3N1UA

Structure of putative had superfamily (subfamily iii a) hydrolase from legionella pneumophila
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
182
structure length
182
Chain Sequence
SLNTEIEMNELLEKAKKIKCLICDVDGVLSDGLLHIDNHGNELKSFHVQDGMGLKLLMAAGIQVAIITTAQNAVVDHRMEQLGITHYYKGQVDKRSAYQHLKKTLGLNDDEFAYIGDDLPDLPLIQQVGLGVAVSNAVPQVLEFADWRTERTGGRGAVRELCDLILNAQNKAELAITGYLKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of putative HAD superfamily (subfamily III A) hydrolase from Legionella pneumophila
rcsb
source organism Legionella pneumophila
molecule tags Hydrolase
molecule keywords Hydrolase, HAD superfamily, subfamily III A
total genus 60
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3n1uA00
4OCZA 5AVVA 4HGOA 1JUDA 3OCXA 5ALEA 1U2SA 3N8GA 4Y2TA 1XP5A 2I54A 4AS2A 4G9BA 3U19A 4ZEVA 4EEKA 2GHQA 2G06A 5AKZA 2OM6A 5AKGA 4BNDA 3OPXA 4UMDA 5FP0A 3N1UA 2JARA 1U7PA 4EELA 5A3SA 2JAUA 2CFSA 3QLEA 3ZVLA 3EF0A 2FDRA 2QLTA 3A1CA 3KOOA 5AIBA 3UMGA 1YNSA 3SKXA 3WK4A 1F5SA 3A1EA 4BX3A 4DCCA 4KNWA 2JAWA 3W5AA 2OBBA 1N9KA 2VKQA 5ALSA 2MU1A 4NWIA 2R8ZA 5AIAA 4RESA 1U7OA 3M1YA 3W5BA 1Z4PX 3IRUA 5AVSA 1RMQA 3A3YA 4UAUA 3AR4A 2HDOA 3ZVNA 4OHFA 3SHQA 3MN1A 1L7MA 1ZJJA 3NAMA 4O8CA 4BYGA 3SLRA 3MPOA 1WPGA 1Z4QA 2GFHA 2ZG6A 2WF9A 5AICA 3OCVA 2RAVA 3TLMA 1LVHA 2CN1A 3I1YA 3L1VA 3L5KA 4BEWA 2HOQA 3DNPA 3WKCA 5A3QA 2C4NA 1T5SA 1Z4MA 2YJ3A 5ALRA 2HI0A 2B1QA 4OFZA 2Q4TA 5AW2A 4Y2JA 1RKVA 1WZCA 1WR8A 1YJ5A 3OCYA 4HGNA 3AR7A 4KYTA 4HGPA 1S8OA 2FPUA 5E0OA 5AW8A 3RFUA 1Z5UA 1J97A 4HYTA 3CZ4A 4RETA 3WKDA 4YIKA 2P11A 1L6RA 3KZXA 2BY4A 2G07A 2HF7A 1ZD2P 1EK2A 5ALTA 3L8EA 1T9ZA 5ALKA 4L6AA 4Y3UA 1N8NA 4PNHA 4CF5A 5IT4A 1RPZA 4XPZA 5ALLA 4BX0A 5AK3A 5ALIA 5AVWA 4KX5A 2NO5A 4UMEA 3FVVA 1YS9A 3U13A 1SWWA 2B82A 5AHXA 5AW4A 4MWOA 3AR6A 3UMBA 4QQFA 1ZD4A 3S6JA 5AK6A 5AK4A 3HYCA 2ZOSA 2G1AA 2I6XA 1O03A 3OCZA 3PGLA 3ZTWA 3EF1A 2FUCA 2GO7A 2Q5EA 1TE2A 1VJRA 5IS2A 5AESA 4J03A 4XQ0A 4UM5A 2O2XA 4UMVA 4HGRA 1RC8A 3M9LA 3A1DA 1NNLA 2B30A 3DDHA 3QU9A 5AI6A 2B8JA 2YN4A 3QU5A 3P96A 3E8MA 5AI9A 1CR6A 2ZBGA 3NIWA 3HLTA 2FPWA 3U7GA 2IOFK 2ZBFA 5AM0A 3UMCA 4I9FA 5AKHA 2WM8A 4Y2XA 4YCLA 5IT0A 4YIHA 1L7PA 2ZXEA 4KN8A 2YJ4A 2HX1A 3AR2A 3MC1A 2RB5A 3KDPA 2OA0A 3AR9A 3IB6A 3BWVA 3R9KA 2Q4RA 3N07A 4L6CA 2JGAA 1J8DA 2AGVA 1L8LA 2IOHA 5AVXA 4I9GA 3AR8A 3QUCA 3B9BA 4Y2RA 4E88A 1QYIA 3FZQA 1RKUA 2YMLA 3SKYA 4UU0A 1EK1A 3ZTYA 1Z4JA 2AMYA 5AW1A 5AM1A 5AW9A 1Z4KA 1QH9A 1O08A 4BEVA 3KD3A 4QJBA 2JAOA 3I28A 1RLMA 1ZRNA 1Z4NA 1SWVA 3CNHA 4NABA 5AKEA 4EX6A 3QNMA 1Z4IA 5AKJA 4ZEWA 2QYHA 4UU1A 2YY6A 5AKKA 5ALZA 4Y2PA 4DWOA 1ZS9A 3ONNA 1RDFA 3EWIA 4EENA 1RLTA 3GYGA 3U7EB 1ZRMA 2I34A 3FPBA 1YV9A 2NYVA 5T41A 2IA5A 5AW0A 4BBJA 5ALHA 5AW5A 4H1WA 2PKEA 3FGOA 2ZBDA 4FFDA 4JDPA 4AS3A 2YFYA 1RQNA 2C9MA 2WF5A 3NRJA 1TA0A 3WK6A 2B0CA 2C88A 2YMMA 1WVIA 3I76A 2FPXA 2WFAA 3ZWDA 3QU7A 5AI0A 1K1EA 4DW8A 2FI1A 2RARA 4EZEA 3IJ5A 3QXGA 3L8GA 4NFLA 3E84A 1XPJA 4F71A 3PDWA 2HSZA 3ED5A 3K1ZA 3QUQA 2I33A 1TJ4A 3QU4A 2BDUA 2YMQA 4UW9A 5ALDA 1Q92A 3WGUA 3L8HA 5AVTA 2O9JA 3ESRA 3OCWA 5AKYA 4KNVA 2EARA 2G0AA 2FPSA 4XE5A 1SU4A 3QU2A 3WKBA 1L8OA 1PW5A 3ESQA 3J7TA 1RQLA 2B1RA 3E81A 5ALGA 1IWOA 1U2TA 3FM9A 2WF8A 1Z4OA 4Y2YA 5AM5A 2B8EA 3W5CA 2NO4A 1RMYA 1RMTA 2W43A 5AW7A 4YH1A 2HCFA 2D2VA 5ALQA 1QQ6A 3WK8A 5ALUA 3BA6A 3R09A 3ZVMA 1CQZA 3NASA 5AVRA 1NF2A 3ZWKA 5ALXA 3U7FB 4B6JA 4OD0A 1FEZA 2BDEA 1U02A 3N5KA 1MH9A 2YJ6A 3L0YA 2I7DA 1ZD5A 3QUBA 4HGQA 3WGVA 3NUQA 2EATA 4Y2VA 2PR7A 1Z4LA 2AH5A 4G63A 2FEAA 2G80A 1AQ6A 2G08A 2ODAA 4C4TA 3SMVA 3PCTA 4YCNA 4NV0A 2I55A 3KC2A 2MSNA 4L57A 5ALFA 3KBBA 3B8EA 3NANA 4Y2UA 4BX2A 3R4CA 3L0CA 4CF3A 2HF2A 2EAUA 2X4DA 3SF0A 3L7YA 5AI5A 2C8KA 4UM7A 2C8LA 5AW3A 5AI4A 2R8EA 2DQSA 3WK5A 4FE3A 4HAIA 1RLOA 2CFRA 3AR5A 3EPRA 1RRCA 3FPSA 3L0BA 2CFTA 2HO4A 3SD7A 5AM3A 3L8FA 4J2TA 1Y8AA 3ZI4A 3ZX4A 5ALPA 4UASA 5AM4A 2IOFA 2R8YA 1S2OA 4FYPA 4Y2QA 3OTQA 3W5DA 5ALNA 2HHLA 4ZEXA 4KX3A 4GIBA 1Q91A 3DV9A 3ZU6A 2WHEA 2YJ5A 1QQ5A 3B9RA 4CE6A 3U26A 1Z5GA 3DAOA 4JB3A 4GXTA 3UM9A 1ZOLA 5AVQA 3ZW7A 5AW6A 1KYTA 5AKXA 1Z88A 4UMFA 5JJBA 5ALOA 5ALYA 2ZBEA 2P27A 2W4MA 2FPRA 2WF7A 3AR3A 3WKAA 5AVZA 5AK5A 5ALVA 4YCMA 4IFTA 3QX7A 3D6JA 1L7NA 4CF4A 2R8XA 3E58A 3F9RA 3QYPA 4UARA 3ZX5A 3ET5A 4Y2SA 1VJ5A 2FUEA 2YBDA 5AI8A 3WK7A 3QUTA 1YDFA 4UAVA 4MUMA 2W11A 3ET4A 1RKQA 4XOUA 2GHTA 5AVYA 4YGYA 1TJ3A 1YMQA 2HEGA 2WF6A 2YMPA 3VAYA 3MMZA 4CNQA 1QQ7A 3WK9A 4C4RA 2G09A 4C4SA 2PQ0A 4DFDA 5ALMA 2P9JA 1TJ5A 1T5TA 4BKMA 5ALJA 1L7OA 5ALWA 3WKEA 3U7HB 1ZD3A 3N28A 1NRWA 3I6BA 2IYEA 4BNDB 3NALA 3QGMA 4NAVA 4EX7A 5AM2A 3L1UA 5AVUA 3PGVA 2P69A 1VFPA 1XVIA 4UATA 3OCUA 1LTQA 2GMWA 3RF6A 3ZUPA 2AUTA 5A3RA 4IG4A 5AKIA 1X42A 4F72A 5AKLA 2OYCA 2RBKA 4AP9A
chains in the Genus database with same CATH superfamily
4YECA 2IKQA 4BVKA 1MX3A 2VRNA 3I12A 3DW1X 5L51A 2LRHA 3ZN2A 2R97A 1EX6A 5EXXA 1JAXA 1I7NA 1U04A 1SU6A 4PYLA 4GGMX 3K70B 1Y7HA 3L0ZA 3H83A 1FSFA 3NTOA 1MB2A 3GG2A 1A5BB 2QM3A 4OBEA 3CN9A 4OHVA 1W36B 3ZJUA 4J9VA 1FFEA 5AHWA 3H7AA 2Q3HA 4BLPA 2OHXA 3I9MA 5L3QB 3MLBA 3H5VA 4DM4A 3TZCA 1L3BA 3IE2A 3N1UA 1BKSB 3GMTA 3EGDA 1WDKA 1YOVA 2XCIA 1V3UA 1HT0A 3ENKA 5BOSB 1E4EB 1PZMA 4L8GA 3GDFA 1XVUA 2YYSA 4O4JF 2PVCA 4O4IA 1CRZA 2RIRA 2ZSEA 5EKXA 3PQFA 4QFBA 1KI8A 1M1YE 2YBEA 5LZ4A 1CJVC 3ANNA 3W5AA 5K6TA 1VI5A 1EM8A 3H4MA 5D85A 2O8BA 4Y6OA 5EJIA 4RGVA 2OLKA 3LCJA 4GH5A 3DUFA 5CVTA 4JELA 4EYSA 1M7BA 4G5FA 3S7ZA 2VHTA 4DANA 3L7MA 4G09A 2P9QA 4BQPA 1XVVA 1VLMA 2OKCA 4KHPB 1Y3CE 3A4LA 3A31A 1SVLA 2X8LA 1AXRA 4FZJA 4IDAA 4MGYR 4BFXA 4BVLA 5B57C 5ADWA 1BJTA 2PWAA 1EVIA 2HA4A 3EG9A 2IC5A 1AUQA 4NOMA 4KGDA 3GT3A 4O2LA 3ULKA 1NU8A 3I3SR 4G01B 3E8SA 3SHVA 1SK9A 4IXMA 1GKUB 4BAGA 5JV5A 1J06A 4LHYA 4QWWA 3ANSA 1N6RA 4JA0A 3I39X 4UHHA 1PVDA 1UPBA 2VT7A 3NKFA 3HADA 3Q6IA 3BWDD 3IBTA 2AFHE 3GJ7A 3EGWA 1USVA 4K05A 5AICA 3FKQA 4YUVA 5HP4A 2AG0A 2HU8A 4IHJF 1NVFA 4MEJA 3ADBA 2NPFA 1VPEA 3CNQS 3DLPX 4ARBA 2HQ1A 2XLBA 2D0PB 3N0VA 2Y2VA 4GT1A 3MJFA 5AYVA 1WV1A 1E69A 2QYSA 2IU6A 4LC9A 3FX2A 1I80A 1ZLXA 3WBJA 4AFNA 4BX8A 4D81A 1EWQA 1Z4MA 2GJAA 4EEZA 3M6UA 4CG2A 2HI0A 5G1NA 4EG1A 2GZAA 4HRXA 2GJKA 3A3NA 3GHYA 5FAXA 1WR8A 4ZYYA 3QRWA 1E79D 1VXRA 5BVHA 3R8XA 4OLBA 4OQNA 3EFOA 1P39A 4TKUA 5E0OA 2JGJA 2P9FA 3B70A 3G2OA 1PJ4A 1QVZA 2CHGA 2RI1A 5DE3A 4IX9A 4B3IA 5EXPA 1A9QA 1XKTA 4LHXA 3ZE9A 3PUYA 1WE2A 3R9XB 2GBGA 2FPKA 1CDEA 2Q8PA 4WA8A 1XZKA 4KE7A 3FWYA 2QMOA 1KWGA 4YAUA 3D4IA 3MWEB 5DJ5A 3IQXA 2JD1A 4AKSA 1S2NA 4HBZA 1RBZA 4NBUA 3TD6A 5AVJA 1RBQA 4JJ6A 3VH3A 1XIVA 1ID8A 1Y3AA 3KETA 4BZQA 1MEOA 1X19A 4PNHA 4JD5A 3RHTA 3WJ1A 2IZ6A 2R9VA 2WYVA 5EKSA 1GEGA 5HIIA 2PXAA 1ORHA 5EIFA 2QTWB 4CGZA 4LDQA 4MYSA 1TYZA 2EL7A 4CKCA 3E0XA 1GQ2A 2JFNA 3U61B 5EP1A 1DJLA 1CUHA 3F9IA 3R7LA 4G5GA 5KTYA 3CWQA 3WYAA 2C83A 5BWNA 3SVLA 5BUSA 5JH7F 4E1AA 4KAFA 5GONA 4BCCA 2A9KA 4BLOA 2PH7A 1E3JA 2EC5A 2DG2A 2JI7A 1WNTA 2AOUA 4HTFB 2IK8A 2RJOA 2Z3ZA 3QVOA 2OLEA 4QPJC 5ICSA 4GKKB 4CT5A 4JGIA 4KN5A 2J3IA 1XQXA 2XPCA 4MRPA 2IL1A 3Q0EA 3RUFA 2ESRA 1M7GA 1CE8B 2XA1A 3USCS 2I62A 4LNHA 1QYRA 3JAKB 4MYRA 2FMUA 4V24A 4TSRA 2AQKA 3ITNA 3T6KA 4A5SA 4UKDA 3ZYZA 2HSWA 3THYB 1R8JA 1P7YA 2Z4SA 3O93A 2EFCB 1NBWB 2IVZA 3EIHA 3QU5A 2WJPA 4EZBA 4YUAA 2HCRA 4C4YA 2CXTA 1AY0A 2C94A 5HYVA 2NPIA 2YWGA 4YRPA 2MR5A 2BVNA 1NBMD 4PINA 1JQDA 3MS2A 5ESWA 5FQOA 2BONA 3UN1A 2WNSA 5IJZA 1OWMA 2FU5C 1EX1A 1KOFA 1N0IA 2LV8A 3CF6R 3TGWA 1VIVA 1VKHA 3WGMA 5JNVA 5K20A 4FIDA 1Z0KA 4N41A 3ACCA 3DE0X 3GNQA 1L7QA 3KR9A 3LUKA 4I4CA 3C1OA 3WVNA 1IY8A 1N7GA 2JBAB 3R5XA 5DASA 1QFZA 2BV3A 2X19A 5F5NA 4UVGA 2GJSA 5I7RA 2P4HX 3AUFA 1PFWA 1ZMBA 4L4RA 4TV8A 5KTOA 2SNIE 3VPGA 5B36A 4V0KA 3D8UA 3LC0A 3QXCA 4M0FA 2EW2A 1L8LA 5IJ9B 1Q7BA 1V4NA 2AYYA 3FCCA 3PQ7A 1ZM2A 3C3KA 4PSVA 3KSMA 1CUVA 4G0QA 4WN9B 3D2AA 4A4DA 4IUDS 3ZXUB 2OTCA 1QIDA 2H2HA 3DP7A 3E9MA 4D46A 2DCMA 1GNRA 3HVKA 1HG0A 2GTHA 3FTFA 3BKXA 2EG9A 3A4NA 1RI3A 4Z9AA 3DAHA 2LWIA 3NC4A 4YRJA 5AW9A 3T1NA 4W5QA 4DR6B 4YRMA 2H08A 4EB6A 4KR6A 3OM9A 4MVJI 5JI3E 4CODB 4N8SA 4BB6A 3RWOA 2IU3A 1EQ2A 2O1WA 1D4AA 2J5QA 2OZLA 2XT9A 4I3HA 3QBJA 4F2GA 1WXXA 4HO1X 1LV8A 2B5VA 2HMUA 8GPBA 4O08A 4HNAA 4B46A 3UH0A 4NCBA 2Z6AA 2PMBA 3GVIA 1AZWA 2ET6A 5FBWB 2VPTA 5JATA 3UKJA 2MJLA 3AJDA 3LOQA 1E1RD 2WMYA 2C2BA 3B5IA 4KUEA 2RGAA 2XECA 4JMPA 4QDZA 2I34A 4A8JB 4DQKA 2ZDQA 4EPVA 5BSVA 3R5HA 3OX2A 2VBIA 4IIDA 3KT8A 4YMWA 2IV7A 4NG5A 1U8TA 4LV5B 5FLXA 2I2CA 3FPKA 3VDXA 5AW0A 5LDDC 2N3ZA 2LE0A 4US1R 1WXQA 1PR6A 2ZBDA 3IVRA 3BTUA 4ZKEA 4K9QA 3PD7A 3EFHA 4X94A 4HEJA 1MIHA 1U3TA 3VR5H 2QMEA 5IKPA 1BCRB 2PKQO 3S1LA 1JDTA 4YMTA 5KNDA 3BSWA 4OY3A 4NPHA 4XIGS 2A0XA 5DZSA 3IIMA 2FPXA 2ZKLA 3CS3A 4H7JA 2QENA 1TDJA 2R79A 4C05A 3DHYA 4Q66C 1SZPA 3UMYA 2C7BA 3H3FA 4MH0R 3AYZB 3ZY6A 4QM7A 3ZWVA 1XZGA 4R7GA 2PGIA 3ROEA 2NVWA 4JFRA 3UGQA 3OLVA 4F92B 4E07A 4B8ZA 1R0XA 1I36A 2PT5A 3IUMA 3WV4A 4J49A 3PA6A 4HLQB 1PWEA 4IV8A 1NE7A 1D6SA 2FMKA 4BZPA 5JXJA 3UJ8A 3L8HA 4G8JA 4L5YA 2H92A 4RV9A 3STYA 2FG5A 1HNZB 2O20A 5AKYA 1YR1A 3E2MA 3ADCA 1Z6GA 3QKRB 1N5JA 4KL8S 4LF7B 5EZYF 3ABOB 8LDHA 2AC7A 3R9IA 2HGSA 5CBKA 2QRGA 3FTEA 3CR8A 2UKDA 3D2LA 2WILA 5NLLA 4E2FA 3PNQA 1DFHA 1IB6A 3IT3A 1KH1A 2BFFA 2ACKA 3AMVA 3IUNA 3OE5A 4HP8A 4MUKA 5LBIA 1X70A 2XTAA 5TS3A 3V2GA 1PQ4A 5HW0A 1HNXB 3DOJA 3ZGYA 3FHCB 3W5CA 2X6TA 4GGOA 1KK2A 1N6KA 4AMBA 1RJEA 4G0UA 2WUGA 3NLLA 2P6MA 5GJWC 3RFCA 2VJLA 2N1MA 3W6NA 1T9CA 1ZK0A 2B8NA 3DBHA 1J42A 3FYUC 1YZNA 1E4VA 4MIOA 3WK8A 3QI7A 2Y76A 5G4LA 1T5BA 2VPPA 3GJZA 5FORA 4CM1A 4GE3A 4E12A 4P0QB 1IK6A 3VM6A 3IBSA 1D9XA 2HNAA 1XUOA 4MQ5A 5B55A 1FEZA 1YZKA 2GYUA 4DIFA 2G7MC 2JZOA 1KFKB 2FVYA 2G83A 2QN7A 4IIJB 4FJ1A 4HAOA 3TNYA 2GVZC 1INLA 3AP2A 3MK31 1G2PA 1H1LB 1NFRA 4FZVA 4H4CA 2HAEA 1L4BA 1NJ5A 1JPUA 2XYHA 2YHIB 3Q5DA 4Y6RA 1BDBA 1G20B 2MYNA 2PGXA 2XBLA 2WG0A 2WOOA 4B40A 3DZBA 2E5FA 2A9PA 4B7ZA 4OXKA 2Y8EA 2ZLBA 3AWIA 5LOVA 3QF4B 4TWAA 1Z4LA 4G37A 4XM0A 1TKAA 5ECGC 3C48A 4MOWA 3MWLA 3FWZA 2P3QA 5LB4A 3VNBA 2GPNA 4CM3A 4DTCA 1CU1A 5HTOA 3R20A 3ER6A 1MB3A 4S35A 4PZLA 5DYYA 2VUUA 3HKCB 3HU2A 2SCUB 1NONA 1LD3A 3H5NA 5CX1B 4BMYA 4KXUA 3TVTA 1V1RA 4F5WA 3NRCA 1ZQ9A 5EE1A 4ZICA 3D8NA 3T12A 1LK7A 4EY8A 1JQLB 3VHXB 1F38A 1W52X 2BR3A 4TUYA 2V0GA 4RM3A 3F3YA 3R4CA 3ND8A 5J2UA 3UZUA 4W9NA 1G8PA 3EWAA 1TU4A 2PAAA 1PEYA 4EHIA 1CNEA 1Z16A 1ONSA 2FEXA 2SHKA 3JASB 3SBXA 1M54A 4ZMSA 1OX6A 1UIRA 3VR2A 5AW3A 5E7JA 4O4HB 4HAIA 1QCYA 1D1TA 3EPRA 2GYWA 2YASA 3F46A 1C30B 1IDOA 2QJOA 3L7IA 4YLEA 1M6WA 3DE2X 5GM2A 4C5CA 4A0SA 1I7QB 2O05A 1UMDB 1K8XB 4HGYA 4OKSA 5FI0B 1PNRA 4WKCA 2V8OA 3SD7A 3KJIA 3NHRA 4F85A 1ZGAA 2A7XA 3LIPA 3RS0A 3LX8A 4D9NA 4FYXA 1UBHS 5E2AA 1QDLB 4JJFA 4N7BA 3ROTA 5CLJA 1KVUA 1EGMB 1S1CA 2D5IA 2CNKA 3M4XA 1NJ2A 1Z36A 4XM2A 3QE3A 3QVKA 4UDXX 4Q9DA 5ICFA 5HZGA 4BXOB 2VHYA 1EX9A 1DQRA 3UWPA 1ULHA 3CZ9A 4WBNB 2ORYA 4BMNA 4I8DA 3WBFA 1ACJA 1RWBA 1YB1A 3BE5A 3I6QA 5ITZB 4A1FA 1UXGA 3BILA 4G0OA 1U2DC 1QHNA 2RGWA 2CL6X 5G0VA 2IYLD 4WNAA 2ZS7A 4ZI2A 1UF9A 2NV2B 4YYEA 3Q40A 2PG3A 3R5KA 4F04A 2H65A 1VYUA 2J3DA 2CLHB 2Q6LA 4GG1A 1XP8A 4ZPXA 2W4MA 5EJFA 3I32A 4I81A 4MDFA 1DWUA 4QQKA 3D6JA 1RWPA 3ZGVA 4BMDA 2AJ8A 4JUAA 3WJ2A 4RF2A 1C9DB 4KWIA 2FZCA 2XYVA 2PJUA 4BLTA 3CUKA 3QHPA 1FX0B 1RAHA 5DYTA 4KRXA 2G1KA 4F84A 4R0VA 4XRRA 3SJ7A 2QVCA 3WK7A 2R7KA 2QM0A 3PF9A 1TFUA 2QRVB 4I5EA 4MUMA 1M1NA 2Z8XA 3QKSA 2XGGA 5KC9A 1DB3A 1EXNA 3R7DA 4BRZA 2B34A 2CL7X 4C0LA 5I8PA 2RBGA 2WIFA 2IELA 2CMGA 4D9KA 3V8VA 2HEGA 5JYBA 2ZJ5A 5LQJA 2PO5A 1B0AA 2NVUA 5DN9A 3D6VA 4C04A 4M1SA 5LFAA 1XVLA 1TJYA 1QGED 2CVQA 1T10A 5KTMA 3F71A 5JDIC 5HQJA 3LRXA 4YRNA 1MVLA 2M6SA 1AKRA 2O14A 2O7RA 4MAMA 4BKMA 1UFRA 3HV2A 1Y81A 1QH1A 4IYJA 4EMSA 3PF8A 1PJTA 3CPSA 4LJKA 3AIMA 4TTRA 1FFXB 4YI5A 1NRWA 1YRHA 1U0SY 2VAVA 2JA2A 2X5JO 3HABA 1O97D 1UPAA 3DDZX 1C4OA 1YR6A 1SXJB 2OXEA 2PA3A 4R16A 4F12A 2WYOA 2W42A 3AF5A 1Z2OX 4EKDA 1CZLA 4EHAA 3BORA 1YS6A 1E1CA 3TDNA 4X66B 1AJEA 3EDOA 1Y9DA 2ENWA 3IOMA 1NAHA 4BNXA 2QAGC 2DUMA 1SCQA 1N92A 2CMDA 5DGIA 4NNPA 1GPBA 4UPDA 2CEAA 1RRGA 3PC7A 4B3HA 2NMVA 3WLFA 3L79A 4AMVA 3VJRA 4XYEA 5BSRA 4AO7A 1JHUA 1MABB 4HFMA 1E1LA 2AG5A 3OLZA 4HXGA 3K4HA 4C29A 1OFVA 3FBTA 1GXSA 3UMFA 4BO7A 4HV4A 2FDXA 2JH9A 2Z09A 1KHTA 1M8JA 1OYVA 1V4BA 3BJIC 3E3AA 3NXSA 3WNZA 1V26A 2YRWA 3PD1A 2PRJA 3RODA 1AGRA 1NQ5A 2RGRA 3CWZA 5A9SA 1JUDA 1SHTX 3ZC3A 2CJPA 3LDHA 2B20A 1NF3A 4Q3LA 1Y9ZA 3KE9A 2VYQA 4TN5A 2DX7A 2A1TS 3BKWA 3E1SA 3M6WA 4EEKA 5JBQA 6NULA 1UBOS 4EHLA 2FMHA 1FUKA 1SC3A 3LYHA 5DYWA 4UMDA 1R8YA 2JJ2A 4H16A 3AEXA 3HWSA 2WUEA 2QN9A 1Q0LA 1FTQA 421PA 4EY5A 4YFYA 5B1YA 4MNTA 1F17A 1OIVA 4CUZA 1VJTA 2IITA 2B9VA 1WXFA 5FA6A 4OI4A 2IPNA 1VA4A 4AIIA 1T15A 1XMPA 2H9AA 2DSNA 4UNRA 4ZHQA 3I61A 4KK3A 4LWPA 4PSUA 5SZKB 4MKRA 1E9CA 1EFVB 3WK4A 4TRRA 1JMYA 1H94A 1IBCA 2HJVA 1ZOOA 3DM9B 4JLSA 4YDRA 4POOA 4YJKA 4K3VA 4NZPA 4K81B 5BV8A 4EYGA 4FYJA 3L82B 1C3LA 2RI0A 4QVKA 3L0DA 5KSPA 3IQFA 2ANCA 2EF0A 3FKSA 1QPZA 5AIAA 2HIHA 3G89A 4CIXA 4JT2A 1WMBA 4YRDA 1EBFA 4IXDA 1WPXA 3GUYA 4L0DA 1LZKA 4GXRA 4B3XA 4PAWA 2W7TA 4KIGA 3GEDA 1A69A 3A1TA 4HNHA 4CKWB 3MOIA 1TECE 1QIHA 3PGXA 1SB8A 1WUJS 2VZEA 3UV3A 4DRXA 4HWKA 5TNXA 4GKBA 4K9NA 3NNSA 2GA8A 1CRWG 1JBEA 3VNRA 3T5CA 1RAGA 2COUA 5CIQA 3GC6A 1ZNWA 2ZIGA 5BN4A 1NQWA 3CO5A 1S2GA 3QENA 1OLUA 3A0RB 4M0DA 2M9MA 2EGUA 3W4IA 5IRCD 4L76A 1H3FA 4IGEA 3UV7A 3VSBA 4O4HF 3OECA 3R24A 4G6ZA 4NH4A 3WQQA 5A3QA 2BE7A 4KBYA 3HACA 3LCRA 1U3FA 1XCJA 3K0EA 3RRNA 3B48A 5I9BA 1VLVA 4FUQA 4ZO7A 2TS1A 4X90A 2R5WA 3DH0A 4TKZA 2GF9A 3BB3A 1RKVA 3LDAA 1Y5IA 4LRTB 5LN1A 3D4OA 4QT4A 1PI3A 4BGDA 2YVQA 1NN3A 1TUGA 1Y4AE 2HMWA 3NATA 4HLUA 3O8DA 2I87A 3DEHA 1V1MA 5FIUA 5CNJA 1XZAA 3ZG6A 4Q7QA 1A5ZA 2G4LA 1C8LA 4URFA 1KVSA 1PYOA 2NN3C 2QJRA 4CEIA 1AZTA 4GX0A 1KQ3A 4CM8A 1HUQA 1A96A 4ZI7A 1S9DA 4MW1A 3ABZA 5KYTA 1E0DA 4LY6A 2GZHA 1T9GS 2EWMA 2V4MA 1DO0A 2IYUA 3SDBA 3VC7A 2QDXA 1QB7A 1QZZA 4TMWA 3U0BA 5F9FA 2ECFA 1V5IA 5B58T 1DXQA 4E5UA 3IXLA 1A9RA 1L7BA 2W2TA 4KJXA 1U2GC 2Q5FA 3B1WA 3EX7C 4IINA 4DWVA 5BURA 3LF2A 5EYPA 2JGFA 3D4PA 4LS3A 2DRIA 3TLJA 1TADA 1AUOA 4NS4A 1TM3E 2ZVQX 1O87A 3IP9A 4LDJA 4TWZA 4XUGB 3M82A 3W5SA 2XF8A 3RPEA 1ISIA 5BSGA 1Z6XA 4PZZA 1N32B 2WE7A 1SHLA 4WWHA 4IXTA 5EHGA 1N6PA 4WJLA 1M1YA 1AZSC 4GE0A 3IR6A 1SWWA 4WZBB 1FVHA 1GP2A 1RTKA 3AUYA 3K09C 3MTJA 4RVSA 4CL8A 5BVGA 4H17A 5FUYA 3TBFA 1L0BA 1G6HA 2E55A 1UIMA 3G0DA 3ZDDA 2CW5A 4JGGA 3TW6A 3DWGA 3HFGA 5LMZA 3GGJA 5AK6A 3WGHA 3AVXA 4NX2A 4ZVMA 2GZRA 5EXDA 4MQMA 1ESDA 2G1AA 1IN7A 3QXSA 1XLUA 2P3LA 4G5YA 5DEOA 5JCXA 2WY2D 4R1OA 4WTOA 2QM8A 2RHLA 3HZRA 1MIOA 1T2VA 4NFHA 4Q4JB 1OSNA 4L5JA 2BEJA 1JSCA 3NBKA 3RAJA 2X0JA 1OFUA 1OKKD 2ZR0A 5ADHA 4MVXA 1TE2A 2JLXA 1LPMA 3DBRB 4HDCA 2JS7A 5AESA 4B7CA 2EZ8A 2QRJA 5KVCA 1KTIA 1IVYA 5KWEA 4J0GA 4RZXA 1I2AA 1OY1A 1QAMA 3G82C 3Q9NA 4DDTA 1SHUX 4A16A 1YZHA 2HY7A 3I01A 4X6YA 4XFJA 1KDTA 2YIJA 1G3UA 4G3XA 4JASB 5FR2A 4X65B 1TVKB 5A0TA 1NNLA 3DDHA 4RCYA 1KFBB 4WNYA 4X5OA 4RA6A 4KIUA 2JGDA 5JDCA 3ZKAA 1L3CA 4UUBA 4FOPA 5DT9A 2JIZD 4RABA 3GRAA 3B3JA 3FSGD 4XIIA 1ZIXA 4E5YA 1PBNA 2QX7A 5EQFA 2RGNA 5AKHA 2PKXA 1HQKA 2EZUA 2XMQA 2H00A 5F76A 3O3NB 1FFHA 4OFWA 3DOIA 1K3UB 2I8LA 4DR4B 1U2RA 2GDZA 5C4MA 4XLTA 5JDCC 2GZ3A 1KR5A 3IAM1 3R3YA 4PPNA 1USUA 3V4SA 4CLRB 2D7JA 5JPDA 1GTVA 3AQIA 4UQPA 1IE3A 2IYWA 3JCZA 3CLUD 4PPFA 4R1NA 1DRJA 4XAQA 2CXUA 2VOEA 3D3WA 5B3JA 1OX4A 2OYSA 4ENSA 3S8YA 1X9HA 1DKRA 2C5GA 3GRRA 2C92A 3OM8A 2WWWA 5EHNA 5EPUA 2G5CA 1UC5B 1FC0A 1MJFA 4GLOA 1Z29A 1N5RA 2WU4A 1KPHA 4GDMA 3RVMA 4FDUA 1M34E 2IKSA 3SIXA 4B74A 4F3NA 4WK0B 3AUJB 4DNPA 3NWJA 4L9SA 1PIWA 3RS7A 3SIPA 3NYIA 5KTRA 2V58A 3N8HA 2Y1CA 4I5FA 1WXWA 2X3UA 1Q7GA 1RACA 1M34A 3EZLA 1U2QA 2HQSA 3N8NA 4UNPA 3EC1A 1L1FA 2TECE 1LGYA 2HWXA 1J24A 1M76A 3N2EA 4YONB 3LT4A 2QYHA 1FP4B 1PX2A 2H1HA 4UNSA 2YV2A 4E5VA 2B69A 5IW8A 5C5EA 3G6KA 3GFRA 4WOCA 3HC7A 4GAEA 5K2MA 1BMFA 1A2OA 1WTAA 4R8VA 1OZGA 3LQ4A 3GYGA 4EO4A 3TJZA 3G8CA 1FQKA 1N6LA 2N9UA 2O7NA 1XWFA 3M9WA 2NYVA 1WBJB 2ZPAA 2QRKA 3FOBA 1SGWA 3KVRA 3RLFA 3QX9A 3VOAA 4WBXC 3ZGLA 1JKIA 4QHSA 2OECA 1EFRA 1H2XA 1PO7A 1CQJB 1RKXA 3NPAA 4P8RA 1E5TA 4AS3A 1PS8A 2QL5A 4AY6A 2AMVA 4QPNA 1RKBA 4KO3S 2L19A 2ORVA 1YQTA 3MWGA 4M7PA 4RPLA 1NW3A 3F6BX 1WB9A 3ZNQA 1VE7A 1RAFA 5KDOA 2BFCB 1AK1A 3KSUA 4JLMA 5AI0A 1L8QA 4BJ1A 1BXKA 1UWKA 1Z13A 5CURA 3GJ8A 3HCDA 4BN0A 1ZZEA 2BGRA 1UAAA 3UB2A 1P2BA 2QUJA 4XGNA 3HS3A 4B0PA 4NFLA 2R7MA 3K35A 4FI3F 4XX1A 5CNIA 2XHZA 3TLAA 1DPFA 3GDWA 4OYYA 2B4KA 3PNSA 3QU4A 4XUEA 4B3GA 1TZ2A 1ISRA 5G1PA 4ZXPA 1SM4A 3SEZA 5C7IO 1JLRA 4KH1A 2WYUA 3IA7A 1LSSA 4ALMA 2D0IA 1F8GA 1D6NA 1XMOB 4DR2B 3ELBA 3JQPA 3WL4A 1VSVA 2BZ0A 2UZIR 1KQPA 3IP5A 4FKMA 2P8JA 2ODEA 3WMRA 2QLJA 4K6OA 1TJNA 2O5RA 1UFKA 3ENQA 2P65A 2P91A 4Y9SA 1BJKA 3SYLA 3H5OA 5E4FA 4DMHA 1QZUA 4HZGA 4QQ8A 2CYBA 2I2XB 3FM9A 2WF8A 5B3AA 2DOKA 2CUKA 2CLOB 4EO9A 2GAIA 2RCNA 2ZE6A 2OFFA 5EXEA 4ZOQI 1KEVA 2HPVA 4B43A 5HHTA 2IEIA 4Q21A 1H23A 5KDDA 2AD5A 1HE1C 1JEJA 2WLSA 3I73A 1SBHA 1QIIA 2BTQB 3Q0IA 4HDMA 4YP7A 1I3NA 4Z49A 1YK0A 5KOHB 2IHYA 1Z28A 2CCKA 3H17A 1W94A 5KYWB 6ABPA 4LF6B 1BVUA 2XZOA 3PWZA 2HT1A 1E2KA 2PVSA 1L5NA 3SN6A 3V4ZA 4PE5B 1I2CA 4O4JB 3I2IA 3DGEC 4ND3A 3BGSA 1GPMA 4ZVRA 3EISA 5JQGF 4DSTA 3M6AA 4F3TA 1JU9A 4IMPA 1O2DA 4MGKR 3W5UA 5IG2A 5KS2A 1G7CA 2PNFA 3IE1A 4G63A 3WO0A 3NAGA 1UODA 1Q77A 3MGBA 2GCOA 3MTAA 1NMXA 4PTLA 3GLTA 3U2QA 1RXSA 1V45E 2BT4A 4JI2B 2XW6A 1ZUWA 3WB2A 1U9YA 1DO2A 1S8AA 2ZSKA 4E3WA 3EEOA 1H0KA 2GXQA 3FRJA 3TLKA 1ZOIA 2C95A 1ANKA 2O1EA 2OV3A 3FSJX 4LJYA 4ND8A 1NFFA 3NHJA 3P9NA 4HUQA 4JB0A 4WZZA 1AN0A 5AK0A 4JLKA 3PX3A 3VSEA 4AY3A 5KWJA 3GLIA 1YA4A 1EAYA 5K3CA 4RFSA 4WZAA 4MSUA 1KNXA 5EWMB 4OB8A 3ZCTA 2HF2A 1FSZA 4RUKA 4BJ6A 3QVMA 3NQ41 2X4DA 2AK3A 2ZYVX 4C0KA 3QLUA 3BRWA 4DLWA 2BW0A 3ND9A 1KP3A 2O3SA 5EE0A 3SF8A 1S7GA 3QJGA 3SNKA 1MVNA 3PNYA 4F9FA 5BSKA 3OZVA 1CULC 4MKHA 1VG8A 1QFMA 5E38A 4U7DA 2H1FA 1CYDA 1UADA 2D1SA 2P2YA 4HH3C 1JHPA 5EG5A 3DMRA 2FPGB 4TV9B 5BW6B 1DAIA 1IN6A 3A1SA 2H6EA 4G26A 1NTRA 4KGZA 4UDYX 4BFSA 3AIKA 4JLVA 4D0GA 1UOPA 2HK7A 3I34X 1T6YA 3ITDA 3PV0A 4XOIA 1KI6A 2W8BB 2NUTB 4PQGA 3KVYA 4ZT7A 3W6UA 2Q0XA 1OB5A 3HP1A 4YRSA 2I3GA 4UBJA 4MR8A 2AG1A 5ADUS 2ZBVA 1NUUA 2J3EA 4FD2A 1BCSA 1G8AA 4AKEA 1DOAA 3PE6A 2DFVA 4P22A 1DTWA 4PAGA 4QWMA 1I4LD 2DQZA 4RQBA 5HZHA 1E3SA 2HFJA 3VVMA 3PXXA 2O3TA 4C14A 1I6LA 3LDFA 3B9RA 1UDRA 1JR4A 4N5NA 1YBMA 1WF6A 3JYLA 3KEMA 1KMNA 4M86A 1ZXLA 3E5NA 3QK7A 4P33A 4ZAWA 3UOWA 2QBYA 3EUAA 2EBHX 2ZYSA 1RP1A 2ZZKA 3KDAA 1XZMA 5FV7A 4EPWA 1N25A 2AFIB 2WF7A 1OJLA 3EMVA 4ZDKA 2C0QA 4KSBA 3ZE6A 3Q6NA 4FDMA 2XUAA 1FXSA 3TNFA 1B7GO 1GKKA 2D4HA 1DWOA 1ZXXA 1PQUA 2J0UA 2YN0A 1NOIA 3KFVA 3F9RA 1VJCA 1OI3A 1UMKA 1BKDR 1ZGHA 4MVJE 3HM9A 3EC2A 1RW4A 4LXUA 4LGVA 4B6EA 2PMFA 3VU1A 5A1JA 1JH8A 2E6UX 4DEVA 3AETB 3KPWA 4XX0B 3UWSA 4EKGA 1CY6A 3EA5A 3SSNA 1ZM7A 2G72A 4UAVA 3RIGA 4RD0A 4UOZA 5DLDA 1Q74A 1R0BA 1S7CA 1SURA 2NUAA 2BWJA 3BSYA 3KEGA 4RH0A 5HJ7A 1XTTA 2XYPA 3W2TA 4CCYB 4R8MA 2CLLB 3ME5A 3I1IA 1YL7A 3GA7A 4HAVA 2GEKA 2IYSA 2WWGA 4M9UA 4LA4A 5DX8A 1AMOA 3M0EA 3T7RA 1A7KA 2ZEJA 1L7RA 2VHJA 2WYWA 5A9RA 5K0EA 2BGTA 4E7PA 3F1KA 4X62B 2JVKA 2J85A 3W4KA 2XGJA 2LDBA 3PEVA 4JLUA 1KWKA 4NOJA 2G09A 4RJJA 3KE8A 2JZCA 2PKQP 2WIGA 3NGLA 1JKMA 5F9HA 3D02A 2QKYA 4PVDA 4CMAA 5K01A 1ODCA 2ONCA 1ZIYA 2QS9A 2WNHA 2X13A 5JW6A 1R0RE 1TKBA 2FQXA 3DAYA 4I5IA 2Y93A 1Y5LA 2XOEA 2AWOA 3D3EA 4QUDA 2D06A 1NYQA 1MOPA 3FNFA 4H3KB 3CN7A 5DGDA 1P3JA 5KAMA 3VR5D 4U3JB 4R0MA 5CA1B 2GAOA 1UEXC 2PIAA 3CKMA 1GDDA 1IUKA 4AUMA 5L95A 4JMLA 1WMSA 1Y6JA 1C81A 2WIKA 3ICOA 3OPMA 1RXCA 2ZWOA 4NYIQ 4P93A 3PD0A 2JG3A 2CJYA 4QO8A 1QH8A 2J5RA 2ZROA 3EIXA 5LQAA 3JD4A 3CY6A 2VQFB 1YMUA 1CJMA 3X1JA 3IAM6 4DEYA 4OSPA 2DQYA 2VRCD 1JFFB 1W88B 1TYEB 2C59A 5JIBA 2QPLA 1NUTA 2ZB4A 1YIDA 4G56A 3UK6A 1PQYA 2OYCA 2I3AA 1QLJA 2V7EA 4B3RB 1W4BA 1D04A 2O3RA 1JMVA 2P0EA 1IG3A 2Y92A 3QEJA 4PLYA 4Q01A 1DUIA 5BR7A 4PYIA 2GNAA 1IATA 2ORED 3M34A 1H9CA 2WFLA 4LISA 4BNJA 1RXVA 3UAYA 1YHZA 3ZGXA 4ZOEA 1L5KA 3G5LA 3EAQA 3TE6A 1Z07A 4NMLA 4O33A 3T3HA 4NCXA 4B4UA 3IC5A 2PANA 1H2HA 3PRHA 1WXIA 2DJIA 3A05A 2Z5VA 1I4DD 4XCXA 1H93A 4R1PA 4CV0A 4WLEA 2YINC 3EASA 2LUOA 3VQTA 3AESB 3RHFA 2OM6A 3CT6A 4JAVC 4YRZA 2CNLA 4TWBA 4BEJA 2QMUA 4LE1A 2JF0A 3H04A 4DLAA 4B83A 1TXGA 2W83A 3MIZA 3LPLA 5I8ZA 4EG5A 4Q3AA 3DMFA 4HWOA 4MI3A 3SC4A 2PRKA 1QH0A 4ZP1A 1EUYA 5CLLA 2C4WA 4W1RA 4DQXA 4YQFA 3EF0A 1PLKA 1C0EA 3DDNA 1SUIA 5CDFE 5B1SA 2ICAA 2O07A 3SI7A 2JI9A 1QVVA 1A9XB 4OJYA 2I6TA 5LDGA 2F3QA 3ST7A 2CNDA 3QFTA 1FFBA 3QVXA 4KNWA 3LU1A 4LXTA 5IMSA 4FU0A 1A9SA 3AI1A 3RU2A 1A72A 1KJJA 2WHQA 4FC6A 4RE5A 4HN2A 3T0FA 3UJHA 4NWIA 2V7QA 4KLNA 2XE8A 4IEFB 4NIMA 3FYUB 1IUOA 5JOQA 1XEWX 3ILHA 2JHGA 3UG6A 3WGIA 4TTVA 1IHPA 2G9VA 4O4LF 4JITA 1FUEA 3GZNA 3FSRA 3DL2A 4PR0A 4DQUA 3RBAA 4AF6A 5H4GA 5AVSA 4LNUB 4NJEA 3OE1A 4G0WA 4WY5A 4KXMA 3VAAA 1KEUA 2JEOA 4B6QA 1ZW6A 4LUCA 4PLZA 3SQNA 4A0FA 5KVSA 1PG0A 1W581 3TFQA 1QG6A 4JB8A 4DUGA 3PG5A 2QORA 1DI0A 2VT3A 3PR1A 1J20A 1AT1A 1L4EA 1MQSA 4LXQA 1GGVA 3PUVA 2GFHA 2WF9A 3TSCA 3H6HA 4PWZA 4DDMA 3FOFC 1RVV1 3LBNA 2QZ9A 5FTWA 4J29A 4LCBA 5DHUA 2P41A 3RRFA 2PYZA 5BV7A 3KR2A 3X2FA 1AUPA 1G2QA 5AH0A 3B1YA 5LLSA 2EYQA 5YASA 3VR6D 3OM0A 4X85A 2PEYA 1YIOA 3Q1KA 1V8ZA 1W2HA 2BJWA 2XX3A 3K0FB 4JNCA 4L22A 2D7DA 5CW2A 3EFEA 2XUPA 3LUPA 2WSBA 4N6OA 4MARA 1SRQA 1WZCA 2F3RA 1JIUA 4O1MA 1PX0A 2GZMA 2DLDA 3BAZA 3TOZA 5C80A 4U6SA 1D03A 3WL5A 2FPUA 4PGAA 2CUTA 2G5GX 4WMLA 2I8AA 5AW8A 3NTQA 3ELWA 1N5IA 1SKUA 2PLFA 2B4TO 1JT2A 4YRCA 3HFRA 2FMTA 2WTEA 4NYMQ 3EIUA 1LNZA 2B4QA 4OFXA 1NVUQ 3DMTC 2BY4A 3UJCA 2HF7A 1B76A 4V0QA 1HNNA 1EK2A 3IKJA 4QIHA 1QHIA 1ZNXA 4TVBA 3ZHQA 3B12A 1JLKA 1MDFA 3X2SA 1JFLA 3B1FA 1TTTA 3NR2A 1E0JA 3WXMA 1RPZA 3IUEA 3QPAA 2H7VA 2WT8A 4ITUA 4A0RA 2GZ1A 4Q93A 4Q6WA 2IOYA 3B3QA 3TEFA 5TMEA 1CLEA 4B6GA 2GUWA 2QVGA 1P4RA 4ROSA 1G2IA 1YE3A 2QAGB 1ZJ4A 4HQ6A 1CUFA 1ARZA 3NKLA 3HZZA 2C20A 3BCSA 1ADJA 1TT7A 1U9JA 1LPBB 4RIEA 2C3YA 3QZUA 1OXUA 1WZIA 4ML3A 4MWOA 2H4ZA 4Y6SA 5CFRA 1XL0A 1T29A 3AERB 3FGZA 3HUUA 3MMXA 4X71A 1QHFA 5CR9A 3UJDA 3TTVA 2D13A 4Q39A 4OGWA 1KDZA 1RXUA 3RTDA 2RHJA 3H2JA 4ZI5A 3DV0A 3T06B 3RSSA 3W06A 2AZXA 4NRDA 5HG0A 1SR8A 3P0EA 1DRWA 3LM8A 3KVVA 4IGFA 3N2ZB 4ZO9A 3AW8A 3DTVD 3K8ZA 4H6XA 3IVAA 5CX4A 1KARA 3ZHVA 5LBTA 1ZOSA 5ITWA 4N5IX 1ZUNA 3V46A 1L4MA 2CDCA 4MGZR 5B7PA 1SVMA 1WPRA 1ECLA 2XNKA 1JIXA 5CCEA 2JIQA 4RF5A 3RK1A 2XTNA 2UVPB 2HBYA 5BXQC 4UM5A 4UCFA 5BQOA 1QAOA 1R6BX 5EMMA 1AK2A 2BGIA 1G6Q1 2JHFA 2JRCA 1J8QA 3M70A 1GGJA 3QW2A 4N01A 3PGKA 2D8AA 3HVUA 4OAPA 2NUBA 4QHTA 2HUNA 4REMA 3V6MA 3HKBB 2PZLA 1UXIA 3UMVA 5JZBA 1V7ZA 4B09A 1Q1BA 3UB3A 1WIWA 2ZBGA 1IWBB 1TQ4A 1WHSA 1Z38A 1X1BA 1YVRA 1ONBA 2H2FA 3BMXA 4PYJA 4ND7A 1GSIA 4E7OA 2OHJA 4GKAA 4B87A 4H7EA 1ML3A 1BMDA 4X1IB 2RB5A 4XXHA 3JX9A 4ZIRA 3EZ9A 3HMKA 1E64A 3EW7A 4XWKA 2EFHB 5LSAA 1CJKC 3B60A 2B99A 2GTIA 5EESA 4RK1A 4PG7A 4XYBA 1G5RA 2IOHA 3G9XA 5CMLA 5J23A 3ZXYA 1YQDA 3CH7A 2A86A 2RDMA 4MUFA 3RBVA 5GIOE 2DECA 3IEVA 4NYIR 1XU7A 2H0QA 2C5FA 1YR9A 1XHFA 1ULTA 4UU0A 2AJCA 3VYRB 5LXTA 1H6BA 2J5XA 4XQ9A 4KQCA 1YVUA 4CMKA 3QYAA 5CNMA 2F3SA 2QGNA 1ITZA 4P84A 4W99A 4EPRA 4GBGA 2EFYA 3F9CA 5HJEA 4MHTA 1E2EA 1Z4KA 1QH9A 3DOUA 3ADDA 3PENA 3BXFA 5BSMA 4CN8A 1E3TA 1Z4NA 3CUEF 3WYCA 3VO2A 4DG9A 7MDHA 4CRWB 4HADA 5DDIP 3AVVA 4DRYA 3WP1B 1T2DA 2A9RA 1NUQA 5KREA 2VTBA 4FZRA 3VR4A 1YCFA 2FW7A 3DLCA 3FCUB 3G79A 4LVUA 2H48A 4UULA 4B2IA 5JD4A 2MSDB 3O84A 4UUMA 1N6OA 2CXSA 1FS6A 1QTRA 4CXMA 4KFCA 3QE4A 3T7SA 2H1SA 2QSUA 3O1IC 5I9SA 1XJ5A 3IT2A 4P08A 1YNOA 2PM8A 3RTCA 4ZDIA 1DG1G 3WFJA 2C1ZA 1I4OA 4RMJA 4TT3D 3JYNA 3CW9A 2FEPA 4UUAA 2H1LA 1YHNA 1Z7GA 5A5VA 4C3VA 2FSUA 2FUG1 3OQMA 3SGLA 5E3JA 1CC1S 4NKRA 2RCYA 2F2TA 2RGUA 2PJDA 2VDUE 3LYUA 4R8LA 2WF5A 3TR5A 2GS9A 5E6UA 3PC8C 3C3EA 1YA8A 2H4XA 4S1NA 1Y80A 3AT1A 1VPTA 2KLBA 5KEIA 2YMMA 1T8SA 3MCTA 1ZMOA 4KW7A 1XZEA 1RPTA 2NSDA 2ZB3A 4KQGA 3Q9LA 1M1XB 3F4LA 4OH1A 1XNJA 3VZQA 2RARA 1QHXA 3MA0A 1Y8RA 1KQGA 1ONPA 5HILA 4OTZA 3EGVA 2QN1A 4XWGA 3U1VA 3VISA 1SVUA 4DDWA 3U5TA 1E1RA 1N5LA 3IA2A 2KS6A 1H05A 1C7QA 1UUFA 3RRBA 4BGVA 1MJ5A 1FFYA 3VYSB 2HK9A 3O21A 4JJZA 2IVFA 3VJKA 3H6KA 2O2GA 4J90A 1QGYA 4RTKA 1GAXA 3C1AA 1JG1A 2EHJA 4R9RA 2BGKA 3RK0A 3SFVA 4KRFA 3FVRA 2W2QA 2NZUG 2Q0SA 3R7FA 1P5JA 4P2BA 5ISMA 1RS0A 1Z9BA 3JQ7A 5FL7A 3RJ5A 1JW9B 5CJPA 3Q8XB 5AQEA 3U6BA 1UJ2A 3LKZA 4J4BA 3KT0A 4HMQA 3RO7A 3ZJTA 2QI9C 3GEPA 4DHWA 1SUCA 3E7WA 1V5FA 3KPUA 4LDNA 4DC0A 2VDNB 2CVFA 1Y4UA 3AXTA 5BT8A 3AP1A 1RJFA 1XRLA 2ZCVA 3T38A 4OLHA 3MSCA 3I0NA 1K7CA 1NV9A 3EEBA 1Q44A 3NWPA 5E1BA 2QD2A 4LRYA 3OOSA 5KI6A 2DUUA 3TH5A 1X15A 2PKCA 1IDN1 3C5WP 2UU9B 3KYJB 4JOQA 5FNVA 1Z56C 2JHAA 3RIHA 1DADA 3R6GA 4GRIA 5KOYA 4LFBB 2GCPA 5I01A 1EEHA 2VTKA 4B4OA 2R48A 2OK7A 2LXNA 3EXAA 1MFPA 5EEHA 1X77A 3NOVA 4N03A 1NBIA 4OD0A 2VQ3A 5IC4A 2QW1A 1W5SA 3CSSA 2VAWA 1Z18A 1PF7E 2Z9CA 4JL8A 4Y30A 5IEJA 1T4DA 1EZZA 2F62A 1OU4A 1T1JA 1TUBB 4WV3A 2A5LA 2I7DA 3D2BA 2DFNA 4BX9A 3IXQA 3JAWA 3PFNA 3QE2A 1H8HA 3ZV4A 2SKCA 4Q4CA 3BDIA 4JB2A 4QOIA 3VPCA 3LLSA 4C0BA 2XZLA 1L4FA 4W7SA 1JKJB 2ZUCA 3FYTA 1U7UA 3N2YA 1GZ3A 3KV1A 1DQYA 3R6DA 1XJQA 3ZLVA 3AUKA 2WAXA 3Q0TA 1YKSA 4G5SA 2QUZA 3V1NA 5KQGA 4V0ME 1N1EA 1OW3B 4X8OA 4BMPB 2RHDA 1X7WB 1MVOA 3TIFA 4JENA 3TQCA 3RUEA 3DTVB 4DLXA 4D3DA 1SBNE 5JC8A 1W75A 2R66A 4L57A 3OF2A 3NBUA 1HOXA 1PL6A 2XADA 4L95C 2PJZA 3KHUA 3GRKA 1AZLA 1CB7A 2PZMA 4Q18A 1W73A 4JP8A 3RG8A 3RYCB 4BQRA 3SCZA 5C35A 1FU7A 4C9BA 1YQEA 1DDGA 2UZ1A 2I9PA 4YEDA 2GVNA 4JR2A 3ZH9B 4MJ3A 1BHSA 2ZIUB 2YZGA 3IGFA 3L7YA 4DOMA 1YQ9A 2CXHA 3G8YA 5BQPA 2F43B 3GLHE 2VWHA 4TMZA 4I1SA 2YICA 2VAMA 2FFRA 2QNRA 4G9EA 2A8YA 2QE7D 3HCFA 4KGVA 2A3RA 4M8NE 2XWPA 1ZHFA 1WVMA 4HAWA 4ZOAA 5E8JA 3G2NA 1E2QA 1L6IA 1XV5A 3Q7SA 1IU9A 2J6IA 1AHNA 2J5BA 3DHWC 2WJJA 1J39A 4N7RA 4TZ6A 1IJBA 2XUOA 4N0PA 2EDCA 2WUFA 3H2SA 2VTDA 4PBRA 1DXYA 1JHDA 1WXGA 2OHOA 4FR2A 4JU8A 3LQRA 2A94A 2MTBA 3HJGA 3GLQA 3JQGA 4R3UC 3FOZA 4H0CA 3ZGOA 1RRCA 4KMOA 4HXFB 3G5MA 4ZGGA 5B7NA 4MQEA 3B7WA 2QPOA 3W8NA 1KMMA 3GGGA 2VYFA 4HF7A 3QLJA 3IVMA 3WLKX 3ASZA 2V0NA 1HE3A 2Z9BA 3WDLA 1KRWA 3Q8LA 1NATA 2IZ7A 3DAOA 1MQAA 3E5MA 1L1RA 2QTGA 5GJBA 2YQZA 3CLRD 4KN9S 3VBCA 3IMFA 1IK4A 1KJ9A 3V5NA 1TVMA 4M9QA 3TSZA 4RVFA 4MR9B 2Q5LA 4P80A 4ZODA 4ZRNA 3V34A 4MVJP 4C3OB 3TSWA 1ZD1A 3NHAA 4RIIA 3PVZA 4ZOCA 4XYGA 2IYOA 4X7RA 3QXXA 1LBIA 2JIBA 2PUFA 1U31A 3ANYB 3P2OA 4DA4A 2FRDC 2UUOA 3GLHA 4HFNA 4OA5A 1KOLA 5A6VA 4Y2SA 3LA6A 3CZQA 3HPRA 3DFFA 3DJFA 4L02A 4QUGA 3WLRA 2GRJA 3P7MA 4GX1A 1XTBA 4QXQA 2PE5A 1VOTA 4L73A 5DT2A 5C81A 1RKQA 4ZJZA 1E7RA 4QE3A 2Y4OA 3BHNA 1QKIA 4A03A 3IO5A 3KZKA 5LQNA 1G63A 1UC9A 1GCAA 3GLIE 4F06A 3OX3A 5ILOA 1DU4A 1D2HA 4RBNA 4O2RA 1HTTA 2YHAA 2WF6A 3LC1O 4DJ5X 3MSXA 3T9DA 1JILA 2ODNA 2Z2IA 3K20A 1W87A 3P71T 1F5NA 4DYVA 2VHEA 1WHTB 1T34A 1I1QB 2NZXA 1VI2A 3PWKA 3U4QA 2C07A 3CSDA 4QODA 2OB1A 4ACBA 1BW9A 3HUTA 1EDDA 5BYAA 3EUEA 2AYXA 2PQ0A 3B52X 2HGZA 3DZDA 3IVGA 4GMGA 3V32A 4DVJA 5KQPA 3S5UA 3SBOA 4D5GA 3OJOA 4KUHA 3ZHXA 3QIAA 4H77A 4H3SA 4BL5A 3P1JA 1GAJA 1NVAA 5F3WB 3W2HA 3LBIA 4S05A 1LDNA 2PO7A 3K16A 4JUIA 1ZEJA 3CRVA 3ZY3A 1VFPA 2J46A 5DGXA 1SULA 2KLHA 3KEOA 1U0EA 1BXGB 1QIGA 3ZKWB 1ENYA 1P4JA 4YUZA 5BUCA 2PRIA 1JXOA 5A3RA 5BV2P 2UV8A 3DZ8A 2WJIA 5J1SB 2V6FA 1W4AA 1IMOA 1V9LA 2Z98A 1X7YA 5DP1A 3CINA 1JR2A 3NTUA 2GI4A 4P7JA 4JXZA 5HNKA 4EKYA 4JV5B 4CKBB 1G20E 4WOBA 4P54A 4KI0A 2HT6A 4KACA 1IQPA 3AVQA 4I0WB 1EUCB 3MHPA 5ERGB 1XCGB 1ISMA 4I46A 4IQ8A 5IULC 3PDIA 5BR1A 2JFXA 5C8ZA 2HWKA 1E9RA 3E22B 3G1TA 4MX8A 1P80A 2E48A 3AP3A 1MT0A 2H1RA 3O4GA 4GYYA 5ER6A 4XGQA 1U2SA 3NTXA 4Y2TA 5TQ0B 5TXGA 2I65A 3IJPA 2F8SA 1XAHA 1Y42X 2LPMA 3KZOA 3N2NA 4D4IA 2DPYA 4CF6A 2AMFA 4DDHA 1NURA 1HYBA 1Y63A 5DWDA 1C4XA 4GOXA 5T57A 3ZIAA 5DI3B 5H3CA 4I4LA 4KVFA 3CHYA 1FDIA 4URYR 2POQX 3C6KA 4DCUA 4EELA 3AF1A 1CQXA 4N3NA 5F2OA 1C3XA 2G9ZA 2OHFA 1C9KA 3GIDA 3FJ1A 3HE3A 1ZCFA 4D26A 1B8UA 2ZSUA 1OFGA 2C8JA 4V0RA 3AM5A 5EJAA 1KIFA 2QG9A 3QFFA 4JP3A 2BHLA 1SMKA 1ZWKA 1TGYA 3P9SA 2CCJA 4LV8B 4QPZA 1U9IC 2OUIA 3SKXA 5E8RA 2ZWVA 3MQ2A 3K9HA 3QJYA 4OLJA 4R41A 1KH2A 5T8KC 3DMNA 2XXJA 3E5RA 4YJ3A 4N12A 5CVVA 1MH1A 2IIVA 4MQUA 4TT8A 3DXXA 5DW0A 3UWOA 3Q7IA 4WCVA 4FNAA 2R8BA 3UFXB 2W2PA 2ZTVA 3IE0A 1FSGA 1F0YA 3NXKA 3PNBA 4NENB 2ZSFA 4PSAA 4C4XA 1ZVVA 2H18A 1T6BY 2ZRDA 3HYNA 4NARA 5KC8A 4NICA 2C2OA 1RJWA 3STWA 5G0WA 4E5SA 3OU6A 3WDMA 1R4MB 1IEVA 3D5QA 4P0PB 4JROA 5ES3A 3IMKA 2BJVA 3TDMA 3PI6A 3ZWNA 3LHDA 3VYTB 5K4GA 1HX7A 2EG5A 3TJMA 4UU8A 3N0TA 2Y3IA 2ZB2A 4DSNA 1O1YA 4UPVA 1R4NB 4U2DA 4F56A 5J4YA 1EE9A 2Y1GA 1XOIA 4A0HA 1M2OB 2ADOA 4GMDA 1J8YF 1SIUA 2QSJA 4B71A 1DKPA 2XMPA 3C14C 1MB0A 3AUSA 5AJHA 5A4FS 5EJMA 4YJHA 2F8MA 1GKIA 2B8WA 4AN4A 4DY4A 1N0UA 4QXRA 5CBPB 4TYPA 4B0OA 4I19A 4CR7A 1L4HA 2VR1A 3HKDA 4Y6GB 1QG2A 1YONA 2ZP1A 1QIFA 1WB5A 1ZNYA 2GEFA 1WOYA 1WAMA 5LBUA 3W7VA 6YASA 2YWEA 1K7EB 4RCVA 1XMSA 2QM7A 2W37A 2ZQ5A 3ORRA 4L3VA 2FUKA 4LDZA 5KYYA 4PZPA 3E82A 3IAUA 2NZ2A 2GZ2A 5HK8A 4GP6A 4JYPA 4DCOA 1J97A 2BBTA 3K8YA 3PEEA 2FX5A 5HOQA 2AK2A 3O0DA 2XUJA 3JYHA 3LY8A 3T4EA 1SKAA 2JW5A 4PZAA 3GMDA 3LGSA 3LFUA 1ZESA 5JFGA 4EY6A 3LDGA 4LC0A 5TGZA 4URZR 5BQFA 4J6FA 3IV9A 2AEFA 3WLHA 3JWEA 4JLBA 3X44A 1Q7EA 3L93A 4IHJA 2BKEA 5K3OA 2VFAA 4ZYXA 4GLLA 2WDZA 4HN9A 1H1DA 5DNUA 3IDZA 1C5KA 1XA3A 2MMGA 2XUFA 1VL0A 4BFCA 3UJ3X 5KTSA 5B3KA 4EP1A 4RVNA 5CDHA 2IW3A 3BXEA 1KFEB 1WB4A 2B82A 2IQIA 3CRW1 1K97A 2X7HA 5JD3A 3HVRA 2KX7A 2IIBA 1YS7A 1RQGA 2XKBA 2WG1A 4EOGA 4ZPJA 4WK4B 1ECPA 1QTIA 4HWTA 4B84A 2QG4A 2ID8A 2W22A 3HYCA 2JBHA 5FL3A 1PNOA 5AUPB 5GZ1A 1C80A 4MP8A 1O03A 3ZTWA 2BEUB 2FQ1A 3C87A 3EVGA 4I4IA 3WWDA 2GPJA 2NNWB 4XDZA 2Y0PA 1EFTA 5CEEA 4RTMA 4Y98A 4F4UA 3L46A 3D9QX 1HRDA 5B7QA 2Y77A 1XN4A 4J1SA 4U8GA 3VNAA 5A02A 5T67A 4XTRA 3GY0A 3VR6A 1U3DA 3GT7A 1NN0A 4XQ0A 1G6KA 3RKRA 1NVVR 3KTOA 3PE4A 4JYMA 1VJDA 4HPJB 4NEGA 4U7JA 3SP1A 1TEZA 5A0VA 3HCEA 7REQB 1Y6QA 2WC1A 2E21A 3IVXA 2GARA 1NPYA 3MELA 1S3IA 1NW6A 4PLPA 1ML4A 5F33A 4TLMB 3LUGA 5BQ3A 2PFGA 2YN4A 1AQJA 3EA4A 3I2KA 3KCNA 4MB6A 3RYFB 1Q16A 3W90A 4EHBA 3G85A 3A6EA 1P73A 4GO1A 2XJ4A 5CA0B 3UMCA 3ZGZA 4NBTA 4Y2XA 4FMDF 3S3TA 2PX5A 3G8DA 2WZQA 6PFKA 3QA9A 3TXXA 1BFUA 3VTZA 1O6CA 1SH7A 5IUNC 1I9GA 1BTOA 1U2DA 3AR2A 2V1XA 2G77B 4A92A 5FTLA 3O73A 4UZFA 2OA0A 3IB6A 4ZCQA 3C16C 2QN2A 1ZNZA 3WMWA 1QDEA 2CB0A 3E53A 2FQYA 4HDNA 5JQGA 3N07A 1PR2A 3VTFA 1K8ZB 3COSA 4Y9UA 3DPIA 3GU3A 1NV8A 3AR8A 2ONYA 4HI0E 1NBEA 4H9GA 4JODA 1CY2A 5F9MA 4HDSA 4IVPA 3LPCA 4Y2RA 2BEWB 3QHAA 3TLEA 3K5WA 4QA9A 3EIOA 3FNIA 1NKTA 4OI1A 1Z39A 3F8SA 4MTLA 2FW6A 3G0CA 3BRSA 3O4IA 3A14A 4JOCA 4P1ZA 4KK4A 4CM4A 3RC8A 3AHHA 3NBFA 4CL2A 1ZJYA 4XVUA 4BEVA 3D6TB 1SG9A 1B8OA 2IU4A 4HX9A 1M72A 2RC6A 3GLGE 3K31A 3CNHA 4QRIA 3T0IA 1AKQA 4E4TA 1KE2A 4ZEWA 3EXHC 1ENOA 3C4QA 3KUDA 1N2SA 3I5UA 1UQUA 5AO9A 4I1RA 2BCEA 1XD9A 1SVNA 3A9VA 1ZS9A 2HF9A 4D9HA 5IJ0B 3O8QB 4O0LA 4RHYA 1K4YA 3MRTA 3FPBA 2REBA 3ROXA 4NZNA 1XZNA 1U1FA 5AUNB 2ZB8A 4RIFA 2H1VA 5TJHA 2FG6C 2VRCA 4GP9A 1MF7A 3REQA 4R69A 4Q82A 3VC1A 1K92A 3AF4A 2A6PA 2R68A 1EUDB 1DCKA 2R751 1RQNA 1G19A 1T1EA 1X1SA 2WEKA 3HCCA 4BB0A 4WJZA 3ROMA 4GM0A 2DR0A 4UPEA 2AEMA 2QTVA 4B9EA 3QV2A 1Q1GA 2ZUUA 5LP1A 3TQFA 1IY1A 2AFIE 5KYXA 1CZKA 1IN5A 1Z8FA 4F4FA 1DIRA 2IJGX 1TT5B 4ZU1X 2X4IA 1GKLA 3FNHA 4QG7A 1A8HA 1CUEA 5EZ5A 3COPA 4N40A 4EZEA 2FDCA 2OCDA 1CBUA 1EXMA 3NS7A 2FY8A 3LZDA 2IOQA 4PX5A 4RVUA 2YWFA 3QLVA 3OFJA 2AZ4A 3RUHA 1GWNA 3QVGA 2PGOA 2VK4A 3EAGA 4UW9A 1VG0B 3JR7A 4DM3A 3R8FA 2I2BA 1CZUA 1P18A 2BEVA 4H6PA 3HRHA 1P0CA 3SIWA 1OFIA 3GCGA 4E2YA 2ZANA 1NMYA 3DA8A 4HPXB 3KPYA 4BDSA 5MN6A 3RK4A 2ZSBA 3TW8B 4PVCA 4W4TA 1TF2A 1KY2A 1LQ2A 3K9QO 2IHBA 5I4CA 4KDEA 2FVXA 1UMCA 3SPXA 4EF4A 2QX6A 3OZUA 1M6VB 3Q7EA 2LKCA 1U2TA 3BCHA 4NJMB 4O4IF 1FFCA 1R6AA 4PYKA 1KJZA 4DMCA 3TQRA 3GWGA 1N7HA 4DV5B 4WL0A 4RVGA 4NDNE 4AVYA 1M1ZA 5FPSA 2TMYA 2ZJAA 1U0TA 2RONA 1VKZA 1Q17A 5FF9A 2ZUFA 5H80A 4Q9HA 4FHFA 1S01A 1T3GA 1V95A 3OEWA 4QNNA 1OTYA 3IESA 1PWHA 2M1XA 4NCJA 3ZVMA 1A9PA 3NASA 4IQFA 4JVOA 4B8WA 3X0DA 3V9PA 3CRNA 5I9NA 5T64A 4LF5B 4PZ0A 1W47A 1ZISA 3ER9A 1PGJA 2IBMA 2H85A 4II2A 2C58A 2F9FA 4GX5A 5FPQA 5DYGA 1LDBA 3NB0A 2HK8A 2OGUA 3WICA 2M2IA 1H0RA 1TTPB 2Q62A 1CVRA 2QU8A 4N5HX 3UQZA 3P9IA 3OTOB 5TY0A 3WIDA 4V3CA 2IWRA 4P3OA 2C7GA 1M0EA 2FE1A 2WP0A 4AG3A 5IBPA 4B3TB 4E6EA 4UQLA 4EI8A 1B1CA 4PLWA 3CYFA 1LBEA 2L82A 1E8MA 1K5DA 4FT4A 4OSOA 5FDFA 2QVYX 4N18A 4NCHA 1UINA 2OV6A 4KFSA 5ELXA 2OVBA 2ZS9A 4MKIA 3BPSA 1H9BA 4Y1RA 4PGGA 4B3BA 3IPYA 2ZBRA 1M74A 4FW8A 4AZ3B 3KBBA 1EA7A 1MX9A 3FPEA 4TZKA 1YHYA 5CB6A 4GR5A 4GEGA 3VNVA 4U6NA 1T4CA 4AZ0B 2QLNA 3B3FA 4M1KA 3RROA 4B79A 1WP9A 3VH1A 3VGPA 5BMOA 5JXWA 2I1VB 2I76A 4MUXA 3PNKA 3PQ8A 1RHMA 2H1WA 2Q7OE 3B1XA 1RQ2A 1IQ0A 3L18A 3CVXA 3EHEA 1U7TA 1H3NA 2GD6A 2PPLA 3QBEA 5LL6P 2JH8A 4AECA 4NZOA 5BWLA 1JHVA 3FF4A 4DA9A 4DN6A 2HJRA 3C5EA 3DG9A 1M9NA 2ANBA 5ETJA 4J2TA 2OD9A 5JCPA 1JB9A 4B3JA 4XLZA 3MB8A 5B7GA 1JDBC 5AJXA 2C7RA 1GQOA 3M5WA 4GP7A 5CDUA 3H9EO 3PQDA 5M34A 3KB1A 4FINA 5ALNA 1W6UA 1G98A 3EVTA 3C85A 4CCWA 4LCJA 3LLCA 1K8YB 1X1EA 2Y05A 4P0TA 1YWGO 3GGSA 1U63A 2D59A 3U7QB 3AC0A 3NIFB 5JSHA 1NBAA 2WZDA 4ZAYA 3HK2A 2HO5A 5DYNA 2G28A 3RC2A 1DKMA 4Z4QA 1AGNA 4HOYA 2WDPA 4GXNA 2HWWA 1IC6A 1PL8A 1V11B 2OZVA 4BO2A 1XZHA 1E96A 5FWNA 3KTAB 1GPWB 2QIPA 5EZYB 2QMHA 5INTA 3F6RA 3Q3EA 4MYHA 5TC4A 1REQB 1I94B 2C9ZA 4BBAA 4KP7A 2J9YB 4CM5A 4KMRA 4MS1A 3W7AA 5AK5A 4MAFA 1DNPA 1KSFX 3ZXXA 4IFTA 3ZCQA 5GZ3A 4GSLA 4KDFA 2VXCA 1QS0B 2R8XA 1OPRA 1G21A 1WMEA 4ER0A 1S8NA 4LYDA 3RUPA 3FPFA 4QU9A 1ZMXA 4DG8A 5HKAA 5F4ZA 3AM3A 5JHGB 1GL9B 2X22A 4GPD1 3QEAZ 4YAFA 4C6SA 4MWEA 4U63A 4EF5A 1W44A 1Z6AA 1H4TA 1TYAE 2OMEA 4AXBA 1JHRA 2V6JA 3FFAA 3VA7A 4MRAA 1H2FA 1KAMA 2RKBA 3H8VA 1VKOA 2IDJA 4ZWNA 1HFKA 1NBMA 3KBOA 4MZDA 4X45A 4HVTA 3GPIA 1RNLA 1CF9A 2MYUA 7MHTA 3ZZNA 5LZ5A 1DKUA 2G17A 3BXPA 4F2WA 3P97A 4KSCA 1NR5A 2F9LA 1N2IA 2V03A 3LWNA 4BUCA 1PZFA 3MCVA 4I4TA 1WSBA 4HWPA 4N5DA 3VKWA 3BF8A 3DNMA 1QRSA 1ZK1A 3DWIA 4BKQA 2WTBA 1XWWA 3DZGA 3L06A 3ED1A 3Q88A 3HHPA 1QKJA 4MRVA 4YB8A 2GBCA 3SZUA 2DWPA 3TM4A 3VDQA 1HV8A 5EWJA 3IP6A 4WKBA 5T4FA 3ZUGA 4D97A 4DLUA 3N28A 5H59A 3RIMA 4YP6A 3V48A 1XXHE 2CWWA 2DPLA 2H5EA 2V9ZA 1ECGA 2XVZA 3DKRA 4TRNA 4B44A 4DIOA 3G49A 5ENDA 3LT1A 4MIKA 3ZE0B 2KPOA 3ZCSA 5DWQA 2VSOA 5HOEA 2P5SA 1E6EA 3ADOA 2GMWA 5HIMA 4D79A 3LCVB 4L16A 1V8BA 3VDMA 1P1HA 4EUFA 5BV1A 2AUTA 4WH0A 4IOMA 5E6RA 3PDUA 3UVEA 4EB0A 1HK7A 3Q7TA 1KI2A 2QTMA 4INJA 3COZA 3THSA 1DCTA 4PFJA 2A5JA 3JQBC 1KPGA 1JBQA 4RAQA 4Q3OA 5KMGA 1X42A 4H3HB 4JI8B 1PV4A 4DCMA 1DAHA 3HP4A 3QMPA 3OUUA 4QFCA 5HS4A 3KJGA 1W4ZA 1JLLB 4PGFA 4QUBA 4U2GA 2CMFA 2A1UB 3BE6A 5J9FA 4EPYA 1BMFD 3WLQA 1ENPA 3ZCVA 3HKEA 4UXIA 4RDCA 1W1IA 4F6LA 1I24A 4AROA 5AVVA 1EYZA 5FPPA 1IUNA 4DDKA 2OUKA 3BMCA 4NCKA 2RGEA 3FIUA 1ZHHA 2F64A 2G9RA 2YHBA 1S89A 3O8OA 4L2IA 4YK7A 1GAWA 3ZWCA 5KYGA 2P2ZA 3BK7A 3MWJA 3T41A 4BAUA 5JS6A 1RZRA 3MLAA 4IJQA 4KU4A 4G9BA 2DVMA 3C4VA 3EXEA 4E15A 4EM6A 5CB4B 1FMCA 5LIPA 4IIXA 4BV8A 2JH3A 3OT4A 5DRTA 4F86A 4V0SA 5D3MB 1PQWA 1BA3A 1E3WA 2CD9A 1MX5A 1JZQA 1A7JA 1KKUA 3T3IA 3D1VA 1WZEA 1Z73A 4YAJA 4CR6A 4DMUB 1TZMA 1BN6A 4LTDA 4YCDA 2QUBA 3UT6A 2D1TA 1XMQB 4ZALA 1U7WA 5J4KA 2CVOA 3LH5A 1M6EX 3UIEA 4JBNA 2ZSIA 2XD9A 3HCRA 4F3KA 1F5SA 5I51A 5KTTA 2VQEB 3LSYA 3HFSA 1AVTA 2OBBA 3WIBA 2DH6A 4REQA 3H11B 1AMNA 4XJSA 3AVYA 4UHFA 3VKFA 4CWAA 2V7GA 4L4UA 3HLKA 3KS9A 1O96B 3M1IA 3TECE 3CZCA 5BOVA 2BHRA 4G86A 4CPDA 4ALIA 4IS3A 3W5BA 1JQAA 3BIJA 3A3YA 3GLFE 1B41A 3ZE8A 4QXMA 3KV3O 4W1PA 1TYCA 1UOQA 1ZKDA 2GBLA 1TEHA 4OHRA 4EDHA 1C0LA 1JMKC 1L7MA 3O8LA 4P7FA 3U4AA 1B26A 3KKLA 4OMCA 1GNTA 1XJWA 3CJQA 1HDYA 2Z8ZA 2ZIVB 3FUXA 4O8CA 4YQEA 1GGEA 1ISFA 1P9RA 4BWYA 4EFLA 2Y1KA 4FD3A 4L8FA 2DWCA 4BU0A 3JQFA 1D8TA 2G9QA 4PNEA 4TTTS 2QP9X 3DVAA 2WAMA 5DIZA 5FAKA 3LBAA 4MYCA 3A6PC 5TPWA 5KIAA 2BF7A 1NTOA 1A8PA 3TLMA 2O2HA 3L1VA 4Y2GA 2C00A 1JTFA 2BMWA 3FDZB 1YH3A 4F9TA 2QPTA 1RFGE 4HH1A 4ARZA 4B3DA 2PD3A 4D43A 3UK7A 2FB9A 2N75A 1T9DA 4E2ZA 2KSQA 3FZEA 4FYKA 4J16C 1U3WA 4Q1AA 5IKMA 2C96A 1LPSA 2PWPA 2A88A 2IYNA 4HGNA 3L9WA 3ZI7A 1DG9A 3MW8A 1PE0A 4PONA 1JRLA 3ZV5A 3HCOA 3SAJA 4ETIA 4K6GA 4EJ0A 2B1IA 4RVHA 4AY5A 3AG6A 3L8ZA 3BF7A 4H1TA 4HWSA 5JE8A 5FYQA 3ZU3A 2QGZA 3AHCA 4MKXA 3L8DA 4YIKA 2C0PA 5A4JA 5LQMA 1K9SA 2YWDA 1RPJA 3LKVA 4CFZA 4DCSA 3VBEA 2K4MA 1GG8A 5JWOA 2ZJ8A 3CLSD 4FSXA 1PJ3A 1V8PA 2FP4B 4HDKB 4UVDA 4X1KB 5AT1A 5HF6A 1ETUA 5KX5B 4Q1FA 1U7XA 2O7QA 4IVNA 1R9JA 1XRJA 5ALKA 1S2MA 2ZB7A 3WB0A 2ZSDA 4RZ2A 2B4RO 1MC8A 5IT4A 2GUGA 2EP7A 3AVOA 2A4MA 3O1JC 1MW9X 2MSKA 4OQLA 3VR4D 5L4LA 1A71A 2Z2YA 2D8MA 4R2LA 4A15A 3D6UA 4HATA 4BMVA 1XQ9A 2O1XA 5FULA 1ORRA 2PU7A 3BHMA 1J9GA 2AI3A 1Q21A 3BMNA 4Q7MB 2W2KB 2X9NA 1WCYA 3E03A 3MRSA 5FEUA 3LT2A 2VF4X 2PLNA 4GVPA 4MPDA 3CRRA 3MQ4A 4BNZA 1XNQB 4GU5A 1AGXA 2P2DA 3GGPA 5KQLA 3DQQA 3I5XA 3EOZA 1NX9A 2Q7XA 1K7YA 1LV7A 2XDQA 1V4VA 3AZQA 3D3KA 3SC2A 4TVSA 4ZT3A 2I6XA 2CD7A 2FUCA 1FVFA 1M8PA 5HFAA 3C3WA 3DEYX 4EHFA 2VRWA 2QQGA 2VHZA 3JAMA 1FB5A 2Q5EA 3JSXA 5JEEA 2ZE7A 1VC2A 2JGRA 3GN1A 3M6FA 1NW5A 2HA7A 1NXXA 1L7AA 4C87A 4DIUA 2VA8A 1VJRA 1XQWA 2QA5A 5FUVA 1IOZA 4BMZA 1BDMA 2DPHA 2XVAA 3OTHA 2Y1EA 1K6JA 3WSWA 1UOEA 3U7IA 2PZKA 2RGNC 4KPYA 3VPBA 2QUKA 1Y3DE 1RC8A 5T3YA 2YYAA 2BKXA 1E5DA 2BYTA 1DHRA 5G0SA 1VHWA 2JRLA 2Y27A 1LSOA 5BNFA 1M2JA 2B8JA 2VSYA 1SPBS 3C6QA 2F8TA 9LDTA 2QTRA 2IUTA 3DL4A 4B4DA 4W5TA 4DV7B 3JQFC 1ZVMA 3HA3A 1YZYA 2OWEA 3LC7O 1YS2X 3E15A 3ZIAD 4J0HA 1CUDA 3DDUA 3PQ4A 1EGAA 4NU8X 1HDIA 1MNAA 1U1DA 1XDBA 4F93B 1UBRS 3TPCA 3UJ7A 4L4SA 1W5AA 4MWDA 2Z9DA 1L7PA 1YZVA 1JA9A 4N7JA 3SJAA 1QMPA 1ESCA 1PGQA 4DR3B 7YASA 4ZQIA 5L3RA 1MZPA 2NIPA 3KD2A 3KDPA 2VWQA 4TS1A 4LJAA 1J5XA 2XUIA 1IONA 2QLBA 4M1QA 4OXQA 4M0EA 5FB3A 4DSOA 4GHWA 1J8MF 2BL4A 4HTFA 2LCFA 4X20B 3T3NA 1ZD9A 2CZQA 1CQIA 1CR1A 2V8BA 2YWRA 1UXKA 2HRCA 1CCWA 4RA9B 5BYBA 1THGA 5IX8A 4W63A 4JC8A 3SQDA 5JVDB 2KB0A 2I2WA 2QRUA 1LPNA 1N2EA 1IBKB 3FNBA 1VYVA 1DQPA 2AC4A 3H2ZA 3RRMA 3RT7A 3NV7A 4BOYA 4LQLA 3T9FA 2OGWA 4TTIA 1MAUA 4XDGA 4GRDA 4X6LA 3TTXA 4E4YA 3FTCA 2X0NA 3GRYA 2F59A 1QTNA 5BSUA 3O8RA 5DO9A 1Z6ZA 3PWSA 4TZTA 3QNMA 5AKJA 2NT4A 2PUDA 2FWAA 4PHTA 5F73A 5FFMA 1MXHA 2PMDA 2BSAA 2F67A 2G7ZA 2ZRGA 1AQLA 1T1SA 1V39A 2LZ0A 4MEAA 3BTSA 1YS1X 4P5DA 3C8HA 2ZAMA 4CTOA 1C8BA 5IDWA 2GKSA 2I91A 2I99A 1KEWA 1BVYF 2O7SA 4KLAA 4EENA 1A9ZA 5EL0A 1RFLA 2DT8A 1O0SA 3GOHA 1DG3A 2VAPA 5CGZA 1QO0A 2ZTLA 3TLGB 2JA1A 1DJQA 4TLBA 4FBLA 3A70A 2ZI4A 3PRJA 5ALHA 3DFZA 4BBJA 4HVCA 2IP2A 2PRZA 2R6FA 3HL0A 2ZS8A 4WN9A 2BCJQ 3VV2A 3RRYA 4E32A 5A5EA 2YZ7A 5JNTA 5FTKA 3P0FA 1A2QA 1TA0A 2CVHA 2YV4A 1F2UA 3IOBA 2XCSB 3ETEA 3MCUA 3SQWA 4M1MA 1NSFA 1U81A 3WRXA 3FN4A 3ZZTA 4XQCA 1EXVA 4W1SA 2AKAB 1Q50A 2CL0X 3NJ4A 4FEYA 6REQB 3KTDA 2VVTA 5KU1A 3LC2O 4QUEA 2VHWA 4CQMB 2VPXA 4AI6A 1WG8A 1XEAA 1Y5RA 2OBLA 3EB9A 5E6SB 3V7FA 2AUMA 1WW8A 3ZK9A 4P6VF 2C5AA 4F71A 3HXLA 4YALA 4GL2A 2QW8A 3ED5A 1XK7A 2HYDA 1HKHA 4OGKA 3IQGX 2QQ5A 4L9WA 4EW3A 1IQUA 3E9NA 4TM7A 5A5GA 2VH5R 2YOFA 3AF0A 3NNNA 4IJUA 2P6RA 2BMAA 2O9JA 1NSYA 3SC6A 4R6XA 2OWDA 1ZX1A 1DAEA 1IN1A 2HQOA 4K9LA 3KWLA 2QMQA 5KOJB 1EWVA 3B2QA 3S29A 4URVR 1KO7A 5TJ9A 1P3Y1 1C7ZA 5H1YA 2P1RA 4G4GA 3O47A 1TAHA 3HB1A 3DLAA 2VT2A 1XEFA 3OSUA 4DCGA 2G8LA 5GGYA 4FBGA 2RMKA 4GPTA 3EJWA 3KZ1E 2HA2A 3OOJA 4BAZA 5JAUA 1R0ZA 3SLGA 1KL7A 2INGX 1E6KA 7AT1A 4XGIA 1T1RA 1N2BA 2WPDA 3KFXA 1TK9A 5I48A 3W8FA 4R05A 4PQFA 2H4YA 2VTBB 3WQSB 1C7FA 1X6VA 2V9PA 1QQ6A 4R2XA 3KZMA 3HB9A 1O6FA 5ICCA 3HDTA 2NACA 1I6WA 4ZU3A 1RJ9B 1KEEA 3IAS6 4QARA 2BGWA 2DB3A 5DGHA 1A4RA 2XB9A 2X3FA 2O0JA 4N5MA 2ZJFA 1OV6A 2J48A 3L6BA 2FKNA 2QG6A 2O2EA 1T8TA 1YJAA 1LWNA 2DPMA 5JSZA 4JVLA 4UNNA 3R9WA 3DZKA 1ZSVA 3ID6C 4YPVA 3PYMA 3GFOA 1FJXA 3HSSA 2B78A 4LX0A 221PA 4AG6A 1K0FA 1HSZA 1UDAA 3WGVA 4D3SA 1GPAA 4JBIA 1NX6A 4R7TA 2PDAA 4UEWA 4BLVA 3L0PA 3ORFA 1DGQA 2JB9A 3LSTA 2G08A 2E7ZA 4C4TA 2G88A 3R2JA 3PK0A 2V6MA 1EBBA 3E9CA 4HFRA 4OU4A 2IEYA 3D31A 5CLIA 3ZD8A 4XSGA 1XZFA 2GNOA 2XLCA 1NSTA 2V74B 4BQFA 3S1AB 1SCAA 4INZA 4YRIA 3KOWA 5HFJA 5G4KB 5EP3A 4WY8A 4YN3A 3E9EA 4GC5A 1Y37A 4NV3A 1OLOA 3QBVA 2ZSJA 5AJZA 2HA5A 2YVLA 4ZA2A 1JLHA 1UKEA 2CLEB 2QJWA 5C32A 2A84A 4CF3A 4KREA 1AA9A 1F8XA 1Q0QA 1NJSA 3NJ8A 4FFRA 4N8DA 5ED0A 4B73A 2IDKA 4IL5A 3MINB 4WCDA 1Q57A 2JIRA 3V8MA 1VB5A 3DBLA 3EZGA 5IVKA 4G2NA 4OQXA 3MYYA 4JEUA 3ESAA 4RELA 4DR7B 3W1EA 3T8YA 4TMVA 2OD2A 4N0QA 1QPGA 4MYDA 4XM1A 1U6KA 2IY9A 3QIVA 3UY4A 1V2GA 3UG7A 4CLHA 1SG6A 1EWRA 4MLDA 5K6RA 1A7UA 4B3MB 3TLXA 3L0BA 5MFZA 4B45A 3M6IA 2GN6A 3HDYA 2P9HA 3T7AA 2YHIA 3FDIA 5JTUA 2GBPA 4CMIA 1ND5A 3ZHYA 3AKZA 2IXTA 4FDAA 3DMTA 4ZKDA 3GZTB 2XA9A 3TRIA 5JH7A 2LIPA 1YR3A 2P0YA 2QAIA 2HREA 5EXSA 3WB9A 4FFBB 4TYYA 4WCFA 1E9EA 2OBMA 2VF2A 1OYWA 1X7ZB 3CXRA 3HJHA 4JYBA 3VH2A 5LM3A 2WHXA 2IV3A 2HQBA 4IIBA 2RH8A 5GQSA 2VT6A