3N1YC

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase t201g mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Site Threonine Facilitates Proton Transfer during Dioxygen Activation at the Diiron Center of Toluene/o-Xylene Monooxygenase Hydroxylase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
molecule keywords Toluene o-xylene monooxygenase component
total genus 24
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3n1yC00
3RMKC 2INCC 3N1YC 3Q3NC 3N1XC 3RNEC 3I5JC 3Q3OC 3RNBC 3RNAC 4P1CC 2RDBC 3RNFC 3Q14C 3Q2AC 3Q3MC 3GE8C 3RN9C 3RI7C 3I63C 3DHGC 1T0RC 3RNCC 1T0SC 3N20C 3RNGC 3DHIC 2INDC 3DHHC 3N1ZC 3GE3C 1T0QC 4P1BC
chains in the Genus database with same CATH superfamily
3I9V1 2SAKA 2QMTA 2KMCA 5IOIA 2JF5A 1XLNA 3CIRB 1ZXHA 2VZKD 5DPTA 3MTNB 3UIPB 3R66C 2V4LA 2INDC 2IGGA 5JH5C 1HA5A 3VH4B 2YLMA 2N9PC 3ENEA 3L10B 2JT4B 4C4VB 2D11A 2L3ZA 1P1AA 1C3TA 1V1PA 1C77A 2VRRB 1E10A 1Y56A 3AN1A 1L7YA 1N63A 4MELA 3NVYA 4BBNF 4TSSA 4WWMA 4BKTA 1XEEA 4W9CA 5JZEB 2LFIA 5D3DA 2BPSA 2JZ3B 2AL3A 1SXTA 3PLVA 1CZPA 3JYUA 5J18A 4GDLA 2M4NA 2AYOB 1ROEA 3AEDB 1TTNA 3WAOA 3ZTDA 2KMAA 3ZGZA 5AZGA 5C3JB 1TKGA 3PV1A 4YXDB 4RGNA 3Q3NC 2K1FA 1XT9B 2LXCA 2JYTA 2BYFA 2WDRB 3IHPC 2DYBA 2PE6B 1OEYJ 2Y3AA 2IO2B 2TSSA 2ZPYA 2DNFA 3ML8A 4KGTA 5IN7A 2WX0A 1EU4A 2N1WA 2D10A 1YX6B 2D3AA 4IW0A 3TEZA 2XN9C 3CWIA 4ASWC 4KV2A 2G1EA 2KDEB 3A1QA 3W1SA 3DBHB 4F8CB 3P4RB 2G4DB 2JX5A 1RM6C 3EHVA 3PO0A 4KDLB 2L0TA 4HROA 2WXLA 1L5PA 4B95A 2JYEA 4HJGE 2EKIA 1FFVA 2AQ1B 1I4PA 3DVNV 1L2NA 1E90A 3VUWA 3NVWA 3B0AA 2KDIA 1RRBA 2ZNVC 3OAWA 3MJWA 1G6JA 4A9AA 1JROA 2IGHA 2BS3B 3V60A 4BBNC 3GS2A 1TJEA 1V5OA 2ZCCA 4DDGD 2XK5B 3ONSA 4HRSA 2OEDA 2QC8A 3DBLI 2NMQA 1OQRA 3D32A 1H4RA 1FXAA 2FIFA 1MPEA 4BKSD 2KDMA 1V5TA 2DBYA 1T0YA 1E9MA 2K25A 3IT4B 2M19A 2REXA 3HVZA 2OJWA 2CHWA 4ZRQA 2NPTB 2BS4B 2Y5CA 2FCQA 3DBSA 2WS3B 3MJ5A 3A9KA 3P1MA 4WJOA 3VFKA 2BKFA 5HG2A 1IGCA 1XCTL 1KLGD 4KZCA 3T3NA 2BYEA 4JX1C 5IP4D 3P42A 1HQRD 1R4MB 1E8ZA 1FNUA 5I4DA 5JHBA 1HXYD 4WAFA 4IOIE 1RWSA 2BB6A 2L83A 2WXKA 5BYSA 4RMAA 1UZXB 4LCDE 1N61A 4HK2A 1AWDA 2EKEC 3NS8A 4ARCA 2L00B 2JZZA 2R2QA 1XO3A 2WXPA 3A4SC 3W1YA 2MP2A 3FAHA 2KNBA 3HRDD 1JWAD 4IM0A 3KLSX 3KQ4A 3Q8AA 4A8XC 2WU5B 3WIMA 4HDQA 3NHEB 3Q6BA 1NDDA 1DOIA 4FHKA 1P9DU 4EE2A 2WXIA 1E8XA 2INCC 4CQNA 2G4SA 5H8YE 3QHTA 1I4HA 4ZRJA 2RDBC 1YX5B 1RFKA 4W9FA 1SGHA 4ZYNA 2DZIA 2JSVX 1WF9A 3ZNHB 5G2NA 1C79A 1FNWA 1VD2A 3HK0A 4KKIA 2N0SB 2D5GA 4WWOA 1QOFA 1Y8RC 1F2RI 1YN4A 5DCNA 1AW7A 4NNJB 1TY2A 1TS2A 2ZZPB 3DHGC 1ZGUB 1IBXA 1KOTA 5D3IB 3AE1B 3VRAB 3A33B 5D2MB 3N30A 4GDKB 3N1XC 3V05A 4C7YA 2K6QA 1HTQA 2QHOA 2JXXA 1GNUA 3DPDA 1YNTE 2BWES 3AE5B 4RGTA 1UNSA 1VDVA 3U4EG 2QSDA 4FULA 4L23A 2WDTB 2CHZA 2L8JA 3RD2A 1WRIA 5E6OA 1D5XC 4YL8A 4DHJB 3PS6A 5E6PA 3TBLD 2INPE 3L16A 4N6EB 3RNCC 1VJKA 1FPYA 1JQ4A 3ZNGC 1VCBA 3KWVA 5J17A 2GLSA 3N32A 2A5UA 4F7ZA 3N1YC 2BW2A 1MJDA 3PTFC 4J6IA 4LJPB 1E5WA 2N9LA 1J7BA 3U8ZA 4W9GA 4MT5A 2E3TA 3GE8C 1U4AA 2MJ3A 2O2VB 2KN5A 3I63C 2OOBB 2M0XA 5JHAA 4IDIA 2KVZA 3BYTB 4LNIA 5BYRA 3K9OB 3A9JB 1I42A 1I35A 1CJEA 3VTUA 4LTUA 4ANWA 5CHWA 2ZJDA 5HI1A 1S1QB 4M8NA 1XD3B 2RR9A 5DPSA 1YN5A 3HVDA 1EWYC 3TEWA 3R3MA 3UF8A 4GXBA 4WQOB 4IUMB 1XLQA 1K52A 5L83A 2DYMA 2V1YA 2KWUB 3AMZA 1GG3A 1IGDA 3ZW3A 4TQ1A 1P3QU 4FJVB 3LYYA 3U7DA 2DWQA 1DOYA 1L0XB 5E6JA 5CTRC 5BYQA 5FR3A 5LNK1 3QARA 2KMMA 4HPPA 3H8HA 4B0MA 3DHHC 4BOZB 1KLVA 4YTPB 3GOEA 1YJ1A 1BUIC 3KVFB 2BKRB 4NY0A 4GSWA 1EWCA 2ZW0A 4IM3A 2AWTA 1V86A 1ZUD2 1T0RC 2WXJA 4H2AA 1WGGA 1ZPSA 2HTME 3VUXA 4FBJB 1MI0A 2XBBC 4NQKE 2MBOA 3PHXB 2GBRA 4MGZE 4FHJA 4RNAA 4CHKA 5G5HA 2ONQA 2MBHA 2BQQA 3ABVB 4KSLC 1WGHA 4XC2A 3SHQA 4AOFA 4FXCA 1PGXA 3VHTC 3A9KB 2J53A 4F1SA 3W2DA 4II3B 1HZ5A 5E6NA 1L6UA 1XCQL 2Y5PA 3CSFA 3GP7A 5HHDG 3Q3OC 3L4PA 1KRHA 3L54A 1QKZA 3NOBA 5LXHA 3AH7A 3T3OA 3T9LA 3B1LX 3EFCA 2L05A 4MM3B 2QCZA 1WWTA 4M0WB 2H89B 4ANXA 1TY0A 2I1KA 4R3DA 2GBKA 3PRPB 1XQQA 1FCCC 1QT9A 3Q69A 1L4DB 3APCA 2KHWB 3ETRA 4WURA 2D07B 1WXAA 2C5LC 2XK5A 2LMCA 3WANA 3SD5A 1A5RA 3M95A 3ZLZA 2KWVB 3AE7B 3OG5A 2YEPB 3VVWB 3UGBB 3VUYA 5BMIA 1UBIA 2JWZA 2YEPF 4A3OA 1FRRA 3DBHI 2JUOA 1TS3A 2MLBA 1FD6A 4GOCA 2WNMA 2WDVB 2LJIA 1KF6B 3A1QB 4FN2A 1JRPA 3PRZA 3DBRB 2GRIA 2B3AA 4BOSC 2JQRB 1F0ZA 4LDTB 2PMVA 1D3ZA 3AEGB 3RNAC 1IBXB 4FADA 2H88B 2HD5B 2X38A 1J0GA 4LK0M 3GZNB 2JRHA 3N3KB 1FCLA 1OTRB 4ACFA 1WXQA 2DZKA 3MC0B 2KWCA 4XWWA 3BWUD 4KVGB 4K81A 3RNEC 2IZVB 2LJ5A 1KFYB 3PRMB 1Q1OA 3V62A 2DAFA 5C23A 1V6EA 4YTMB 2FCNA 1TS5A 3ZRFA 3RCZA 1RFAA 2MBBB 1UGJA 4GDLB 2WHIA 5AZHA 1WXVA 2WGSA 2RD0A 2CU3A 1NEKB 2M8SA 1OGWA 2WLBA 3L08A 1FFUA 2ASQA 1AYFA 2O6VA 4E71A 4NJ6A 2N9XA 5CHVC 2R61A 1EU3A 5D7GA 4ZHOA 4W9IA 2WXMA 3M3JA 1WMHA 1H8CA 3C19A 4DXAB 1F1HA 1JCKB 2UWQA 1OQQA 1L0YB 3O13A 1OQYA 1AN8A 5CX3A 3SEBA 2PTLA 2UU7A 5TR5A 2I38A 2M0AA 2WXNA 2YVCA 3RZFA 1L0VB 4PT5A 4HWIB 2VH2A 2WX1A 2PIAA 4XYCA 2MQJA 2WXHA 3MC9A 1GC7A 2PKOA 1T0SC 2FAZA 4RFBA 3DVGX 2EELA 4HXDA 3ZYYX 3CSTA 2GI9A 4S0RA 3P4PB 2A4ZA 1WX9A 3NUHB 3CMMB 2PVGC 4ZDVA 4RF0A 1B1ZA 2O6VB 4N9F4 2C9WB 1QQRA 2K6DB 2ICIA 2M17A 1VZ7A 5DPRA 3DDCB 2Q5WD 1WJ4A 4DHZE 1V49A 4N59A 1N62A 1V8CA 3APFA 2CJNA 5L95C 1WGDA 2RGFA 1E8WA 2LEKA 2CS4A 4ITKA 4P1CC 1QOAA 1RLFA 1TKEA 3LDZE 4BAXA 4IG7B 2VZKB 3TSSA 2OHFA 2LGDA 4OHJA 2DZJA 1WR6E 4FJYA 1KLUD 3ZRCA 3VTWA 3FILA 4EEWA 1CK1A 2IGDA 1WY8A 2MCNB 2IO3B 2L1AA 1ET9A 1I7HA 1JALA 3OJ4B 3N9YC 3VR9B 3W5VB 2DX5B 2ON8A 1Q10A 4XE0A 4FLHA 3TCAA 1L6VA 3QK0A 4LDTD 2LXAA 3AECB 1PGAA 3N1ZC 3NG0A 1P0RA 3ZO5B 2KT7A 1R7SA 4Q2JA 3NZSA 4DQOC 2X8XX 1QLBB 4C00A 1R4NI 3QX1A 4MSMB 1WXSA 3SDLC 3UI3A 4CYEA 2O6VD 4KZ0A 3LB8C 3H7PB 4X57B 1FM0D 4LNNA 5J2RA 4ICVA 1TGZB 5AUKA 2KTRB 2BTEA 4EUTA 4NAMA 1HE8A 2KX0A 4C7ZA 1UF0A 3QQ8B 2KC1A 4XWTA 5G55A 2GBNA 2CHXA 4E3CA 1JWSD 2ACZB 4GN1A 2WXRA 2MEKA 4HCNB 3R8BA 3MFGA 2C7MB 1TS4A 3EFUA 4WJNA 2IBIB 2IDYA 4IKGA 4EZLA 2NPTA 3AU4A 5KHOA 1ZW7A 4OZAA 4IC7B 2UYZB 3Q2AC 2INNE 1WH3A 4PYUA 4ZRKA 3W5UB 4ZYSA 1IUEA 3AE6B 1MG4A 2HE7A 1XLPA 1ACCA 1TKYA 2IPKD 1TYGB 1PYWD 2KX3A 2K8HA 1PGBA 2DAJA 2FIDA 1V81A 1WGKA 3I5JC 3RNBC 1HTOA 2FNJB 2KD0A 2KVRA 3AI5A 3RFZB 3V61A 2KJ6A 2KTFA 3EGRA 4DK5A 5DPWA 1QOGA 2CR5A 4DDID 3V3XA 2ZEQA 2LI5A 4PYZA 2KXJA 4KGSA 2GB1A 1CQVA 4JWSC 5D94A 1T0QC 3DWMA 3AE9B 2ZVOA 2WQYB 2G9HD 3NY5A 3RULA 3ZDMC 4MGIE 1L4ZB 1I4QA 2WU2B 2BYVE 2LWPA 3WALA 3ZVVA 2RDGA 4LLGM 3S2AA 2NS5A 4A3PA 1E0ZA 1KJTA 1WE6A 4DHJD 2GOWA 2J52A 3AEFB 1EO6A 4NZLB 3GZNI 1FO4A 1JWMD 2L32A 1JRUA 1YIWA 3T8MA 3LJ3A 3ZQ4A 2BT6A 4G50A 5IKCM 1F9JA 3ZXVA 4K3BA 2KQSA 1YQBA 1ESFA 2ZCBA 1SEBD 2N9EB 3BVMA 1WYWB 4S17A 3B2GA 1BMLC 1QZEA 4RCOA 5BMHA 4LJOB 1K8RB 1ZDVA 4TQ0A 2K8CA 2MBEA 4WIPA 1KM7A 4WWPA 2RDHA 3UIOB 4HPMB 1I4XA 1GAQB 1E8YA 3M63B 4NJ7A 4A6QA 4A55A 1WFYA 4M02A 4OVUA 3Q8FA 2WWZA 3X23A 1IYFA 3ZNZB 4I6LB 3PZDA 1SBBB 3AM9A 2WXOA 4OW0A 3URYA 4PS7A 3CF6E 1UWXA 4HJKA 1FXIA 4KDIC 5LLIA 1WRDB 2PJHA 1DYQA 2J0KA 1NENB 1V1PB 3EC8A 2FCMA 3PZ7A 4GIVA 2LVPA 4O1NA 2HTHA 4B0EA 4DXFA 4IWPA 2BF8B 4K7SA 2BGFA 1CMXB 3R2TA 2PEAA 2DLBA 2MA9B 2PE9A 3HUIA 4MACA 3MC8A 1MHHE 1K53A 1V97A 5D6JB 3KYCD 1GPXA 3SR6A 2KQ4X 1C76A 2KQ7A 3HM3A 3Q3FA 1SE3A 1TIFA 1SB3C 1WI0A 4KIKB 4KGRA 2ZVNA 1KTKA 4JIOU 2CU1A 4RGMA 2XEWA 5BO4B 3ALBA 3DWGC 1ZP0B 1K50A 2D3BA 2JU6X 3VXWA 3PSEB 2FUHB 2IY1B 1MVKA 2Z8LA 4GGQA 4N58A 1Q0WB 1WM2A 2KC2A 3AV8A 3VRBB 4AQ7A 3ZNID 1ZDXA 1LM8B 1F2RC 1WXMA 1T5XD 2W54A 4MH0E 2LGYA 3RN9C 4W9JA 2C60A 3APDA 3H7PA 3EA6A 1SJHD 2KWDA 3JSVA 2FBWB 1NYQA 2I1JA 2RSUA 2L0FA 4FJZA 4DXGA 3R7QA 1D4BA 5T8IA 4ZRPA 2BB5A 2N7JA 2QILA 5GMVA 2KJRA 3OJ3A 3U7ZA 1SJED 3EUB2 3Q8CA 1FMAD 3MHSD 3PZ8A 2VH1A 2ZPNA 3IVFA 4A20A 4DHZB 4AJYB 1I4RA 1ENFA 2QEJC 1P7EA 2Z0DB 3KWLA 4ICUA 4P6VF 2WDQB 2SEBD 1F52A 3RPFC 5BMGA 3HHMA 1JWUD 2NBWB 5IO9A 5G5GA 4IWQA 2EMTA 3BINA 2D3CA 1FRDA 2LHEA 1VLBA 3KW5B 2QIEB 2J42A 4YT0B 4BKSA 1E6EB 1WJ6A 3IT6B 3ECIA 1HEZE 1SE4A 3P4SB 3VR8B 4P1BC 2KZRA 3P63A 3JVZX 4BFRA 1J8CA 1UUPA 4PS8A 4XGAB 2XNAC 3DBRI 1J7AA 2B76B 3TMPB 2FCSA 4XX5A 3W9CB 4ANVA 4YTNB 3AE3B 1WIAA 1YJIA 3AE4B 2NCNA 1SE2A 1K51A 1S3SG 3I57A 5C1ZA 2NR2A 2V0GA 4RM9A 4M0WA 2AEHA 2KFJA 4MM3A 4II2B 5EE9A 4BVUC 4BKGA 4AP4C 4KIKA 1C4PA 4RH6A 5FK9C 3QAQA 4WJQA 2W3RA 5AEKB 3IFWB 2D3GA 4W9LA 1JWBD 2DZMA 3DVGY 2PVOD 4ARIA 1XLOA 2MSED 3P2BA 2M1MA 2K0PA 1YQ4B 4B9KA 2L76A 3E56A 4EKUA 4BZAA 4HKQA 1BXTA 2W3SA 4URKA 3K9PB 2L52A 2BVCA 5KHQA 3GE3C 1BT0A 3L17A 4KSKC 4NAWA 1AARA 2KTRA 1WJUA 3H6NA 1E7VA 3NJTA 3C8YA 4NQLB 1OEYA 2MJEA 3PPAA 2AL6A 2JVCA 3I3TB 1WZ3A 2LHDA 1SSNA 4XDDA 4TUUA 3PREA 4IM2A 1LGRA 4DWFA 3PT2B 1N5WA 2EMSA 3NZUA 1LXDA 4YSXB 1MG8A 1YJJA 1PUTA 3V6EB 2AX5A 1C1YB 1WX7A 3SFEB 1I4GA 5EE3A 3W1SC 2R2OA 3ZIMA 2M56B 1IP9A 4DBGA 3ZJUA 2MWSB 4P16A 1N6ZA 4WWNA 2MW5A 3DVNU 3DHIC 4GDKA 2IO1B 1D6EC 3TL5A 5MPOA 4OVVA 4XZ4A 1WZ0A 4YWGG 2GBJA 1ISNA 1VZ6A 3FKYA 3IAM1 2KYWA 1N5XA 4C56C 1UGMA 1RYJA 2LD9A 1T3QA 3A4RA 1P7FA 3IBEA 1GB4A 3B08A 4OVZA 4G3XB 2KDFB 2J4XA 3B2FA 4ZOHC 3E9SA 1WE7A 1V9JA 3LXFA 4AWJA 2ZNVB 3AE8B 4KKJA 4RM8A 3JW0X 2DYOA 4HEA1 5HFYA 1FXTB 2IY0B 5IA7A 4WAAA 1WGRA 2GBMA 3NVVA 2KFKB 3TEYA 1R4MI 1J7CA 2Y5BB 4WQMA 2MHJA 4LNFA 4MJSB 5EE1A 2K39A 4US9A 2JWUA 2V9HA 4TKNA 3QWZB 3PGEA 2HDEA 4LNOA 2NBUA 4TMAB 2V3SA 1V1OA 3MHZA 2FUG1 2RPVA 3RT3B 3AEAB 2HJ8A 1QF6A 2L7RA 2V3NA 2IO0B 4REZA 2IJ0A 2KANA 2Z59B 4NAWB 1MHXA 2W9NA 2K22A 3BVGA 2K5PA 3SU8X 3KUDB 3VTVA 3R7RA 4MEMA 3H9DA 2WYQA 3EECA 1WYGA 3BK1A 2WXFA 4FA6A 1GB1A 4HVBA 3Q8BA 1GC6A 4GMVA 3BK2A 4I6NB 4HDOA 3SFDB 1UWMA 1YD8U 4ZRIA 3OWEB 1ET6A 1WR1A 3FC4A 1FNVA 1XXGA 1GUAB 3DOWA 1NYRA 3Q3JA 1C4AA 4L2YA 4ANUA 5AUIA 3P4QB 3ZJVA 2J0MA 1RAXA 3WAMA 2RPQA 3B9JA 3GB1A 2C7HA 3PHWB 1N60A 3FILB 2AQ2B 3DCGA 5FKAC 2LUEA 3RNGC 1NVID 3X0WA 2WXQA 4YSZB 4LNKA 2G45B 2C7NB 2NTSA 2PW9A 2LASA 2N9KA 3BVZA 2KJHB 2BBCA 3ML9A 3L0WB 1P98A 3U2SC 4MJSA 3TEXA 4JGHB 1A70A 2JY6A 2K9XA 5IAAC 1WSPA 1J19A 2K3UA 3OLMD 2W55A 2N7EA 3NS1A 1SIFA 4J3OD 4K3CA 1LO5D 1TZ1A 3QCAA 1ZOYB 4AUQC 1VR9A 2CJOA 4RGOS 3BIID 3AB5A 1IPGA 4PK1A 5CHFA 2KLCA 3DQVA 5HKHA 4CO7A 2NVUI 3KYDD 2LGSA 2W82A 3VH3B 1FIQA 2LVQA 1PFDA 4B6WA 3Q14C 2N1VA 5JXVA 1UBQA 1OFFA 3RUIB 2LGXA 5C2TB 1Z5SB 1X1MA 1WMHB 4M01A 1VRAB 4K7UA 4D2KA 1GJZA 4EOYA 2N4FA 1STEA 2LVOA 3VQIA 4P7IA 3IXSA 4I6PA 1T6BX 1MFWA 2LUMA 2NBVB 5H92C 3L13A 2E6XA 2KO3A 3WAPA 1LQBA 2LGIA 4NJCA 2MX2A 2JRIB 3ZXRA 1QILA 4C80A 1DOXA 3C0RB 3AXCA 1DGJA 4UDUC 5EDSA 3AU5A 2IYDB 2WP9B 2HJ1A 1YOVB 4YSYB 3NRZA 1M4VA 2OJRA 4IWOA 4USAA 2GMIC 2KLGA 2KAJA 1YMHE 3MP9A 2LRUA 2MP2B 4JLCA 3BY4B 1KH0A 5EE0A 3RMKC 2LZ6A 1YQ3B 4M00A 4OZBA 1EUVB 3Q3MC 2J0JA 1TBEA 3TIXA 1UD7A 3M62B 3RI7C 3UQAA 2I2YA 4MSQB 1VZ8A 3DBLB 4K1RB 3NZ3A 2BS2B 4E74A 3AULA 4HLEA 2JZPA 1YN3A 4A90A 1V2YA 3VAWA 4PS3A 3RZWC 1SIJA 1NI2A 1TZOA 2QJLA 4G0NB 1LFDA 4MH8A 4EZKA 4MGKE 2JPHA 3AE2B 3O65B 1D5ZC 4HCPB 1EF5A 4MDKE 3TUOA 1QOBA 4MGYE 1NI3A 4W9HA 3AEEB 3WCQA 1E7PB 4W9KA 1C78A 3A9JA 4JE3B 1ZXIA 5AZFA 4AJWA 2NTTA 3AEBB 3ZKJC 2O2VA 3U52E 1TT5B 1ZE3D 2MBQA 4C4VA 1C4CA 2KK8A 4K7WA 4M8MA 4JPSA 4KX6B 1JMLA 1SE9A 2N7DA 4QAYA 3HM6X 2LRWA 2WXGA 4JQWC 4W9EA 3J9CA 2KKCA 2DENB 3IG3A 4W9DA 2ZW1A 2DHZA 1WGYA 1PQSA 3PLUA 3BYYB 3U30A 4AS1A 2D2QA 4ZHPA 1C9FA 2BYTA 1ZKHA 4OZCA 1R4NB 4JWUC 3QIJA 2MJDA 1WX8A 3R2IA 1NBFC 2JXTA 4WH4A 2FE8A 5GXGB 3RYTA 2PLPA 1EM7A 2PPHA 1JW9D 2MH7A 5LXIB 4EFOA 1HZ6A 2KDBA 5FR6A 1Q5WB 3V6CB 1V80A 2V3PA 1EF1A 3RNFC 1SF0A 4HKZE 4EZJA 2AQ3B 3NVZA 4GU2A 3N20C 1B9RA 2BWFA 3QA8A 1UELA 2QDFA 4US8A 3VDZA 4TV3A 3JSVB 2KACA 4GLSC 4RF1A 4L1BA 3ZJTA 2KN4A 4JL9A 3KUCB 4HPLB 2CKHB 3H1UA 3TJPA 3ZDTA 4WJPA 2RMMA 3PVLA 1D5MC 2J7QB 2K8BA 3H7SA 1UH6A 3Q8EA 3BZDB 1PDXA 4GB9A 3KH0A 4NPNA 2KOXA 3ZUNA 1E7UA 2G3QB 1WJNA 3ZTCA 1F77A 3IAS1 1WM3A 1M94A 1GOZA 3QJZA 4G11A 1FEHA 3QC8B 3WA0A 5TSSA 2V4IB 3UINB 4XDCA 2KFKA 3UQBA 2Z0EB 1Z2MA 1XF5L 3HIZA 3KUZA 2MRPA
chains in the Genus database with same CATH topology
3RMKC 2INCC 3N1YC 3Q3NC 3N1XC 3RNEC 3I5JC 3Q3OC 3RNBC 3RNAC 4P1CC 2RDBC 3RNFC 3Q14C 3Q2AC 3Q3MC 3GE8C 3RN9C 3RI7C 3I63C 3DHGC 1T0RC 3RNCC 1T0SC 3N20C 3RNGC 3DHIC 2INDC 3DHHC 3N1ZC 3GE3C 1T0QC 4P1BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RMK C;  2INC C;  3N1Y C;  3Q3N C;  3N1X C;  3RNE C;  3I5J C;  3Q3O C;  3RNB C;  3RNA C;  4P1C C;  2RDB C;  3RNF C;  3Q14 C;  3Q2A C;  3Q3M C;  3GE8 C;  3RN9 C;  3RI7 C;  3I63 C;  3DHG C;  1T0R C;  3RNC C;  1T0S C;  3N20 C;  3RNG C;  3DHI C;  2IND C;  3DHH C;  3N1Z C;  3GE3 C;  1T0Q C;  4P1B C; 
#chains in the Genus database with same CATH topology
 3I9V 1;  2SAK A;  2QMT A;  2KMC A;  5IOI A;  2JF5 A;  1XLN A;  3CIR B;  1ZXH A;  2VZK D;  5DPT A;  3MTN B;  3UIP B;  3R66 C;  2V4L A;  2IND C;  2IGG A;  5JH5 C;  1HA5 A;  3VH4 B;  2YLM A;  2N9P C;  3ENE A;  3L10 B;  2JT4 B;  4C4V B;  2D11 A;  2L3Z A;  1P1A A;  1C3T A;  1V1P A;  1C77 A;  2VRR B;  1E10 A;  1Y56 A;  3AN1 A;  1L7Y A;  1N63 A;  4MEL A;  3NVY A;  4BBN F;  4TSS A;  4WWM A;  4BKT A;  1XEE A;  4W9C A;  5JZE B;  2LFI A;  5D3D A;  2BPS A;  2JZ3 B;  2AL3 A;  1SXT A;  3PLV A;  1CZP A;  3JYU A;  5J18 A;  4GDL A;  2M4N A;  2AYO B;  1ROE A;  3AED B;  1TTN A;  3WAO A;  3ZTD A;  2KMA A;  3ZGZ A;  5AZG A;  5C3J B;  1TKG A;  3PV1 A;  4YXD B;  4RGN A;  3Q3N C;  2K1F A;  1XT9 B;  2LXC A;  2JYT A;  2BYF A;  2WDR B;  3IHP C;  2DYB A;  2PE6 B;  1OEY J;  2Y3A A;  2IO2 B;  2TSS A;  2ZPY A;  2DNF A;  3ML8 A;  4KGT A;  5IN7 A;  2WX0 A;  1EU4 A;  2N1W A;  2D10 A;  1YX6 B;  2D3A A;  4IW0 A;  3TEZ A;  2XN9 C;  3CWI A;  4ASW C;  4KV2 A;  2G1E A;  2KDE B;  3A1Q A;  3W1S A;  3DBH B;  4F8C B;  3P4R B;  2G4D B;  2JX5 A;  1RM6 C;  3EHV A;  3PO0 A;  4KDL B;  2L0T A;  4HRO A;  2WXL A;  1L5P A;  4B95 A;  2JYE A;  4HJG E;  2EKI A;  1FFV A;  2AQ1 B;  1I4P A;  3DVN V;  1L2N A;  1E90 A;  3VUW A;  3NVW A;  3B0A A;  2KDI A;  1RRB A;  2ZNV C;  3OAW A;  3MJW A;  1G6J A;  4A9A A;  1JRO A;  2IGH A;  2BS3 B;  3V60 A;  4BBN C;  3GS2 A;  1TJE A;  1V5O A;  2ZCC A;  4DDG D;  2XK5 B;  3ONS A;  4HRS A;  2OED A;  2QC8 A;  3DBL I;  2NMQ A;  1OQR A;  3D32 A;  1H4R A;  1FXA A;  2FIF A;  1MPE A;  4BKS D;  2KDM A;  1V5T A;  2DBY A;  1T0Y A;  1E9M A;  2K25 A;  3IT4 B;  2M19 A;  2REX A;  3HVZ A;  2OJW A;  2CHW A;  4ZRQ A;  2NPT B;  2BS4 B;  2Y5C A;  2FCQ A;  3DBS A;  2WS3 B;  3MJ5 A;  3A9K A;  3P1M A;  4WJO A;  3VFK A;  2BKF A;  5HG2 A;  1IGC A;  1XCT L;  1KLG D;  4KZC A;  3T3N A;  2BYE A;  4JX1 C;  5IP4 D;  3P42 A;  1HQR D;  1R4M B;  1E8Z A;  1FNU A;  5I4D A;  5JHB A;  1HXY D;  4WAF A;  4IOI E;  1RWS A;  2BB6 A;  2L83 A;  2WXK A;  5BYS A;  4RMA A;  1UZX B;  4LCD E;  1N61 A;  4HK2 A;  1AWD A;  2EKE C;  3NS8 A;  4ARC A;  2L00 B;  2JZZ A;  2R2Q A;  1XO3 A;  2WXP A;  3A4S C;  3W1Y A;  2MP2 A;  3FAH A;  2KNB A;  3HRD D;  1JWA D;  4IM0 A;  3KLS X;  3KQ4 A;  3Q8A A;  4A8X C;  2WU5 B;  3WIM A;  4HDQ A;  3NHE B;  3Q6B A;  1NDD A;  1DOI A;  4FHK A;  1P9D U;  4EE2 A;  2WXI A;  1E8X A;  2INC C;  4CQN A;  2G4S A;  5H8Y E;  3QHT A;  1I4H A;  4ZRJ A;  2RDB C;  1YX5 B;  1RFK A;  4W9F A;  1SGH A;  4ZYN A;  2DZI A;  2JSV X;  1WF9 A;  3ZNH B;  5G2N A;  1C79 A;  1FNW A;  1VD2 A;  3HK0 A;  4KKI A;  2N0S B;  2D5G A;  4WWO A;  1QOF A;  1Y8R C;  1F2R I;  1YN4 A;  5DCN A;  1AW7 A;  4NNJ B;  1TY2 A;  1TS2 A;  2ZZP B;  3DHG C;  1ZGU B;  1IBX A;  1KOT A;  5D3I B;  3AE1 B;  3VRA B;  3A33 B;  5D2M B;  3N30 A;  4GDK B;  3N1X C;  3V05 A;  4C7Y A;  2K6Q A;  1HTQ A;  2QHO A;  2JXX A;  1GNU A;  3DPD A;  1YNT E;  2BWE S;  3AE5 B;  4RGT A;  1UNS A;  1VDV A;  3U4E G;  2QSD A;  4FUL A;  4L23 A;  2WDT B;  2CHZ A;  2L8J A;  3RD2 A;  1WRI A;  5E6O A;  1D5X C;  4YL8 A;  4DHJ B;  3PS6 A;  5E6P A;  3TBL D;  2INP E;  3L16 A;  4N6E B;  3RNC C;  1VJK A;  1FPY A;  1JQ4 A;  3ZNG C;  1VCB A;  3KWV A;  5J17 A;  2GLS A;  3N32 A;  2A5U A;  4F7Z A;  3N1Y C;  2BW2 A;  1MJD A;  3PTF C;  4J6I A;  4LJP B;  1E5W A;  2N9L A;  1J7B A;  3U8Z A;  4W9G A;  4MT5 A;  2E3T A;  3GE8 C;  1U4A A;  2MJ3 A;  2O2V B;  2KN5 A;  3I63 C;  2OOB B;  2M0X A;  5JHA A;  4IDI A;  2KVZ A;  3BYT B;  4LNI A;  5BYR A;  3K9O B;  3A9J B;  1I42 A;  1I35 A;  1CJE A;  3VTU A;  4LTU A;  4ANW A;  5CHW A;  2ZJD A;  5HI1 A;  1S1Q B;  4M8N A;  1XD3 B;  2RR9 A;  5DPS A;  1YN5 A;  3HVD A;  1EWY C;  3TEW A;  3R3M A;  3UF8 A;  4GXB A;  4WQO B;  4IUM B;  1XLQ A;  1K52 A;  5L83 A;  2DYM A;  2V1Y A;  2KWU B;  3AMZ A;  1GG3 A;  1IGD A;  3ZW3 A;  4TQ1 A;  1P3Q U;  4FJV B;  3LYY A;  3U7D A;  2DWQ A;  1DOY A;  1L0X B;  5E6J A;  5CTR C;  5BYQ A;  5FR3 A;  5LNK 1;  3QAR A;  2KMM A;  4HPP A;  3H8H A;  4B0M A;  3DHH C;  4BOZ B;  1KLV A;  4YTP B;  3GOE A;  1YJ1 A;  1BUI C;  3KVF B;  2BKR B;  4NY0 A;  4GSW A;  1EWC A;  2ZW0 A;  4IM3 A;  2AWT A;  1V86 A;  1ZUD 2;  1T0R C;  2WXJ A;  4H2A A;  1WGG A;  1ZPS A;  2HTM E;  3VUX A;  4FBJ B;  1MI0 A;  2XBB C;  4NQK E;  2MBO A;  3PHX B;  2GBR A;  4MGZ E;  4FHJ A;  4RNA A;  4CHK A;  5G5H A;  2ONQ A;  2MBH A;  2BQQ A;  3ABV B;  4KSL C;  1WGH A;  4XC2 A;  3SHQ A;  4AOF A;  4FXC A;  1PGX A;  3VHT C;  3A9K B;  2J53 A;  4F1S A;  3W2D A;  4II3 B;  1HZ5 A;  5E6N A;  1L6U A;  1XCQ L;  2Y5P A;  3CSF A;  3GP7 A;  5HHD G;  3Q3O C;  3L4P A;  1KRH A;  3L54 A;  1QKZ A;  3NOB A;  5LXH A;  3AH7 A;  3T3O A;  3T9L A;  3B1L X;  3EFC A;  2L05 A;  4MM3 B;  2QCZ A;  1WWT A;  4M0W B;  2H89 B;  4ANX A;  1TY0 A;  2I1K A;  4R3D A;  2GBK A;  3PRP B;  1XQQ A;  1FCC C;  1QT9 A;  3Q69 A;  1L4D B;  3APC A;  2KHW B;  3ETR A;  4WUR A;  2D07 B;  1WXA A;  2C5L C;  2XK5 A;  2LMC A;  3WAN A;  3SD5 A;  1A5R A;  3M95 A;  3ZLZ A;  2KWV B;  3AE7 B;  3OG5 A;  2YEP B;  3VVW B;  3UGB B;  3VUY A;  5BMI A;  1UBI A;  2JWZ A;  2YEP F;  4A3O A;  1FRR A;  3DBH I;  2JUO A;  1TS3 A;  2MLB A;  1FD6 A;  4GOC A;  2WNM A;  2WDV B;  2LJI A;  1KF6 B;  3A1Q B;  4FN2 A;  1JRP A;  3PRZ A;  3DBR B;  2GRI A;  2B3A A;  4BOS C;  2JQR B;  1F0Z A;  4LDT B;  2PMV A;  1D3Z A;  3AEG B;  3RNA C;  1IBX B;  4FAD A;  2H88 B;  2HD5 B;  2X38 A;  1J0G A;  4LK0 M;  3GZN B;  2JRH A;  3N3K B;  1FCL A;  1OTR B;  4ACF A;  1WXQ A;  2DZK A;  3MC0 B;  2KWC A;  4XWW A;  3BWU D;  4KVG B;  4K81 A;  3RNE C;  2IZV B;  2LJ5 A;  1KFY B;  3PRM B;  1Q1O A;  3V62 A;  2DAF A;  5C23 A;  1V6E A;  4YTM B;  2FCN A;  1TS5 A;  3ZRF A;  3RCZ A;  1RFA A;  2MBB B;  1UGJ A;  4GDL B;  2WHI A;  5AZH A;  1WXV A;  2WGS A;  2RD0 A;  2CU3 A;  1NEK B;  2M8S A;  1OGW A;  2WLB A;  3L08 A;  1FFU A;  2ASQ A;  1AYF A;  2O6V A;  4E71 A;  4NJ6 A;  2N9X A;  5CHV C;  2R61 A;  1EU3 A;  5D7G A;  4ZHO A;  4W9I A;  2WXM A;  3M3J A;  1WMH A;  1H8C A;  3C19 A;  4DXA B;  1F1H A;  1JCK B;  2UWQ A;  1OQQ A;  1L0Y B;  3O13 A;  1OQY A;  1AN8 A;  5CX3 A;  3SEB A;  2PTL A;  2UU7 A;  5TR5 A;  2I38 A;  2M0A A;  2WXN A;  2YVC A;  3RZF A;  1L0V B;  4PT5 A;  4HWI B;  2VH2 A;  2WX1 A;  2PIA A;  4XYC A;  2MQJ A;  2WXH A;  3MC9 A;  1GC7 A;  2PKO A;  1T0S C;  2FAZ A;  4RFB A;  3DVG X;  2EEL A;  4HXD A;  3ZYY X;  3CST A;  2GI9 A;  4S0R A;  3P4P B;  2A4Z A;  1WX9 A;  3NUH B;  3CMM B;  2PVG C;  4ZDV A;  4RF0 A;  1B1Z A;  2O6V B;  4N9F 4;  2C9W B;  1QQR A;  2K6D B;  2ICI A;  2M17 A;  1VZ7 A;  5DPR A;  3DDC B;  2Q5W D;  1WJ4 A;  4DHZ E;  1V49 A;  4N59 A;  1N62 A;  1V8C A;  3APF A;  2CJN A;  5L95 C;  1WGD A;  2RGF A;  1E8W A;  2LEK A;  2CS4 A;  4ITK A;  4P1C C;  1QOA A;  1RLF A;  1TKE A;  3LDZ E;  4BAX A;  4IG7 B;  2VZK B;  3TSS A;  2OHF A;  2LGD A;  4OHJ A;  2DZJ A;  1WR6 E;  4FJY A;  1KLU D;  3ZRC A;  3VTW A;  3FIL A;  4EEW A;  1CK1 A;  2IGD A;  1WY8 A;  2MCN B;  2IO3 B;  2L1A A;  1ET9 A;  1I7H A;  1JAL A;  3OJ4 B;  3N9Y C;  3VR9 B;  3W5V B;  2DX5 B;  2ON8 A;  1Q10 A;  4XE0 A;  4FLH A;  3TCA A;  1L6V A;  3QK0 A;  4LDT D;  2LXA A;  3AEC B;  1PGA A;  3N1Z C;  3NG0 A;  1P0R A;  3ZO5 B;  2KT7 A;  1R7S A;  4Q2J A;  3NZS A;  4DQO C;  2X8X X;  1QLB B;  4C00 A;  1R4N I;  3QX1 A;  4MSM B;  1WXS A;  3SDL C;  3UI3 A;  4CYE A;  2O6V D;  4KZ0 A;  3LB8 C;  3H7P B;  4X57 B;  1FM0 D;  4LNN A;  5J2R A;  4ICV A;  1TGZ B;  5AUK A;  2KTR B;  2BTE A;  4EUT A;  4NAM A;  1HE8 A;  2KX0 A;  4C7Z A;  1UF0 A;  3QQ8 B;  2KC1 A;  4XWT A;  5G55 A;  2GBN A;  2CHX A;  4E3C A;  1JWS D;  2ACZ B;  4GN1 A;  2WXR A;  2MEK A;  4HCN B;  3R8B A;  3MFG A;  2C7M B;  1TS4 A;  3EFU A;  4WJN A;  2IBI B;  2IDY A;  4IKG A;  4EZL A;  2NPT A;  3AU4 A;  5KHO A;  1ZW7 A;  4OZA A;  4IC7 B;  2UYZ B;  3Q2A C;  2INN E;  1WH3 A;  4PYU A;  4ZRK A;  3W5U B;  4ZYS A;  1IUE A;  3AE6 B;  1MG4 A;  2HE7 A;  1XLP A;  1ACC A;  1TKY A;  2IPK D;  1TYG B;  1PYW D;  2KX3 A;  2K8H A;  1PGB A;  2DAJ A;  2FID A;  1V81 A;  1WGK A;  3I5J C;  3RNB C;  1HTO A;  2FNJ B;  2KD0 A;  2KVR A;  3AI5 A;  3RFZ B;  3V61 A;  2KJ6 A;  2KTF A;  3EGR A;  4DK5 A;  5DPW A;  1QOG A;  2CR5 A;  4DDI D;  3V3X A;  2ZEQ A;  2LI5 A;  4PYZ A;  2KXJ A;  4KGS A;  2GB1 A;  1CQV A;  4JWS C;  5D94 A;  1T0Q C;  3DWM A;  3AE9 B;  2ZVO A;  2WQY B;  2G9H D;  3NY5 A;  3RUL A;  3ZDM C;  4MGI E;  1L4Z B;  1I4Q A;  2WU2 B;  2BYV E;  2LWP A;  3WAL A;  3ZVV A;  2RDG A;  4LLG M;  3S2A A;  2NS5 A;  4A3P A;  1E0Z A;  1KJT A;  1WE6 A;  4DHJ D;  2GOW A;  2J52 A;  3AEF B;  1EO6 A;  4NZL B;  3GZN I;  1FO4 A;  1JWM D;  2L32 A;  1JRU A;  1YIW A;  3T8M A;  3LJ3 A;  3ZQ4 A;  2BT6 A;  4G50 A;  5IKC M;  1F9J A;  3ZXV A;  4K3B A;  2KQS A;  1YQB A;  1ESF A;  2ZCB A;  1SEB D;  2N9E B;  3BVM A;  1WYW B;  4S17 A;  3B2G A;  1BML C;  1QZE A;  4RCO A;  5BMH A;  4LJO B;  1K8R B;  1ZDV A;  4TQ0 A;  2K8C A;  2MBE A;  4WIP A;  1KM7 A;  4WWP A;  2RDH A;  3UIO B;  4HPM B;  1I4X A;  1GAQ B;  1E8Y A;  3M63 B;  4NJ7 A;  4A6Q A;  4A55 A;  1WFY A;  4M02 A;  4OVU A;  3Q8F A;  2WWZ A;  3X23 A;  1IYF A;  3ZNZ B;  4I6L B;  3PZD A;  1SBB B;  3AM9 A;  2WXO A;  4OW0 A;  3URY A;  4PS7 A;  3CF6 E;  1UWX A;  4HJK A;  1FXI A;  4KDI C;  5LLI A;  1WRD B;  2PJH A;  1DYQ A;  2J0K A;  1NEN B;  1V1P B;  3EC8 A;  2FCM A;  3PZ7 A;  4GIV A;  2LVP A;  4O1N A;  2HTH A;  4B0E A;  4DXF A;  4IWP A;  2BF8 B;  4K7S A;  2BGF A;  1CMX B;  3R2T A;  2PEA A;  2DLB A;  2MA9 B;  2PE9 A;  3HUI A;  4MAC A;  3MC8 A;  1MHH E;  1K53 A;  1V97 A;  5D6J B;  3KYC D;  1GPX A;  3SR6 A;  2KQ4 X;  1C76 A;  2KQ7 A;  3HM3 A;  3Q3F A;  1SE3 A;  1TIF A;  1SB3 C;  1WI0 A;  4KIK B;  4KGR A;  2ZVN A;  1KTK A;  4JIO U;  2CU1 A;  4RGM A;  2XEW A;  5BO4 B;  3ALB A;  3DWG C;  1ZP0 B;  1K50 A;  2D3B A;  2JU6 X;  3VXW A;  3PSE B;  2FUH B;  2IY1 B;  1MVK A;  2Z8L A;  4GGQ A;  4N58 A;  1Q0W B;  1WM2 A;  2KC2 A;  3AV8 A;  3VRB B;  4AQ7 A;  3ZNI D;  1ZDX A;  1LM8 B;  1F2R C;  1WXM A;  1T5X D;  2W54 A;  4MH0 E;  2LGY A;  3RN9 C;  4W9J A;  2C60 A;  3APD A;  3H7P A;  3EA6 A;  1SJH D;  2KWD A;  3JSV A;  2FBW B;  1NYQ A;  2I1J A;  2RSU A;  2L0F A;  4FJZ A;  4DXG A;  3R7Q A;  1D4B A;  5T8I A;  4ZRP A;  2BB5 A;  2N7J A;  2QIL A;  5GMV A;  2KJR A;  3OJ3 A;  3U7Z A;  1SJE D;  3EUB 2;  3Q8C A;  1FMA D;  3MHS D;  3PZ8 A;  2VH1 A;  2ZPN A;  3IVF A;  4A20 A;  4DHZ B;  4AJY B;  1I4R A;  1ENF A;  2QEJ C;  1P7E A;  2Z0D B;  3KWL A;  4ICU A;  4P6V F;  2WDQ B;  2SEB D;  1F52 A;  3RPF C;  5BMG A;  3HHM A;  1JWU D;  2NBW B;  5IO9 A;  5G5G A;  4IWQ A;  2EMT A;  3BIN A;  2D3C A;  1FRD A;  2LHE A;  1VLB A;  3KW5 B;  2QIE B;  2J42 A;  4YT0 B;  4BKS A;  1E6E B;  1WJ6 A;  3IT6 B;  3ECI A;  1HEZ E;  1SE4 A;  3P4S B;  3VR8 B;  4P1B C;  2KZR A;  3P63 A;  3JVZ X;  4BFR A;  1J8C A;  1UUP A;  4PS8 A;  4XGA B;  2XNA C;  3DBR I;  1J7A A;  2B76 B;  3TMP B;  2FCS A;  4XX5 A;  3W9C B;  4ANV A;  4YTN B;  3AE3 B;  1WIA A;  1YJI A;  3AE4 B;  2NCN A;  1SE2 A;  1K51 A;  1S3S G;  3I57 A;  5C1Z A;  2NR2 A;  2V0G A;  4RM9 A;  4M0W A;  2AEH A;  2KFJ A;  4MM3 A;  4II2 B;  5EE9 A;  4BVU C;  4BKG A;  4AP4 C;  4KIK A;  1C4P A;  4RH6 A;  5FK9 C;  3QAQ A;  4WJQ A;  2W3R A;  5AEK B;  3IFW B;  2D3G A;  4W9L A;  1JWB D;  2DZM A;  3DVG Y;  2PVO D;  4ARI A;  1XLO A;  2MSE D;  3P2B A;  2M1M A;  2K0P A;  1YQ4 B;  4B9K A;  2L76 A;  3E56 A;  4EKU A;  4BZA A;  4HKQ A;  1BXT A;  2W3S A;  4URK A;  3K9P B;  2L52 A;  2BVC A;  5KHQ A;  3GE3 C;  1BT0 A;  3L17 A;  4KSK C;  4NAW A;  1AAR A;  2KTR A;  1WJU A;  3H6N A;  1E7V A;  3NJT A;  3C8Y A;  4NQL B;  1OEY A;  2MJE A;  3PPA A;  2AL6 A;  2JVC A;  3I3T B;  1WZ3 A;  2LHD A;  1SSN A;  4XDD A;  4TUU A;  3PRE A;  4IM2 A;  1LGR A;  4DWF A;  3PT2 B;  1N5W A;  2EMS A;  3NZU A;  1LXD A;  4YSX B;  1MG8 A;  1YJJ A;  1PUT A;  3V6E B;  2AX5 A;  1C1Y B;  1WX7 A;  3SFE B;  1I4G A;  5EE3 A;  3W1S C;  2R2O A;  3ZIM A;  2M56 B;  1IP9 A;  4DBG A;  3ZJU A;  2MWS B;  4P16 A;  1N6Z A;  4WWN A;  2MW5 A;  3DVN U;  3DHI C;  4GDK A;  2IO1 B;  1D6E C;  3TL5 A;  5MPO A;  4OVV A;  4XZ4 A;  1WZ0 A;  4YWG G;  2GBJ A;  1ISN A;  1VZ6 A;  3FKY A;  3IAM 1;  2KYW A;  1N5X A;  4C56 C;  1UGM A;  1RYJ A;  2LD9 A;  1T3Q A;  3A4R A;  1P7F A;  3IBE A;  1GB4 A;  3B08 A;  4OVZ A;  4G3X B;  2KDF B;  2J4X A;  3B2F A;  4ZOH C;  3E9S A;  1WE7 A;  1V9J A;  3LXF A;  4AWJ A;  2ZNV B;  3AE8 B;  4KKJ A;  4RM8 A;  3JW0 X;  2DYO A;  4HEA 1;  5HFY A;  1FXT B;  2IY0 B;  5IA7 A;  4WAA A;  1WGR A;  2GBM A;  3NVV A;  2KFK B;  3TEY A;  1R4M I;  1J7C A;  2Y5B B;  4WQM A;  2MHJ A;  4LNF A;  4MJS B;  5EE1 A;  2K39 A;  4US9 A;  2JWU A;  2V9H A;  4TKN A;  3QWZ B;  3PGE A;  2HDE A;  4LNO A;  2NBU A;  4TMA B;  2V3S A;  1V1O A;  3MHZ A;  2FUG 1;  2RPV A;  3RT3 B;  3AEA B;  2HJ8 A;  1QF6 A;  2L7R A;  2V3N A;  2IO0 B;  4REZ A;  2IJ0 A;  2KAN A;  2Z59 B;  4NAW B;  1MHX A;  2W9N A;  2K22 A;  3BVG A;  2K5P A;  3SU8 X;  3KUD B;  3VTV A;  3R7R A;  4MEM A;  3H9D A;  2WYQ A;  3EEC A;  1WYG A;  3BK1 A;  2WXF A;  4FA6 A;  1GB1 A;  4HVB A;  3Q8B A;  1GC6 A;  4GMV A;  3BK2 A;  4I6N B;  4HDO A;  3SFD B;  1UWM A;  1YD8 U;  4ZRI A;  3OWE B;  1ET6 A;  1WR1 A;  3FC4 A;  1FNV A;  1XXG A;  1GUA B;  3DOW A;  1NYR A;  3Q3J A;  1C4A A;  4L2Y A;  4ANU A;  5AUI A;  3P4Q B;  3ZJV A;  2J0M A;  1RAX A;  3WAM A;  2RPQ A;  3B9J A;  3GB1 A;  2C7H A;  3PHW B;  1N60 A;  3FIL B;  2AQ2 B;  3DCG A;  5FKA C;  2LUE A;  3RNG C;  1NVI D;  3X0W A;  2WXQ A;  4YSZ B;  4LNK A;  2G45 B;  2C7N B;  2NTS A;  2PW9 A;  2LAS A;  2N9K A;  3BVZ A;  2KJH B;  2BBC A;  3ML9 A;  3L0W B;  1P98 A;  3U2S C;  4MJS A;  3TEX A;  4JGH B;  1A70 A;  2JY6 A;  2K9X A;  5IAA C;  1WSP A;  1J19 A;  2K3U A;  3OLM D;  2W55 A;  2N7E A;  3NS1 A;  1SIF A;  4J3O D;  4K3C A;  1LO5 D;  1TZ1 A;  3QCA A;  1ZOY B;  4AUQ C;  1VR9 A;  2CJO A;  4RGO S;  3BII D;  3AB5 A;  1IPG A;  4PK1 A;  5CHF A;  2KLC A;  3DQV A;  5HKH A;  4CO7 A;  2NVU I;  3KYD D;  2LGS A;  2W82 A;  3VH3 B;  1FIQ A;  2LVQ A;  1PFD A;  4B6W A;  3Q14 C;  2N1V A;  5JXV A;  1UBQ A;  1OFF A;  3RUI B;  2LGX A;  5C2T B;  1Z5S B;  1X1M A;  1WMH B;  4M01 A;  1VRA B;  4K7U A;  4D2K A;  1GJZ A;  4EOY A;  2N4F A;  1STE A;  2LVO A;  3VQI A;  4P7I A;  3IXS A;  4I6P A;  1T6B X;  1MFW A;  2LUM A;  2NBV B;  5H92 C;  3L13 A;  2E6X A;  2KO3 A;  3WAP A;  1LQB A;  2LGI A;  4NJC A;  2MX2 A;  2JRI B;  3ZXR A;  1QIL A;  4C80 A;  1DOX A;  3C0R B;  3AXC A;  1DGJ A;  4UDU C;  5EDS A;  3AU5 A;  2IYD B;  2WP9 B;  2HJ1 A;  1YOV B;  4YSY B;  3NRZ A;  1M4V A;  2OJR A;  4IWO A;  4USA A;  2GMI C;  2KLG A;  2KAJ A;  1YMH E;  3MP9 A;  2LRU A;  2MP2 B;  4JLC A;  3BY4 B;  1KH0 A;  5EE0 A;  3RMK C;  2LZ6 A;  1YQ3 B;  4M00 A;  4OZB A;  1EUV B;  3Q3M C;  2J0J A;  1TBE A;  3TIX A;  1UD7 A;  3M62 B;  3RI7 C;  3UQA A;  2I2Y A;  4MSQ B;  1VZ8 A;  3DBL B;  4K1R B;  3NZ3 A;  2BS2 B;  4E74 A;  3AUL A;  4HLE A;  2JZP A;  1YN3 A;  4A90 A;  1V2Y A;  3VAW A;  4PS3 A;  3RZW C;  1SIJ A;  1NI2 A;  1TZO A;  2QJL A;  4G0N B;  1LFD A;  4MH8 A;  4EZK A;  4MGK E;  2JPH A;  3AE2 B;  3O65 B;  1D5Z C;  4HCP B;  1EF5 A;  4MDK E;  3TUO A;  1QOB A;  4MGY E;  1NI3 A;  4W9H A;  3AEE B;  3WCQ A;  1E7P B;  4W9K A;  1C78 A;  3A9J A;  4JE3 B;  1ZXI A;  5AZF A;  4AJW A;  2NTT A;  3AEB B;  3ZKJ C;  2O2V A;  3U52 E;  1TT5 B;  1ZE3 D;  2MBQ A;  4C4V A;  1C4C A;  2KK8 A;  4K7W A;  4M8M A;  4JPS A;  4KX6 B;  1JML A;  1SE9 A;  2N7D A;  4QAY A;  3HM6 X;  2LRW A;  2WXG A;  4JQW C;  4W9E A;  3J9C A;  2KKC A;  2DEN B;  3IG3 A;  4W9D A;  2ZW1 A;  2DHZ A;  1WGY A;  1PQS A;  3PLU A;  3BYY B;  3U30 A;  4AS1 A;  2D2Q A;  4ZHP A;  1C9F A;  2BYT A;  1ZKH A;  4OZC A;  1R4N B;  4JWU C;  3QIJ A;  2MJD A;  1WX8 A;  3R2I A;  1NBF C;  2JXT A;  4WH4 A;  2FE8 A;  5GXG B;  3RYT A;  2PLP A;  1EM7 A;  2PPH A;  1JW9 D;  2MH7 A;  5LXI B;  4EFO A;  1HZ6 A;  2KDB A;  5FR6 A;  1Q5W B;  3V6C B;  1V80 A;  2V3P A;  1EF1 A;  3RNF C;  1SF0 A;  4HKZ E;  4EZJ A;  2AQ3 B;  3NVZ A;  4GU2 A;  3N20 C;  1B9R A;  2BWF A;  3QA8 A;  1UEL A;  2QDF A;  4US8 A;  3VDZ A;  4TV3 A;  3JSV B;  2KAC A;  4GLS C;  4RF1 A;  4L1B A;  3ZJT A;  2KN4 A;  4JL9 A;  3KUC B;  4HPL B;  2CKH B;  3H1U A;  3TJP A;  3ZDT A;  4WJP A;  2RMM A;  3PVL A;  1D5M C;  2J7Q B;  2K8B A;  3H7S A;  1UH6 A;  3Q8E A;  3BZD B;  1PDX A;  4GB9 A;  3KH0 A;  4NPN A;  2KOX A;  3ZUN A;  1E7U A;  2G3Q B;  1WJN A;  3ZTC A;  1F77 A;  3IAS 1;  1WM3 A;  1M94 A;  1GOZ A;  3QJZ A;  4G11 A;  1FEH A;  3QC8 B;  3WA0 A;  5TSS A;  2V4I B;  3UIN B;  4XDC A;  2KFK A;  3UQB A;  2Z0E B;  1Z2M A;  1XF5 L;  3HIZ A;  3KUZ A;  2MRP A; 
#chains in the Genus database with same CATH homology
 3RMK C;  2INC C;  3N1Y C;  3Q3N C;  3N1X C;  3RNE C;  3I5J C;  3Q3O C;  3RNB C;  3RNA C;  4P1C C;  2RDB C;  3RNF C;  3Q14 C;  3Q2A C;  3Q3M C;  3GE8 C;  3RN9 C;  3RI7 C;  3I63 C;  3DHG C;  1T0R C;  3RNC C;  1T0S C;  3N20 C;  3RNG C;  3DHI C;  2IND C;  3DHH C;  3N1Z C;  3GE3 C;  1T0Q C;  4P1B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...