3N1UA

Structure of putative had superfamily (subfamily iii a) hydrolase from legionella pneumophila
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
b'SLNTEIEMNELLEKAKKIKCLICDVDGVLSDGLLHIDNHGNELKSFHVQDGMGLKLLMAAGIQVAIITTAQNAVVDHRMEQLGITHYYKGQVDKRSAYQHLKKTLGLNDDEFAYIGDDLPDLPLIQQVGLGVAVSNAVPQVLEFADWRTERTGGRGAVRELCDLILNAQNKAELAITGYLKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrolase, HAD superfamily, subfamily III A
molecule tags Hydrolase
source organism Legionella pneumophila
publication title Structure of putative HAD superfamily (subfamily III A) hydrolase from Legionella pneumophila
rcsb
total genus 60
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3n1uA00
3WK5A 1QYIA 3QUQA 2RBKA 5A3SA 3K1ZA 5AW6A 3KZXA 4QJBA 4B6JA 3W5DA 1Z4QA 3L8EA 3ZI4A 5ALKA 4Y2PA 5ALTA 5T41A 3QLEA 1RMTA 3OTQA 5AVYA 4C4SA 4UMEA 1YS9A 1EK2A 1Q92A 1T5SA 5AK4A 5ALYA 1N8NA 3DV9A 1ZD3A 4ZEXA 2FUEA 5ALUA 5AKGA 1Z4KA 2B1RA 1Z88A 2YJ6A 1S2OA 4NFLA 1VJ5A 4MUMA 1L6RA 2X4DA 3MN1A 3L1UA 1J8DA 2HX1A 3KBBA 5AVSA 2PR7A 2CFTA 4UAVA 5ALXA 2GHQA 3N1UA 4O8CA 1U02A 3WK7A 4CF4A 3PDWA 2CN1A 3GYGA 1WR8A 3QNMA 3FGOA 4YIKA 1RLOA 2W4MA 4YH1A 5ALVA 3ZX5A 3N5KA 4EX6A 1ZRNA 5AW5A 3QUBA 3WKEA 1IWOA 5AI9A 2P27A 2WF5A 3N28A 2YBDA 3R09A 3SD7A 2B30A 2GHTA 3AR8A 3L5KA 3I28A 2ODAA 4BX0A 4EENA 3A1DA 4DFDA 4I9GA 3DDHA 3OCYA 2OYCA 5AVZA 1RQNA 2YMPA 3ET5A 2HF2A 2WF7A 1RRCA 4Y2RA 3OCUA 2GMWA 2R8XA 5AKYA 1F5SA 4FE3A 3QU7A 3AR3A 4FYPA 2NO5A 2WF9A 1TJ5A 2GFHA 5ALOA 1RDFA 5AKXA 3FVVA 3NALA 2ZOSA 3A3YA 5AW3A 4YGYA 2EAUA 4UU1A 5A3QA 1JUDA 1RMYA 3ZU6A 2HEGA 3I1YA 1Z4JA 1WVIA 2AMYA 3RFUA 5AIBA 5AKEA 4OHFA 4HGOA 5ALSA 4YCNA 1ZOLA 2NYVA 1L8OA 2B0CA 3ONNA 3U13A 5ALLA 3AR4A 2IOHA 3U26A 3L0CA 2AUTA 2ZBFA 5AKJA 3EPRA 1SWWA 2I55A 5AM4A 2BDUA 3QU9A 3QUCA 1XP5A 1YDFA 3SHQA 3AR9A 2FI1A 4Y2QA 3L8HA 4JDPA 2VKQA 5AW8A 3E8MA 2ZBGA 5ALRA 4G9BA 1YV9A 2JARA 3OPXA 3QU5A 3ZWDA 3UM9A 2O2XA 2W43A 1QQ6A 3QX7A 1NRWA 5IT0A 3EF1A 5AM0A 3FM9A 5AI0A 4GXTA 5AW2A 3L0BA 4AS2A 3KD3A 3W5AA 1RPZA 2BY4A 3PCTA 4HGNA 3I6BA 4L6AA 2G07A 2HCFA 5ALJA 1VFPA 4C4TA 3PGVA 3KOOA 3WK8A 1YNSA 1KYTA 4I9FA 3NAMA 1T5TA 4NWIA 2R8ZA 3U19A 3CNHA 1AQ6A 3UMCA 2ZBEA 3WK4A 5AKIA 4KNWA 2IA5A 2YMQA 4AP9A 5ALGA 4Y2UA 2G09A 1FEZA 1TJ4A 1XVIA 1L8LA 1ZD4A 3I76A 3S6JA 5AM5A 5AI6A 3ZWKA 2JAWA 5AM3A 4UARA 1ZD2P 1PW5A 1TJ3A 4L6CA 3AR7A 5AVQA 5AVWA 1L7OA 5AVTA 3A1CA 1RLTA 2HF7A 1X42A 3WGUA 4AS3A 1L7PA 3MPOA 2C8KA 4OCZA 3J7TA 2NO4A 5ALWA 3QUTA 4JB3A 5AESA 3P96A 1CR6A 5ALPA 3WKBA 2YJ5A 3NRJA 1RC8A 5AK3A 3UMBA 3ZUPA 4KYTA 3AR6A 3E81A 2YMMA 5AM2A 3DNPA 2ZG6A 1L7NA 5ALZA 4EX7A 3W5CA 2R8EA 3M9LA 3WKAA 2FPRA 4UASA 4DWOA 3E58A 3FZQA 1U7OA 5ALHA 4KX3A 5ALQA 5IS2A 1LVHA 3AR2A 2P9JA 5AK5A 2D2VA 3B9BA 2AH5A 5AVRA 3TLMA 2HHLA 2EATA 4BNDB 4E88A 3N07A 3D6JA 2I34A 5AI8A 5AKKA 1Z5UA 2I7DA 1MH9A 5AI4A 2Q4RA 3SMVA 3PGLA 3VAYA 1TA0A 5ALDA 1Z4IA 5AW1A 4OFZA 5AHXA 4YIHA 4UM7A 1XPJA 2YJ3A 4BX2A 3WKDA 4UW9A 2I6XA 2WF8A 1YJ5A 2YJ4A 5AI5A 1RKVA 1Z4MA 3L8GA 2B8JA 1WZCA 1QQ5A 2PQ0A 3OCWA 4J2TA 2RARA 4CNQA 5AW7A 3BA6A 4HYTA 4CE6A 2QLTA 1O03A 4QQFA 3N8GA 4XE5A 2DQSA 3ZVMA 2YY6A 1RLMA 4J03A 1RKQA 3B9RA 3ZX4A 4UAUA 4RETA 2RB5A 4ZEWA 3ZW7A 3QU2A 3SF0A 3ZVNA 1NF2A 1LTQA 3L0YA 1CQZA 2W11A 4RESA 3NASA 3R4CA 2FPUA 3ZTYA 3NIWA 4ZEVA 3ZVLA 2WM8A 1U7PA 3QGMA 2CFSA 4YCLA 2MU1A 3U7FB 5ALNA 4EEKA 2IOFK 4FFDA 4NAVA 2EARA 3IRUA 4YCMA 2HI0A 4NABA 2G06A 4XPZA 5AK6A 4HAIA 2OM6A 3NUQA 2QYHA 2BDEA 4XOUA 1RQLA 3L7YA 2I33A 3EF0A 3WKCA 3U7HB 1TE2A 2FPWA 2OBBA 3M1YA 4UMFA 3FPSA 4BBJA 2CFRA 3EWIA 3MMZA 4HGPA 3ESRA 3ZTWA 4Y2VA 2GO7A 3KDPA 5ALFA 2FPSA 3IB6A 5IT4A 1RMQA 4HGRA 1Z4PX 2FPXA 2YFYA 5AW0A 3ET4A 2HO4A 4NV0A 2C88A 2R8YA 3UMGA 3B8EA 3QXGA 1SU4A 2FEAA 3KC2A 2RAVA 2ZXEA 1EK1A 3ED5A 4HGQA 1N9KA 2C8LA 1SWVA 2WHEA 2JGAA 1Z4LA 5A3RA 1S8OA 2JAOA 2I54A 3HYCA 5AKLA 3QYPA 4Y2SA 3SKYA 4BYGA 4BKMA 4UM5A 2G80A 1ZJJA 4DCCA 3BWVA 1QH9A 3U7GA 4MWOA 4UU0A 1K1EA 2Q4TA 2B82A 2WF6A 2HSZA 3R9KA 4EELA 3W5BA 3AR5A 4KN8A 5E0OA 2C9MA 4G63A 4GIBA 3IJ5A 1U2TA 4UMDA 4KX5A 4Y2JA 3SLRA 4Y2TA 3CZ4A 3A1EA 4H1WA 5FP0A 5AKZA 2AGVA 5AW4A 4BNDA 2G0AA 4XQ0A 4OD0A 1Q91A 5AW9A 4EZEA 5ALEA 5AKHA 1Z4OA 3RF6A 1T9ZA 1QQ7A 1L7MA 4Y2YA 2G1AA 4BEVA 3QU4A 2P11A 2HOQA 4PNHA 4KNVA 3WK9A 2OA0A 3MC1A 2MSNA 3OCZA 3E84A 3SKXA 5AIAA 3WGVA 3WK6A 4IFTA 5ALMA 3OCXA 1ZRMA 2O9JA 2YN4A 2B1QA 2HDOA 4DW8A 5AM1A 3U7EB 4CF3A 4Y3UA 3DAOA 1U2SA 5AVXA 2B8EA 4IG4A 3ESQA 2WFAA 3L8FA 5JJBA 4C4RA 2JAUA 2ZBDA 1WPGA 4UATA 1NNLA 1YMQA 2IOFA 2YMLA 1VJRA 2G08A 4CF5A 1O08A 1RKUA 1ZS9A 2P69A 4Y2XA 5AICA 2IYEA 1J97A 4L57A 1ZD5A 2FUCA 1Y8AA 2Q5EA 3HLTA 4F71A 4F72A 5ALIA 3L1VA 4UMVA 2FDRA 3OCVA 1Z4NA 3F9RA 2C4NA 4BEWA 5AVVA 3NANA 4BX3A 5AVUA 2PKEA 3FPBA 1Z5GA
chains in the Genus database with same CATH superfamily
3HDHA 2C0QA 4P4LA 4YRKA 2NUPB 4J6FA 1XTSA 4E21A 1NBHA 3OLVA 4Q4AB 1IPFA 3UKJA 3GLKA 1I4DD 1PT9A 2H1CA 4N3CA 5CLHA 3ZDBA 3EBLA 1G98A 3LWDA 4HH0A 4NEGA 2W7TA 3EWAA 1AX9A 3CTPA 4MIEA 1ORHA 3ZWAA 5FULA 5ALTA 1RRGA 3HU3A 4DG9A 1CE8A 1E9FA 1RMTA 1ZH8A 3NKFA 3SP1A 2FPIB 4DIBA 3EQ2A 2P6RA 2FZVA 5EMHA 3HR8A 4Z4CA 4G01B 2QXTA 3C74A 5TPWA 4X54A 2O0MA 4O2BF 5T3UA 4FB4A 1Z18A 2CJXA 4BAGA 4ZEXA 3PGXA 1L9XA 1FUKA 1Z73A 4XH9B 1GGKA 2PRYA 1O4WA 1Y8QA 3V4VB 5T3YA 4BQRA 5LSAA 5D3MA 5A4MS 3GA0A 2B1RA 3NBKA 2BM1A 5D8DA 4JS0A 1Q16A 3KHUA 2C7VA 4LCBA 3UIEA 4LY3A 5KNDH 1BROA 2UYYA 1RHKA 3OZSA 4CM8A 1FP4B 4I1VA 3L4KA 1K9SA 3LUFA 5HSGA 1N0WA 1V4NA 3W5UA 3SICE 2V74B 2EP5A 5JFOA 1XNRB 2HT1A 1G42A 5CH8A 4O0MA 2Z6VA 4WMLA 1XROA 2AF4C 3K6JA 4H7JA 3V4RA 3GLFE 3V1MA 3L8ZA 4TS9A 3M6VA 4HZGA 2DHQA 1W76A 2Q9CA 3KQNA 1CZKA 1II9A 2H4WA 3LSYA 3VQTA 1XJCA 2QE6A 1AKNA 1EYZA 5BVHB 5J63A 5BMVA 3LKVA 1WULS 3UUFA 4D4KA 2XB8A 3VHXA 4DMGA 2VNKA 5CW1A 5JDIA 5LMNB 4KRFA 3VHQA 1ZRNA 2PKCA 1NQTA 3QUBA 4MRMB 4V39A 2G28A 1F60A 3NT2A 3MLEA 2WYWA 2P27A 1MRNA 4W1QA 4X60A 5AI9A 1CULC 2R7KA 3ZE9A 3TVDA 2PQ6A 4BX0A 3U16A 3U1BA 1FRZA 4ZTBA 1YBMA 4V3CA 1NP3A 3A2NA 1ZIPA 3Q7RA 4KJZA 4E2WA 5AVZA 2VH1A 5KJCA 3FAKA 1KOJA 2P9YA 2ZITA 3FZNA 5TNXA 2BJWA 1P4SA 1XP8A 3KLNA 4DLUA 4RQAA 2R5WA 2R6R1 4MUIA 1PJBA 2XA1A 4Z7OB 3IUNA 2A7QA 1E7WA 3SHVA 6NULA 1AB5A 2L42A 2AI3A 1WX1A 4CL3A 4EECA 4BLWA 2CC2A 3K1AA 3H9QA 1VLVA 3V8PA 5LDGA 3V1TC 3QX8A 4K2HA 1XEFA 3K72B 1G6HA 3FCSB 3EY4A 4B3HA 1E7QA 3ZOZA 1H3NA 1K5GA 1T3TA 1IM2A 1INLA 2CXRA 4QNNA 5TPZD 1FCJA 5EWLB 2HEGA 1FFEA 2J09A 3LPMA 2V96A 1Z8HA 1ONPA 2NN3C 3KM0A 1YR8A 1QK5A 5FOXA 5G41A 1XZGA 3P2IA 4RPCA 4A8JA 5KYYA 2EX0A 2I4MA 3JZDA 4LV8B 5AKEA 5DTIA 5I3ZA 3MRTA 4B0OA 1CQJA 1QH8A 4D9CA 4LJKA 2LZ0A 2JS7A 1G0NA 4Q1EA 3B1XA 3PC8A 2AFVA 2YVKA 4FFVA 4J2OA 4C2TA 5ALLA 1KZYC 3DE4X 2VZLA 4JSTA 2CEKA 2QN9A 3A6JA 3P2OA 1RQ2A 1EWTA 4I19A 4L02A 3ROZA 1BXKA 4JI3B 4PTLA 4S35A 3U40A 3AM5A 1M66A 2P8JA 1P0PA 1P2UA 1SKQA 1TF5A 1MZVA 2XRFA 3EISA 2IEIA 1HPLA 2A84A 3GFSA 2JCSA 2QWXA 2C4KA 4B9AA 1UBMS 2FI1A 3HNPA 2AIRA 1Z6YA 2QVBA 4BLPA 4ZCMA 2PE5A 1KK3A 1M5RA 1T2FA 2EEZA 3DTVD 5DFAA 5C1DA 1YBAA 4E33A 2QM0A 3FGPA 1XZJA 4MPRA 4HYEA 4HQFA 4RV5A 4BJHB 1YR1A 2X19A 1RRMA 2ORYA 3D6MA 2QTCA 4L28A 3MMSA 4NKRA 4WXPA 3ZHYA 4DR3B 2CHVA 1GAXA 3QEOA 1P7ZA 5H81A 2XXJA 4G85A 4WVFA 1SOAA 2FR0A 4R2HA 3TJMA 5JFTA 1JU9A 4IKPA 4LZJA 4GXTA 3S1LA 2XAUA 1S0UA 3GEGA 5BUZA 1WCXA 1S2IA 1X87A 1QOZA 3K7EA 5JS1A 5IU6A 3LIPA 2GN9A 4QRDA 2HCFA 2PX2A 2UYOA 3GWGA 3UC5A 1RI3A 2ACKA 2YWJA 2PRKA 3ENZA 1A97A 1SURA 3QI7A 1WV0A 4LMBA 1VBKA 1U5BB 3NP7A 3QTTA 2ZRQA 4GR5A 2HBYA 2W5UA 4G8BA 3TDKA 4Z53A 2R8ZA 5IVKA 4HBZA 1AZTA 4M60A 1JZQA 4Q1BA 5JDCC 1RPZA 1PIWA 1DIHA 4W5QA 3WMWA 2X6TA 5DCLA 1QLWA 1DT5A 2H5IA 2V6GA 2HA2A 2OV1A 3BZBA 1B0UA 4JUFA 1GARA 4ZT6A 2OXIA 4C0HA 1NJ6A 4YUZA 1PNOA 4G8DA 2YXLA 3FHCB 2DZDA 3MBIA 3J81k 1ZD4A 4K6GA 3A1SA 2N46A 2B3DA 4UREA 1GOTA 1JS1X 4JJ6A 3FSJX 4DLVA 4C05A 3HEMA 5AM5A 3DE5X 4FX5A 1Y1LA 2FMHA 2PX4A 2A0WA 2SNIE 2V7QA 3PXXA 4XCXA 4AXBA 1O7JA 1C2TA 2IGBA 5JT1A 2IYXA 5LP6A 3TZLA 5HZGA 3VAZA 2UZ1B 2EV9A 4MWZA 3KV3O 2G83A 4EA8A 3AY0A 1JGTA 1HFEL 4UARA 2ZROA 1PW5A 1K4YA 1C0EA 1YKSA 1Z35A 3LXRA 1KC3A 4JJFA 5H83A 6REQB 1XDGA 2G7MC 2FSGA 2IBTA 1FSGA 1N2OA 1FLVA 2GEKA 2JGRA 1GV1A 1A9SA 4UUMA 1VKOA 2XNDA 1X42A 5JRDS 1R00A 5JVDA 3UZUA 1GRRA 2APJA 1Y7PA 3ZWOA 4AT1A 1XCPA 3CPSA 5F21A 1E99A 3L07A 4U00A 1X7DA 1TZJA 2ZYRA 4RZUA 3O8CA 2VPXA 3BULA 1DBWA 1QK3A 1E66A 4B79A 5BQXA 2Q0SA 1VP3A 2H6EA 4AIIA 5GV7A 5IXSA 2FY8A 5LKAA 3F3SA 1FTNA 2GZRA 4YJ2B 3K70B 3G9QA 1QG0A 3OJ0A 5B2EA 4ONEA 5K51A 2XNHA 2AI1A 2XYGA 1RJEA 2GILA 2BMFA 3F7OA 4JBLA 1AKWA 3TZHA 3W90A 1XZBA 3DQQA 4RHEA 2XF2A 1FZTA 4QPCA 1TD9A 2D13A 1GNLA 2DCUA 1AC5A 1U80A 1Q19A 2AEMA 2P1DA 2RHLA 3JTMA 3KYDA 1T6XA 1VA5A 3A8TA 3SF8B 3B8HA 5K0BA 2O8CB 3F98A 3LXUX 2HJSA 2FETA 1RQXA 3PHIA 4B31A 5LXTA 3MJSA 1K4MA 4G0PA 4EAAA 1O97C 2EATA 1U11A 3ITEA 1AK9A 1B6RA 1S2MA 3AV3A 1JG1A 1KQNA 1GL6A 5BQPA 4MRAA 3EIOA 5DHSA 4MW5A 1U1IA 2MYUA 4EI8A 5CITA 5EQDA 1Z4IA 5EWMB 2ZKIA 4UTXA 3JYQA 5DXJA 3A6EA 3A3KA 4P31A 3LPDA 4LF4B 4OKSA 2BDTA 1FIUA 4RJIA 1YVUA 4EHAA 1FJXA 4AY5A 5BQ3A 1XMQB 1US8B 3DXXA 3HWRA 2CCKA 2ZREA 3LOUA 5EHNA 5KSPA 3TXYA 1RZUA 3R3JA 1QHXA 2B8JA 1WZCA 2GJ4A 3JYLA 5HBGA 5KWEA 2I91A 3R9XA 3PD1A 3MERA 4LXQA 5FEUA 2PUAA 4CNQA 2WIJA 2ONJA 2UAGA 3PJDA 4C3VA 3D5TA 3TSAA 1EG2A 3BE6A 2VS1A 5MDHA 4QQFA 2QBYA 4L8FA 1ADJA 2F3RA 2NXEA 1E3WA 3GUYA 1LLQA 3HO6A 3SIWA 1RKQA 2A14A 4OYHA 1Y6ZA 4MI6A 4UHJA 3T3EA 1Z74A 3JQGA 4KPFC 3VZQA 4B73A 2IBSA 1WHTA 3SXJA 2C7QA 4YRRA 2AC4A 2V7BA 1XA3A 4P3PA 1CF2O 1XQWA 4ZRMA 4ZHQF 1DKMA 2FW6A 2FPLA 3EFHA 4XYEA 1DTEA 1KBZA 2P2NA 1RYBA 1WXDA 3HL4A 3RS0A 1MX5A 1TGYA 3GLFA 3H5TA 2IYUA 2ATIA 4BUCA 3GEDA 3Q85A 4QULA 3EIFA 2QX9A 4XPIA 1KO1A 3GPBA 5C35A 3SX0A 3VR1A 1NLYA 4PAGA 3UICA 2C54A 3RVJA 1LZLA 4NE7A 3B3JA 2GJ9A 1YB6A 2NV6A 4DCGA 1ZITA 2XB4A 4PBTA 2MINA 3AG6A 1V7CA 4BWYA 1YQDA 3DAFA 4FDUA 5G0VA 2W58A 1VGVA 2J5QA 2R00A 1YK1A 4QDKA 1KY5A 4EA6A 4EW2A 1EB9A 1C1DB 2QJFA 3AVOA 2JATA 3MTAA 1DC6A 3MOIA 4RXMA 4URUR 2F62A 2IU6A 3P9SA 1IHOA 3UWOA 3QBTA 4UQLA 1K8XB 1QH1A 3T34A 3C8UA 2FZEA 3NXKA 4ZYZA 5MFPA 1ZM2A 4JYBA 3PEVA 1X7HA 3C3CA 4HJRA 4OHXA 1GV0A 4W6QA 5ECDA 4BJ5A 1WO8A 3UT5B 4C6RA 4L5IA 1SFRA 4J0GA 4RLFA 1OIVA 2X0DA 1T1GA 1NBMA 3DZFA 1JKJB 4RHFA 1PL0A 1CFJA 3FUCA 3GIDA 4FSHA 1LSJA 5J5AA 3NOOA 1K0FA 2Q1TA 1JHVA 2AYZA 2ODWA 4J0DA 1O94D 1QRRA 2I8AA 5DMXA 5JY1A 2B94A 5GADl 2GBLA 3ZTWA 4OH7A 4HGPA 2XZTA 4X24A 3DVAB 1PZEA 5AJVB 4ZVPA 5IT4A 4ALJA 4YAUA 2A0UA 1G6Q1 2WHRA 4FCTA 4GPIB 4JI6B 3N2NA 2IVZA 1YSCA 1L0BA 3GUVA 4G41A 1KO5A 2C9YA 2QNBA 2UVDA 3MBKA 4PQFA 5CT6A 2VXOA 4LOLA 3UHFA 1T34A 4MHSA 3BGOS 2NYRA 2SCUA 2YWGA 2QENA 2LCFA 3MW8A 4P0TA 3RCBA 4HQNA 5K3OA 2P6UA 1A9XB 2WLTA 1DCFA 1ZUNB 2CDCA 3Q3JB 1GSAA 1ST3A 3A1FA 1P17A 3ANNA 4YCAA 2C8LA 4UXHA 3VHLB 3WJ7A 2WHEA 4N41A 4HL6A 3K09C 4BPBA 5E1OA 4JQSA 3FDXA 4Z9BA 1Y1SA 1DG9A 3ZI0A 1AK2A 3TSCA 4DQKA 5IF9A 3QFRA 1RXCA 5JWRA 3QYPA 1ML3A 1A7JA 1BJTA 1SCDA 5JCOA 1QYWA 3IIMA 5LDHA 4BKMA 1HZZC 3BJEA 2ZUBA 4V03A 2B7LA 2OUIA 5CDUA 1WV1A 2I0FA 3DBHA 1YZGA 2RCNA 3EIQA 4QGFA 1Q1ZA 5E9JA 4CQMD 1P1KA 1D2MA 3BIOA 4H27A 4KWIA 4UU0A 3FVRA 3UYLA 2O19A 1YACA 5H70A 1Z0KA 3WHIA 5MN6A 4IIYA 1C9DB 3W5BA 5CXUA 3KR2A 3CLUD 2YJZA 3DBLB 3VOSA 1W30A 3N75A 4JGBA 3ORHA 3LT0A 3SHFA 3RD5A 3IQFA 3S8YA 3TYXA 3HJBA 4PC3A 3SDBA 2QRQA 2VOJA 3AESB 4QWMA 4EATA 3M4ZA 3SX2A 4HP8A 3O2QB 3JS5A 1JQLB 4Q1VA 4TWRA 3KZOA 2CUTA 2HXSA 3VAAA 5DBIA 3ZDZB 2P9CA 3AEQB 5T4BA 4PLZA 2E4YA 3PYMA 4O1HA 4EWLA 2QGNA 1KL7A 1OLOA 1QFXA 1Q91A 2YV4A 2ZWPA 1W2WB 1DCMA 2UV8A 3H16A 2N47A 2QL5A 3PQDA 3P4XA 2R48A 4DJFC 3A14A 4FHDA 3LWNA 1KO8A 1KI2A 5JO9A 2HSDA 5LCXA 3OEYA 3KOZA 3HI4A 1QE3A 1UPXA 2OBXA 3QU4A 3QEJA 4XDZA 2OA0A 5HQ3B 4LQ4A 1JG7A 3VKWA 5KKNB 3C6MA 4YJKA 2VP4A 4B46A 2VL7A 3OWHA 3KL2A 2RGXA 4XD7A 2JA2A 3VR3A 5HM6A 2IU4A 3RHFA 2HTFA 1E5LA 3D6VA 2O2YA 4KLZA 4B2PA 3CC8A 3B6MA 1U0OC 5CB4F 2HDOA 3FYHA 1I0IA 3V42A 1C7JA 1G60A 2R9VA 3VUEA 3O2JA 4YJ3F 3DS8A 3EEQA 3IT0A 2CDRA 4H2DA 3UT5A 2COKA 3ORSA 3RU9A 4OFWA 3T61A 2GR9A 3BD8A 5LUAA 4Y6LA 1U0SY 2DSTA 1ZBQA 3F6PA 2J3QA 1JIXA 1EDOA 1T6YA 4ASUD 2J59A 3GLGE 3I0ZA 1EFCA 5LZ7A 2VZ9A 4TYNA 3A6GA 3P2YA 1QG6A 1Y4AE 3GNSA 2DKOA 2JBHA 4HXEB 4FJ1A 4X63A 3T5MA 4CM8B 2JJ1A 1JHQA 3NFYA 2GFIA 1TCCA 3QVKA 1BX3A 1O6ZA 3GK3A 2NZVG 4H17A 4HLUC 3TFWA 4CF5A 5AUNB 2RE8A 3CZMA 3H9GA 1P2BA 4I55B 3VVBA 5F3WB 4Q1DA 1KDZA 5B53A 1MGOA 1M2FA 1V71A 1ZS9A 3DO8A 2FP3A 2PRJA 4WOCA 3AESA 3QI2A 5G40A 2H2HA 3TSZA 2J0VA 3LF2A 1YOVA 2H4ZA 4J76A 4MS3B 4AM8A 1WU8A 3HUTA 3PR2B 1CDDA 3PXGA 1ENOA 4BEWA 3EC2A 3PC6A 4HFJA 2J3EA 3Q12A 3D4OA 3LBFA 5FWDA 5C8YF 1H0KA 2QN7A 3OE5A 5A9SA 4NCBA 1R4MB 4G0YA 4XYGA 4GFDA 2GKGA 4U5XA 3SF8A 4K46A 2FX3A 4QTXA 5B37A 3PDJA 4GRIA 5EHGA 2E1PA 4ZI5A 2D0IA 4MKFA 5F9MA 3K9QO 3UGJA 3K96A 4BMYA 4DV2B 2CK3A 1F8UA 1H5NA 5KX5B 4BNUA 3IIIA 3KWLA 3NBXX 2YTZA 3E35A 2Q3CA 5ALKA 1WB9A 3OFKA 1H0RA 4CFYA 2QR3A 2VCYA 2X8LA 5EE9A 2E49A 4PRKA 2ZTSA 1C9NA 1EXMA 2BLNA 1LGYA 1T1RA 3FWNA 3HKDA 2VZ8A 2CLOB 3O3OB 1W59A 3EULA 1CUDA 2ZSAA 4ER5A 1GR0A 2OHIA 3JARB 1CR0A 1JEAA 2DKFA 1SOWA 3Q9UA 1XCGB 4ZCLA 1QVVA 1T35A 2X3UA 2ZANA 3PQEA 1ODSA 3PNBA 4HO1X 3CZRA 1YZKA 1YASA 1ZD9A 1SR8A 1YZQA 5KVVA 3RBVA 4FN4A 4FYJA 5F73A 3IBSA 2B2NA 2NPFA 3VZSA 1WNFA 1Z88A 4I1SA 4MUMA 2FEOA 4JI7B 3AVVA 2ZDQA 3PICA 1R6XA 1N1MA 4FFMA 1N6KA 4P34A 5I47A 4K6CA 3EBOA 3EH2A 3DL2A 4NP6A 5DDIP 5FPSA 2DT5A 2FP4B 4FHGA 2CJFA 3C1UA 1CP2A 1U02A 4QO7A 4WCFB 2LR0A 4NIMA 1P91A 4B4KA 2QL7A 3O7MA 3U48A 2PKWA 2NVOA 2GEUA 2PD4A 2G82A 3FMIA 3L6CA 4TSKA 1N5IA 1SBQA 3PFGA 2ECPA 5T8KA 4X6LA 4RLHA 4Y2GA 3AH8A 4IHAA 3T4EA 1H2YA 4JJKA 1PVDA 2LKDA 2BV3A 2VF4X 2VOEA 5FHRA 5CLQA 4YRSA 1T2AA 4L8GA 5HCNA 3WC4A 2G36A 4GPEA 1U6JA 4JI1B 3EW9A 5M29A 2WWRA 3DDHA 2H1HA 2GPWA 2JFQA 2VHZA 3IP7A 3L43A 4GP9A 4AW9A 5ED4A 1QVZA 4I50F 4FYWA 3L41A 2GCOA 2HA3A 3R0QA 2Q5OA 5C32A 3AINA 4MPTA 4KRYA 3KYCB 1LJ8A 3THYA 3H1AA 2IZ1A 4JC4A 5LQDA 1C3EA 3EB9A 1N5KA 3NIGB 1EGMB 4OLFA 4EB8A 3MF4A 4FFOA 3TPZA 3FZGA 5I45A 3P71T 3BFJA 2ZSKA 1N57A 3ZHVA 1O9GA 1YC2A 4KODA 4XDHA 3WNZA 1VKRA 5DI3A 4IKOA 4UU1A 4BNKA 1JFFB 1RIIA 3A70A 1N0UA 3DW3X 5BT9A 3MFQA 3NCTA 3ITNA 3REOA 1UIRA 3GBVA 3JAWA 2QORA 4YRQA 2IEZA 4DG5A 2CNLA 2HMVA 3SFVA 1J8FA 3DYBA 5J47A 4BAZA 4OIMA 3MZ0A 1WMDA 1LF0A 2EG9A 4G5YA 1RI2A 1I1QB 2QJTA 2NYVA 3DZDA 3GRVA 5A7GA 1G8SA 4DUPA 3ENWA 2RHJA 4EF4A 2XZOA 1FSZA 4CIXA 3HBAA 2YJNA 3I5AA 3T15A 4HB3A 1QVAA 4KB5A 2VPWA 1YHZA 2ZETA 5IX8A 5JAIA 2FQ1A 1ESNA 1IUOA 2HXGA 2P7HA 2R5NA 2YV1A 4H1VA 5AKJA 3S55A 4RTMA 4EI7A 2NO6A 1K89A 2CJWA 2VT6A 1ULHA 2LXNA 1GTVA 1N8TA 5EXXA 1L1QA 3IUMA 2HA4A 1UOPA 1XKXA 4I8IA 1VYUA 4BEJA 4ZOBA 4BHTA 4CIDA 1B0AA 2I3BA 2PCJA 3LIIA 1TZKA 2BZSA 1VJ0A 2IHYA 1TMYA 5CFRA 4G84A 5T4FA 2MJLA 1L8XA 2B5OA 2IHKA 4GBED 2PG3A 3GEEA 4IIJA 3K6SA 1HDIA 2NUPA 2L0XA 3C6KA 2RGNC 4UDYX 4E5MA 4C6TA 1J5EB 1MW8X 3HY3A 4BLTA 1MX9A 3JVVA 2IDZA 2QTMA 1GQ2A 2HAEA 1RJDA 1VLLA 4CLRB 2PZEA 5TQ0B 4K28A 3G9TA 1GA6A 2HPVA 1SM4A 2PNFA 4HSEA 4NMHA 2Y66A 4Q9NA 4D4HA 1H2EA 1VL0A 2CLHB 3IQHX 2X4IA 3CNQS 2F4NA 4HGNA 5KU7A 4BDTA 3GJTA 1E0JA 1U0FA 2JFPA 1E61A 2ALJA 4Q7QA 3RYCB 3K9FC 1L3BA 1M8JA 3F96A 1Q17A 4M76B 5KWIA 2X4LA 4RA6A 5KCMA 4DM7A 1C30A 3AVTA 1XTTA 4S24A 2ZBEA 3UG6A 4BNJA 2AXPA 5JJKA 1W1WA 5CURA 4OO3A 1NM5C 1DHRA 2E9SA 3E82A 4GQIA 1MFZA 4H9GA 4KE7A 4EG8A 3YASA 2O20A 3OJOA 1VDZA 3OKFA 3VVMA 4RK4A 1XVIA 3S2SA 2BKAA 5KTTA 3S6JA 3V7UA 3ZR4B 4Q3BA 4IS2A 5BNZA 1V96A 3COSA 1PYDA 4WZAB 2FDCA 1W4BA 3JQFC 3U49A 5EHXA 2P2YA 1V6CA 2PFGA 2WKPA 1MA3A 3FSRA 2HLDA 2IUFA 3ONEA 1G59A 1VE7A 4YMIA 3LO5A 5KOJA 4TSFA 2AFHB 1N6HA 1OH7A 3KZNA 5LQRA 3ZLTA 4TT8A 3RJ5A 5JD4A 4XR4A 1ZD2P 1VGRA 2J0QA 4EKYA 4XI9A 3TJZA 3X1DA 4LYHA 3GD7A 1R0ZA 2H2WA 2W6ID 3HBLA 5IWCA 5KX5F 5T6MA 4DRYA 3KOUA 5LXTF 4GG1A 2ZI9A 1I7LA 2I66A 2PQMA 2V03A 5CEJA 2DT8A 3FFWA 2V0NA 1Z22A 3MUEA 2YY5A 1EFAA 1QPGA 1WDWB 4KYUA 3ZXYA 1A5ZA 4YI5A 1EFRD 1KPIA 2JJYA 4KR9A 5LYJB 3I5XA 4IH4A 2C4WA 3QITA 3K9HA 2IP1A 4FZVA 4UNNA 3T1OA 3U4AA 2WLSA 1RCTE 2A5GA 2FZ5A 3KJIA 3FCCA 3KKPA 3G1UA 3BD9A 4Y1RA 5AK3A 3KJXA 5TV2A 1OWOA 3U9SA 3W8EA 4UXIA 2FSVC 1T9DA 1LLFA 1NUSA 3P45A 4LZAA 1U99A 2WJVA 3AYXB 3SMQA 2ZQ5A 3LBYA 1QAOA 3EF3A 4PIVA 3LNCA 5JOQA 4RS4A 2IPLA 3K0FA 4KAXA 3BMOA 3WYCA 3NV9A 4GZMA 1W36D 1W6RA 5F3RA 3B6JA 3BWXA 1JA0A 3FHLA 4MV3A 1VZ3A 3E58A 2P6OA 5CGZA 3SQOA 1QK4A 3AETB 3SZUA 4D74A 2JEOA 4KX3A 2Q2VA 5ITZB 1YIOA 1H6DA 1UBGA 2AH5A 3GEHA 4PBSA 4Z51A 2HHLA 1IOWA 5JROA 4NK5A 1WUHS 2WIFA 5F9FA 3GJ7A 1J20A 5D84A 3QP9A 4RPGA 3BPSA 5FOSA 5BWLA 1LPMA 2B6NA 2CF6A 4HDRB 5EL0A 5B55A 3QKRA 1TA0A 4WXEA 4PHCA 1VCHA 2IYPA 2ZSUA 4M7OA 3TM5A 1BMFD 1KVUA 1O9BA 1XK6A 3AWDA 4J6EA 4XSHA 1H6AA 1TLFA 1U9CA 4ZTZB 1TDJA 2Z4RA 3EVFA 2EZ4A 3K8ZA 3VYUB 4YY3B 4Q9HA 3VOTA 1NNEA 2UYQA 4MLDA 4IJ6A 4O5OA 4ZJYA 2LUOA 3A6ZA 4GVPA 5LZ8A 2JAHA 3LDUA 4ALNA 3L8GA 3TMYA 1Y1PA 2O7RA 5IT5A 3GA5A 3GH1A 1H1LA 4LN1A 1HE5A 4DG8A 2QOEA 1V8FA 4L4RA 4C0QC 1GEEA 1A5AB 4DMUB 5C5IA 2F64A 4WFIA 1YBHA 3EPHA 2G5CA 4ITVA 1IAQA 1DP4A 3TRFA 3AQ4A 4KQXA 1RQGA 2DQSA 4WKPA 5CH5A 2VPPA 1PNQA 4PQEA 2FSHA 4KVFA 4RUKA 3JVUA 1LEHA 4N65A 5CU7A 2C98A 3LYLA 3W5VA 4MUAA 1CR1A 4YLYA 5K05A 2HWXA 5FI3A 2X0FA 1FFYA 1N3BA 2WV7A 2RB5A 2X7JA 4LWQA 4IEEA 5FA5A 4A8TA 2FLWA 2WC1A 4C4XA 3K0AB 1V7QA 1AGXA 3DXFA 3K0FB 3QU2A 4JN6B 4LC1A 4Y6PA 3O9VA 5A7FA 3OT1B 3SNKA 3IPAA 2IFTA 3VTZA 2I3AA 3G2JA 1C3LA 2C2WA 2CNKA 4XVQA 4EG6A 5AVJA 3D9QX 2MIIA 4POAA 4EFNA 3PITA 4J2HA 1CEQA 3T3OA 3SM9A 3NHZA 1IXRC 3VPHA 2CFIA 4KSYA 1P3Y1 3HJGA 2JVKA 2X8BA 5CNKA 4NULA 5HFAA 1XQ6A 4C04A 5IAAA 1KPGA 4O02B 4RD6A 4RK1A 2A1UB 1EGAA 4ZQFA 2QRPA 4QPZA 4P5EA 3G0OA 3I9OA 2AQIA 3OCJA 4LV6A 1RXEA 4WX2B 1YS7A 3MSCA 3A6DA 4FFDA 5IYZA 2HLNA 1DGQA 1HNXB 1XLTC 3K2EA 3DWFA 1Z28A 1ZIOA 4OX9B 1H1TA 2B35A 3H2IA 2CXPA 4FHEA 4AVYA 4JVOA 2ASVA 2A4MA 5BSKA 1ZR2A 5IJAA 4WH0A 3VO1A 2J7KA 2Q5FA 4DIEA 2C42A 4RZXA 2ERXA 1GQSA 3N3BC 3D1JA 5FUMA 3K8QA 4K88A 1C7RA 2PLWA 5G53C 3SS7X 3WJ2A 1CB7A 2BFDA 3PFBA 2WKSA 3PPVA 1PTJC 3EF0A 4YQEA 5J3JA 2WJGA 3GU3A 3SEFA 5ITZA 2Q7DA 5H1YA 5JQWA 4GGOA 1S9DA 4ML3A 4XGKA 3LWZA 2YS7A 5EIFA 4YRDA 5A4FS 1GFIA 1SKUA 4QYWA 3NBMA 3KXDA 1PU2A 2C1XA 1NL3A 4BNVA 3EHEA 3T0GA 2WZQA 3WP1B 4BMVA 1QQTA 3BXPA 3DL4A 4I6EA 3CSUA 3L04A 1KZ6A 4KBFA 4MMZB 4Q02A 3O8DA 1TEHA 3H8SA 2IZ0A 3R7AA 3OMLA 1RHMA 3AT1A 3T99A 4S2UA 1E1YA 3QXGA 1A7KA 2FTKE 3OT4A 2C2OA 2FEAA 2X6QA 3DLPX 3KC2A 4RWZA 5EC8A 4DIFA 4JP5A 1M73E 1SWVA 3CH7A 4LEIA 4RIFA 2CXUA 3BD6A 3FOCA 4XW2A 3OQHA 2QRLA 5A3RA 1A9XA 3FWZA 4GNKA 5D87A 1GTJ1 4ND3A 1D4FA 1D2AA 3RM3A 3UO8B 2QRNA 2RSLA 2KYRA 2GN4A 1U4SA 3N76A 3IURA 5EJ9A 3AW9A 3QG5A 1BWPA 3CURA 4GECA 4DCCA 4OFXA 3AJRA 4CM5A 5BORA 3ZY3A 1J8QA 4KCGA 4HMQA 2EKDA 4TMFA 1KQ3A 2H16A 3CRNA 5EIEA 2PV7A 1Y42X 2BW0A 4RVDA 3MWFA 2Y93A 2YH2A 1SC3A 4WZBE 3OOEA 1I7QB 1DFGA 1UMDA 1VXRA 2QB5A 4TV8B 1UC9A 2KE5A 4QFCA 4W5WA 2F1RA 2BTOA 2ZBPA 2GD6A 5DOVA 5EJFA 2ZUTA 2CMGA 4TMZA 5A5VA 1D1SA 2XUAA 1E1LA 3IIKA 2C4HA 3BD7A 3EIXA 4F6CA 5JNSA 3LE8A 4KAJA 4BGDA 2XHZA 1G41A 1GVHA 5D1HA 1RPTA 3IPXA 3OD1A 3WQQA 3KTFA 3ROEA 2W6QA 4MPJA 2VHVA 3WGNA 1CRLA 2BF4A 4RGBA 5EEGA 3GLGB 3L0PA 1JLRA 1A9YA 5CXQA 3VSAA 2NU7B 4B87A 4A1OA 3RTBA 3ON5A 3AYZB 3K9CA 4A0GA 2R4TA 4AJJA 1B16A 3ZGXA 4DA6A 2X7HA 4ARZA 1J22A 1NRJB 2IIQA 2NT3A 2DHRA 2OBYA 3PBKA 2D1TA 3OCXA 1X14A 1ZRMA 2OZVA 1YI0A 2ZUSA 1XZIA 4G5QA 4I3HA 1JKIA 4A8PA 4BB9A 4KUGA 3RSLA 1ZCBA 2QG6A 4DW8A 4ALKA 1ETHA 3D43A 2AN5A 1GNRA 2B8EA 1J1IA 2D0DA 2GVZC 3CKYA 3I1IA 2D2IA 3OQBA 4URYR 2A5YB 4V02A 1W9HA 3SZLA 3SZMA 1GZ6A 1LRLA 2WABA 1P61B 4C4RA 1KMMA 2Q4BA 2JAUA 3CPJB 3K30A 4QASA 4LI0A 2ZJ7A 4YGXB 5A6SA 4C7OA 5ISMA 1YMQA 1KMIY 2JC3A 3FW1A 2EFGA 1NJ1A 1N34B 5LPNA 2C9OA 3P97A 1J8MF 1UBSB 2O1SA 2OHHA 2YRWA 4M88A 5FWXA 5U9CA 4AZWA 4XGQA 2D6FA 4LDJA 3GPLA 1U9YA 3RK4A 1IEQA 3ODPA 4OU5A 4O5AA 4CFZA 1VLHA 1C1DA 4TTRA 4JVLA 3WNQA 4C01A 2GJ8A 2R2GA 3R3UA 1DIGA 3IOBA 3M6UA 1IQRA 2FPGA 3A9WA 3CWCA 3FETA 4JLOA 4RABA 5ERXA 5AYVA 1AF7A 2B5VA 3IP1A 3HLTA 3NYRA 4YP5A 3UA3A 1C0LA 1Z39A 3GJ0A 3RVMA 1I7NA 3L1VA 1PFYA 3PUVA 3AI3A 3F9RA 1I4EB 1OHHA 5IHXA 4FLFA 2P3LA 2ZBQA 1RSZA 2FAXA 5CG2A 5KC9A 3U44B 1P9RA 3T7SA 2W2TA 3PQ6A 3E8XA 1ZH4A 4I4TA 1Y1TA 2YYYA 1LVGA 2OY0A 2PAFA 4X8HA 3L2OB 2Z6QA 3UK2A 1MW9X 2ZU6A 4JXZA 1W0JA 4EMUA 1ORWA 2FW8A 2BR3A 2OM2A 2OO5A 4OUDB 1QO7A 5DF1A 3JD1A 4QU8A 4CBVA 3LVRE 2I80A 4MZXA 1E3SA 2NO1A 1QIEA 2BGRA 2QLFA 3D02A 1ICEA 1S89A 1NUPA 2ZIAA 3DMDA 3HR4A 3K0CC 4M1EA 4XGIA 1GN8A 2K7ZA 4BIMA 2F00A 3MWEB 1TOAA 5ALYA 2I03A 1ZK3A 3PXCX 5CYOA 4M37A 4CV2A 1T5HX 4FKMA 1JBKA 2P5SA 2V9PA 1CS0A 4CCSA 4LXYA 1ZKMA 5FLKA 3N2KB 1OY1A 3VKVA 3A6LA 4V38A 3HN2A 4DLPA 2PT5A 1CYDA 4QBFA 1WXWA 2C5BA 1IVYA 3LGXA 4OLHA 5EP3A 2D7CA 2O54A 2YRXA 5HX7A 5AWFC 4RD3A 1XO1A 1YJAA 2J67A 4AFNA 4MGKR 4MVJF 1KFJB 1RHJA 3KELA 3O47A 1QH8B 4N9WA 2Z58A 1HQKA 1E3MA 1DV1A 1O89A 3R4VA 2XBLA 3O8QA 1O95D 3PEUA 3WK7A 5KINB 3JVDA 3S3TA 3IJPA 3PFFA 5K5EA 2AG6A 3QNMA 1E6LA 2XT9A 4LBWA 2VTBB 1YBVA 3COPA 3USES 4DQDA 1C9YA 4JUBA 3LFTA 1I01A 4ERNA 1NVTA 2B83A 4MS4B 2N3ZA 3RTCA 3FSGA 5K3AA 3VU9B 4ND2A 1U2QA 2P6NA 3B78A 3ST7A 1U7DA 3GRUA 1G3QA 3GMDA 3OKPA 3EQ7A 4OMFG 3SS9X 4O59O 2GQ0A 3R09A 4M1MA 4Q21A 2GHTA 1VG8A 2GYUA 4K2AA 4B6GA 3SC2B 4C08A 1SBTA 1ZM9A 2R6AA 4OXXA 5E7JA 2OCDA 3KJZA 5FUWA 2L82A 3IOYA 3LLVA 3HDGA 4BFXA 3FMFA 1FFBA 1FYFA 3LX5A 5L8VA 3IDOA 3OCUA 4XOIA 1HY3A 1UXKA 3FYSA 3NEAA 2EHDA 3HJCA 4X7PA 2WWVD 3S1AB 3IKVA 3OZGA 1W75A 4QPJC 1GPYA 3BORA 1RXIA 3BQNB 4UDXX 2GUWA 4WNIA 5KJFA 5JC1A 3PEWA 2XDQB 1J9GA 2ZBRA 4DXHA 1OVGA 3AILA 3HFSA 1QHYA 4L15A 5EIBC 4BLQA 4QUDA 1OAOC 3F6YA 1JLKA 3HCDA 1KFKB 4V0OA 2WA1A 2WTAA 1N2XA 3KQQA 4DNFA 3P94A 3HB1A 3BRWA 1YRQA 2H2FA 4GXRA 2MR6A 2O5RA 2WSBA 3ZZUA 5F7ZA 2WAMA 3ZQJA 2AJ8A 3HG7A 3EASA 1V9LA 3GCWA 4HWRA 1DUVG 5LP6B 3V7YA 3ZGZA 3ADPA 4OHFA 3A1TA 5JYEA 5J1SB 3R3WA 5L3QA 3IH5A 2JB9A 5GV8A 1NF9A 4JNCA 1M0EA 3P2JA 5K0SA 4ZCTA 4JV5B 1DO2A 1NURA 1H4SA 2BSAA 1X1RA 2JFWA 2QN6A 4U2GA 3WIOA 3IAUA 3TI9A 3NORA 3R3XA 4LDQA 3A7DA 4Z4FA 2ANCA 3HHPA 1N77A 4HK4A 1U3FA 2ACWA 3BAFA 1HFKA 3QPVA 4MH0R 2JHFA 4DMHA 1E9DA 1I14A 5CT9A 1Y4ZA 3RNLA 3V7NA 2G9VA 2ZCJA 1QYXA 3P0RA 1L5ZA 1P77A 4MA0A 4P7KA 4WZZA 2GTPA 4HMOA 3Q9LA 2A1TR 4LTNA 4U2BA 5TMDA 4L5BA 5FNVA 1DEHA 2XVZA 3DBLA 2Q28A 2W43A 3X0DA 4I4CA 5A3VA 4BMNA 3D81A 2EZ8A 5DSZA 4ND7A 2QK4A 1CEYA 5ES4B 1D07A 3RC8A 1TU0A 4JQZA 3SJAA 1OBOA 5EXTA 5BN4B 4TYWA 2NNWB 2O7VA 4TS3A 1QIFA 1KEKA 3DOIA 4JHLA 1R16A 2JKZA 1F8XA 1ODJA 1FNCA 4NHEA 5CT8A 1O95C 4XM1A 1YZ3A 3ZE2B 1T4DA 3V1YA 4AYTA 4MRNA 4CMJA 3HU5A 4A10A 4X44A 1KYTA 1OYWA 4IZOA 3ECSA 3MGBA 4NWIA 3PF9A 4L74A 1PQWA 2OAQ1 3HCWA 4M36A 4Z7JA 5IDVA 1G8AA 1F8FA 1FE8A 5LLSA 2VSQA 2D5LA 4FW8A 4AY2A 2OV2A 3BA1A 2A8YA 3H2YA 4U02A 1MH1A 521PA 3JU3A 1S01A 1OIXA 2J4DA 5DN6D 2HK6A 3ANMA 4FT4A 5FD8A 1Y9ZA 1EMDA 1PLLA 2Q2OA 3KKLA 3LH5A 3M2TA 3NQ41 4IXWA 4WZBA 5DGIA 1RPAA 4J0CA 3H3XA 1A2QA 1E4YA 1SXJB 2XEXA 2C03A 1UZMA 3KJHA 4P7JA 4REQB 2QTFA 4QSHA 2OCXA 2YFHA 3RS4A 1GAQA 1HH4A 2ZIXB 4B7CA 1PYOA 4CM4A 2VWGA 2NZYA 3C3XA 5EMJA 3SGLA 3WWCA 1V11A 3GLUA 1SOVA 2VAPA 2AZDA 3ZPXA 3TLCA 3I45A 3WZMA 4JFAA 4Q3DA 3RFCA 2OCBA 1ZUNA 4CQNA 3HCEA 5KTYA 1THZA 3NATA 4MSUA 4FC6A 1LH0A 2A57A 4LVNA 4KO2S 4MV7A 3FGZA 4CM1A 3NC4A 3NH9A 5EMMA 3HJRA 2GZSA 5I8PA 1GKYA 2AVDA 5DMHA 3M34A 2YV2A 5L6MB 1M74A 2H06A 2WPDA 2EL7A 5JCOC 2WI8A 1RHUA 3CZCA 4GYWA 1HZZA 4JB3A 5LR6A 1FSPA 1BJRE 4XCQA 1E6CA 1ONBA 4NARA 2LKCA 3E81A 1J0DA 4L76A 5AM2A 3GP8A 4M49A 1UMKA 2A5LA 3JWPA 1EEXB 2GNAA 3MXTA 4TWJA 1JT2A 3DO5A 4DJAA 1J33A 4YT2A 5BVGB 3M89A 4FDMA 4B3BA 5L7WA 2I67A 3LFHA 3V4FA 3L0SA 2GCPA 3MQFA 4MPDA 4DWOA 1I5EA 1OH6A 5K6AA 3BMNA 3BKWA 4D8VA 1B1AA 3RV3A 3TIVA 4B44A 3GDHA 4CKWB 2W83A 1QX3A 3L49A 3TLMA 3BJZA 1JF8A 4YDQA 1VJTA 1N2GA 2A3NA 4AUNA 4DMRA 2JLYA 1PJ2A 3SEZA 4JI4B 4LF9B 2O3TA 6LDHA 3C5EA 3LCUA 2OD7A 4RMNA 2GGSA 1P2TA 1XXHB 5CA1A 5JAUA 1NTRA 2FFRA 2QN1A 5AHXA 4AJ2A 3CLTC 4OXRA 3R24A 1WABA 4TUYB 1XPJA 2BKEA 3U7QA 4EJ0A 3RIMA 4BASA 3WKDA 1X7ZA 4MEAA 4MJ3A 4BTLA 3AGQA 1F6BA 2H9AA 1NVGA 1GY8A 1U9ZA 3EG5A 4DS3A 3EXAA 4XYLA 5IH3A 2XRYA 4H4EA 4JD5A 1RS0A 1V6SA 4QZVA 3C45A 4NU0A 3OCWA 2FZ4A 4Q9DA 2MTBA 1LFDB 4MUBA 1JQAA 3B85A 2ZJAA 5CXXA 1PFQA 2MMCA 3BOSA 1QF7A 2CBXA 1EK6A 1XRNA 3A9UA 3N05A 3SYRA 2G5GX 1PSDA 3TTTA 4CN9A 1GFSA 1NDUA 1YDWA 3MM4A 4HGYA 3CTMA 3G2PA 1T0BA 3R0IA 2A3RA 4XDGA 2WAYA 4YUYA 4II2A 2VSNA 1ZRSA 1JILA 2GCIA 2X3FA 4J16C 2QN8A 4LNAA 1N8KA 1JHDA 1NA5A 2I2CA 2YVQA 2ZWAA 1LRKA 5CLGA 4BUJA 3WLAA 2O8EA 4L2IA 3KUXA 1ISFA 1YRHA 2CHEA 2VDMB 4IIGA 3UJNA 4ARIA 1WZEA 3R7LA 3OEWA 3VJRA 1Z37A 2GKSA 1NYTA 1FUEA 1DAOA 1ZC3A 3LHDA 1D4ZA 2LWIA 3C3BA 3N0XA 3WV5A 2QQFA 4A2QA 4NE2A 4L4SA 4HX9A 1V7ZA 2G0NA 2W11A 3M49A 4ZYVA 3DLHA 1TCUA 4JEMA 4K7JA 4RTQA 3HR7A 4DCSA 3EUEA 4KWTA 1OBHA 1SZDA 5JZSA 2BFPA 1CETA 1V8ZA 3EPLA 2HADA 1OE0A 3NGMA 2FUNB 3AUTA 4M0UA 8ADHA 3DLCA 1SQ0A 5I01A 1K5PA 1TUEA 2IPXA 3QBEA 3GP3A 4C22A 3LHKA 5F76A 1VL2A 4DT1A 3MUNA 4E46A 2PUVA 4DLYA 2H4HA 4GZ5A 3SM3A 1SVWA 1JYFA 1KI6B 5CVCA 5ALNA 3KSUA 1SVUA 2IOFK 3BH7A 2G63A 1ZMXA 1PR2A 4PZYA 1Z7EA 2VWQA 3S1SA 1CIVA 4JBIA 4BFTA 3TOCA 1RD4A 1HTTA 4FOTA 5ESXA 1WOYA 3ZLBA 4UOQA 2ZSBA 4D3YA 3WQHA 1FS4A 2EKQA 5FBVB 3LT1A 2REBA 4JYAB 2I33A 4TWIA 3RKSA 1FSSA 5J5VA 2HW8A 1H2HA 4PX3A 1K6IA 4OFBA 1WMBA 3C97A 1HTWA 4Q6BA 4RHCA 3KT3A 4RA9B 1I0LA 4HWGA 4Z0HO 1AT1A 3VJKA 2C77A 3EWIA 3MMZA 5FJJA 2GO7A 1G5RA 1PR1A 1KP2A 2IPAB 1P73A 3KB6A 4L4YA 3OLCX 5DVZA 4B8YA 4MVWA 4YRAA 1JVNA 2H2GA 3L4EA 3IX7A 1HE3A 1GTSA 2F8TA 1I94B 3B6EA 2DGDA 5C81A 4XIGS 5EINA 5BOVA 1YQXA 2LPMA 2YZMA 3ENQA 3HM2A 3O73A 3WSVA 6REQA 4MI3A 4HGQA 4PTYA 4UPEA 4PQGA 4ZVRA 3RUAA 3IAS6 2Z2IA 1VJGA 2PXHA 1KFEB 3GH3A 3N5CA 5BMVF 5IZ4A 1WPQA 4KXNA 3TD2A 2W2MA 3F1KA 1V6AA 2YVLA 1NN5A 2W9XA 4YFVA 1POXA 2JBAB 3M6WA 1H3EA 2QU7A 1LSSA 3T7RA 4OI0A 5JSQA 3WBJA 1R6UA 4F97A 4LGVA 2W93A 3TOZA 4PINA 3NBAA 4EA9A 2Q6TA 1DFHA 2J31A 3PNSA 4GWLA 3FMGA 2CLKB 4E1VA 5ICFA 1E5XA 2WF6A 1HDZA 2AWOA 2I1WA 2XQVA 3IUQA 1JDTA 1R15A 1DC3A 2H08A 3AJ8A 1N6NA 3ROGA 5IKXA 4F2DA 4QDOA 4GIBA 5FI0B 3C98A 1Q15A 2HUPA 1BO6A 3OQOA 4W63A 4JODA 3D8HA 3NX4A 3SIPA 1ZGZA 5CCXA 3A1EA 1PD0A 5E2BA 2IU0A 2HWWA 1TKAA 1JR4A 2GARA 1K7EB 3O2NA 3FNGA 1WUTA 2RGEA 4P4GA 4LJ6A 4K6FA 2Q5HA 5CVJA 1P7WA 4NCIA 1ZOSA 5DGTA 1VE6A 3LHIA 3MJDA 4L9AA 2OFXA 3TDNA 4AYXA 5JECA 5ALEA 1CHNA 1KHTA 1WOMA 2ZB2A 4F2WA 5D5PA 4MQEB 2G1AA 2OEPA 1DINA 4LXUA 1PK9A 4F46A 1C1XA 3KEGA 3L3BA 1SJ9A 5JATA 5KHOC 4YJ2F 1PD1A 4FE7A 3HACA 5AIAA 4WBNB 2Q6LA 3RANA 3T5GA 1J0BA 2RK4A 1M2GA 2ZR9A 4DABA 5JXHA 1JXMA 1RR6A 3NDJA 1Q1GA 3C48A 3PX7A 2HGZA 1Y33E 3MFYA 1JG6A 2R25B 3AL2A 3TMKA 5KNCD 1IHXA 1OXTA 2O8BA 2PKYX 2ZJ1A 2B7CA 1SBNE 4LC0A 3PS9A 3PHCA 4O4HB 3FPEA 3WGLA 4AO6A 4C1NA 3R3SA 4RD1A 3GX1A 4A4DA 3DZHA 1NMZA 5BW4A 5EJ7A 2YV3A 3A10A 4YRTA 5HMLA 5F98A 1JIQA 3QVXA 3R8FA 1OZ0A 1RCFA 4G8CA 2G9QA 4I99A 1RJ9A 2HD4A 4K8OA 5TGTA 4D82A 4DPMA 4ED9A 3EZXA 5CAEA 5IKMA 4QPPA 3IDFA 4D45A 2IOFA 4EA7A 2X42A 3AUKA 1OLUB 4BO0A 5TXGA 2ZTHA 4WCFA 3K9LA 1TMOA 2BBTA 2HZBA 3PRKE 1DOZA 3TNFA 2JIQA 3MLBA 1H2RS 1SXJE 3CQ9A 1XD9A 3HDJA 4KMSA 5FPPA 2WIDA 1PNTA 2OR3A 2IITA 3LGSA 3PHGA 4AJHA 3RG8A 4PFQA 2BEVA 4HDSB 1J97A 2PEYA 2QW0X 1YTLA 2X40A 1K6EA 3OIGA 3PI7A 3D3NA 3R1IA 1TVCA 2OLJA 3O3MB 4F72A 1NDQA 2VUUA 5C8XA 3PDCA 4D6PA 2QR5A 2FG7C 4J0IA 5E2IA 3W9UA 1PT8A 4TYYA 2PVCA 2QD2A 2QE7D 4MVJG 2SECE 5CIYA 4JENA 1CDZA 4C4AA 2G9RA 2Q3MA 3FOAA 1PGNA 1FMLA 5H02A 2ZPTX 3UK0A 2YXBA 2DBRA 3IHWA 4RZIA 1TTQB 1FB5A 2GEVA 2WEKA 3L5OA 3EGWA 3UWPA 1U1FA 2CVZA 3EAQA 4RDHA 3W7VA 2QSYA 2C3OA 3O8OB 2PL9A 2PK3A 4ZOLB 1YA8A 1XDWA 1L8AA 1WRBA 3TEMA 3SWWA 3H0CA 4BO3A 1QP4A 3QPAA 5BNFA 2BHNA 3QEBZ 4TS4A 3ZI4A 4AX4A 3HRIA 3NBQA 3WG9A 4J1TC 4NCAA 2FN3A 3I62A 4Z9FA 2XKKA 4J1NA 2CVPA 3LL7A 2ZQZA 3AOEA 3B7GA 2AOTB 5BPFA 3Q9SA 3HB5X 1F9EA 1CUUA 1PGPA 3G2HA 4N01A 221PA 4OUDA 1EK2A 2QVZX 2ZT6A 1JJBA 1OFHA 3C7CB 3P26A 4RD4A 4UMEA 3V46A 1ND6A 3TW8A 3ZHUA 2YHIA 3CLTD 3GEMA 4HVAA 3KVRA 4CTOA 1EWQA 2WHPA 4N6GA 1X8KA 1WNTA 1Z5PA 4ZMBA 2XNKA 3L7DA 2XWSA 3PFIA 2XBMA 3LCVB 4EPWA 4IVPA 2JGDB 4I7EA 1OZGA 2EGHA 4IMJB 3JALB 1SVKA 3T7AA 4UE6A 4EQ6B 3O31A 5E7IA 3CEAA 1VJ5A 3IAM1 2QQ0A 4EJSC 3M70A 3W6OA 3LTNC 3DEZA 4RMGA 3EXG1 1N78A 2RGBA 4OA8A 5JDIC 3L4JA 4YNBA 3UC9A 4JBGA 5SICE 5T5QA 1K7YA 4ZQHA 1QB8A 1KXZA 1Y1KE 3KPVA 4NBWA 3ZGLA 4WOJA 4D9KA 2FOIA 2QVGA 3IOEA 4KUEA 3OC6A 3EOZA 4DC9A 2VHXA 3AV0B 2PUGA 3NAZA 2I8CA 2IKQA 3CBGA 4EX6A 1H65A 4CTNA 1COWA 4U6NA 5C1OA 3FNRA 3O75A 4ZOQI 5CA1F 4C4OA 4NBTA 3B5EA 3WWZA 2BFCA 5COBA 2PZJA 3CF0A 2UU9B 3KAPA 1XJWA 2GBPA 4JL6A 2HLHA 1EBFA 4JASB 4KQJA 4LE1A 2ZCVA 4ZCQA 3ZY5A 5L4LA 2EGUA 4C2AA 3LU1A 3TCKA 4G0MA 4LKRA 4MKXA 5TX7A 3SR3A 4TRMA 2ZU0C 2BFMA 5JAQA 1K5HA 5CLLA 1LXCA 3PX3A 2OYCA 1ZIDA 3HRHA 2PX5A 1PJAA 1VHJA 4AX8A 1T9BA 3LUJA 2HBRA 5C7YA 4IIEA 4DDVA 3N0RA 1PZFA 1IDN1 2WU0A 5G4LA 1G5TA 3SC2A 3E1KA 1H66A 4RK5A 1KI6A 2HN9A 5A9TA 2WJZB 2QV7A 3H5LA 4GRAA 2C57A 4NLLA 4TTPA 4HNSA 3ILXA 4LWOA 1GG9A 3SK0A 2GDJA 3JSXA 1L4FA 1L6IA 3GRRA 5DLDA 2W2QA 1DTWA 1HL3A 5FOVA 1TJ5A 4ZVMA 5CEEA 4MYSA 4NOJA 3THRA 1E3IA 4ZJZA 2JCVA 1IJBA 3BRQA 5EIAA 5AW3A 1JDBC 2H4FA 3EGDA 2HKIA 3UOGA 4YAWA 5D2CA 1N0VC 4L7QA 1EIZA 3AGPA 4JAVC 5F7JA 3SSOA 2QRHA 4S0ZA 5JYDA 4QRIA 3VR4D 2P41A 1BHQ1 4E1BA 2UZ3A 2O0JA 4X64B 1SO8A 3BMQB 3WRWA 2TSYB 4Y6OA 2F3QA 4CMIA 4NBRA 1V8DA 1OBFO 4Q3CA 1N2CE 2CLLB 2VCEA 3SC6A 4YCCA 3IVAA 4NHOA 2VYND 2YICA 4PZAA 4E0BA 4TKVA 4UM9B 1AK1A 1AXEA 1T9GS 1D04A 1TK3A 4QNRA 4DVJA 4GNRA 3EPRA 4R1UA 4PU0A 5COAA 5LUBA 3SSAA 2OILA 1DDGA 5F5XA 1ILEA 3K9WA 1XP5A 4Y1EA 2XUOA 4IV8A 2JFHA 5LL6P 2B9EA 1Y4UA 1R4NA 1C7EA 1Z6TA 3ANYB 2Q1YA 3P0EA 3FVWA 1KR2A 5ECGC 1DQYA 2H5LA 3JR7A 3QPWA 3E9MA 3ZK9A 3TNYA 3QWBA 1IY2A 2MINB 3G6KA 3OE7A 4H7KA 4BNZA 1NW7A 4P98A 4PPYA 3JQRA 5KSWB 3P5SA 2FKNA 2YWBA 4RTKA 3I9LA 1YRBA 4RXUA 4D4JA 2R44A 2Y9PB 4U4AA 1Q7TA 5I7SA 5A71A 4ZRNA 2ZE7A 3WWEA 2J9XB 4KWCA 4UUBA 4AJNA 2VJAA 3FXAA 3O1JC 5DRTA 4PLGA 3V8QA 1KDPA 2BELA 4EG4A 3Q8MA 3SC4A 5DNWA 3K5HA 4A36A 4L5AA 5DM1A 4F2PA 5AJYA 5ALJA 1FVOA 2CGEA 2HREA 4GI1A 4RC9A 1TYEB 2DPYA 2EX4A 2R6FA 1G7RA 4D3FA 2MYNA 1PF7E 1WVMA 4RSHA 4I9FA 3OFJA 1C8KA 2OP1A 2Z2XA 1BXZA 1H9AA 1N92A 3OEHA 3U3XA 1U3DA 4UHEA 3UOWA 4A2PA 4ARVA 5KNLA 4JI8B 1CQWA 3ZJ4A 2Y0DA 1XWWA 4QJ3A 3ESBA 2VHTA 1TMGE 5M34A 4C88A 5EJ5A 4RVSA 3OPNA 2QEQA 3MCUA 1AKYA 4Y9SA 1U7HA 4JWKA 2BP7B 3MTDA 4OOFA 4DCMA 2G09A 1MDFA 4PHHA 4BCDA 2ZVJA 1NV8A 1FYVA 3V7WA 4KIJA 2YBEA 1MCZA 2O23A 3MTBA 2I4OA 4TPKA 4ZZ1A 1OX4A 4JROA 5BT8A 1M0TA 1U81A 1SBYA 1WB5A 5IXJA 2ZAOA 3O91A 4JBHA 2LP4Y 5IDYA 3CEJA 3GJYA 4KDFA 4MCIA 4C7OB 2I99A 1MAWA 1V3UA 1KJNA 3PFKA 2AKAB 5DTRA 4H35A 1JP7A 1NKVA 3FYTA 4FYHA 5E4FA 5E95A 5LMUB 2FNAA 4MWEA 4EHDA 2HY7A 2HL6A 5EN4A 2V1UA 2XMQA 1E3DA 2I9KA 1E89A 3BRCA 1TPZA 3BH0A 4F5YA 2H7CA 1FFGA 1D2HA 5KJEA 4M4SA 3RKUA 1HDEA 1FFDA 4CMIB 1S6YA 2QF7A 4RF3A 4FR0A 1CR6A 3DZ8A 4NFYA 2F8MA 4WY2A 2JI7A 3H2GA 3EZ9A 1RXUA 3FUUA 4AJIA 2NXNA 1VHTA 2IZOA 3ONVA 5B1IA 2BONA 5P8WA 3L05A 4JC5A 3TTVA 5A1TA 1TB4A 4DSTA 3WBBA 5K7SA 3RYFB 1MTZA 3OZBA 1QWOA 1U2GC 1ZUWA 1YJQA 1VSTA 3GPCA 4K9NA 4NVRA 1ZU4A 1PKEA 4DLTA 5A4IS 2H7YA 4MDEA 4GEKA 2C7OA 1O5TA 4PONA 2FMTA 1H5UA 5ICGA 4Y67A 2QVXX 1K06A 4D3ZA 5JD3A 2PS0A 4BX8A 1Q83A 2GTHA 3DBVO 1GUDA 1DBIA 5LYYA 1M2VB 4A5SA 1CRPA 4LYJA 1AS2A 1TM4E 2ANBA 2D5CA 4XASA 4AP6A 4K6KA 2OVBA 4MR8A 4C21A 5JAHA 3K8OE 3OG9A 5AI8A 5AKKA 5EWMA 3UH0A 3BB3A 3KWFA 3LP6A 1WSWA 1E9VA 2WT4A 3HVIA 1WCWA 5LP6C 3Q88A 5FYQA 5LOVF 4AMVA 2V7EA 5AW1A 2FFBA 5KWSA 1ZCJA 4RULA 1JVBA 1YIAA 2PIAA 3T5BA 1UF9A 3V4OA 4YIHA 4UM7A 2IS6A 1NMEA 1Y48E 3O8LA 4GOJA 3EGOA 2C92A 4UW9A 1F48A 3EJWA 5F23A 4DUYB 1RYDA 2ZUDA 2YJ4A 1UBFA 5AI5A 5D51S 1C80A 4J29A 3W4JA 4R1PA 4CMCA 1UAGA 4FN5A 1S1CA 4RH1A 2BFDB 2R6ZA 5FFNA 3VZBA 1G7TA 3SC3A 3IEKA 2AS0A 1MOZA 1RYEA 1U7XA 5C5EA 1MKYA 3FH0A 3WO1A 3QVLA 4WVLA 2WIGA 1NUUA 4KV9A 3FY4A 2JGIA 3OUZA 5FWYA 4ZTUB 1IMJA 2XB6A 2BFBB 3N8GA 4I50B 4E1AA 4FHCA 1MQSA 1AKQA 2R6DA 4EKGA 5C1BA 2G1PA 3ZDDA 4WBXC 1THTA 1FNBA 2YY6A 1WMFA 1IONA 2ZPUA 3M0EA 1VBMA 5IFLA 2AG5A 1IBCA 3SJBA 5ER6A 4BPRA 4RMIA 5FA8A 1KJJA 2Z30A 4V0NA 3EPJA 1DFIA 3C8HA 4Z2YA 2YZ2A 4F6LA 1RBZA 2IC5A 2OVFA 3B2QA 3EE6A 4NOLA 1P19A 4GMFA 3OT5A 5HJEA 4Z4EA 4UBJA 5H9WA 1DRJA 2XTMA 3IHLA 1M9NA 1SHJA 4E09A 2V59A 3MS4A 4OP1A 1GWNA 3VVLA 2R00C 1E1DA 1U31A 3GO4A 3PZBA 3QWHA 1HYHA 1SU6A 3I23A 3TOSA 4G2TA 1PVVA 1USKA 3QIAA 4WNCA 5D85A 4BQEA 5EKXA 4CR6A 4K0KB 3MGGA 1OR8A 4PS1A 4NEQA 1V8BA 1XQVA 3FJOA 1Z0DA 5EPEA 1ZR4A 2FUG1 1JR3E 4G07A 4HHEA 1YJXA 4DN6A 4W5TA 5E6SA 3THSA 3FR7A 3I6QA 2HIHA 3QGMA 1H23A 4X3PA 4YCLA 1WLYA 4K6MA 2IL1A 2OV3A 3AXTA 3WXMA 2BMWA 1AE1A 1CJTC 1YB1A 1G20B 2XOKA 1Y3IA 2ZE5A 4HFMA 4PR0A 1EJ6A 1E1NA 3F74A 1O96A 2QMZA 2W6MA 4NAVA 4MB0A 3RK0A 1RKBA 4MR7A 4O4LF 2E48A 4EDFA 4OQ4A 1IPEA 4IFEA 4UVIA 4HAIA 4Y9DA 3CEMA 4INPA 4KFTA 1G5QA 1F2DA 3A4LA 3C8DA 3PT5A 3HZZA 3CG0A 4R98A 2OXCA 3U81A 1A82A 1QRDA 4YRNA 5LMZA 2FPIA 2OBBA 2GBFA 1GPNA 3FVQA 4JC0A 5I8ZA 1BD4A 4Z54A 4F2GA 1T4BA 1T3SA 5KO2A 4ENSA 2FPSA 3P19A 6Q21A 3OM9A 5DGDA 3ZK7A 5LQCA 1X7YA 1FOEB 3BFPA 5C3UA 5H9VA 2Z4TA 3MUOA 4NCKA 4DEXA 4HDRA 2VHEA 2YFYA 3N2GA 3DMTC 3JQ6A 1AURA 3DC2A 2QPTA 1NMXA 3C1OA 2X8AA 4RPKA 2Q0QA 3SR0A 1C9EA 1DWQA 2JZOA 1PZHA 2NAPA 4PYIA 3T5DA 1TJPB 3G79A 1X6VA 2CNWD 3ED5A 2VPTA 3LF1A 2VDVE 2JG3A 1AKVA 3MS2A 1LUAA 1SOMA 1U98A 3I01A 1M0SA 4F7WA 5K03A 1DJQA 1H4TA 4L27A 1OMOA 4V3BA 5ALVA 1QV9A 5HK9A 5JRJA 1CUEA 4DZTA 4DYVA 5LQUA 2DQZA 3EXHA 4RNCA 1KC1A 3VPBA 2CUKA 5E0KB 4UUNA 5EXSA 1Z8FA 2PKQO 2I1QA 1HE1C 2QX6A 3BF7A 4N3GA 1M8KA 2J07A 1RAIA 2DFTA 3ZDQA 2C3YA 1EU1A 4EYGA 1Q7GA 1E1MA 3HJFA 4DV5B 5KSYA 5EEHA 3IODA 1F6WA 2I4LA 3V55A 3L0OA 1I2DA 2VR1A 3GAAA 1P0FA 3EXIA 2YV5A 3MS7A 2PV0A 4HRYA 4RSGA 3X1ZA 1XWFA 4FR5A 2AMFA 4GMKA 1XNHA 1OWNA 1XF9A 1UOEA 2I8LA 1MJGA 4G0QA 2WZDA 5DNEA 4D9HA 1JQ3A 4U3JB 3GEBA 5DNVA 4UAJA 4DKJA 1X80B 4XQ0A 4YO8A 4AICA 3SXPA 4BRSA 2D8MA 2XQGA 1G21B 4B6SA 1JJ7A 2RK3A 2GRJA 5BW5A 2BR5A 5IC5A 2XTZA 1T9ZA 1XCOA 2FLKA 3FPJA 3QIVA 1VL5A 3E5MA 4AU1A 1O0BA 1GDTA 4FXOA 2X4GA 2P11A 3H04A 4MVJP 1LI7A 1VCMA 4KNVA 1NW8A 1EWRA 2ZT8A 4KJXA 1NYRA 1VL6A 3PU6A 4P38A 1YMVA 3BSFA 1XR3A 5P21A 3UTCA 1ZSVA 2RHWA 5CJPA 3E9ZA 2QLBA 2F43B 1V39A 1ZKDA 3AZPA 2YNMA 3NYIA 2WHQA 4FGSA 5FOTA 5M3BA 3W5HA 1PBNA 3ZV3A 3WL4A 1JQKA 5IAJA 3FPGA 3DCYA 1FYWA 2AW5A 3ADCA 4DV7B 4WOKA 2ERYA 1BW9A 3L1IA 2DFPA 2XUDA 3QXSA 5JH7A 1QUFA 1OXXK 4AP5A 1QP8A 2VSYA 3L8FA 4LDZA 4JLWA 3BAZA 5KAPA 4QOEA 3NHYA 4OAPA 3VYRB 4CMEC 2ZCUA 1JX6A 4F38A 3FWKA 2I7VA 4U7DA 1M6VB 3E22A 4WNAB 3WNCA 1PEDA 2FJ0A 3W05A 2POCA 2HHJA 1QU3A 4BV2A 1WUYA 3RI3A 4H7DA 4ZV4A 3AM1A 4CZ2A 1E79D 5I6DA 4MKGA 1R8QA 3NJRA 4M53A 3JSAA 5LQNA 1PDVA 2HU7A 3GDWA 3IT3A 4FMDB 2F4VB 1WMSA 3LY9A 1VL8A 4FKZA 2FSIA 4KOAA 1J9EA 3G0CA 1FJHA 2WD7A 2O3JA 1D1QA 4QGSA 2O2SA 5FAKA 2ZZMA 2HU2A 2IP2A 2NZ8A 3CW2A 3HKCB 1AG9A 3GN1A 2W6CX 4FR2A 4KGZA 4MKIA 4Y7DA 3SSMA 3LGAA 2HJWA 2PBFA 4RTNA 4MQBA 3A6PC 1M2JA 1WG8A 2P7IA 4IF4A 1WIWA 4Q9IA 2O4UX 5KJ1A 2GA9A 1PG5A 4HUTA 1Y34E 1JTVA 3DBRB 4L95C 4P3XA 3EEIA 1Z63A 3I5UA 1P5FA 3EGEA 3SLGA 1NNUA 3WK5A 1XPUA 1BZYA 1EA7A 1ZSYA 3K1ZA 3KZXA 2PUDA 4MUKA 2X41A 4QJBA 5A5GA 3H5VA 1C5KA 1CERA 4FGKA 2P4SA 1KSHA 3DE6X 2R751 4EGCB 1Z4QA 3L8EA 421PA 1H6BA 5AJXA 4DC0A 1NU8A 2FQXA 3B1YA 621PA 5AO9A 4Y0VA 1Z07A 1MF7A 1Q21A 3HDTA 1BEZA 1QANA 2HM7A 4F3RA 3H9UA 4US0R 3OZTA 2BF7A 2C9DA 1H4VB 2Z09A 1Q92A 3RYIA 5GIPE 4D4LA 4J8PA 4NYIQ 1B4DA 2J3HA 4NBVA 3EC7A 4N4AA 4LX0A 4X62B 5C3MA 1IIRA 1PJTA 3GFPA 4GE3A 3KQUA 3RVNA 4C06A 4E5PA 1NQXA 3F6EX 5AKGA 3F3MA 3HVJA 1A4RA 1X94A 3JX9A 3LECA 4TM8A 2C5GA 2A30A 2Q27A 5ECWA 4PNEA 1PUJA 2X2FA 3PXUA 5EXEA 1CUAA 3K6KA 4URZR 2CW5A 2V6MA 2X5KO 3F8SA 1OW3B 2AZTA 4O1MA 3LVQE 2B8NA 2C5LA 2ENWA 1O6CA 4IMIB 1CUCA 5EZYA 5HQJA 5K2OA 1XMXA 1G21E 2HPHA 2E3JA 1R0BA 4XQGA 3X1XA 1MPXA 3ZZNA 1CNFA 2I62A 2J9YB 3EUWA 3VU0A 3WADA 4A8JC 4CF4A 4GMDA 4LOJA 4EF6A 1H8HA 3QKUA 2IWHA 1TVKA 1XRQA 2QRJA 5HOEA 1F14A 3F5FA 3I12A 1Z2DA 1NFRA 2GSWA 2XDAA 5KNBD 4PYRA 1DAIA 1NNI1 1K88A 3LOQA 2KHZA 2IE0A 1M7GA 1N2EA 1F4PA 3K31A 3KS9A 4KE6A 1W4RA 3PUYA 4ME6A 3U17A 2QN2A 1UC4B 3W06A 4A6XA 2XOEA 3B1FA 5IAOA 4PLVA 2R1TA 1DPFA 1JHRA 1G2IA 1KP9A 1XT6A 3CJRA 3RS7A 1IWOA 1KQGA 3WISA 4RPJA 3P2MA 1N2CB 3BXOA 4QDUA 4HWSA 4OHWA 2C3PA 3FLAA 4FVTA 5IT9A 1ODKA 3RB8A 3OQVA 5EG5A 1Y4DE 5FLEX 1NKSA 3SBOA 2GEDA 4QXPA 4Y1RB 3KE8A 1FVFA 4C78A 4WOPA 1BDHA 4N8EA 4R05A 5DYIA 2GMWA 3Q9NA 4CI0B 1ODFA 4LRXA 1IB0A 1KFBB 2H00A 2UVPA 2G7ZA 4XIIA 5FDFA 3HVRA 4AKGA 2ERCA 1TCVA 2HJVA 2OD9A 3H1FA 2QRVB 3QLVA 4XIYA 3ZJUA 1KH3A 4KQFA 1VCNA 3D0KA 2PM8A 5H80A 4GE0A 2BI8A 3KQYA 4C03A 2XSZD 1BMDA 4PGAA 5DGCA 5CFMA 1RDFA 4PIPA 4JLUA 2E6KA 1I32A 3BWEA 3NFRA 1XLWA 3C3KA 3Q4GA 2XODA 2OLKA 1J1ZA 3VSCA 2XDWA 2O1EA 2PX8A 5BQ5A 1EQUA 4ISBA 1Q2XA 5JHGB 4B2YA 5ICMA 4R4JA 2DM6A 3HADA 3TLBA 2JGMA 2D54A 2E85A 1KZGB 5ALSA 4UAGA 4GGMX 4N3NA 3OAAD 1V11B 1IQPA 4EY6A 4BQOA 1XZLA 2G72A 3EGXB 3OZFA 4DC1A 2P3SA 2VPIA 3HLYA 1KJ8A 2IOHA 3RGWS 4B71A 4ABYA 2ZJZA 5EJGA 4BN0A 2QRKA 3OFND 1M1XB 3UMYA 1SWWA 9LDBA 3H5AA 3R6LA 2XI4A 5DHRA 2CMDA 4I9NA 2I29A 3AVYA 1LPAB 3VI3B 5BSRA 2NXWA 2ZS9A 1AOXA 4HDKB 3IERA 4TL7A 2XCSB 1YU9A 2UZIR 4EY5A 1ZXXA 1GGFA 1CHDA 4YJFB 3DAHA 1ORDA 4NICA 3T7DA 3V4LA 1EE9A 4I6JA 1DX6A 4Y9UA 3UCFA 4FDLA 1O6FA 4KV7A 4X8OA 5J5CA 2WD7B 1U2PA 4IW3B 4QELA 4Q3NA 1J56A 2PZMA 3I42A 1G20A 3CKKA 4MGIR 4P33A 1KYVA 2AFHE 3QBVA 1Y7IA 2BMVA 4TGLA 2V0GA 3WYNA 1T4GA 3JASA 1L5GB 3BF8A 3G2QA 1YZVA 3K0HA 4S1PA 5DH9A 3WDMA 4KFRA 5FLXA 3RAFC 3G2MA 2HCRA 1S4MA 3L0BA 4G6ZA 4Q18A 2BMDA 3A2MA 2ZWVA 3G59A 2D4AA 1D1PA 2Q46A 3G9UA 3JWEA 3NIBA 4WK2B 4CLOB 1BD3A 1EZ4A 1JNYA 1V5GA 2G76A 3DQPA 1AHNA 3BXGA 4LQCA 4WXYB 5AQEA 4G09A 3DBIA 4D02A 2XMGA 1WZ2A 4AJ4A 2CLIB 3BZUA 4WXHA 4DDHA 1PEYA 1XMJA 1L5FA 2R8PA 3WK4A 4DLBA 4C30A 1W2GA 2PJRA 3N6VA 4H3KB 2VP9A 1U3GA 4AMBA 2G40A 3IBTA 4HLNA 5D6OA 2J87A 2VBFA 1A1VA 5DNAA 2JGNA 4JU8A 4NSNA 2REOA 5KUTA 1O6GA 2BGNA 3U0VA 4N7RA 2A0KA 2GVDC 3F1LA 4Q6WA 1BSVA 3AF2A 2DHEA 3DNFA 3AI1A 1FX1A 4BGIA 5J1TB 4D9MA 4YHHB 3RWMB 4YT4A 1AA9A 2GLUA 1XYYA 3K35A 1L1RA 4I81A 1L5YA 2GNPA 2E4XA 3QA3E 1F1BA 4OHOA 1Q7CA 3ZS8A 4MA4A 2IUTA 1ZJ4A 1LK5A 4R41A 2X23A 2HA6A 2HMWA 5GONA 4OQYA 2OYRA 3TUZC 3U4MA 1KI7A 5F12A 1VJCA 5E3IA 2CXQA 3UWMA 5JJ5A 1OZHA 1HYQA 3KB1A 2F3PA 4UEQA 5HXAA 2FYTA 1OX6A 4BVBA 3V00A 4CF7A 5JBQA 1LBIA 1QP7A 1WE2A 3NBYC 2BHLA 2YR0A 3VX4A 4WKOA 2HF7A 3IOMA 2VC2B 3CNEA 3CUKA 2JLBA 5FNVF 1W5EA 1WHTB 2G9ZA 4CMEA 1XL1A 2OHFA 1D0VA 1X1BA 2HYDA 1A5TA 1L7PA 3PKZA 4IICA 4RZ3A 3C7AA 2FEWB 2C8KA 3OD5A 4KGXA 1MV8A 4TL6A 4ZFNA 4W5OA 2ZVPX 1BNCA 4M3NA 3R8XA 3NDBB 1DWUA 1V41E 2BFEA 3B6ZA 4KQMA 1H9BA 2AT1A 3NRJA 4Q19A 1B26A 2E2WA 1KJWA 4UBNA 4CDMA 1LWNA 4GUAA 3AR6A 2YMMA 5B2FA 4FMBB 3G2LA 3EDOA 2XYVA 4JVMA 3OICA 4DCUA 4RE6A 2J3IA 2Y92A 3BREA 4LRTB 2D1YA 1H6CA 3DHEA 4G4SP 4N8DA 3K6RA 4KI0A 3PNVA 5C4MA 2B61A 4P3KA 4UFPA 4DR4B 4WKCA 2O2DA 2FR8A 4IWYA 3EVAA 4FS8A 4NBUA 1G3RA 2BSXA 2FWAA 1KK2A 3BGVA 2P3QA 3EGDB 5AK5A 4YP0A 1D2EA 3IC5A 2WJHA 4ZYTA 2OHVA 2ZRLA 3C8MA 3TNLA 5JJCA 4J1TA 2O4CA 4XJXA 5BR8B 4JYCA 1MH9A 4LHXA 4LRSB 4E2FA 4F11A 2GD0A 2QLMA 1EFDN 4HXGA 1LD3A 3GGJA 4MKZA 2K5UA 4CCYB 4IDCA 2WINI 4PEVA 1SBHA 4JB2A 1CUSA 4WKBA 3GLQA 2F1KA 4Q00A 3U9TA 3Q2KA 5DYTA 4RGQA 3ZWBA 3OETA 5FI1B 3OOJA 3WOHA 1OB5A 2FVYA 1SXJA 3R7WB 4S05A 1WW3A 1Z4MA 2Y1EA 1KIMA 4KQ9A 4R8LA 2VVTA 3KSRA 3IJEB 4XWYA 4HG2A 1DEXA 2CKDA 4U7WA 5GJVC 1P1RA 4ER7A 1RAAA 1EP3B 1KSFX 3F0TA 2BGMA 4M83A 3KWMA 3WRVA 1EVIA 1E96A 3AWIA 3PSAA 3MTJA 4XUEA 4F1KA 1ZXLA 4R16A 4JOSA 2QN3A 1Y7LA 3TH5A 4Z49A 2IPMA 3PUKA 4FCCA 1BXGB 1X1SA 4YRIA 1EGHA 1GRNA 1RLMA 2GCEA 5AXBA 3RJ9A 2GBLC 4JQCA 3IT1A 4RM3A 1ZM4A 4MW6A 3MB5A 4I9HA 4YPOA 3ZV6A 3BG5A 1WS6A 2GD1O 4WCFC 1B00A 3HJAA 4RD2A 3T7IA 2ZUCA 2Y4NA 3MJVA 1OXSC 4KIGA 3PFWO 1E4VA 3H86A 1OZFA 2QGZA 1ZWKA 1QTNA 5AUQA 3CHYA 2FF7A 2Q3JA 3DTVA 3SN6A 4HVLA 1OOEA 1KJIA 1GUZA 4G4IA 4X00A 2ONKA 3MTGA 5BN3B 3H9BA 4H77A 1J9ZA 4HNVA 2Q8QA 1ENZA 3CBQA 3T3IA 4BC0A 1EBBA 5KI6A 4EVIA 5GGXA 1ZGAA 1EVLA 3UUEA 3LY7A 2IIVA 3IQZA 1T5IA 2HT6A 2ZUUA 3E5HA 4UNIA 3GDFA 2VXCA 1DXQA 2EARA 4OJYA 1RJFA 1WTAA 2PL1A 3ABSB 3AIIA 3Q7SA 4JLBA 2W70A 1NJ8A 4E70A 3IDQA 1Y3DE 5HDQA 1LLUA 1SD2A 1V16A 1Z13A 2IJGX 1L5RA 2QP3A 2WYOA 4OHPA 5K3FA 2AE1A 2QLLA 1ZH0A 4RVNA 5E3HA 3G2KA 1AQNA 4MW7A 3KJNA 2BDEA 3H97A 3LKBA 1QTQA 2CFCA 2VDWA 2AFHA 4ND4A 2VPZA 2GPJA 4E07A 3BYZA 3QA9A 3QJYA 3V6MA 2JBWA 2VKTA 3WKCA 1Z6GA 1KYYA 1NW3A 1M5UA 1CLEA 3ABQB 4AO8A 2FMIA 2J6HA 3IHKA 5HJ2A 2E5FA 3UCEA 4AL4A 3H2ZA 4DGQA 3DUWA 5KYXB 1Q3KA 3ROFA 2HMTA 3MG9A 1DQZA 2V8BA 3WIEA 1LDYA 4QDJA 1NLUA 3TQOA 2BR4A 2HRDA 2CWDA 2DWPA 3DOEA 3STXA 3H2HA 5BV0A 1U8YA 4EYEA 5CR9A 1LV8A 4A8JB 1PI3A 2XPCA 1J8YF 4I5GA 1A7UA 1R5JA 1YR7A 1W4AA 5IAKA 3A2KA 1ZW6A 4O2AF 1Q0TA 2EG5A 2HA7A 4EOGA 5KNDD 2GN2A 3LRPA 3ONFA 4HH1A 4OKIA 5DT9A 4P3OA 4AMGA 4UQOA 3CH5A 1JDJA 1IE3A 3BXFA 2JAXA 1L5LA