3N1YC

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase t201g mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
b'TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Active Site Threonine Facilitates Proton Transfer during Dioxygen Activation at the Diiron Center of Toluene/o-Xylene Monooxygenase Hydroxylase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3n1yC00
2INDC 3Q3NC 3N1YC 3RNBC 3N1XC 3GE8C 3I5JC 3RI7C 3Q3OC 3DHGC 3RNEC 3RMKC 1T0RC 4P1BC 3Q14C 3RNGC 3RNFC 3GE3C 4P1CC 3N1ZC 2RDBC 3RN9C 3DHIC 1T0QC 2INCC 3N20C 3RNAC 3DHHC 3Q2AC 3Q3MC 3RNCC 3I63C 1T0SC
chains in the Genus database with same CATH superfamily
2WYQA 2LGYA 2GBKA 2WXJA 1YQBA 3RMKC 1EF5A 5EE3A 2BYEA 3Q3JA 2WLBA 4FHKA 3L4PA 1AWDA 3NRZA 1YQ4B 5EDSA 5L83A 2UYZB 1UELA 1N63A 3DBLB 3TEXA 4HPPA 2G45B 3BZDB 4C56C 4JIOU 3P63A 1VD2A 2J0MA 3TL5A 1V86A 3Q3MC 4MH8A 1Q10A 2NS5A 3KH0A 2VH1A 4GMVA 3W1SC 2N1WA 1P9DU 4CQNA 2W82A 4AJYB 2PKOA 2VZKB 4M00A 1VZ6A 5CTRC 2NPTB 5HHDG 1YJJA 2E3TA 5IOIA 2Y5BB 4G50A 3OJ4B 3R8BA 2WQYB 3AM9A 2GBMA 1VR9A 4OVZA 5D3IB 1EO6A 3A9JB 5LXIB 2N4FA 1TBEA 4F1SA 1MI0A 1E90A 5E6OA 3L0WB 3EGRA 1TTNA 1Z2MA 5IA7A 1ZKHA 4JWSC 1M4VA 1TJEA 3GB1A 1V9JA 1A70A 5E6JA 2QDFA 3NVZA 3VTWA 3TEWA 3NG0A 3EFUA 3V6EB 1EU3A 3UIPB 1P7EA 3ZYYX 2RSUA 4WJQA 4JQWC 2KZRA 4BFRA 3WANA 2CU1A 2KAJA 3H7PA 4ANWA 3NY5A 1T0QC 4ICVA 3OWEB 2ONQA 3BWUD 1KLVA 3IXSA 1Q0WB 1RWSA 1GC7A 4HJGE 3NJTA 1EUVB 3ECIA 1F77A 1CJEA 1WI0A 1TYGB 3ZUNA 1J7CA 5GXGB 1V6EA 4MSQB 4XGAB 2V0GA 2SAKA 1S3SG 4ZHPA 4X57B 4S17A 3NVWA 5HFYA 1WM2A 3UF8A 2FCMA 4LCDE 3TMPB 1E8YA 2FE8A 3RT3B 3ZTCA 2O2VB 3R7QA 3HRDD 2HDEA 2DZKA 1XT9B 1V49A 2FNJB 2WNMA 3B2GA 3PHXB 2K8HA 3C0RB 2O6VA 1MG8A 3URYA 1TKEA 3A1QB 2GLSA 4LDTB 4MT5A 1T0SC 1WR1A 2IO2B 3AEAB 1CK1A 4R3DA 4WJPA 2FBWB 1FMAD 1FNWA 4A6QA 2AWTA 1C79A 3GE3C 3NS1A 1ZXHA 3SEBA 4DWFA 1ZDVA 3AEBB 3EUB2 1R4NI 3AE9B 1OTRB 2ASQA 1ZOYB 1V2YA 1V81A 2DENB 1S1QB 1XCQL 1RAXA 2PIAA 3PZ8A 4TV3A 4BBNF 1C4CA 5FR6A 2YEPB 2HD5B 3KYCD 1Q5WB 4KVGB 2ACZB 3PVLA 3VAWA 1L2NA 4LNKA 1TS3A 1V1PB 2JYTA 3VH3B 4IM2A 2KT7A 1PGXA 3UQBA 4II2B 1QOFA 3I5JC 1X1MA 5H8YE 1GB1A 3WA0A 1UH6A 2CR5A 1P0RA 1WMHA 1GUAB 4HXDA 1LO5D 1JWMD 2BS2B 2GI9A 2XK5A 2KN4A 2R61A 4YWGG 4C7ZA 1Y8RC 1PQSA 4DBGA 4BKTA 2WXKA 2WDRB 3U2SC 3ZJTA 4RM9A 2QJLA 1ZE3D 1H8CA 3GS2A 2WWZA 3A33B 2LJIA 3W2DA 3DWGC 2K6DB 5CHFA 1F1HA 1C4AA 5EE1A 3AE7B 1LM8B 3CSFA 1T0YA 3W1YA 4ACFA 2C5LC 2JXXA 4RGMA 3V6CB 2KFJA 2KANA 2Z59B 1YX6B 2ZJDA 2RDBC 1ZUD2 3PO0A 4EZKA 4M0WA 3M63B 2N7DA 1OFFA 1RRBA 1XO3A 1WX9A 4MJSA 4BKSD 2I1JA 2JVCA 1EM7A 5D7GA 2N9LA 2L0FA 1ZXIA 2JY6A 1EWCA 1D3ZA 4REZA 1D6EC 2I38A 4DXGA 5J18A 2MX2A 1FFUA 4A3PA 2D5GA 3AI5A 1J8CA 4B9KA 5FK9C 4XYCA 3AECB 4MSMB 4DQOC 1UD7A 1XEEA 2DBYA 3BY4B 2QSDA 3GZNI 2N7JA 2CHXA 1JALA 2IY0B 1R7SA 1WXQA 3P42A 4TMAB 3ZKJC 2OOBB 1QQRA 2MWSB 1Q1OA 4RCOA 1FXIA 3O65B 3JSVB 4EE2A 5BMGA 3VTUA 2WXMA 3AU5A 4RF1A 2JXTA 3I9V1 2JPHA 3VRBB 2DZMA 3TCAA 3H1UA 3RZWC 4KZ0A 4FJZA 1IYFA 2V3PA 2JSVX 4P16A 1RFKA 4DHJD 4KGRA 1E7UA 4P7IA 2MCNB 1JWBD 5AUKA 3RPFC 3OJ3A 1V5OA 3WIMA 2KJRA 2AQ3B 4KSLC 2KKCA 4HWIB 2WX0A 3A9KA 2AL3A 5AZFA 3RULA 2KX0A 1QOGA 1WJUA 1SSNA 4WAFA 3EA6A 2IO0B 3PTFC 3OLMD 2DYOA 2XEWA 3B2FA 4TUUA 2WXNA 4MH0E 3UINB 3KUZA 2KTRB 5G5HA 5JHBA 3GOEA 3RNGC 1UWXA 5C3JB 2CJNA 2ZVOA 2N9PC 5H92C 1SIFA 2LVQA 3L13A 4J6IA 3FILB 1IPGA 4NY0A 2KVRA 4NJ6A 3HHMA 1QOBA 1JMLA 3APDA 4GB9A 1V97A 2D3AA 3ZJUA 4KGSA 3IHPC 2MQJA 3MP9A 4HKZE 4DXFA 3LB8C 2RDGA 1MHXA 1C9FA 2K0PA 2K8BA 1DOIA 3ZW3A 3PT2B 3B1LX 1E7PB 2WXGA 1MFWA 1E9MA 5HKHA 4RGNA 2KMAA 1NYRA 3QCAA 4E74A 4K3CA 2OEDA 2J0JA 3P4RB 2JZZA 1WE7A 1F9JA 4WJOA 4C80A 2BYFA 3ABVB 3RZFA 4FLHA 1E0ZA 3DHHC 1QILA 3NHEB 1SEBD 2Y3AA 1WGYA 3CMMB 2KNBA 1M94A 3SU8X 2GOWA 3QARA 3DBHI 2V4LA 3ZLZA 2FIDA 4ZRQA 1J7BA 1WYGA 4ZRKA 2KQ7A 5AZHA 3PZDA 3AH7A 2H89B 3VTVA 4IWPA 2LXAA 3MC9A 4XX5A 3ZNZB 1N6ZA 1T0RC 1Z5SB 1SE9A 1E7VA 1JRPA 4M02A 1NEKB 2OJWA 1EF1A 2JX5A 2WGSA 5BMHA 3KVFB 5T8IA 4IUMB 4XDDA 4KDLB 4DK5A 2J52A 3BK1A 5DCNA 2O2VA 1CQVA 2W55A 1SJHD 4GSWA 1XLQA 2INDC 4HRSA 2SEBD 1L4DB 1E5WA 3DBSA 4W9JA 2R2OA 2KACA 2BF8B 2KDBA 3A1QA 2NBWB 2RPQA 2GBJA 1KRHA 2W3SA 1I4QA 4W9DA 4AS1A 4HPLB 4RGOS 4XWWA 4HEA1 1WXVA 4WIPA 2PW9A 2C7HA 3A9KB 4NJ7A 2M1MA 3R66C 3QJZA 3AE4B 2MBBB 1PGBA 1WSPA 2V3SA 4DHJB 3RFZB 3IAS1 1VZ8A 2ZW1A 2M4NA 2KX3A 2JUOA 5IKCM 2IGDA 3RCZA 3RNAC 3MC8A 1TS2A 3B08A 2WXIA 2IDYA 5HI1A 3ZRCA 4GOCA 2KLCA 3ZNGC 1WJ4A 2Y5CA 1V1PA 4ZRJA 3MC0B 3ZQ4A 3APCA 1WWTA 1BMLC 2D3GA 2QIEB 3VHTC 1R4MB 2MJ3A 2D3CA 1TY2A 5BYRA 2KDFB 5C2TB 3NOBA 3AE3B 2LVOA 2J42A 2DZIA 2D11A 4B95A 1HZ6A 4NPNA 3DPDA 3RNEC 3ALBA 1SXTA 3VXWA 5LXHA 1D5ZC 5FR3A 1FEHA 1JQ4A 2KWDA 2B3AA 4HKQA 1WGKA 4FULA 4NAMA 2PJHA 4LNFA 3RN9C 3WAMA 3PS6A 2JRIB 1P98A 3DBRI 1NDDA 2XNAC 1LQBA 1FPYA 2LVPA 3MTNB 3BK2A 2V3NA 2DWQA 3VQIA 3T3NA 1TGZB 3AEEB 4ASWC 4GU2A 2ZZPB 4HDQA 2KC2A 1L0VB 3U7ZA 1P3QU 2KQ4X 4RMAA 1VZ7A 2JRHA 1C77A 3ZDTA 3T3OA 3DDCB 4WQOB 3DQVA 4RGTA 4FADA 1ZGUB 3ZNID 2AEHA 2ZNVC 1TS5A 1B1ZA 2G4DB 3Q3OC 5AZGA 4C00A 3ETRA 2LRUA 3DWMA 4HCPB 3ZVVA 4BVUC 2NBUA 1I4RA 3AV8A 1XLPA 4PS8A 3AN1A 2YVCA 4JLCA 3J9CA 1JWAD 4GDKB 4KIKB 4IC7B 2KQSA 3VRAB 2IPKD 2L00B 2V1YA 3SR6A 2CU3A 3GP7A 2N1VA 1TKYA 1XF5L 1JWSD 4PS7A 2HJ8A 3ZIMA 3ZO5B 3H6NA 2BWFA 4W9LA 1F0ZA 1MJDA 2WHIA 2MSED 4FJVB 2K8CA 2IO1B 1SE4A 1BUIC 2CKHB 3RNCC 1AARA 2MJDA 3VH4B 2PVOD 1FNUA 4IG7B 1SF0A 3WALA 4M8NA 4K7UA 2HJ1A 3FKYA 1N61A 1CZPA 3BYYB 3JSVA 5DPSA 4UDUC 5IN7A 1T5XD 2KYWA 2BGFA 1V8CA 3R3MA 2K6QA 1YN3A 4W9CA 1FCCC 2LHEA 4G0NB 3Q6BA 3AEDB 2WXRA 4AWJA 1KJTA 2KDMA 1FXAA 2UU7A 2NBVB 2Q5WD 3L54A 2KFKA 1A5RA 4KKJA 2MH7A 3QWZB 5J2RA 2ICIA 4H2AA 4YXDB 3QC8B 3EFCA 1RLFA 3NZUA 3GE8C 2JYEA 2GBRA 4BOSC 1PYWD 1D5XC 1L6VA 3ZRFA 3WCQA 2KTRA 5DPRA 2L05A 5G55A 2BPSA 2LFIA 2ZNVB 2LXCA 5IP4D 2IO3B 1JW9D 2NTTA 4F8CB 1ZPSA 2W3RA 3HK0A 2KOXA 2JF5A 2AQ1B 1WGGA 1YQ3B 3CIRB 3FILA 3JYUA 1J19A 4TQ1A 4DXAB 2J7QB 4W9HA 3AXCA 4BBNC 2LMCA 3MJWA 4WAAA 4CYEA 3U52E 2HE7A 1XXGA 2KHWB 4HDOA 4W9IA 1KH0A 2WDTB 4W9FA 1VCBA 3Q14C 4FA6A 4IM0A 1KLUD 2NMQA 4JPSA 1AYFA 3L17A 4AP4C 5AEKB 1RYJA 1UGMA 4FJYA 3QQ8B 1HTOA 3DVGY 2LASA 2L3ZA 4YSXB 3KYDD 3Q3FA 3X0WA 1UWMA 2MJEA 4YTMB 1V5TA 1FFVA 2L0TA 3V62A 3N1XC 3H7SA 3RD2A 1DGJA 4QAYA 2FIFA 2K5PA 5D6JB 2JQRB 2INPE 2BVCA 2IYDB 2LEKA 3CF6E 3PV1A 1NENB 2BYVE 3DBLI 2JZPA 1QT9A 1TKGA 2GRIA 4MDKE 3RNBC 2RR9A 3L08A 1HTQA 5E6PA 2N9XA 3IT6B 1OQQA 4BKSA 2IGGA 1WM3A 2WU5B 2ZPYA 2ZPNA 3NVYA 4ZRIA 3EHVA 3V3XA 3TIXA 3N3KB 4N9F4 1IBXA 1I4HA 1VLBA 4M01A 1C3TA 3KUDB 4OVUA 3BVGA 3H9DA 2HTME 3U8ZA 4S0RA 2MBEA 1YX5B 1E10A 4HROA 1C4PA 3PPAA 3LXFA 3PRMB 1MHHE 3ENEA 3MFGA 1VDVA 2KFKB 3E9SA 3I3TB 1MPEA 3IT4B 2D10A 3KQ4A 4MM3A 5D2MB 1ZDXA 3EC8A 2IBIB 4MEMA 4RF0A 4J3OD 4IW0A 2JZ3B 2WX1A 2G1EA 1I7HA 1FIQA 2DAJA 1GJZA 2BBCA 4HK2A 1F2RI 2KWVB 5G2NA 4JX1C 2FCSA 4FN2A 5KHQA 2FUHB 1FRRA 1TS4A 4WWPA 3PLVA 1DOXA 3ML8A 2CHWA 1ESFA 2JWUA 5BYQA 1I4PA 1XQQA 1RM6C 1UBIA 4DHZB 2V4IB 2EKEC 2VZKD 4ANXA 4YL8A 3FAHA 1QF6A 1JROA 2NCNA 4II3B 2DHZA 1BXTA 4W9KA 2EELA 3IG3A 4XDCA 2ZCCA 1WXSA 4IKGA 3NVVA 4A8XC 2MA9B 2MRPA 3H8HA 3DHGC 4RNAA 2RD0A 2HTHA 4Q2JA 4B0EA 1D4BA 1I4GA 4RM8A 1R4NB 1GC6A 2QC8A 4KGTA 2Z0DB 4KZCA 2X8XX 2K22A 4YTNB 4MACA 2BWES 1QLBB 3MHZA 4XC2A 1GAQB 2EKIA 4YSZB 5LLIA 3DVGX 4NNJB 1IGDA 2L1AA 1FCLA 5DPWA 3PSEB 2LGDA 4ICUA 4KSKC 3ML9A 2M19A 4M8MA 3M3JA 1LXDA 4I6LB 3EECA 3ZNHB 3U4EG 3P2BA 3P4SB 5MPOA 4NQKE 4BKGA 1SIJA 3SFEB 3U7DA 2GMIC 4OZBA 4N6EB 2L7RA 3WAOA 2C7NB 4GDKA 4KIKA 2KN5A 2X38A 3SD5A 1IBXB 2QHOA 3MHSD 4FXCA 4LJPB 2CJOA 1QOAA 1UF0A 4L2YA 2D2QA 1EWYC 4PYZA 1PDXA 1GG3A 3B9JA 4KKIA 1TT5B 2LGSA 3UQAA 1NI2A 2PE6B 1WFYA 2N9EB 2H88B 3LDZE 3SFDB 3Q8FA 1J7AA 1TIFA 1WRIA 5FKAC 3OAWA 5BYSA 3QK0A 5JZEB 2ON8A 2PLPA 2G3QB 1NVID 4USAA 3NZ3A 4LDTD 4RFBA 4MGYE 2WXFA 2VH2A 1VJKA 4MM3B 2E6XA 5LNK1 1HZ5A 2KMCA 3BVZA 2QCZA 1E8WA 2FCQA 3RNFC 4W9GA 1L7YA 3B0AA 1B9RA 4HVBA 1WX8A 2C9WB 3C19A 4PS3A 5BO4B 1WX7A 1WR6E 4A20A 1MVKA 4ANVA 2DAFA 4E3CA 2R2QA 2W54A 2LHDA 2IZVB 3Q8CA 2JT4B 4YTPB 2BB6A 3HM6X 3DOWA 4C4VA 1N62A 4TQ0A 1P1AA 2YEPF 1GB4A 4PK1A 3IAM1 4HCNB 1E6EB 3N32A 4HPMB 1LGRA 1TZ1A 1PFDA 3PZ7A 2BTEA 3SHQA 1KFYB 4YT0B 2N7EA 2IY1B 2XBBC 4TSSA 3N1YC 3GZNB 3KWVA 3CWIA 2MW5A 1OEYA 3APFA 1ISNA 3KUCB 3W9CB 1WXMA 2J0KA 1FXTB 4G3XB 2M8SA 4ZDVA 4BZAA 4GGQA 4WJNA 2B76B 2LJ5A 4TKNA 2DLBA 3Q2AC 3DCGA 2BQQA 3SDLC 3NUHB 1KF6B 2BT6A 3N30A 3VR8B 1JCKB 2Z0EB 1TY0A 1L5PA 1SGHA 4OHJA 2D07B 1D5MC 1HEZE 2A5UA 3FC4A 3KLSX 2G4SA 1YJ1A 3HVZA 4B0MA 3QA8A 4L23A 3TBLD 3VUWA 1AW7A 2KVZA 2BS4B 2AL6A 4K3BA 2GBNA 3QHTA 5EE0A 2L83A 2LWPA 1G6JA 1OQYA 1IGCA 2BW2A 2LUMA 3X23A 4JE3B 1I42A 4URKA 3PRPB 1WJ6A 1WGRA 1HE8A 3A4SC 2LGIA 4K7SA 1V1OA 2KJ6A 1XLOA 1F52A 1JWUD 1K52A 1OEYJ 1YN4A 3ONSA 1XLNA 4IM3A 3P1MA 2K25A 2PEAA 5TSSA 4ZRPA 3DVNV 1ROEA 3N9YC 3ZJVA 4A90A 1MG4A 2AX5A 1DOYA 1NI3A 1KLGD 1WRDB 4KX6B 2MEKA 2K9XA 4WQMA 3PHWB 5JXVA 2K1FA 3HIZA 4PT5A 2KK8A 1ZW7A 2LZ6A 2O6VD 1I35A 2RMMA 2WS3B 3IFWB 2Y5PA 2BB5A 4OZAA 4LLGM 4IWQA 3S2AA 2OHFA 4KV2A 2NR2A 2A4ZA 1LFDA 1CMXB 4MGKE 5CX3A 2BS3B 3IBEA 2PVGC 3I57A 1JRUA 1YJIA 3UI3A 2WDQB 1WGHA 2FAZA 2N9KA 2BYTA 3AEGB 5D3DA 2DNFA 2I2YA 1WXAA 2DYMA 2M56B 3M62B 4LTUA 2LI5A 4GIVA 4MGIE 4C4VB 5E6NA 2LGXA 1K50A 2KWCA 2WXOA 1DYQA 4C7YA 1WIAA 3U30A 4ZHOA 3DBHB 4N59A 4EFOA 3TJPA 2MBQA 1FM0D 4EZJA 4JGHB 3ZXVA 1YNTE 2QEJC 2LD9A 2LUEA 1HXYD 3ZXRA 1WZ0A 4LNIA 1N60A 3Q3NC 1XCTL 4N58A 4HLEA 4BAXA 1PUTA 1HQRD 1WGDA 3WAPA 4F7ZA 3PLUA 3DVNU 2AQ2B 1WH3A 3Q8BA 5G5GA 3VUYA 5L95C 2ZCBA 2MP2A 4GXBA 1N5XA 3R7RA 2J4XA 3PGEA 4XZ4A 4BOZB 1UUPA 2C7MB 1E8ZA 4W9EA 4LNNA 1SB3C 4NAWA 3AU4A 2WXPA 1YIWA 1KTKA 3OG5A 4IWOA 1OGWA 3PRZA 2EMTA 3E56A 1C76A 1NBFC 4EUTA 3PREA 4ZYSA 2UWQA 1T3QA 2WU2B 2WXHA 2YLMA 1YMHE 2KWUB 3P4QB 3AEFB 4GLSC 1C78A 3H7PB 2NTSA 4JL9A 3HM3A 3LYYA 1L0YB 4P1BC 2KDIA 2EMSA 2TSSA 4NJCA 3C8YA 4XE0A 4K1RB 3CSTA 2M0XA 2L52A 1C1YB 3L10B 2BKRB 3QAQA 5EE9A 1L0XB 2M0AA 4GDLA 4LNOA 4US9A 4JWUC 4A9AA 1XD3B 3Q8EA 2BKFA 2WXLA 1WY8A 3AB5A 3QIJA 4K7WA 1WJNA 1WF9A 2V9HA 4AUQC 3AE1B 3TUOA 2IGHA 4E71A 1ACCA 3VDZA 4WWMA 1OQRA 4ITKA 4NZLB 4OVVA 4DDID 1WE6A 1R4MI 2RPVA 5C1ZA 1K51A 3JW0X 3JVZX 2D3BA 2M17A 1ET9A 3TSSA 1BT0A 2O6VB 3AE2B 4D2KA 5JHAA 3IVFA 3AE8B 3W5UB 2PMVA 2C60A 2K3UA 1IP9A 2REXA 3DBRB 1SJED 3ZDMC 4WWNA 1STEA 4GN1A 3P4PB 2K39A 2MBOA 2ZEQA 2XN9C 2RGFA 3I63C 1UBQA 5GMVA 3D32A 3V60A 1E8XA 3AE6B 1YD8U 1V80A 2QMTA 4NQLB 2KMMA 1EU4A 4FBJB 1I4XA 1AN8A 3AULA 3QX1A 2J53A 2WDVB 5D94A 1FD6A 1RFAA 4EOYA 4I6PA 5CHWA 3RYTA 1K8RB 4A3OA 3RI7C 3RUIB 3VVWB 1GNUA 4DHZE 1J0GA 1GOZA 5IAAC 4A55A 1ZP0B 5AUIA 5I4DA 2W9NA 3BYTB 2KJHB 3UGBB 2PE9A 3LJ3A 5TR5A 4AOFA 5CHVC 2INCC 2CS4A 4EZLA 2KD0A 2ZW0A 4OZCA 2MP2B 1NYQA 2WP9B 1QZEA 3VFKA 1KM7A 4ARCA 1WMHB 4EKUA 1P7FA 3W5VB 2DYBA 2CHZA 4O1NA 2I1KA 2XK5B 4NAWB 4PYUA 1WZ3A 4HJKA 3MJ5A 3UIOB 4FHJA 3BINA 3HVDA 4ZYNA 2JWZA 3DHIC 1GPXA 2ZVNA 2KDEB 3BIID 3AMZA 1ET6A 5DPTA 2DZJA 4WWOA 2AYOB 2NPTA 3HUIA 2PTLA 2IJ0A 4YSYB 5HG2A 1FO4A 4LJOB 2L76A 2N0SB 1L4ZB 2FUG1 3ZTDA 4K81A 4OW0A 3VR9B 3KWLA 2KO3A 3A9JA 3BVMA 5BMIA 3R2TA 3V61A 4AQ7A 2L8JA 2KC1A 1UNSA 4RH6A 4M0WB 3R2IA 3TEZA 1TZOA 1FRDA 4GDLB 1QKZA 4CO7A 2KLGA 1SBBB 4US8A 3A4RA 1PGAA 2Z8LA 1T6BX 1YOVB 2OJRA 4MJSB 1H4RA 2QILA 4WH4A 3T9LA 1SE3A 1Y56A 4AJWA 3VUXA 2KXJA 2VRRB 2PPHA 1U4AA 3K9PB 5KHOA 4EEWA 3NZSA 1L6UA 4ARIA 4ZOHC 3N1ZC 2WXQA 3V05A 2NVUI 4KDIC 2L32A 2JU6X 3N20C 1FNVA 1SE2A 4MELA 5J17A 2FCNA 3ZGZA 4CHKA 4MGZE 4ANUA 1UZXB 3L16A 4P6VF 2MLBA 1IUEA 2RDHA 1HA5A 5C23A 4LK0M 4P1CC 2KTFA 4I6NB 2G9HD 1K53A 1ENFA 2MBHA 3Q8AA 3Q69A 2DX5B 1KOTA 5JH5C 1F2RC 4WURA 1UGJA 1VRAB 2GB1A 3AE5B 1N5WA 3KW5B 1YN5A 3NS8A 4IDIA 4L1BA 3M95A 3TEYA 3T8MA 4XWTA 1WYWB 4G11A 3O13A 3K9OB 5IO9A 4DDGD 2INNE 2MHJA 4B6WA 2LRWA 3W1SA 4IOIE
chains in the Genus database with same CATH topology
2INDC 3Q3NC 3N1YC 3RNBC 3N1XC 3GE8C 3I5JC 3RI7C 3Q3OC 3DHGC 3RNEC 3RMKC 1T0RC 4P1BC 3Q14C 3RNGC 3RNFC 3GE3C 4P1CC 3N1ZC 2RDBC 3RN9C 3DHIC 1T0QC 2INCC 3N20C 3RNAC 3DHHC 3Q2AC 3Q3MC 3RNCC 3I63C 1T0SC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IND C;  3Q3N C;  3N1Y C;  3RNB C;  3N1X C;  3GE8 C;  3I5J C;  3RI7 C;  3Q3O C;  3DHG C;  3RNE C;  3RMK C;  1T0R C;  4P1B C;  3Q14 C;  3RNG C;  3RNF C;  3GE3 C;  4P1C C;  3N1Z C;  2RDB C;  3RN9 C;  3DHI C;  1T0Q C;  2INC C;  3N20 C;  3RNA C;  3DHH C;  3Q2A C;  3Q3M C;  3RNC C;  3I63 C;  1T0S C; 
#chains in the Genus database with same CATH topology
 2WYQ A;  2LGY A;  2GBK A;  2WXJ A;  1YQB A;  3RMK C;  1EF5 A;  5EE3 A;  2BYE A;  3Q3J A;  2WLB A;  4FHK A;  3L4P A;  1AWD A;  3NRZ A;  1YQ4 B;  5EDS A;  5L83 A;  2UYZ B;  1UEL A;  1N63 A;  3DBL B;  3TEX A;  4HPP A;  2G45 B;  3BZD B;  4C56 C;  4JIO U;  3P63 A;  1VD2 A;  2J0M A;  3TL5 A;  1V86 A;  3Q3M C;  4MH8 A;  1Q10 A;  2NS5 A;  3KH0 A;  2VH1 A;  4GMV A;  3W1S C;  2N1W A;  1P9D U;  4CQN A;  2W82 A;  4AJY B;  2PKO A;  2VZK B;  4M00 A;  1VZ6 A;  5CTR C;  2NPT B;  5HHD G;  1YJJ A;  2E3T A;  5IOI A;  2Y5B B;  4G50 A;  3OJ4 B;  3R8B A;  2WQY B;  3AM9 A;  2GBM A;  1VR9 A;  4OVZ A;  5D3I B;  1EO6 A;  3A9J B;  5LXI B;  2N4F A;  1TBE A;  4F1S A;  1MI0 A;  1E90 A;  5E6O A;  3L0W B;  3EGR A;  1TTN A;  1Z2M A;  5IA7 A;  1ZKH A;  4JWS C;  1M4V A;  1TJE A;  3GB1 A;  1V9J A;  1A70 A;  5E6J A;  2QDF A;  3NVZ A;  3VTW A;  3TEW A;  3NG0 A;  3EFU A;  3V6E B;  1EU3 A;  3UIP B;  1P7E A;  3ZYY X;  2RSU A;  4WJQ A;  4JQW C;  2KZR A;  4BFR A;  3WAN A;  2CU1 A;  2KAJ A;  3H7P A;  4ANW A;  3NY5 A;  1T0Q C;  4ICV A;  3OWE B;  2ONQ A;  3BWU D;  1KLV A;  3IXS A;  1Q0W B;  1RWS A;  1GC7 A;  4HJG E;  3NJT A;  1EUV B;  3ECI A;  1F77 A;  1CJE A;  1WI0 A;  1TYG B;  3ZUN A;  1J7C A;  5GXG B;  1V6E A;  4MSQ B;  4XGA B;  2V0G A;  2SAK A;  1S3S G;  4ZHP A;  4X57 B;  4S17 A;  3NVW A;  5HFY A;  1WM2 A;  3UF8 A;  2FCM A;  4LCD E;  3TMP B;  1E8Y A;  2FE8 A;  3RT3 B;  3ZTC A;  2O2V B;  3R7Q A;  3HRD D;  2HDE A;  2DZK A;  1XT9 B;  1V49 A;  2FNJ B;  2WNM A;  3B2G A;  3PHX B;  2K8H A;  3C0R B;  2O6V A;  1MG8 A;  3URY A;  1TKE A;  3A1Q B;  2GLS A;  4LDT B;  4MT5 A;  1T0S C;  1WR1 A;  2IO2 B;  3AEA B;  1CK1 A;  4R3D A;  4WJP A;  2FBW B;  1FMA D;  1FNW A;  4A6Q A;  2AWT A;  1C79 A;  3GE3 C;  3NS1 A;  1ZXH A;  3SEB A;  4DWF A;  1ZDV A;  3AEB B;  3EUB 2;  1R4N I;  3AE9 B;  1OTR B;  2ASQ A;  1ZOY B;  1V2Y A;  1V81 A;  2DEN B;  1S1Q B;  1XCQ L;  1RAX A;  2PIA A;  3PZ8 A;  4TV3 A;  4BBN F;  1C4C A;  5FR6 A;  2YEP B;  2HD5 B;  3KYC D;  1Q5W B;  4KVG B;  2ACZ B;  3PVL A;  3VAW A;  1L2N A;  4LNK A;  1TS3 A;  1V1P B;  2JYT A;  3VH3 B;  4IM2 A;  2KT7 A;  1PGX A;  3UQB A;  4II2 B;  1QOF A;  3I5J C;  1X1M A;  5H8Y E;  1GB1 A;  3WA0 A;  1UH6 A;  2CR5 A;  1P0R A;  1WMH A;  1GUA B;  4HXD A;  1LO5 D;  1JWM D;  2BS2 B;  2GI9 A;  2XK5 A;  2KN4 A;  2R61 A;  4YWG G;  4C7Z A;  1Y8R C;  1PQS A;  4DBG A;  4BKT A;  2WXK A;  2WDR B;  3U2S C;  3ZJT A;  4RM9 A;  2QJL A;  1ZE3 D;  1H8C A;  3GS2 A;  2WWZ A;  3A33 B;  2LJI A;  3W2D A;  3DWG C;  2K6D B;  5CHF A;  1F1H A;  1C4A A;  5EE1 A;  3AE7 B;  1LM8 B;  3CSF A;  1T0Y A;  3W1Y A;  4ACF A;  2C5L C;  2JXX A;  4RGM A;  3V6C B;  2KFJ A;  2KAN A;  2Z59 B;  1YX6 B;  2ZJD A;  2RDB C;  1ZUD 2;  3PO0 A;  4EZK A;  4M0W A;  3M63 B;  2N7D A;  1OFF A;  1RRB A;  1XO3 A;  1WX9 A;  4MJS A;  4BKS D;  2I1J A;  2JVC A;  1EM7 A;  5D7G A;  2N9L A;  2L0F A;  1ZXI A;  2JY6 A;  1EWC A;  1D3Z A;  4REZ A;  1D6E C;  2I38 A;  4DXG A;  5J18 A;  2MX2 A;  1FFU A;  4A3P A;  2D5G A;  3AI5 A;  1J8C A;  4B9K A;  5FK9 C;  4XYC A;  3AEC B;  4MSM B;  4DQO C;  1UD7 A;  1XEE A;  2DBY A;  3BY4 B;  2QSD A;  3GZN I;  2N7J A;  2CHX A;  1JAL A;  2IY0 B;  1R7S A;  1WXQ A;  3P42 A;  4TMA B;  3ZKJ C;  2OOB B;  1QQR A;  2MWS B;  1Q1O A;  4RCO A;  1FXI A;  3O65 B;  3JSV B;  4EE2 A;  5BMG A;  3VTU A;  2WXM A;  3AU5 A;  4RF1 A;  2JXT A;  3I9V 1;  2JPH A;  3VRB B;  2DZM A;  3TCA A;  3H1U A;  3RZW C;  4KZ0 A;  4FJZ A;  1IYF A;  2V3P A;  2JSV X;  4P16 A;  1RFK A;  4DHJ D;  4KGR A;  1E7U A;  4P7I A;  2MCN B;  1JWB D;  5AUK A;  3RPF C;  3OJ3 A;  1V5O A;  3WIM A;  2KJR A;  2AQ3 B;  4KSL C;  2KKC A;  4HWI B;  2WX0 A;  3A9K A;  2AL3 A;  5AZF A;  3RUL A;  2KX0 A;  1QOG A;  1WJU A;  1SSN A;  4WAF A;  3EA6 A;  2IO0 B;  3PTF C;  3OLM D;  2DYO A;  2XEW A;  3B2F A;  4TUU A;  2WXN A;  4MH0 E;  3UIN B;  3KUZ A;  2KTR B;  5G5H A;  5JHB A;  3GOE A;  3RNG C;  1UWX A;  5C3J B;  2CJN A;  2ZVO A;  2N9P C;  5H92 C;  1SIF A;  2LVQ A;  3L13 A;  4J6I A;  3FIL B;  1IPG A;  4NY0 A;  2KVR A;  4NJ6 A;  3HHM A;  1QOB A;  1JML A;  3APD A;  4GB9 A;  1V97 A;  2D3A A;  3ZJU A;  4KGS A;  3IHP C;  2MQJ A;  3MP9 A;  4HKZ E;  4DXF A;  3LB8 C;  2RDG A;  1MHX A;  1C9F A;  2K0P A;  2K8B A;  1DOI A;  3ZW3 A;  3PT2 B;  3B1L X;  1E7P B;  2WXG A;  1MFW A;  1E9M A;  5HKH A;  4RGN A;  2KMA A;  1NYR A;  3QCA A;  4E74 A;  4K3C A;  2OED A;  2J0J A;  3P4R B;  2JZZ A;  1WE7 A;  1F9J A;  4WJO A;  4C80 A;  2BYF A;  3ABV B;  3RZF A;  4FLH A;  1E0Z A;  3DHH C;  1QIL A;  3NHE B;  1SEB D;  2Y3A A;  1WGY A;  3CMM B;  2KNB A;  1M94 A;  3SU8 X;  2GOW A;  3QAR A;  3DBH I;  2V4L A;  3ZLZ A;  2FID A;  4ZRQ A;  1J7B A;  1WYG A;  4ZRK A;  2KQ7 A;  5AZH A;  3PZD A;  3AH7 A;  2H89 B;  3VTV A;  4IWP A;  2LXA A;  3MC9 A;  4XX5 A;  3ZNZ B;  1N6Z A;  1T0R C;  1Z5S B;  1SE9 A;  1E7V A;  1JRP A;  4M02 A;  1NEK B;  2OJW A;  1EF1 A;  2JX5 A;  2WGS A;  5BMH A;  3KVF B;  5T8I A;  4IUM B;  4XDD A;  4KDL B;  4DK5 A;  2J52 A;  3BK1 A;  5DCN A;  2O2V A;  1CQV A;  2W55 A;  1SJH D;  4GSW A;  1XLQ A;  2IND C;  4HRS A;  2SEB D;  1L4D B;  1E5W A;  3DBS A;  4W9J A;  2R2O A;  2KAC A;  2BF8 B;  2KDB A;  3A1Q A;  2NBW B;  2RPQ A;  2GBJ A;  1KRH A;  2W3S A;  1I4Q A;  4W9D A;  4AS1 A;  4HPL B;  4RGO S;  4XWW A;  4HEA 1;  1WXV A;  4WIP A;  2PW9 A;  2C7H A;  3A9K B;  4NJ7 A;  2M1M A;  3R66 C;  3QJZ A;  3AE4 B;  2MBB B;  1PGB A;  1WSP A;  2V3S A;  4DHJ B;  3RFZ B;  3IAS 1;  1VZ8 A;  2ZW1 A;  2M4N A;  2KX3 A;  2JUO A;  5IKC M;  2IGD A;  3RCZ A;  3RNA C;  3MC8 A;  1TS2 A;  3B08 A;  2WXI A;  2IDY A;  5HI1 A;  3ZRC A;  4GOC A;  2KLC A;  3ZNG C;  1WJ4 A;  2Y5C A;  1V1P A;  4ZRJ A;  3MC0 B;  3ZQ4 A;  3APC A;  1WWT A;  1BML C;  2D3G A;  2QIE B;  3VHT C;  1R4M B;  2MJ3 A;  2D3C A;  1TY2 A;  5BYR A;  2KDF B;  5C2T B;  3NOB A;  3AE3 B;  2LVO A;  2J42 A;  2DZI A;  2D11 A;  4B95 A;  1HZ6 A;  4NPN A;  3DPD A;  3RNE C;  3ALB A;  1SXT A;  3VXW A;  5LXH A;  1D5Z C;  5FR3 A;  1FEH A;  1JQ4 A;  2KWD A;  2B3A A;  4HKQ A;  1WGK A;  4FUL A;  4NAM A;  2PJH A;  4LNF A;  3RN9 C;  3WAM A;  3PS6 A;  2JRI B;  1P98 A;  3DBR I;  1NDD A;  2XNA C;  1LQB A;  1FPY A;  2LVP A;  3MTN B;  3BK2 A;  2V3N A;  2DWQ A;  3VQI A;  3T3N A;  1TGZ B;  3AEE B;  4ASW C;  4GU2 A;  2ZZP B;  4HDQ A;  2KC2 A;  1L0V B;  3U7Z A;  1P3Q U;  2KQ4 X;  4RMA A;  1VZ7 A;  2JRH A;  1C77 A;  3ZDT A;  3T3O A;  3DDC B;  4WQO B;  3DQV A;  4RGT A;  4FAD A;  1ZGU B;  3ZNI D;  2AEH A;  2ZNV C;  1TS5 A;  1B1Z A;  2G4D B;  3Q3O C;  5AZG A;  4C00 A;  3ETR A;  2LRU A;  3DWM A;  4HCP B;  3ZVV A;  4BVU C;  2NBU A;  1I4R A;  3AV8 A;  1XLP A;  4PS8 A;  3AN1 A;  2YVC A;  4JLC A;  3J9C A;  1JWA D;  4GDK B;  4KIK B;  4IC7 B;  2KQS A;  3VRA B;  2IPK D;  2L00 B;  2V1Y A;  3SR6 A;  2CU3 A;  3GP7 A;  2N1V A;  1TKY A;  1XF5 L;  1JWS D;  4PS7 A;  2HJ8 A;  3ZIM A;  3ZO5 B;  3H6N A;  2BWF A;  4W9L A;  1F0Z A;  1MJD A;  2WHI A;  2MSE D;  4FJV B;  2K8C A;  2IO1 B;  1SE4 A;  1BUI C;  2CKH B;  3RNC C;  1AAR A;  2MJD A;  3VH4 B;  2PVO D;  1FNU A;  4IG7 B;  1SF0 A;  3WAL A;  4M8N A;  4K7U A;  2HJ1 A;  3FKY A;  1N61 A;  1CZP A;  3BYY B;  3JSV A;  5DPS A;  4UDU C;  5IN7 A;  1T5X D;  2KYW A;  2BGF A;  1V8C A;  3R3M A;  2K6Q A;  1YN3 A;  4W9C A;  1FCC C;  2LHE A;  4G0N B;  3Q6B A;  3AED B;  2WXR A;  4AWJ A;  1KJT A;  2KDM A;  1FXA A;  2UU7 A;  2NBV B;  2Q5W D;  3L54 A;  2KFK A;  1A5R A;  4KKJ A;  2MH7 A;  3QWZ B;  5J2R A;  2ICI A;  4H2A A;  4YXD B;  3QC8 B;  3EFC A;  1RLF A;  3NZU A;  3GE8 C;  2JYE A;  2GBR A;  4BOS C;  1PYW D;  1D5X C;  1L6V A;  3ZRF A;  3WCQ A;  2KTR A;  5DPR A;  2L05 A;  5G55 A;  2BPS A;  2LFI A;  2ZNV B;  2LXC A;  5IP4 D;  2IO3 B;  1JW9 D;  2NTT A;  4F8C B;  1ZPS A;  2W3R A;  3HK0 A;  2KOX A;  2JF5 A;  2AQ1 B;  1WGG A;  1YQ3 B;  3CIR B;  3FIL A;  3JYU A;  1J19 A;  4TQ1 A;  4DXA B;  2J7Q B;  4W9H A;  3AXC A;  4BBN C;  2LMC A;  3MJW A;  4WAA A;  4CYE A;  3U52 E;  2HE7 A;  1XXG A;  2KHW B;  4HDO A;  4W9I A;  1KH0 A;  2WDT B;  4W9F A;  1VCB A;  3Q14 C;  4FA6 A;  4IM0 A;  1KLU D;  2NMQ A;  4JPS A;  1AYF A;  3L17 A;  4AP4 C;  5AEK B;  1RYJ A;  1UGM A;  4FJY A;  3QQ8 B;  1HTO A;  3DVG Y;  2LAS A;  2L3Z A;  4YSX B;  3KYD D;  3Q3F A;  3X0W A;  1UWM A;  2MJE A;  4YTM B;  1V5T A;  1FFV A;  2L0T A;  3V62 A;  3N1X C;  3H7S A;  3RD2 A;  1DGJ A;  4QAY A;  2FIF A;  2K5P A;  5D6J B;  2JQR B;  2INP E;  2BVC A;  2IYD B;  2LEK A;  3CF6 E;  3PV1 A;  1NEN B;  2BYV E;  3DBL I;  2JZP A;  1QT9 A;  1TKG A;  2GRI A;  4MDK E;  3RNB C;  2RR9 A;  3L08 A;  1HTQ A;  5E6P A;  2N9X A;  3IT6 B;  1OQQ A;  4BKS A;  2IGG A;  1WM3 A;  2WU5 B;  2ZPY A;  2ZPN A;  3NVY A;  4ZRI A;  3EHV A;  3V3X A;  3TIX A;  3N3K B;  4N9F 4;  1IBX A;  1I4H A;  1VLB A;  4M01 A;  1C3T A;  3KUD B;  4OVU A;  3BVG A;  3H9D A;  2HTM E;  3U8Z A;  4S0R A;  2MBE A;  1YX5 B;  1E10 A;  4HRO A;  1C4P A;  3PPA A;  3LXF A;  3PRM B;  1MHH E;  3ENE A;  3MFG A;  1VDV A;  2KFK B;  3E9S A;  3I3T B;  1MPE A;  3IT4 B;  2D10 A;  3KQ4 A;  4MM3 A;  5D2M B;  1ZDX A;  3EC8 A;  2IBI B;  4MEM A;  4RF0 A;  4J3O D;  4IW0 A;  2JZ3 B;  2WX1 A;  2G1E A;  1I7H A;  1FIQ A;  2DAJ A;  1GJZ A;  2BBC A;  4HK2 A;  1F2R I;  2KWV B;  5G2N A;  4JX1 C;  2FCS A;  4FN2 A;  5KHQ A;  2FUH B;  1FRR A;  1TS4 A;  4WWP A;  3PLV A;  1DOX A;  3ML8 A;  2CHW A;  1ESF A;  2JWU A;  5BYQ A;  1I4P A;  1XQQ A;  1RM6 C;  1UBI A;  4DHZ B;  2V4I B;  2EKE C;  2VZK D;  4ANX A;  4YL8 A;  3FAH A;  1QF6 A;  1JRO A;  2NCN A;  4II3 B;  2DHZ A;  1BXT A;  4W9K A;  2EEL A;  3IG3 A;  4XDC A;  2ZCC A;  1WXS A;  4IKG A;  3NVV A;  4A8X C;  2MA9 B;  2MRP A;  3H8H A;  3DHG C;  4RNA A;  2RD0 A;  2HTH A;  4Q2J A;  4B0E A;  1D4B A;  1I4G A;  4RM8 A;  1R4N B;  1GC6 A;  2QC8 A;  4KGT A;  2Z0D B;  4KZC A;  2X8X X;  2K22 A;  4YTN B;  4MAC A;  2BWE S;  1QLB B;  3MHZ A;  4XC2 A;  1GAQ B;  2EKI A;  4YSZ B;  5LLI A;  3DVG X;  4NNJ B;  1IGD A;  2L1A A;  1FCL A;  5DPW A;  3PSE B;  2LGD A;  4ICU A;  4KSK C;  3ML9 A;  2M19 A;  4M8M A;  3M3J A;  1LXD A;  4I6L B;  3EEC A;  3ZNH B;  3U4E G;  3P2B A;  3P4S B;  5MPO A;  4NQK E;  4BKG A;  1SIJ A;  3SFE B;  3U7D A;  2GMI C;  4OZB A;  4N6E B;  2L7R A;  3WAO A;  2C7N B;  4GDK A;  4KIK A;  2KN5 A;  2X38 A;  3SD5 A;  1IBX B;  2QHO A;  3MHS D;  4FXC A;  4LJP B;  2CJO A;  1QOA A;  1UF0 A;  4L2Y A;  2D2Q A;  1EWY C;  4PYZ A;  1PDX A;  1GG3 A;  3B9J A;  4KKI A;  1TT5 B;  2LGS A;  3UQA A;  1NI2 A;  2PE6 B;  1WFY A;  2N9E B;  2H88 B;  3LDZ E;  3SFD B;  3Q8F A;  1J7A A;  1TIF A;  1WRI A;  5FKA C;  3OAW A;  5BYS A;  3QK0 A;  5JZE B;  2ON8 A;  2PLP A;  2G3Q B;  1NVI D;  4USA A;  3NZ3 A;  4LDT D;  4RFB A;  4MGY E;  2WXF A;  2VH2 A;  1VJK A;  4MM3 B;  2E6X A;  5LNK 1;  1HZ5 A;  2KMC A;  3BVZ A;  2QCZ A;  1E8W A;  2FCQ A;  3RNF C;  4W9G A;  1L7Y A;  3B0A A;  1B9R A;  4HVB A;  1WX8 A;  2C9W B;  3C19 A;  4PS3 A;  5BO4 B;  1WX7 A;  1WR6 E;  4A20 A;  1MVK A;  4ANV A;  2DAF A;  4E3C A;  2R2Q A;  2W54 A;  2LHD A;  2IZV B;  3Q8C A;  2JT4 B;  4YTP B;  2BB6 A;  3HM6 X;  3DOW A;  4C4V A;  1N62 A;  4TQ0 A;  1P1A A;  2YEP F;  1GB4 A;  4PK1 A;  3IAM 1;  4HCN B;  1E6E B;  3N32 A;  4HPM B;  1LGR A;  1TZ1 A;  1PFD A;  3PZ7 A;  2BTE A;  3SHQ A;  1KFY B;  4YT0 B;  2N7E A;  2IY1 B;  2XBB C;  4TSS A;  3N1Y C;  3GZN B;  3KWV A;  3CWI A;  2MW5 A;  1OEY A;  3APF A;  1ISN A;  3KUC B;  3W9C B;  1WXM A;  2J0K A;  1FXT B;  4G3X B;  2M8S A;  4ZDV A;  4BZA A;  4GGQ A;  4WJN A;  2B76 B;  2LJ5 A;  4TKN A;  2DLB A;  3Q2A C;  3DCG A;  2BQQ A;  3SDL C;  3NUH B;  1KF6 B;  2BT6 A;  3N30 A;  3VR8 B;  1JCK B;  2Z0E B;  1TY0 A;  1L5P A;  1SGH A;  4OHJ A;  2D07 B;  1D5M C;  1HEZ E;  2A5U A;  3FC4 A;  3KLS X;  2G4S A;  1YJ1 A;  3HVZ A;  4B0M A;  3QA8 A;  4L23 A;  3TBL D;  3VUW A;  1AW7 A;  2KVZ A;  2BS4 B;  2AL6 A;  4K3B A;  2GBN A;  3QHT A;  5EE0 A;  2L83 A;  2LWP A;  1G6J A;  1OQY A;  1IGC A;  2BW2 A;  2LUM A;  3X23 A;  4JE3 B;  1I42 A;  4URK A;  3PRP B;  1WJ6 A;  1WGR A;  1HE8 A;  3A4S C;  2LGI A;  4K7S A;  1V1O A;  2KJ6 A;  1XLO A;  1F52 A;  1JWU D;  1K52 A;  1OEY J;  1YN4 A;  3ONS A;  1XLN A;  4IM3 A;  3P1M A;  2K25 A;  2PEA A;  5TSS A;  4ZRP A;  3DVN V;  1ROE A;  3N9Y C;  3ZJV A;  4A90 A;  1MG4 A;  2AX5 A;  1DOY A;  1NI3 A;  1KLG D;  1WRD B;  4KX6 B;  2MEK A;  2K9X A;  4WQM A;  3PHW B;  5JXV A;  2K1F A;  3HIZ A;  4PT5 A;  2KK8 A;  1ZW7 A;  2LZ6 A;  2O6V D;  1I35 A;  2RMM A;  2WS3 B;  3IFW B;  2Y5P A;  2BB5 A;  4OZA A;  4LLG M;  4IWQ A;  3S2A A;  2OHF A;  4KV2 A;  2NR2 A;  2A4Z A;  1LFD A;  1CMX B;  4MGK E;  5CX3 A;  2BS3 B;  3IBE A;  2PVG C;  3I57 A;  1JRU A;  1YJI A;  3UI3 A;  2WDQ B;  1WGH A;  2FAZ A;  2N9K A;  2BYT A;  3AEG B;  5D3D A;  2DNF A;  2I2Y A;  1WXA A;  2DYM A;  2M56 B;  3M62 B;  4LTU A;  2LI5 A;  4GIV A;  4MGI E;  4C4V B;  5E6N A;  2LGX A;  1K50 A;  2KWC A;  2WXO A;  1DYQ A;  4C7Y A;  1WIA A;  3U30 A;  4ZHO A;  3DBH B;  4N59 A;  4EFO A;  3TJP A;  2MBQ A;  1FM0 D;  4EZJ A;  4JGH B;  3ZXV A;  1YNT E;  2QEJ C;  2LD9 A;  2LUE A;  1HXY D;  3ZXR A;  1WZ0 A;  4LNI A;  1N60 A;  3Q3N C;  1XCT L;  4N58 A;  4HLE A;  4BAX A;  1PUT A;  1HQR D;  1WGD A;  3WAP A;  4F7Z A;  3PLU A;  3DVN U;  2AQ2 B;  1WH3 A;  3Q8B A;  5G5G A;  3VUY A;  5L95 C;  2ZCB A;  2MP2 A;  4GXB A;  1N5X A;  3R7R A;  2J4X A;  3PGE A;  4XZ4 A;  4BOZ B;  1UUP A;  2C7M B;  1E8Z A;  4W9E A;  4LNN A;  1SB3 C;  4NAW A;  3AU4 A;  2WXP A;  1YIW A;  1KTK A;  3OG5 A;  4IWO A;  1OGW A;  3PRZ A;  2EMT A;  3E56 A;  1C76 A;  1NBF C;  4EUT A;  3PRE A;  4ZYS A;  2UWQ A;  1T3Q A;  2WU2 B;  2WXH A;  2YLM A;  1YMH E;  2KWU B;  3P4Q B;  3AEF B;  4GLS C;  1C78 A;  3H7P B;  2NTS A;  4JL9 A;  3HM3 A;  3LYY A;  1L0Y B;  4P1B C;  2KDI A;  2EMS A;  2TSS A;  4NJC A;  3C8Y A;  4XE0 A;  4K1R B;  3CST A;  2M0X A;  2L52 A;  1C1Y B;  3L10 B;  2BKR B;  3QAQ A;  5EE9 A;  1L0X B;  2M0A A;  4GDL A;  4LNO A;  4US9 A;  4JWU C;  4A9A A;  1XD3 B;  3Q8E A;  2BKF A;  2WXL A;  1WY8 A;  3AB5 A;  3QIJ A;  4K7W A;  1WJN A;  1WF9 A;  2V9H A;  4AUQ C;  3AE1 B;  3TUO A;  2IGH A;  4E71 A;  1ACC A;  3VDZ A;  4WWM A;  1OQR A;  4ITK A;  4NZL B;  4OVV A;  4DDI D;  1WE6 A;  1R4M I;  2RPV A;  5C1Z A;  1K51 A;  3JW0 X;  3JVZ X;  2D3B A;  2M17 A;  1ET9 A;  3TSS A;  1BT0 A;  2O6V B;  3AE2 B;  4D2K A;  5JHA A;  3IVF A;  3AE8 B;  3W5U B;  2PMV A;  2C60 A;  2K3U A;  1IP9 A;  2REX A;  3DBR B;  1SJE D;  3ZDM C;  4WWN A;  1STE A;  4GN1 A;  3P4P B;  2K39 A;  2MBO A;  2ZEQ A;  2XN9 C;  2RGF A;  3I63 C;  1UBQ A;  5GMV A;  3D32 A;  3V60 A;  1E8X A;  3AE6 B;  1YD8 U;  1V80 A;  2QMT A;  4NQL B;  2KMM A;  1EU4 A;  4FBJ B;  1I4X A;  1AN8 A;  3AUL A;  3QX1 A;  2J53 A;  2WDV B;  5D94 A;  1FD6 A;  1RFA A;  4EOY A;  4I6P A;  5CHW A;  3RYT A;  1K8R B;  4A3O A;  3RI7 C;  3RUI B;  3VVW B;  1GNU A;  4DHZ E;  1J0G A;  1GOZ A;  5IAA C;  4A55 A;  1ZP0 B;  5AUI A;  5I4D A;  2W9N A;  3BYT B;  2KJH B;  3UGB B;  2PE9 A;  3LJ3 A;  5TR5 A;  4AOF A;  5CHV C;  2INC C;  2CS4 A;  4EZL A;  2KD0 A;  2ZW0 A;  4OZC A;  2MP2 B;  1NYQ A;  2WP9 B;  1QZE A;  3VFK A;  1KM7 A;  4ARC A;  1WMH B;  4EKU A;  1P7F A;  3W5V B;  2DYB A;  2CHZ A;  4O1N A;  2I1K A;  2XK5 B;  4NAW B;  4PYU A;  1WZ3 A;  4HJK A;  3MJ5 A;  3UIO B;  4FHJ A;  3BIN A;  3HVD A;  4ZYN A;  2JWZ A;  3DHI C;  1GPX A;  2ZVN A;  2KDE B;  3BII D;  3AMZ A;  1ET6 A;  5DPT A;  2DZJ A;  4WWO A;  2AYO B;  2NPT A;  3HUI A;  2PTL A;  2IJ0 A;  4YSY B;  5HG2 A;  1FO4 A;  4LJO B;  2L76 A;  2N0S B;  1L4Z B;  2FUG 1;  3ZTD A;  4K81 A;  4OW0 A;  3VR9 B;  3KWL A;  2KO3 A;  3A9J A;  3BVM A;  5BMI A;  3R2T A;  3V61 A;  4AQ7 A;  2L8J A;  2KC1 A;  1UNS A;  4RH6 A;  4M0W B;  3R2I A;  3TEZ A;  1TZO A;  1FRD A;  4GDL B;  1QKZ A;  4CO7 A;  2KLG A;  1SBB B;  4US8 A;  3A4R A;  1PGA A;  2Z8L A;  1T6B X;  1YOV B;  2OJR A;  4MJS B;  1H4R A;  2QIL A;  4WH4 A;  3T9L A;  1SE3 A;  1Y56 A;  4AJW A;  3VUX A;  2KXJ A;  2VRR B;  2PPH A;  1U4A A;  3K9P B;  5KHO A;  4EEW A;  3NZS A;  1L6U A;  4ARI A;  4ZOH C;  3N1Z C;  2WXQ A;  3V05 A;  2NVU I;  4KDI C;  2L32 A;  2JU6 X;  3N20 C;  1FNV A;  1SE2 A;  4MEL A;  5J17 A;  2FCN A;  3ZGZ A;  4CHK A;  4MGZ E;  4ANU A;  1UZX B;  3L16 A;  4P6V F;  2MLB A;  1IUE A;  2RDH A;  1HA5 A;  5C23 A;  4LK0 M;  4P1C C;  2KTF A;  4I6N B;  2G9H D;  1K53 A;  1ENF A;  2MBH A;  3Q8A A;  3Q69 A;  2DX5 B;  1KOT A;  5JH5 C;  1F2R C;  4WUR A;  1UGJ A;  1VRA B;  2GB1 A;  3AE5 B;  1N5W A;  3KW5 B;  1YN5 A;  3NS8 A;  4IDI A;  4L1B A;  3M95 A;  3TEY A;  3T8M A;  4XWT A;  1WYW B;  4G11 A;  3O13 A;  3K9O B;  5IO9 A;  4DDG D;  2INN E;  2MHJ A;  4B6W A;  2LRW A;  3W1S A;  4IOI E; 
#chains in the Genus database with same CATH homology
 2IND C;  3Q3N C;  3N1Y C;  3RNB C;  3N1X C;  3GE8 C;  3I5J C;  3RI7 C;  3Q3O C;  3DHG C;  3RNE C;  3RMK C;  1T0R C;  4P1B C;  3Q14 C;  3RNG C;  3RNF C;  3GE3 C;  4P1C C;  3N1Z C;  2RDB C;  3RN9 C;  3DHI C;  1T0Q C;  2INC C;  3N20 C;  3RNA C;  3DHH C;  3Q2A C;  3Q3M C;  3RNC C;  3I63 C;  1T0S C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...