DS8A 4O08A 5LWQA 2IH2A 1QIJA 5HIKA 1ZNYA 3PDWA 2I1QA 3FHOA 1M6VB 5IDYA 4OSEA 3PC3A 4ZIRA 4PLYA 3K1AB 3CVXA 2OSBA 1E20A 3HB4X 2JIRA 4FFBA 4NSNA 2OCIA 1T5HX 1EJ6A 2FX2A 2Z5VA 3H11A 1LWOA 1DP4A 3KPUA 2QENA 4JP2A 1ZUD1 4MKIA 3HO8A 3V9PA 1ARZA 1AZSC 4HLQB 1V41E 5TT1A 3TWOA 5L8VA 3AEYA 2Y1LA 1TFRA 4C7MA 1W581 1KRHA 3KJQA 1T4BA 5LQKA 4KYVA 1P17A 1NW9B 1SC6A 1YULA 1MA3A 2G0AA 3ONNA 5KOHA 4L72A 1UWKA 1I5OA 2RBGA 4L8WB 2J3KA 4BBJA 5DX1A 3O8OA 4MICA 4RXMA 5REQA 1TCAA 4LZAA 1SK8A 3CNNA 5JZBA 3T5CA 1WE2A 4YP1A 3WGGA 4G1BA 1JHZA 3FCCA 1XZIA 1TAHA 3ZH9B 3INTA 1MFZA 3D6FA 4U6NA 4RZHA 1HRDA 1R8QA 2WW8A 1XXHE 3RVRA 1E4YA 3FPGA 4NH0A 1RU3A 3X44A 1V3VA 4QQKA 3OEHD 2VPPA 4LXGA 4ECEA 3GRUA 1RNLA 3GN1A 2PNJA 5TRTA 2PL1A 4P84A 4Y18A 3TOVA 2BY4A 5CXUA 2G76A 2H18A 3P2JA 1H2YA 1JR3A 2GEKA 4XFJA 1RXVA 3EE6A 1RW4A 5E3IA 1M0SA 2R4TA 3GV0A 4DA7A 1UF9A 1U28A 1KVRA 2GMWA 4I6JA 4KQCA 1IZ9A 2BP7A 5AI4A 3OCZA 3TE6A 5JXWA 3D8NA 1TW3A 1OIXA 4RU1A 5KTMA 3R5TA 4BO6A 4E03A 1NQVA 4UOZA 1BHJA 4JJAA 3KHSA 1L4BA 4FHGA 5CMLA 1X1RA 3RS9A 4UZEA 3AOEC 2V98A 2I2AA 3H5WA 3OTWA 2LZ0A 4NE7A 4ZGBA 3D6VA 4R2IA 5JU6A 1EMDA 4M0EA 5HIJA 2FMKA 4GKVA 2PJRA 1Z2DA 1P9NA 3BIOA 4RANA 1B8PA 4MVCA 5FA8A 5BWOA 3S2ZA 3R0IA 3BZBA 4QOGA 4K81B 1I13A 3E2MA 5AOVA 3C6YA 3DKPA 3FIJA 4RH1A 2OORC 3GNTA 1PTJC 4WLFA 3T7EA 4DIBA 5KJ1A 5DYWA 3EYAA 3ZGNA 1XELA 1YR8A 2CLCX 3GA0A 2OXRA 3NUGA 4WZAE 1ZCJA 4Q3NA 2GAJA 5G2OA 4LGYA 1E1QD 3W04A 1L1EA 2CHVA 4H16A 4RD3A 4NFSA 1PLLA 3W4JA 1KQGA 4BRWA 1EWQA 3D6HA 4FCWA 5MN5A 1O94C 3KLNA 4AUEA 4LC1A 4LXYA 1G21B 2QXUA 2REOA 4GPEA 4JBYA 3STVA 1OB2A 2XVZA 1QG0A 3DAFA 3M6LA 3QF7A 3G2NA 1GAJA 1MT3A 1OIVA 3GUYA 3S0JA 3EGDA 1XP5A 2GTPA 5A03A 2B36A 4JXXA 1QHSA 1VJGA 4L8GA 3UBMA 4C5CA 3N7TA 2QRZA 5HA5A 2XNJA 3L6DA 4FIZA 2O2GA 4FS8A 2AZ4A 2HPHA 4U7PB 2ZJ0A 3VC2A 1QYDA 1I1NA 1QOQB 2R5WA 1DFHA 1B6SA 4OA5A 4LOJA 4X95A 1IBLB 1NJ8A 2PGIA 2R5NA 3W4KA 3W0LB 2ZT7A 2HYIC 1ODLA 3DL2A 3HM9A 3V8MA 1R18A 4YDRA 1MUUA 3TPCA 3S8YA 4RJ2A 3Q40A 4XFDA 5HM6A 2GRJA 3AILA 2QG4A 2XUQA 1IBMB 4XM0A 4FM9A 2J3MA 1GSOA 1TAQA 4NYJR 3SHWA 2ZREA 4OQMA 1Y81A 2TYSB 4ZP1A 4IO1A 1ZA2A 4AKEA 4KR3A 1SBHA 3CZRA 1RXWA 5ALWA 2JFPA 3OM9A 3K2QA 1R4NA 1E99A 1V37A 2QK4A 4HZGA 4N1AA 1ODCA 3L6UA 3ZI4A 1KSHA 3OO0A 4ALNA 1UOEA 4NHEA 5DLEA 5DWVA 5A9SA 1U63A 1N6PA 2PBRA 2VQ3A 4MQUA 3WYNA 4BO5A 4E33A 2H52A 4GFDA 5GVRA 1JG2A 3A6ZA 4O8CA 4XYLA 4MTCA 3R75A 1Y9AA 4LYYA 2GK7A 2QGZA 4ITVA 3SEFA 1F48A 4N6OA 4NPAA 3J80A 3LBYA 2RE8A 3U3JA 1MAAA 1T2CA 2PZBA 3MWJA 3PHLA 5ETJA 5AWFC 2GH1A 2J08A 5CG1A 1ZP6A 2D5CA 3QVTA 1QTNA 2FFQA 3FPFA 3JW8A 3FUVA 4QYWA 4RL4A 2IOQA 1PKXA 4PNEA 3P4XA 1RAFA 2FSVA 4C05A 3RG8A 1EWVA 2JA2A 1EWYA 5LLTA 2FZ4A 2HV9A 3H86A 1YSCA 3ONFA 4PO9A 4HMQA 4CDRA 1ZCAA 5EE5B 2X0FA 2VUUA 1UOOA 4NBRA 1WPXA 5M5BA 2AMJA 2RCYA 2W48A 1YKSA 2HWUA 4G5SA 4P2GA 2Z6AA 1UBSB 2YDXA 3L0YA 1M54A 2PKXA 1TO6A 3I37X 1LJLA 3IAS1 4N5HX 4JEHA 3VR5A 4G0XA 1HEIA 5AK6A 4FI3C 2VXBA 4NC9A 1U3UA 3NB0A 4K9SA 1I80A 3N58A 3MA0A 1CUFA 2AOXA 1LRLA 3PCTA 3A6LA 1SXQA 4GBJA 4A2QA 3JPWA 4IJ6A 1QVZA 1UPTA 1LI5A 5C5IA 4M1KA 3VU9B 5AKHA 1RAIA 4LZZA 5J5CA 3QVKA 3KT6A 1L1QA 4TTIA 4A26A 4H6XA 4NJEA 1I1OA 1TI7A 2FEMA 5E7MA 3PU6A 4TT3A 2OBBA 5LIPA 1NG1A 3IL2A 1KAMA 3EVNA 4KIJA 3E53A 1JJ7A 1J4AA 2PSJA 3PGXA 1PWEA 3K0AA 4BAGA 4IV8A 3NTQA 4YRAA 3HA5A 5BW4A 4Q4JB 3NNNA 4MS1A 4Z2YA 4AO7A 2GD0A 2PX8A 3CBGA 3MS2A 4JUDX 4Q3CA 2OVFA 3IFSA 1DWUA 4W5JA 5EGSA 4AAYA 5K8IA 2YWBA 3O9VA 4KGVA 3RYHA 3RIXA 1NXPA 3LC7O 2I7TA 5C5DA 1ENOA 1P2UA 1HL7A 2R9VA 1P9WA 5FD8A 2X3UA 4FJ2A 3ZCTA 3ZEAA 2YS6A 4HTAA 4K6KA 1AXEA 2XMBA 4I9HA 4TUYA 5TEVA 2VCEA 1HI9A 4YR9A 4BNWA 3GPIA 4YV0A 5L3SA 3BJEA 3R0QA 4FMCB 5IDVA 3IKVA 1HT3A 1V7CA 4I1IA 2HDNB 3KAJA 4CEIA 4MWSA 1NVBA 3DD1A 4OLJA 4CGYA 4PSKA 2ZYAA 3FWNA 3P9QA 3GH3A 4QPPA 1LBQA 4FBLA 2GI4A 4LTNA 5KYVA 4CODB 4CT4B 3NATA 1AMNA 2TRSB 4LC0A 2WF6A 1DTSA 1KBZA 3PKJA 2I8AA 3C8DA 1R74A 4PQGA 4UXJA 1I6WA 2JGDB 2Z2JA 4H0CA 3YASA 3AUYA 4CL3A 1T3SA 2OPBA 1T6BY 2ZSEA 3VYSB 1PEDA 3VU1A 4Q9JA 2XXBA 3WAGA 3TSAA 3MERA 4XM1A 1O1YA 5IDWA 1HFWA 3X1MA 1LSJA 1N5KA 3D02A 1WEHA 1OT3A 3NYRA 4DEYA 1DXHA 1HSOA 1NP6A 2IIPA 3NC0C 4HATA 4ZC1A 2Y77A 5LYJF 4ZTZB 2I0FA 2WNIA 1ZVKA 1G4UR 1VGQA 4MJXA 3WDMA 3RRZA 2ZKIA 4YAFA 1BMFA 3C48A 2A9VA 4DLAA 1IC6A 3M1IA 1X7GA 4G1EB 3FRIA 1YFKA 4BZWA 4B3MB 4LOKA 1U6KA 2OBMA 1E2MA 3ONEA 3VUEA 1I7PA 1DXOA 3N8HA 3PIIA 4G25A 4W9RA 3IOBA 1G7CA 2PH5A 1Z15A 1ZOPA 2A14A 3BDIA 4MRVA 3UT5A 1E2IA 2C2XA 1V1MA 4QFDA 1WM1A 1NTOA 2AN9A 1D03A 4LHWA 3KB2A 1E7SA 1OYVA 2Z09A 3CFYA 2ZPUA 3OJFA 1EQ2A 4NDNE 5GGYA 4QWMA 4E31A 5GTDA 3ZDZB 5JCOC 2OBXA 2WP8J 3KVRA 3K1JA 3WIDA 4ECAA 5BSKA 4GM1A 3R6LA 3LG2A 1M8GA 3EG5A 4H6VA 3WB2A 2IDKA 4F4HA 2ODPA 4H4EA 1GFIA 1XALA 2F64A 1N7IA 1RMTA 1YS7A 2Q9CA 4FFLA 3H83A 4ZQEA 4A8HA 2VTBA 2GDZA 1JDUA 3ZS9A 1E7YA 3EODA 2XHZA 2FEAA 3UV6A 2ZRLA 3HO6A 4Q3KA 4JUBA 4FFDA 5EHNA 1F8XA 2VP9A 4MB6A 1L4KA 1GGMA 2FZ5A 2IZ5A 2OKCA 2F43B 2I87A 3IDAA 5ENVA 1KDVA 3SN6A 3OM8A 4BMDA 5HMLA 5L4SA 1RRCA 2WUWE 4PAQA 4A6XA 3MYYA 4H17A 1DIHA 1WDLA 5A5EA 5LZ2A 1BEUB 2ZJ2A 3RBXA 4EP1A 1Z38A 4BXOA 1IXKA 5E6SA 3MWGA 2YV1A 2DMRA 3KKMA 1I2DA 3T9CA 1TCBA 2VQ6A 3P9KA 3OTOB 1UBEA 5EIAA 5IYZB 4PPNA 1BO6A 2GJ4A 2E82A 2PU7A 3F6BX 1Q7RA 3JQBC 3DV0A 3CN9A 1NASA 4IMRA 4YP9A 3DCJA 4M49A 1CJUC 1XG5A 4PO1A 4CLOB 3ABOB 2PRSA 4PCUA 1E66A 5I8ZA 1ZZEA 3A26A 4FR0A 2DEUA 4RUKA 4LWZA 3MAJA 4MVJD 5U9CA 3VR5D 3SG0A 1W49A 1YS4A 2X5JO 1WY7A 1BN6A 4QJ3A 2V96A 4L8FA 2BE9A 2WAXA 3RS8A 4ZHQA 4MQEB 3LT1A 721PA 4IIYA 3U6KA 3O31A 2ZIXA 2X0NA 3OCXA 5BVHB 4AJOA 1BG6A 1IVYA 1WOYA 3I9MA 1TK9A 2CVQA 2PKWA 2YWEA 3KXDA 3L8HA 4R84A 5B36A 1QQBA 3QVVA 1YTLA 1LPAB 2MIIA 4XWAA 4RLHA 2ZSKA 1EP3B 4Z4HA 4II3A 3FNGA 5MFPA 4BN0A 4AMYA 2H1HA 5JI2E 3FFXA 1EQUA 3L9XA 3ICCA 3ZXSA 2OGWA 1BVUA 4RA6A 4UQPA 3RLFA 3F7TA 4FQ7A 3T94A 3T95A 4Z4CA 3S8EA 4B6GA 3O9ZA 5D51S 5G3ZA 1MX3A 1EFVA 1TGYA 2EP7A 3NBQA 4FLFA 1YHYA 4WA8A 3L7NA 3AOEA 4LCBA 3KWFA 3AF6A 4I81A 5LSAA 1EWKA 4ZCQA 4F3YA 1UXKA 4IJQA 4WLOA 3EQ8A 4HH4A 1SZCA 4Y2HA 3U3KA 2WJIA 2BW0A 3ET4A 1Q7GA 2FX5A 4GZLA 4JNCA 3Q7QA 4ADSG 4DXDA 4F5DA 3FLBA 4DMUB 4LS3A 3DBIA 2AD5A 3WTBA 2KBFA 4EOGA 2QUKA 5D84A 4MV6A 4PHGA 2BMDA 4E0BA 4X97A 5F73A 1MHPA 2Y9MB 3IQEA 2OORA 1XD2A 3OZSA 4EKGA 1GFWA 1PTJA 2G82A 2ZS9A 3MSXA 2OGTA 2W6IA 4OFWA 4B87A 5BW8A 3DYVA 4WBSA 2A57A 3NWBA 3VGPA 4B46A 4OYRA 5ITVA 1Z0AA 3AWIA 3BPSA 3KJZA 3OU2A 4WEOA 3T1NA 1W2HA 5CB4B 3AM1A 2YC2C 4QUKA 1O94A 4MDEA 4DLZA 1XD9A 1QZZA 2CXXA 2HEIA 3OECA 5DN6A 1C0EA 1F6WA 5HQ3A 2XF2A 1ZI8A 3GFQA 2CD9A 1GNSA 3NTXA 5EUCA 1UAGA 3QUSA 4M8NE 3U31A 4AMGA 2O5EA 3N87A 1Z25A 2HU2A 1RJ9A 3ABRB 3PR3A 3X1ZA 2QLTA 4KOAA 3T7IA 1DEAA 5EPEA 1KWGA 1GYPA 1H66A 3ZHRA 1GA4A 2LWIA 4CKCB 1P9RA 4FLEA 3V1MA 1GL9B 2JIOA 3UWOA 1A8QA 2RK3A 3IAXA 2GZRA 4MS3A 1FSFA 2AN3A 3IUQA 3O5AA 2H0QA 3ANNA 3M83A 3PUYA 1BMFD 1ONPA 1X15A 3RS5A 3JZDA 1ADFA 3RPEA 4YRJA 3ILHA 4M38A 5CIWA 3F9RA 3MUNA 5F98A 1T8SA 3HDJA 1NBAA 5ICGA 4HFJA 3ZW9A 3B8EA 2XUKA 4MQLA 1Y82A 1DEKA 1MJHA 3IYLW 4X1YA 3R7FA 1XPJA 1VLLA 4EQ6A 3DKRA 1VLQA 4FDTA 1CETA 5G1OA 3RSLA 2OQIA 1EXMA 5DBHX 1NUTA 2B4RO 4CF6A 1M2HA 4EGCB 3RYFA 2GSDA 4JOQA 3ACBA 5J47A 3OZFA 3D4IA 2A84A 4L6IA 3PQDA 1T3HA 5JMTA 1EINA 4I19A 4AJ9A 1VSUA 4TL8A 2M6LA 3NWOA 1ZN7A 4EECA 2CYCA 4Z9BA 4BLPA 4KXYA 5K8VA 3QG1A 3TGWA 3ZK9A 5G4LA 2DUUA 4OEHA 1OLOA 5CFLA 1UP7A 4GOJA 3BMOA 1FMLA 4C88A 4Q37A 2QZ4A 1E2UA 2F17A 2WWWA 3NCHA 2RGNC 1KSGA 2C7RA 3EZXA 5TVKA 2XQIA 4EG1A 2I22A 3G1TA 3JAWB 1C4WA 1TUEA 2C4WA 2MSNA 4LDPA 1PW5A 2C4MA 3HDHA 4PQYA 3SS8A 2PT5A 1Q7EA 2IKSA 2VK4A 3PC7A 3R5XA 5BN3B 5KTTA 1FDUA 1RC1A 1L5FA 1RZVA 2D06A 5TVGA 2B2NA 3IRVA 4CL2A 5D85A 1ZK1A 3LH5A 4ASUD 2X86A 2IPLA 2XLBA 1TPYA 3PXUA 4CTNA 4LY9A 4L7QA 2CBGA 5LP6F 2CJYA 4XFKA 2IT1A 4GW3A 1G8AA 1BDMA 4IFBA 5E6UB 4O1HA 2Z2ZA 3C15C 1BE1A 5JRDS 4U7HA 3TSOA 2C7BA 3I4FA 4HEJA 4QQFA 1ISFA 1RAAA 2HCBA 4JLUA 1TU4A 2ZIVB 3G8YA 1XQXA 3U7IA 1E2BA 1SWWA 1UWCA 2EIHA 4BVFA 5IANA 3ZWKA 5C3UA 5H82A 2CXNA 4EVIA 5AJXA 4ARSA 4M37A 4Z4EA 3IUSA 1E58A 4D4HA 2WFZA 3BGDA 4G5XA 3AR5A 1JQ3A 1XNJA 2XUPA 3TKAA 2ZUDA 4KFTA 4KR9A 3P5BA 4JV5B 4GVPA 3KBOA 4TSFA 2I4TA 7MHTA 1I4WA 1ELOA 3PPXA 3EEIA 3GA5A 4IWYA 5HS4A 5K3OA 3CKYA 4Q6BA 4C0JA 1FTGA 2HA7A 2ZJOA 4F96A 5A0FA 1P7YA 3IH5A 5CH5A 2WJ4A 3DC7A 3WBFA 3T9DA 1QYIA 3PITA 1PQPA 1PZMA 1QR6A 4F04A 4BNVA 2P1DA 1Q1NA 2PD4A 4OP1A 1XLVA 3NIFB 4YHBA 3GZJA 2VRBA 1F20A 3HVHA 2H4WA 4YUZA 1WUHS 3GD7A 1X8KA 3TMYA 3DEHA 4D82A 2QT0A 2L42A 2WHRA 5KYYB 5EVCA 3GG2A 3RBVA 3RU7A 3T4EA 1F7VA 4KH0A 4B3HA 2WA2A 2G36A 1SHUX 3GLGA 1XZQA 3P9YA 5TQ2A 1HDRA 3GMIA 4UXHA 4TRJA 3WK5A 3WYDA 2P75A 1L8LA 1LNSA 1XN4A 1MG0A 4PONA 5DPMA 3W1EA 5KNBD 1HORA 4ND1A 3UXEA 3QFRA 2F62A 4U5XA 5EE0A 4ZCMA 3HJFA 2PLRA 5JVDA 4OLFA 4RIGA 5EZYA 4BWFB 2W6ID 1XFAA 1HKHA 1MAUA 1XDDA 4WZ6A 1KWKA 1XCOA 3V6LA 1GT91 4JLNA 1B3BA 4RYLA 1Q83A 4N0DA 2IS6A 1HC7A 4J4TA 4FFNA 2QX9A 1BIFA 4UTZA 3SY8A 2VTVA 3RG2A 4LF5B 1O94D 1K9SA 2EFHB 4Q00A 4EL5A 4TTAA 1KVQA 5ULLA 2KE5A 2DHCA 4IDEA 5DN6D 4IUCS 3K9CA 1QQ7A 3O3MB 4Q16A 5BSVA 2XKBA 1R0RE 2Q3MA 2AE1A 3UXYA 2B4KA 2JVJA 3EXG2 4WEQA 3DQZA 3E9EA 2IDJA 3QXCA 3UT0A 1MX9A 1HYBA 2AW5A 2FPMA 2J4FA 2OCKA 4EJ6A 1G1MA 2HMUA 2DRIA 3D7NA 1SOWA 1D2RA 2OILA 1QIGA 3BFVA 3EQ7A 5CVUA 4K9QA 1ECBA 4L9RA 2D59A 5IUNC 5EQJB 4I8IA 4FE3A 3KJXA 1HYGA 3TTXA 3UCFA 2O23A 1G6OA 1W88A 2REXB 4MCIA 1US8B 1N5IA 3NWJA 4G09A 4GWKA 4DPMA 2WQ6A 3L7YA 4RZUA 4EBFA 2AVDA 3IDQA 4W9NC 4GPIB 4PWZA 4TV9A 5DHFA 3A9WA 5LNK1 1UFOA 1N2CA 2BMWA 1H22A 2EG5A 4OF4A 5EP4A 3T3HA 1FVOA 2BR3A 5BVGA 1R0CA 1IN8A 2AK3A 3NTVA 3U48A 4EZIA 3VOTA 3P9RA 1RXUA 2P2DA 4FHZA 2JA1A 2V5UA 3JATA 1E94E 4ZDKA 5EHXA 3KQNA 5CJ2A 1EE2A 2UYOA 3FOFC 2UVDA 1BN7A 2VEDA 5AK4A 2JFVA 3KT3A 4OL9A 3E2IA 3SHQA 4AL4A 1G2IA 4HNVA 1F8UA 1QUEA 1TZCA 2FMIA 3RASA 7ABPA 1I1HA 4W7HA 1E4OA 1H5QA 5HMMA 1JSXA 2NZUG 1MTOA 4LUCA 3OT1B 1FYFA 2IIBA 4GQBA 5BNZA 1CFZA 4G85A 2LCFA 3A9CA 3F0TA 4NDZA 2AMFA 3OTGA 2OM2A 3GZNA 3TZEA 3KEMA 3V3KA 3AFNA 4S1PA 3JQRA 4Y6QA 5I3CA 2UYYA 4P83A 2QTVB 4QGHA 1R6AA 2B99A 2D54A 4EW1A 2R6AA 2A33A 5TMPA 1AGXA 4WJKB 2LGJA 1CUVA 2G71A 1DINA 1VHWA 3C6XA 1QFJA 4Y6RA 1SD2A 2QB5A 4NE2A 5LL6P 2BE7A 4O1MA 4TYQA 3MJVA 3EDCA 3HGMA 3JQBA 4ZT3A 3NJ8A 3QG5A 3TRFA 3DZKA 4AZ0A 2O7RA 1DAPA 2BEVA 3O4FA 4R7TA 3AEKA 4RK6A 4YRNA 1EDEA 5FLEX 2OD7A 3IULA 1G0NA 4G5QA 2QV7A 1UK9A 3QF4B 2ZVPX 3SNKA 5ICEA 4L3OA 2B94A 4JKOA 1Q3KA 2YRWA 3DMDA 3GJ4A 4KMRA 1VI5A 1ZPDA 2CW5A 2EAUA 2XVAA 2P67A 2V74B 1JDBC 1YS9A 2XXAA 4P92A 5I3ZA 2F8TA 2UVPB 4WGGA 4WECA 4AJNA 4UE3S 1NXWA 2CDAA 2ZQZA 4GKAA 4EY3A 3O3CA 1MVOA 5A5FA 4M60A 4KVZA 3JTMA 2JD1A 1P29A 4ABTA 2BDUA 4DLNA 3V46A 2VDJA 2XB6A 4KFSA 1WF3A 1Q91A 2YHSA 3IS3A 4NEQA 1VM6A 3M3HA 1UBLS 1NNUA 4JSRA 1NI5A 2IEGA 1DXYA 2FRDC 3LPMA 1NW6A 4TSFD 3ID6C 3S99A 5LN1A 2JCYA 3V4SA 5B2FA 3UCEA 3M4YA 1K6JA 2NO4A 1UM9A 3C6QA 3GWZA 4JOBA 2IYZA 3D43A 4CIVA 5FWYA 3HCAA 3OEEA 1H6DA 3O9MA 1E1NA 3EF0A 5JXJA 1FEZA 3ZGZA 2JLCA 2OZLB 2Y4OA 4L02A 3TOSA 4TN1A 4I4TA 4X6UA 1CF9A 4DV3B 4JI8B 1P8AA 3DP9A 3WYAA 4LEIA 4GXQA 1V5GA 4TV8A 2F1OA 4MXDA 2O8VA 5EGNA 1CB0A 4PPQA 1TQ4A 4GI2A 4OATA 3VA7A 1SELA 1T2NA 2RHBA 1G6KA 4CGZA 1P7WA 2PZJA 3M6MD 4E2WA 1CJSA 2Q8QA 1TJYA 3RRXA 3CJQA 3HJRA 3LT0A 5J1TB 1XEWY 4KAAA 1KO5A 2HX1A 3UN1A 1QE3A 4B4DA 4YJHA 3I73A 3VU8A 1PJCA 3CRW1 4UBJA 3OUUA 1FDSA 1M2OA 2OFOA 1WB6A 4BQRA 3TM4A 4V1CA 2GVDC 4KC0A 3NOXA 1JQ5A 4ZOLF 3THRA 3D6NB 2OC9A 4B6EA 2BEUB 4B09A 2WY2D 2FEXA 2QN2A 3DEJA 3TX2A 1J5EB 1N5RA 2BCGY 4RPIA 4UVEA 3JARA 1TYAE 2VNJA 1PUXA 2NADA 2WU4A 2AC4A 3O47A 4IW3B 4IDGA 1G8GA 3P9IA 4R5MA 4XLTA 3EG9A 3VAAA 5D5HA 2AFHA 5I7RA 1LJ8A 2C20A 1USWA 1KA9H 2R7AA 3JV7A 3R7AA 1OWOA 3SZRA 1ICEA 4QT4A 3E03A 5KYNA 5KYWB 3NKFA 5GADl 2OYCA 1P2DA 1NW5A 3E48A 2QUIA 4QDZA 4J9VA 3CUSA 3SVLA 4WH0A 5FBZA 3EQZA 4ZAZA 4DY6A 3AEUA 1XF1A 3BFKA 3VOAA 3T4PA 3DEZA 5KYUB 4UHDA 5U4QA 3P8ZA 5CNMA 3DO5A 2AEFA 2Q21A 4NXMB 2H08A 3SQMA 2Q0SA 3PJGA 4N3BA 4ZKDA 2ZYUX 1JHRA 3ROZA 2QPOA 1BGWA 1KAQA 3EJWA 5F33A 3UF0A 4BGDA 3COSA 4UBNA 1SXIA 1NGSA 1P7ZA 3HR8A 4D98A 5LDDC 2DR0A 1A9ZA 2OZVA 3OPXA 2ACWA 5C1IA 3D8BA 4DYVA 3K15A 4DG5A 2ZUEA 1T1SA 1JR2A 2RHJA 2YJGA 3QTBA 1EHYA 3SPXA 1J42A 1HE8B 1M2VA 2ODTX 2HSEA 2V4MA 1LD3A 3O75A 2J9FB 2BKVA 4EENA 3P2IA 4GOXA 5I6DA 3RRNA 1V6AA 2BJHA 4DA8A 5I48A 4D0RA 1Q3TA 1W93A 5F3RA 4E5SA 3KV1A 2UYGA 2WSLA 1AHIA 1UMCA 4BMZA 4CRWB 2QD4A 2M6KA 5C5CA 3JY6A 4DLPA 1UT8A 4IPTA 4NFYA 3A6FA 1RPTA 1IN5A 5AHRA 5FPPA 1MH9A 2RGNA 2AXEA 1EGVB 2WNHA 1H0HA 1W0KD 3R6WA 1ONSA 1P31A 1V1RB 2Y76A 2W2XA 5ITWA 1EVYA 1R6UA 1UMDA 1QCDA 1J7JA 2VUTA 4G8CA 5AHXA 3VSCA 2EW8A 4NYMR 2NSYA 3WMEA 2XUOA 4NF2A 4HH3C 3ZLVA 5JTUA 4D9NA 3RFCA 1PJQA 2OXCA 3B3FA 3MYRA 1GV0A 1VPVA 4BNLA 3Q1LA 2Q2WA 3A31A 4MV5A 1W5SA 3E05A 2V6JA 4ZN6A 3D2BA 5IJWA 2NU6B 4RORA 2X8JA 5JPCA 1E9RA 1IPEA 1SKMA 2ZRQA 2BI7A 3MINA 2I99A 2O8NA 5AI8A 4IJ5A 4BO2A 2D5BA 3HK2A 1SK9A 3P2EA 3C41J 4J0FA 4MV9A 1P0QA 4B4VA 1RJWA 4ENVA 1H2ZA 5A5GA 2W6MA 3N05A 1OASA 5K45A 2EFEB 3THXA 2VCHA 3TIFA 1MOPA 2VPWA 3DL0A 1WZNA 3QQ5A 4KQIA 4Q7EA 2BFNA 5K4AA 4ND5A 1U65A 2GKOA 1SKUA 4HRYA 3CUUA 3OHSX 1VIMA 4TLEA 4X1IB 3U7RA 4B33A 4GQAA 5K6TA 2AQKA 2R1VA 1FS4A 3DBVO 4IXTA 1Q44A 1Z7WA 1OU0A 1ESMA 4MV0A 4NDAA 4NS1A 4WZAA 4BNGA 5FV4A 3NHRA 1Y8CA 5EYPB 3GX1A 1A69A 2P1RA 1EFPA 2QMZA 4I9GA 3FHTA 5EPOA 2W6ZA 3ZZ1A 1TZ2A 3WKCA 3DA8A 3LZ6A 2NPFA 2GM5A 5DM1A 2DFPA 2XTZA 2UZ4A 2QE6A 3K20A 4FQ8A 4H27A 1XMQB 3LWZA 3C4QA 4RO0A 1BCSA 3E4CA 3OEED 4DHWA 1AQJA 1CY1A 3UOGA 5C5EA 3OIVA 2PTHA 3V1TC 2FWNA 4WNAB 3WYCA 1H8HD 1GZ3A 3PDIA 4XW2A 3EFBA 2ZJ6A 4GSLA 4TX1A 3JQ8A 5FOVA 4HAYA 1GKIA 3V4LA 2GVNA 3WLJA 2E2WA 3ASYA 1WNTA 3LA8A 2B2CA 3M6UA 1E96A 2Y68A 3ZOZA 5IF9A 4OHOA 1TYDE 4ALJA 4WOJA 3ELYA 1Z7GA 3TECE 1SCIA 5AK5A 1N1GA 1K5HA 3B85A 3BXEA 3E35A 2GCOA 1B00A 3BMQA 1N9ZA 2C59A 2WIBA 5KOYA 3OUTA 4RY0A 1JZTA 2W6PA 2W98A 4XUEA 5CVJA 3IBGA 1TT5B 4LRQA 3ORQA 4LJ5A 4PC1A 4NK4A 3ZHCA 5K0JA 3EZGA 4HQFA 2QRJA 4GYJA 5ECDA 5PNTA 1OH8A 4BV3A 4X91A 9MHTA 5BOSA 2HJSA 3PSHA 1XRLA 1Y4DE 4KPYA 4N5NA 1VRVA 2NVBA 4QBFA 1J8QA 2JFOA 5DX0A 1QU3A 4LJ8A 1L3IA 3QVJA 4GR5A 2DFVA 4C0WA 5DWDA 4ZQFA 2WSMA 3N2YA 3V8VA 1LQ2A 3PGJA 1DLIA 5KINB 1W85A 1ZC4A 1UKZA 4MIEA 1EA5A 1KI8A 1KI4A 2G0NA 2XDYA 1DRJA 1FS5A 2E4AA 5K20A 4IGEA 4AMUA 4F1JA 1C1DA 1CE8B 3R9WA 1DQYA 1JU4A 4XR4A 3TE7A 1XTKA 3WGUA 2JIBA 3HWX1 2UZ0A 1UBTS 1VXRA 3DHVA 3IJPA 1PSWA 3KAPA 3MILA 4ZQBA 3UJ3X 4EM6A 2E9SA 3D7KA 3CNBA 3GFPA 5SY4A 5A7FA 4KSBA 3EMKA 2JAWA 4DFDA 2VP6A 3HHEA 3RRJA 5F3DA 3IR5A 2VDUE 1V71A 4DCJA 3U60B 2XEXA 4PANA 2Q8NA 4ZI7F 2W8BB 3JRXA 1PR3A 2FY8A 4G01B 1GTL1 4TN5A 3ZCUA 1C9YA 1XRPA 1QANA 5TQJA 1QP7A 5KWIA 4W1PA 2UZ1B 5IULC 1XF9A 3H2IA 2YASA 1FJXA 4R2LA 2A30A 1ZK3A 1NVFA 1J5XA 4KPUB 4B31A 3KYCA 3FBTA 4P1ZA 1CRPA 5CXQA 5HE9A 2H57A 4LWOA 4BO4A 2IHZA 4MRAA 2W83A 2ZAMA 1QGYA 4Y2JA 4OBWA 2N46A 2HDHA 3QU9A 5IT0A 1STOA 2ZR9A 3HMQA 5T4HA 1YNSA 4HN2A 4O2AF 1JZQA 3Q10A 4YCLA 5JZMA 4GBGA 4PX2A 2FR0A 4ZO9A 3ZCXA 4PS0A 5CFRA 5JQGB 1GNLA 1K06A 1OXTA 1P6XA 1U2QA 2H5IA 3VPGA 1N32B 1GO2A 3B8HA 2QRQA 3H75A 1CR2A 2N75A 2QM8A 1DQZA 1Q0SA 3GLRA 2QN9A 3HCEA 5A3VA 3TD9A 3ZQJA 4G56A 2QGNA 3ZDRA 5M2QA 3MGKA 3FWZA 2QKYA 8OHMA 3LQYA 3HUTA 4ZEXA 3OWOA 3BWMA 2IIQA 4ZMSA 1DO8A 1OFUA 2BKUA 4KODA 5IRCD 3ZDEA 1ZVJA 1P91A 3LY5A 1N3LA 1TKRA 3A4IA 4KB5A 2CFIA 2NTNA 3UYLA 4BYMA 4F2WA 4MP8A 1JYEA 2AFVA 4Q9LA 4ZV9A 4YQZA 4N48A 2WU1A 1TC1A 2VSOA 3AKEA 1EYZA 2C4TA 4MR8A 4O4IF 5LD2C 1DT5A 2HIHA 4RX1A 4B6OA 3BEOA 3CX4A 1MPTA 1HFKA 1TO2E 2C07A 4TWJA 4XWYA 4ZO6A 1W2GA 4EI7A 2XQFA 4UFPA 2D1TA 1PNVA 2GPTA 6REQB 3ADPA 4GNRA 1WBJB 3LUCA 5IM4A 5TS3A 1RFGE 1XK7A 3LO5A 2FRDA 4RV4A 3ZYCA 3GUZA 2F7SA 1L1FA 4EJFA 4JX9A 3SLRA 1FP6A 3ICPA 2IHYA 3MUOA 4KWHA 4O33A 5K3SA 1GUAA 1DAFA 3M4JA 3X3HA 3MT0A 4P5DA 5KTNA 2ZJ1A 1WY5A 4RAQA 3N53A 1LBEA 1Q17A 1IM5A 1PVDA 1C3OB 4LTMA 2TS1A 4L78A 3SFZA 3UWKA 4ENQA 2YIDA 4ZOEA 1W35A 2O2IA 4E5MA 5BUSA 1J6UA 3IE1A 2GZDA 1ZJ5A 3RAJA 2X4GA 4K2AA 4ZYXA 3QKSA 4NAVA 2HU7A 1UZLA 1XTUA 4I8XA 1LZKA 4X1KA 1K8RA 4QU8A 5TNXA 1NRXA 2SECE 2Z8XA 4WK4B 2ZM5A 2QMQA 1XTTA 1FYEA 4DNXA 3PV0A 1YCHA 3MJRA 3KKKA 4CLRA 2Q3EA 3D5QA 1CPYA 1KC1A 2G7ZA 2RAVA 2V7PA 1L8OA 2VPZA 2R7MA 2WAAA 4I1OA 1QRUA 4UHBA 1EDZA 4MRNA 1R88A 5ALIA 3ZWWA 3BCUA 2GXQA 2VWGA 1UKYA 4R1LA 1TRHA 1ZOIA 3GVIA 4FJ1A 4CU2A 4X44A 1WXIA 4PHFA 2PXAA 4BEJA 1P1RA 2PMCA 3HY4A 3BREA 2D7CA 4A10A 1LI4A 4OHVA 1KZ9A 3HBMA 2GT1A 3IIEA 4R9UC 5FJJA 4F4UA 2HGSA 2Q3CA 2BGIA 1VBNA 4JP1A 4DSTA 1RABA 2BGMA 3FUUA 3CINA 3T4UA 2RJOA 3I62A 1U1FA 2Z4TA 1T9ZA 1KIAA 2TMKA 4RPCA 3URMA 2ZE7A 4B0PA 2WLTA 3ZWQA 1DRKA 2CLHB 4KXWA 4DNOA 5IXJA 1NOIA 4CEHA 4TL7A 1IHOA 3DE7X 4AUNA 2V0CA 2YY7A 1K5PA 4GZ6A 2WHPB 4NG4A 1EVJA 2XRFA 3PVSA 1KYZA 3BM5A 4H3HB 2ZR8A 1T9GS 4NKRA 3IAEA 4YBRA 3RAFC 4OI0A 3N7UA 3QXSA 3FCUB 5DTQA 4Q18A 3QY0A 2FDXA 3QFHA 1FFHA 2DT5A 5ALGA 3TTVA 1JZSA 4RMIA 1O5TA 3KSZO 3O4RA 3O74A 3P9SA 5AW3A 1KZ7B 4E4RA 2MJLA 5C7IO 5EJ4A 3PTZA 2Y1GA 2IH4A 1Z6ZA 3FYTA 3QH4A 3G9ZA 3UIEA 3SLGA 3DEKA 4I4CA 4LZNA 4BEVA 5EXEA 5DNCA 1CUZA 3EPHA 4M7WA 2DBQA 1JSZA 4MB0A 3PFNA 4QTUB 1YB4A 3STWA 1AK9A 1KGSA 2QP4A 1ZRHA 4JOSA 4O0MA 4FCTA 2GNPA 5HTKA 2G40A 3LUPA 1XX6A 3STYA 3KRTA 2FPXA 3T5BA 3T54A 2GFQA 3PQ7A 1WCYA 4GP7A 1MQ9A 1WCIA 1QH9A 4J6EA 2WWIA 4OVKA 3ZQ4A 5ELLA 4ZYLA 3L0SA 4MA4A 2VP2A 4BX0A 2GM9A 1X0XA 3QVGB 1DU4A 3VR3A 3B6IA 2V5AA 1W94A 4BGUA 4MR9A 3RE1A 2EJWA 4MAFA 1DX9A 1ZUNB 4JY7A 2NG1A 3EXFB 2YW9A 2H4XA 4BP9A 1IHUA 2NACA 4DSOA 4LFCB 3VKUA 4TVBA 5A62A 5KO2A 3H5VA 2QEQA 3EWNA 4B17A 3I28A 5GAJA 1SHKA 2D13A 2WVJA 1HWYA 3TLCA 3UH0A 2D2EA 1WDTA 4DQDA 4W1RA 4R8KA 5FULA 4PLCA 2DXIA 4X20B 2PYZA 2VF8A 2ZYVX 5JJLA 1Y8QA 3TGLA 3AUKA 5CK4A 2DETA 2CY0A 1FPMA 3TTTA 1RLMA 4IIVA 2B1GA 4PSUA 1EXDA 3LK6A 3R4CA 1OKKD 4XIGS 2MSKA 2PUEA 3IUMA 4DMMA 5ALMA 4BFUA 4P8RA 5K3AA 4LF7B 1TLTA 3ZGYA 4GXNA 3KC2A 4MB2A 2AHOA 1WXFA 3JWIA 1BWSA 4TT8A 5J2UB 1N5OX 3WLLA 3ZWVA 4ERNA 1SUEA 4IX1A 4TZKA 4QUDA 4LHZA 4DLYA 4D96A 3I2IA 4RTLA 2VSXA 1Q92A 1G1AA 4HEA1 2QAGC 1KYVA 2FW6A 2GJAA 2XLCA 4UBIA 3CSSA 4CFSA 2RJNA 1LBSA 2IDMA 2ZAYA 3OIDA 2YYZA 4TMVA 3COJA 2ZSFA 2NPIA 2OHOA 2QRNA 3H5LA 3PGLA 3SX0A 1I0IA 3ASZA 4A0RA 1D5CA 4YRIA 1X7HA 3N8IA 4H59A 4ENWA 3ESAA 2I4RA 2AT1A 4AMBA 1SXHA 1KBOA 3LQ1A 5AKKA 3VX4A 5FOUA 3A7DA 5K09A 4Y9SA 4CPDA 1B26A 4ZTUB 2JLWA 1U8TA 1LPMA 2BHSA 5SZKB 3RF7A 4YRRA 4H1HA 1YI0A 4TGLA 3OFJA 1PNRA 3FCYA 3I30X 3E5HA 1T5DX 2O05A 1E9DA 1TK2A 1ZM2A 3H1EA 4P3KA 2FTKE 1GM5A 3CB2A 3TR5A 1XDSA 2ES4A 2ZBUA 3CPEA 3S2SA 1KJWA 4NVRA 2ORIA 5HDBB 2XBUA 3O2SB 1DJOA 1NKSA 3JVUA 4IIJB 5BV2P 4LJLA 1VJ5A 3OX1A 3WWCA 3BZWA 1JIVA 13PKA 2GXSA 3OSUA 3OTIA 4KO8A 2HRBA 3B1ZA 4LBYA 4QJ5A 5BUZA 3NVKI 4QC2A 4CV0A 3AL3A 3U3XA 2FLWA 1SKYB 3VJRA 1M1XB 3EHDA 2BI4A 1OOEA 4Y2YA 4CM8A 1BW9A 1Y42X 2C84A 1R64A 2E18A 2JRLA 1ZOSA 1P81A 2HUNA 3MBIA 1SCQA 3K1TA 3LLMA 2QMYA 2B0CA 2JK1A 4CT0A 1FDTA 1F9EA 3ZHTA 3ESXA 3N5CA 2PWAA 4Z7OB 5EIHA 2ZVJA 1BXRA 5J40A 1IOVA 2JJQA 1BMTA 4JQCA 3V1KA 1RMQA 4CKBB 2C7OA 2PSEA 2AW3A 2QTCA 3EA0A 3NBYC 3CRNA 4MX8A 4DCOA 2V54A 4EZBA 3MVEA 5HZGA 5F9MA 2UXDB 3RSOA 4OP3A 1IJKA 1TB4A 3G2QA 4KPFC 1PSDA 1Z7EA 2FSPA 3UV3A 1F2TA 1WHSB 5LQSA 1VE5A 3RVQA 3GVPA 2PUJA 2E5FA 1OE0A 5LPNA 1V5WA 3AXTA 4IQ0A 2O1EA 3LMKA 2AJ8A 2Q6KA 3RRBA 1E6LA 4DB4A 4IR7A 3LVFO 1AKQA 1CEYA 1D09A 2XAUA 1F4VA 2E4UA 3OSZA 3R5KA 3G23A 2KW5A 3H9GA 4UVGA 4CTMA 1BX0A 1UK7A 1G41A 5FEUA 2IYAA 3BE5A 2ZYWX 2YWJA 2G63A 4LDAA 2EYUA 4YJGA 4BZZA 1KEPA 1P7PA 3SICE 1Y6FA 2I7DA 1MN6A 1T4MA 1TO1E 3PGKA 4BKPA 5BQXA 1UAYA 2YOFA 3IVAA 2ODNA 1GKLA 4L07A 4P2BA 1EWTA 1RLJA 4BE7B 1YRHA 3F6PA 4HQ6A 1NXQA 4NCNA 3UB3A 2VSNA 2R2AA 5E3JA 4UUQA 1T9HA 1SBQA 2WQZA 2VNIA 5TPWB 3DFKA 4URUR 4WZBE 1X7XA 3HC7A 1EH5A 1U2EA 2A9JA 2VHEA 5H0IA 3TZCA 4CKZA 4F11A 3VR3D 5I5GA 4LW8A 3P9CA 1WCWA 1OLUA 4MVJH 5H80A 3TQQA 2N1BA 3TXAA 3VR5H 3BXPA 2C4HA 3HEBA 3KLMX 3Q12A 5FBHA 3JD3A 1QIKA 3BX1A 3VR6D 3W3ZB 1EFAA 1Y5LA 2RDMA 3AJRA 2GXUA 1FRFS 4TSRA 3SYLA 3HR7A 4EUNA 2HJHA 2H65A 2IUYA 4N3CA 2YZ2A 3VZSA 1L4MA 2XWQA 3WGJA 1E7QA 1MX5A 1QZUA 3EF3A 1ZZGA 1ZN2A 4M1WA 4NYIR 4RM3A 2V6FA 1Z5NA 2R1TB 3ZD9A 1ZGJA 2Y93A 2FPIA 3GG9A 3OQ1A 4I1RA 4MW1A 4NG5A 4ZU1X 5GONF 4JLSA 4BS9A 1FOEB 1KSFX 3QV1A 2FN7A 1P62B 2VF7A 3COWA 4FOOA 2AX4A 3DV2A 4CCWA 3PHJA 1GT6A 1PUIA 1ZFNA 1A5BB 2NZYA 4XDYA 3KOMA 2LKCA 1AUQA 1DQSA 2XODA 2ZIUB 5HBRA 4ZVMA 1IATA 5GJWC 3VPAA 2FPOA 3VPFA 4B32A 3V8NA 1PFVA 3GPDG 5ALQA 1W46A 1Y6RA 4DB2A 4XB2A 4FVTA 3WDKA 1VG9B 4BNDA 2XW6A 3UJ9A 1IIRA 3C8HA 3ZY4A 2QLLA 3GDOA 2CDNA 1U5BB 4R1SA 4U3JA 2IS4A 1ZYUA 1VGRA 3OJLA 1PGNA 2WILA 1BCRA 5D87A 4QAQA 4FD2A 5JSYA 5JNUA 3ZD6A 1BMQA 4KO1S 4UU0A 2VYCA 5C35A 3STUA 2GM4A 1H85A 1OWLA 1USKA 4LQLA 5ALPA 2C5EA 4KQJA 4KIWA 3TL3A 1CW2B 1P7VA 3WBJA 1UC9A 2CMHA 3E8SA 1UPBA 4CTKA 3FDIA 3RHFA 2NVUA 2CL6X 3T5DA 4WXYB 3LFUA 3JYHA 3CEAA 4DYHA 3Q2KA 1ZM9A 4G9BA 1JHQA 4M6WA 3DHYA 4X63A 5FP0A 4P31A 4EJ0A 3K8QA 3CLHA 2RHCA 5INTA 2Y0BA 3HU1A 4QPDA 1CV2A 3ZXYA 4K8OA 3T3OA 3FSJX 5A2QA 2BWJA 2NSHA 2D4AA 4CL0A 4NBLA 4JWKA 4FHDA 3ZBQA 1BKSB 4XJVA 3EPPA 1CY4A 2QVGA 4JBGA 2XUFA 5BW5A 1EB9A 2QDXA 4G67A 1NMYA 1CNEA 3CX3A 2X9VA 5CUQA 4BFSA 4CDNA 4FJ0A 5KPDA 1H2FA 1R8JA 1V25A 2HMYB 3U62A 4CKEA 1M6NA 1S2OA 1NKVA 1Y7TA 2WM2A 2C9DA 2ZYDA 2LDXA 4OU4A 5ICCA 3HBAA 1B0AA 2I3BA 3MGGA 4UNSA 4CHTA 3ZG6A 2DH6A 1JB9A 3EFHA 3FJ1A 3TRKA 3UGJA 2M6RA 4MTLA 1QGZA 2A5FA 2WJHA 3DJFA 3UK2A 4TXJA 3CLTC 1PBTA 1S1MA 4JR1A 3HKEA 4MWEA 1QR2A 3N2NA 4R51A 4L2IB 4IUDS 1ADYA 3LIPA 4HO1X 3ICOA 2AFIE 3FN4A 5A1TA 10MHA 2AF3C 2DF8A 3DE1X 4I5IA 3U37A 4P7KA 4ISCA 4RBNA 2H1IA 2YN2A 3LGXA 4O6VA 1C9MA 2JPDA 4PSVA 4IGIA 2J6BA 2Z43A 3KQKA 1NR7A 2Q46A 1K92A 2VRCA 5CGZA 3VO1A 5KMGA 5GM2A 3P2KA 4D4MA 3T1TA 3U4QB 1Y34E 2DZDA 1LVHA 1L5QA 1MABB 1XT6A 2I3DA 1LLFA 3OCUA 3CPHA 4JLPA 1G8PA 4PW0A 5FJIA 3TAXA 2V9CA 2BYTA 5FB3A 4J90A 4WESA 4XEUA 4UNIA 6CHYA 1JPVA 1MIOA 3QWHA 2Q6TA 3IMGA 4Y9UA 4EG5A 4MCHA 5KTPA 3LP5A 3OU6A 2XUGA 3GEHA 3HYSA 2I6FA 5EIFA 1JLLA 4XIYA 4ZAGA 3M34A 1CRZA 3MM4A 1FVHA 2CLMB 2VBIA 2J5XA 2JI6A 1QIEA 3DE3X 3LTNC 4HR7A 3K73O 4HN9A 1TVKA 1TIKA 2DPHA 4XWWA 2FOXA 1AXRA 3HXOA 3WNZA 4M86A 3M4XA 3ORFA 1T0PA 4IMJB 3WWDA 3ENKA 3RIMA