3N1YC

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase t201g mutant
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Active Site Threonine Facilitates Proton Transfer during Dioxygen Activation at the Diiron Center of Toluene/o-Xylene Monooxygenase Hydroxylase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
total genus 24
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3n1yC00
3I63C 3RNAC 3GE8C 3Q3OC 2INCC 3N20C 3RNCC 2RDBC 3RNFC 4P1BC 3RNGC 2INDC 3N1ZC 3DHHC 3Q2AC 3N1YC 1T0QC 3DHGC 3Q3MC 3RNBC 1T0SC 3RN9C 3Q3NC 3RI7C 3GE3C 3DHIC 3I5JC 3N1XC 3RMKC 4P1CC 3RNEC 1T0RC 3Q14C
chains in the Genus database with same CATH superfamily
1WXMA 4BKTA 2JPHA 3LYYA 4MT5A 1WXQA 2HTHA 3AN1A 1DOIA 1YQ3B 4XDCA 2DX5B 2GI9A 3IBEA 5AZGA 2MJEA 1HTQA 2KMAA 1V2YA 3CMMB 3A1QB 2FCQA 2KJ6A 1YD8U 3V61A 1UH6A 3CSFA 1QOFA 1WR6E 2NR2A 3UIPB 4P1CC 1UD7A 4WQOB 4E3CA 2KFKB 2KANA 1V8CA 3VRAB 1GUAB 2PTLA 1T0QC 1QT9A 2KVRA 3ECIA 1C9FA 4HPLB 4YXDB 1KLGD 4LCDE 2WX0A 2Y3AA 1VZ6A 1UBIA 1WMHA 4BVUC 4DXFA 3KW5B 4JWSC 1T6BX 4X57B 4W9DA 2GBNA 4ZYSA 1WX9A 5EE1A 3GB1A 5AUIA 3PSEB 3VDZA 4A90A 2GRIA 4MM3A 1FXIA 4ARCA 4NQKE 3B0AA 1TBEA 2J4XA 4ANWA 1WM3A 2NCNA 2CR5A 4US9A 3ZGZA 2W54A 4WWOA 4KVGB 5J17A 2PMVA 4M01A 4BKSA 2OOBB 4YTNB 1TZOA 3ZNGC 2RGFA 1IBXB 2N9XA 2ASQA 3U2SC 1J8CA 3P4PB 1WM2A 1KH0A 3DBLI 1C77A 4FJYA 1FPYA 3L17A 2AQ3B 1TKEA 2GBKA 1NI2A 1C3TA 2O2VA 5T8IA 3R7QA 3Q8AA 4YSXB 4MACA 3CWIA 5LXHA 2QIEB 3HM6X 1Y8RC 4HDOA 3JSVA 4KX6B 2R2QA 5FKAC 2FNJB 3TEWA 1TS2A 4KZCA 4A3OA 2X8XX 3MHSD 1L6UA 4P6VF 1TS5A 1MHXA 2KT7A 1WZ0A 2KLGA 2LEKA 3AH7A 2K6DB 4LNOA 5KHQA 2RDGA 3PRPB 2DNFA 3NS1A 1R4NI 1WGYA 1WRIA 3N32A 4KZ0A 3VR8B 1XD3B 3UI3A 2JWZA 3WANA 1F2RI 1XF5L 2NBUA 3HVDA 1JWUD 2GBJA 3QA8A 3AE1B 3ZRCA 2LRUA 3PZDA 1QOGA 4HPMB 2G9HD 2JRHA 1EWYC 1RFKA 3I63C 3CF6E 2I1JA 4K3BA 2M1MA 3L16A 1JALA 4EOYA 2ZCCA 3TJPA 2CHZA 2PVGC 3SR6A 5EDSA 2PKOA 1C4AA 1WGKA 1EU4A 2H88B 1AARA 2WXMA 3DOWA 3A9KB 1XEEA 1FEHA 3I5JC 4HROA 1RAXA 3TCAA 3DBLB 1DOXA 1NVID 2KFKA 1WXSA 1I4XA 2GLSA 2PW9A 2G4SA 3ONSA 4FJVB 3H7SA 2RMMA 2LASA 4BOZB 2OJWA 2N1VA 1MPEA 2KTFA 4OHJA 3V6CB 4F8CB 4ZRQA 3AE5B 4N59A 2K8CA 3MTNB 5G55A 4I6LB 4USAA 1J7CA 4RH6A 1TZ1A 3E9SA 4A3PA 1VDVA 1R4NB 4NJ7A 2KLCA 3VR9B 2M0AA 3ABVB 3ZUNA 4KGTA 1M4VA 3JW0X 2B3AA 2KN4A 1UWXA 3U8ZA 3AE2B 2WGSA 4DDID 1I42A 3KYDD 4RM8A 4ZHPA 2GB1A 2LHEA 1VZ8A 1NI3A 4IC7B 2MQJA 4C56C 1V9JA 1JWMD 2DWQA 3X23A 1VLBA 5BYRA 2XK5B 1Q10A 1QOBA 3L4PA 1BT0A 3MJWA 1ZPSA 2PE6B 2KDMA 1TTNA 3AMZA 2KX3A 3U4EG 2XEWA 2N9EB 1WE6A 2PIAA 4N9F4 3RN9C 2L0TA 2HTME 3H6NA 4KIKB 4B6WA 3R66C 3VUXA 2EMSA 2N7DA 1JW9D 4HKZE 3R7RA 1VD2A 2V4IB 4B95A 1ROEA 2WXHA 3PVLA 2KD0A 2WXFA 1IP9A 2KJHB 1EF5A 2ZCBA 2KO3A 2C7HA 1C78A 2E6XA 3H9DA 2C7MB 2AL6A 3RNFC 1WYWB 2LJIA 1E90A 2WU5B 2NBVB 3ZRFA 1LGRA 2AQ1B 2WU2B 2MX2A 3PV1A 1D4BA 3NG0A 2J0MA 4REZA 4BFRA 5BMHA 4C00A 1HE8A 1WWTA 2KNBA 3NZUA 1WE7A 1VR9A 3RPFC 1KLUD 2OJRA 3QJZA 4MGKE 2VH1A 3DWGC 3K9PB 4XZ4A 3IG3A 3DPDA 2GOWA 1TY0A 2ACZB 3SFEB 2IO1B 1GPXA 1C4PA 2DHZA 1WIAA 3C0RB 1Z5SB 4HVBA 1RFAA 3IT6B 1YJJA 2IZVB 3Q14C 1FCCC 3GE8C 1WGRA 1V97A 4ASWC 4Q2JA 3Q8CA 3RNCC 4P16A 3ZXVA 2LGXA 4QAYA 1GB4A 3NY5A 3W1SC 1LQBA 4FA6A 4L23A 3PRMB 1XLNA 3AULA 4TSSA 2GBMA 3VTVA 4AUQC 2W3SA 5D94A 2YLMA 4C4VB 3QQ8B 2BKRB 3VFKA 3L54A 4GN1A 1SIFA 4D2KA 4JL9A 2FBWB 5D2MB 1V1PB 3AE9B 3AB5A 2KXJA 3AEDB 2BW2A 2FCMA 1G6JA 4HLEA 1D5MC 2KDBA 2L1AA 3Q8FA 2M19A 1QOAA 1SJHD 3B2GA 4RF0A 2KVZA 2N9LA 1C4CA 1FXTB 1I4GA 4HPPA 2KYWA 3OJ4B 5LLIA 1GG3A 3AXCA 3X0WA 2UYZB 4H2AA 1OTRB 1RM6C 2LGIA 5J2RA 1XCTL 2CHXA 1CMXB 3GE3C 2INPE 4XWWA 2K9XA 2ZJDA 2XK5A 5EE3A 1CJEA 2MEKA 1ET9A 4A55A 3GP7A 1GC6A 3R2IA 3CSTA 4ZRIA 3AEAB 3KUDB 3B9JA 3PPAA 3PHWB 1YIWA 3WALA 1FIQA 2LD9A 2E3TA 1FD6A 1SJED 3Q6BA 2KWUB 1KLVA 2HE7A 1YN4A 5E6JA 3M62B 5L83A 4KIKA 4AQ7A 2Y5CA 4DDGD 3EFCA 2KZRA 1QKZA 4IDIA 1HZ6A 5CHFA 4BAXA 1ZP0B 1L7YA 3L13A 2I2YA 1SE3A 5HI1A 4OZBA 1F52A 1VRAB 2J42A 1WFYA 4LJPB 5HFYA 2BWFA 3QIJA 2PLPA 2L83A 2NBWB 3U7ZA 1P0RA 2LUMA 3AE6B 4ACFA 2PVOD 4HJKA 5E6NA 2W55A 2FCNA 3AU5A 3NZSA 3AEEB 3BZDB 4W9HA 3H1UA 1NENB 1WGDA 3PRZA 4KKJA 3VUYA 2LVPA 3ZKJC 2BPSA 4ANVA 3QCAA 4KGSA 3AEBB 3APCA 4DHJB 4B9KA 4MEMA 1STEA 1Q5WB 4ZHOA 4YTMB 4ZRKA 1CZPA 2UU7A 1H4RA 1HEZE 1UGMA 4TV3A 4PS8A 1OEYJ 2WX1A 2UWQA 3A9JB 3EA6A 2WDRB 2I38A 3RFZB 1EWCA 1E8WA 3KLSX 3DHGC 1TJEA 5BYSA 2D07B 3V05A 2BQQA 2V3SA 2NS5A 2ONQA 4CHKA 2NMQA 2Z8LA 2CKHB 3R3MA 2WXNA 4LNKA 4BBNC 1RLFA 1ZDXA 2WS3B 2OHFA 1H8CA 3TSSA 1P7EA 3KWVA 2WXLA 2O6VB 1WJ4A 3PLVA 1I4HA 3BYYB 1GJZA 2QSDA 4L2YA 4C4VA 4DHJD 1NEKB 1A5RA 3VTWA 2JUOA 3L10B 4FULA 4WJOA 2AX5A 3AEGB 1V1PA 4NQLB 1TKGA 2KK8A 4HDQA 2QC8A 2JVCA 3VQIA 3L08A 2D3BA 1DGJA 1WZ3A 2L52A 4NNJB 2N0SB 3KUZA 1PYWD 4EZLA 2Z0DB 3RUIB 1F1HA 1YQBA 2L0FA 1UWMA 1TT5B 3RI7C 3AE3B 3UIOB 1I4PA 5CX3A 2SAKA 4G50A 4IM2A 2LFIA 3AM9A 2QJLA 3DHHC 2WXRA 3ZJVA 3PLUA 3C19A 3H7PB 1KF6B 2O6VD 1AN8A 2VH2A 2C60A 1FO4A 1YJ1A 1FMAD 4GDKA 4NY0A 1MVKA 4GOCA 3AU4A 4RGMA 2RDHA 4EKUA 2ZPNA 2G1EA 1OQQA 2VZKB 3AE4B 4GU2A 1YN5A 3UQAA 4PK1A 5J18A 1L4ZB 4II3B 2N1WA 3SFDB 3TIXA 3ENEA 3VH3B 2EKIA 1ACCA 3ZLZA 1QILA 5JZEB 4GLSC 3L0WB 4K3CA 3CIRB 2C5LC 3MFGA 1E8ZA 4GSWA 3VRBB 2B76B 3M95A 3KVFB 1YN3A 2NPTB 4K1RB 1X1MA 1SEBD 2ON8A 1TS3A 2DYOA 5D3DA 1MI0A 1DYQA 2LMCA 3PREA 5BMIA 2WDVB 3BVMA 3LB8C 2DBYA 5MPOA 2AEHA 4MSQB 1FNUA 2L8JA 2WXGA 2KFJA 3PT2B 2J7QB 2KAJA 2ZW1A 2FIDA 2R61A 2FUG1 4MGZE 2VZKD 1WR1A 1FNWA 1WX8A 3NUHB 4URKA 1BXTA 1F0ZA 2KWVB 5CHVC 2N9KA 2K5PA 2MBEA 5IO9A 3P42A 5IA7A 1YX6B 3A9JA 4OVZA 2KTRB 4WAFA 1SGHA 1K53A 2IGHA 4ZRPA 3ZIMA 4WIPA 4DHZB 4ZYNA 4P7IA 3A1QA 3HRDD 2WXIA 2CS4A 1JRUA 2Y5PA 3W1YA 3ZVVA 1FXAA 2Q5WD 1NYRA 1YOVB 3TUOA 5I4DA 1ZXIA 2D2QA 2MRPA 3QK0A 4AJYB 1OEYA 1IGDA 2W9NA 1ENFA 3APFA 2INDC 4UDUC 5BMGA 2BYFA 4PYZA 4FADA 2DYMA 2O6VA 2V4LA 4LLGM 4MH8A 3T3NA 4NZLB 3VXWA 3B08A 2MBQA 4JIOU 3OAWA 2QDFA 5L95C 2W82A 2D11A 2ZNVC 2K1FA 4YSYB 1UUPA 3LDZE 3I57A 2JYTA 1WH3A 4DXAB 3NJTA 1P9DU 1JROA 3Q2AC 1LXDA 3W9CB 3I9V1 4YT0B 1T5XD 2JWUA 2FAZA 3N9YC 1N62A 4RCOA 5TSSA 2KWCA 5G5GA 1JWBD 2XNAC 4MH0E 3R8BA 2JF5A 4EZJA 4FJZA 2IO2B 2M0XA 4IWQA 4ZOHC 4RMAA 3ZTDA 3PO0A 2DENB 3EC8A 1ZDVA 1WXVA 5IAAC 3PZ7A 3AI5A 1KJTA 3H7PA 3EECA 1AYFA 3AEFB 2MJDA 4FLHA 1IPGA 3NHEB 1EF1A 2CJOA 3UINB 1J7AA 1SBBB 1U4AA 3M3JA 1PUTA 3IHPC 1IBXA 1E7PB 2M4NA 1HZ5A 2FE8A 5AEKB 2DAJA 3ZJTA 1XLQA 4AOFA 2N9PC 4HWIB 4JLCA 4M00A 3ZNZB 1RRBA 2YVCA 3EUB2 2JZZA 4IKGA 2LVOA 2MBOA 5BO4B 4AWJA 3ZW3A 4J6IA 4LDTD 3QWZB 1XXGA 1GOZA 1FM0D 5DPRA 1PGXA 5JXVA 2C9WB 3BWUD 2CJNA 1L4DB 1PFDA 4LK0M 2FCSA 4WWNA 3B1LX 3N1ZC 1V5OA 3HIZA 2KQSA 4MJSB 5GMVA 2NPTA 3D32A 3NVZA 3WCQA 1E7UA 1E10A 3Q8BA 2OEDA 3RCZA 1P7FA 2HD5B 4M0WB 4ARIA 1KRHA 4RFBA 2J52A 2AQ2B 4HK2A 2DYBA 4JGHB 3TEYA 3DBRI 1D6EC 3ZNID 2RPQA 2K8HA 4CO7A 5GXGB 5G5HA 1N6ZA 3RYTA 1PQSA 1ZKHA 4BZAA 3ZNHB 5KHOA 3RNEC 4A8XC 4XX5A 4R3DA 2V3PA 2EMTA 2IY0B 1M94A 1K50A 2RDBC 1J0GA 3LXFA 2KTRA 2BBCA 3NVVA 4HCNB 4PS3A 4PT5A 2FIFA 2IGGA 1MG4A 3A9KA 2J0JA 3S2AA 2MW5A 2M56B 1QQRA 2WHIA 2RSUA 2JYEA 3TEXA 2VRRB 3IAS1 1V81A 2JY6A 2K39A 1SE2A 3OJ3A 4IUMB 4TUUA 1WX7A 1YJIA 3N1YC 1UNSA 2A5UA 2QMTA 4GMVA 4KGRA 2KQ7A 2IDYA 4WURA 1N63A 3H8HA 3NZ3A 4HJGE 5DPWA 3ALBA 1P98A 1T3QA 2BKFA 2PPHA 1AWDA 2BS4B 4TQ1A 3NVWA 5CTRC 4M02A 4TQ0A 2IGDA 4A9AA 4TKNA 1MHHE 2LUEA 1N5XA 4MDKE 3KWLA 4IWOA 5C23A 3U52E 1JCKB 2LWPA 1TIFA 4B0EA 4YL8A 2CHWA 2JXXA 2K0PA 1WYGA 3DDCB 3SHQA 3RNAC 3DBRB 1P1AA 4DK5A 1SE4A 3VVWB 1NYQA 2JZ3B 3TBLD 2D3CA 3Q3FA 1JQ4A 1D3ZA 1I4QA 4W9KA 4IOIE 1P3QU 4JX1C 1VCBA 2BT6A 1YX5B 2MBBB 2ZEQA 3FC4A 4N6EB 2MWSB 2J0KA 2LGDA 2LGYA 2DZMA 2LI5A 1V49A 4MM3B 2KX0A 1D5XC 1N60A 1E5WA 3AE7B 2L00B 3N30A 4XGAB 1S1QB 3HK0A 2FUHB 2QCZA 3E56A 2KKCA 2L05A 3GS2A 1PGBA 1T0SC 5EE0A 4DXGA 2JU6X 3EGRA 2GBRA 1MG8A 2KWDA 2DLBA 1UGJA 5D3IB 4C7YA 2L3ZA 4II2B 1J19A 4RGOS 4I6PA 3V62A 3KQ4A 5IN7A 1PGAA 4NAWB 4FN2A 4AP4C 2YEPB 1E9MA 4C80A 3AE8B 2A4ZA 4FXCA 4EEWA 1L0VB 2Y5BB 3SDLC 4M0WA 3PZ8A 3P1MA 2YEPF 1DOYA 4LJOB 1WRDB 3FKYA 2K6QA 2PE9A 2KHWB 3V60A 2HDEA 3Q3JA 4M8MA 1I4RA 1EUVB 2BB6A 1JWSD 1V86A 2IY1B 5D6JB 3HUIA 4G3XB 2ZZPB 4BKSD 3VH4B 4JPSA 1XLOA 3P4RB 4W9GA 4XDDA 3ZQ4A 5FR6A 2GMIC 1ZOYB 1HA5A 1FNVA 2KACA 4GGQA 2V9HA 5LNK1 2DZJA 2ZW0A 1YNTE 3RT3B 2EELA 4L1BA 4NJ6A 1HXYD 4ANUA 1WJUA 4N58A 2CU1A 1YMHE 4DWFA 1NDDA 2C7NB 1WJ6A 5IP4D 3AV8A 3ZO5B 2BS2B 4K7SA 3WAPA 3V3XA 2LHDA 2REXA 4GXBA 4S17A 1Y56A 1V1OA 3O13A 1UZXB 2N7JA 3W2DA 2MSED 1EU3A 1UF0A 3T8MA 3LJ3A 2WWZA 1L5PA 4A6QA 4JQWC 3RZWC 1AW7A 2IJ0A 1B9RA 4YTPB 1XT9B 3UF8A 3U30A 5DPTA 3WIMA 2D3AA 3BVGA 1ISNA 1C79A 4RGTA 4NAMA 3OG5A 3DQVA 3K9OB 3Q3NC 2V1YA 1ET6A 4KV2A 1F2RC 4FHKA 3P63A 1OFFA 1UELA 3ML8A 4B0MA 3HVZA 3PGEA 3UGBB 1N5WA 4TMAB 4EUTA 2MP2B 2RPVA 2KQ4X 2XBBC 3A33B 1ZW7A 4NJCA 2WXPA 2WXJA 4XWTA 4F7ZA 2LXAA 1E0ZA 1SIJA 3IFWB 2JX5A 1XLPA 3DBSA 4YSZB 3BK1A 5JHBA 4RF1A 1LO5D 3M63B 3QAQA 4HKQA 2IBIB 3P4SB 4DQOC 2DZKA 2M8SA 3DBHI 4O1NA 3RNBC 1FFVA 1Q0WB 2JT4B 4OZCA 3IAM1 5HG2A 2ZPYA 3R2TA 5G2NA 2JSVX 4CYEA 3A4RA 1FRRA 4RGNA 4WJPA 2KMCA 3O65B 3NS8A 3VTUA 4FHJA 1Q1OA 2XN9C 1TS4A 4GIVA 3FILB 3RD2A 2I1KA 4WJQA 4NAWA 5DCNA 2WDQB 1IUEA 1S3SG 1EM7A 3TMPB 2BVCA 4WWPA 2HJ1A 1OGWA 5C2TB 2BWES 4S0RA 1YQ4B 3TEZA 2KJRA 2H89B 2X38A 1RWSA 3MP9A 1XO3A 2G45B 2QHOA 2K8BA 2J53A 1GAQB 5HKHA 4PYUA 4IW0A 2KC1A 5E6PA 3P4QB 1GC7A 4JE3B 1V80A 3W5VB 4EE2A 4WH4A 1BMLC 3NRZA 2EKEC 3MJ5A 3DWMA 3Q3OC 2TSSA 4ITKA 1CQVA 1TY2A 4W9JA 3PS6A 2AYOB 1V5TA 3VHTC 3U7DA 2BB5A 5FK9C 1ZGUB 2MLBA 5H92C 2WLBA 1F9JA 1N61A 1GB1A 3ZDTA 1WY8A 3HHMA 3DBHB 4KSKC 3GZNI 2ZVNA 2KMMA 3WAOA 3UQBA 4CQNA 2LXCA 3N3KB 1SSNA 2W3RA 4W9IA 1UBQA 3KYCD 2QEJC 3NOBA 4OZAA 5DPSA 3WA0A 1R7SA 1V6EA 5FR3A 1K52A 3DVNV 3SEBA 1J7BA 5JHAA 1L0XB 1GNUA 1ZUD2 1OQYA 1WXAA 4LDTB 3W1SA 2N4FA 4XC2A 1IGCA 4HXDA 3DCGA 1E8XA 1PDXA 3IXSA 5EE9A 1ESFA 2IO3B 4BBNF 2AWTA 3SD5A 4WQMA 2MP2A 4DHZE 2BF8B 1L2NA 3C8YA 1SF0A 1VZ7A 2D5GA 1C1YB 3OLMD 3Q3MC 1QLBB 1RYJA 4G0NB 4ZDVA 1WI0A 2NVUI 1ZE3D 4I6NB 2LVQA 4JWUC 2MJ3A 4MSMB 4P1BC 3ZTCA 1WGHA 3ZJUA 1KTKA 2HJ8A 2DAFA 1OQRA 2NTSA 2BTEA 2N7EA 4XE0A 2BGFA 4GDLB 4IM3A 3RULA 3DHIC 1HTOA 1FFUA 5D7GA 4DBGA 3FILA 3KH0A 4HCPB 4AS1A 4K7UA 1E7VA 3Q69A 1TKYA 3GZNB 3JYUA 1E6EB 3BIID 1F77A 2BYEA 2LZ6A 4LNFA 3VAWA 4M8NA 1KM7A 2IO0B 2KN5A 1I35A 3B2FA 5JH5C 4F1SA 1WGGA 1XQQA 1BUIC 3A4SC 2IYDB 3FAHA 3MC0B 2D10A 4ZRJA 1XCQL 2INNE 2K25A 1MJDA 5AZFA 1HQRD 5C3JB 3OWEB 4ICUA 3IVFA 2QILA 2IPKD 1JMLA 2WXOA 3I3TB 3T3OA 1Z2MA 2L76A 3GOEA 1LM8B 3MHZA 2WDTB 4KDLB 1SB3C 2G3QB 4MGYE 1FRDA 5LXIB 4HRSA 4YWGG 3SU8X 2MA9B 1QZEA 4FBJB 1K51A 2WXKA 4PS7A 3Q8EA 5CHWA 2D3GA 1QF6A 3P2BA 5IOIA 4RNAA 1I7HA 2KC2A 1B1ZA 3MC9A 3PTFC 2L32A 2WP9B 2Z59B 4E71A 2JQRB 4OVUA 2MHJA 2ICIA 2KDEB 3AECB 3BY4B 3QX1A 4MGIE 4W9LA 2PJHA 4WJNA 4J3OD 4AJWA 1R4MI 2SEBD 2WYQA 3BINA 1CK1A 2PEAA 3EHVA 1L6VA 3IT4B 2RD0A 1TYGB 2MH7A 4K7WA 4W9FA 3N20C 3MC8A 3ZDMC 1D5ZC 1K8RB 3DVGX 4LNIA 3JVZX 4RM9A 5C1ZA 3V6EB 4IG7B 4IWPA 2KDIA 2JRIB 2WNMA 4W9CA 4MELA 1KOTA 4WWMA 3N1XC 4LNNA 4GB9A 1WJNA 2NTTA 5TR5A 4ANXA 1WMHB 1WF9A 2G4DB 5H8YE 3BYTB 2ZNVB 3DVNU 2JZPA 3APDA 1NBFC 2K3UA 3PHXB 2K22A 3NVYA 1JRPA 1ZXHA 3BVZA 2V3NA 2AL3A 1L0YB 3BK2A 3TL5A 4NPNA 2LRWA 1EO6A 1MFWA 4A20A 3EFUA 3QHTA 5AUKA 4KKIA 4OW0A 1VJKA 2MBHA 4GDLA 2BYVE 3ZXRA 3HM3A 2KDFB 2LJ5A 3RMKC 2V0GA 1LFDA 1SE9A 4XYCA 3T9LA 1E8YA 4K81A 5AZHA 2BYTA 1WSPA 4GDKB 3ETRA 3URYA 1A70A 3RNGC 2WQYB 3J9CA 4LTUA 5HHDG 2Z0EB 2RR9A 3WAMA 4MJSA 4EZKA 2O2VB 1R4MB 4E74A 4OVVA 5IKCM 4KSLC 3W5UB 2CU3A 2JXTA 4EFOA 1FCLA 4US8A 1IYFA 4HEA1 1KFYB 3QC8B 3JSVB 4ICVA 2DZIA 4KDIC 2R2OA 3VUWA 2WXQA 3KUCB 5E6OA 4BKGA 1T0YA 4W9EA 4G11A 1C76A 3DVGY 1JWAD 3QARA 2BS3B 2ZVOA 3RZFA 2INCC 1TGZB 2L7RA 2LGSA 4IM0A 4C7ZA 3ML9A 4WAAA 3ZYYX 1SXTA 2MCNB 5BYQA 2M17A 1T0RC 2KOXA 4BOSC
chains in the Genus database with same CATH topology
3I63C 3RNAC 3GE8C 3Q3OC 2INCC 3N20C 3RNCC 2RDBC 3RNFC 4P1BC 3RNGC 2INDC 3N1ZC 3DHHC 3Q2AC 3N1YC 1T0QC 3DHGC 3Q3MC 3RNBC 1T0SC 3RN9C 3Q3NC 3RI7C 3GE3C 3DHIC 3I5JC 3N1XC 3RMKC 4P1CC 3RNEC 1T0RC 3Q14C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I63 C;  3RNA C;  3GE8 C;  3Q3O C;  2INC C;  3N20 C;  3RNC C;  2RDB C;  3RNF C;  4P1B C;  3RNG C;  2IND C;  3N1Z C;  3DHH C;  3Q2A C;  3N1Y C;  1T0Q C;  3DHG C;  3Q3M C;  3RNB C;  1T0S C;  3RN9 C;  3Q3N C;  3RI7 C;  3GE3 C;  3DHI C;  3I5J C;  3N1X C;  3RMK C;  4P1C C;  3RNE C;  1T0R C;  3Q14 C; 
#chains in the Genus database with same CATH topology
 1WXM A;  4BKT A;  2JPH A;  3LYY A;  4MT5 A;  1WXQ A;  2HTH A;  3AN1 A;  1DOI A;  1YQ3 B;  4XDC A;  2DX5 B;  2GI9 A;  3IBE A;  5AZG A;  2MJE A;  1HTQ A;  2KMA A;  1V2Y A;  3CMM B;  3A1Q B;  2FCQ A;  2KJ6 A;  1YD8 U;  3V61 A;  1UH6 A;  3CSF A;  1QOF A;  1WR6 E;  2NR2 A;  3UIP B;  4P1C C;  1UD7 A;  4WQO B;  4E3C A;  2KFK B;  2KAN A;  1V8C A;  3VRA B;  1GUA B;  2PTL A;  1T0Q C;  1QT9 A;  2KVR A;  3ECI A;  1C9F A;  4HPL B;  4YXD B;  1KLG D;  4LCD E;  2WX0 A;  2Y3A A;  1VZ6 A;  1UBI A;  1WMH A;  4BVU C;  4DXF A;  3KW5 B;  4JWS C;  1T6B X;  4X57 B;  4W9D A;  2GBN A;  4ZYS A;  1WX9 A;  5EE1 A;  3GB1 A;  5AUI A;  3PSE B;  3VDZ A;  4A90 A;  2GRI A;  4MM3 A;  1FXI A;  4ARC A;  4NQK E;  3B0A A;  1TBE A;  2J4X A;  4ANW A;  1WM3 A;  2NCN A;  2CR5 A;  4US9 A;  3ZGZ A;  2W54 A;  4WWO A;  4KVG B;  5J17 A;  2PMV A;  4M01 A;  4BKS A;  2OOB B;  4YTN B;  1TZO A;  3ZNG C;  2RGF A;  1IBX B;  2N9X A;  2ASQ A;  3U2S C;  1J8C A;  3P4P B;  1WM2 A;  1KH0 A;  3DBL I;  1C77 A;  4FJY A;  1FPY A;  3L17 A;  2AQ3 B;  1TKE A;  2GBK A;  1NI2 A;  1C3T A;  2O2V A;  5T8I A;  3R7Q A;  3Q8A A;  4YSX B;  4MAC A;  3CWI A;  5LXH A;  2QIE B;  3HM6 X;  1Y8R C;  4HDO A;  3JSV A;  4KX6 B;  2R2Q A;  5FKA C;  2FNJ B;  3TEW A;  1TS2 A;  4KZC A;  4A3O A;  2X8X X;  3MHS D;  1L6U A;  4P6V F;  1TS5 A;  1MHX A;  2KT7 A;  1WZ0 A;  2KLG A;  2LEK A;  3AH7 A;  2K6D B;  4LNO A;  5KHQ A;  2RDG A;  3PRP B;  2DNF A;  3NS1 A;  1R4N I;  1WGY A;  1WRI A;  3N32 A;  4KZ0 A;  3VR8 B;  1XD3 B;  3UI3 A;  2JWZ A;  3WAN A;  1F2R I;  1XF5 L;  2NBU A;  3HVD A;  1JWU D;  2GBJ A;  3QA8 A;  3AE1 B;  3ZRC A;  2LRU A;  3PZD A;  1QOG A;  4HPM B;  2G9H D;  2JRH A;  1EWY C;  1RFK A;  3I63 C;  3CF6 E;  2I1J A;  4K3B A;  2M1M A;  3L16 A;  1JAL A;  4EOY A;  2ZCC A;  3TJP A;  2CHZ A;  2PVG C;  3SR6 A;  5EDS A;  2PKO A;  1C4A A;  1WGK A;  1EU4 A;  2H88 B;  1AAR A;  2WXM A;  3DOW A;  3A9K B;  1XEE A;  1FEH A;  3I5J C;  4HRO A;  1RAX A;  3TCA A;  3DBL B;  1DOX A;  1NVI D;  2KFK A;  1WXS A;  1I4X A;  2GLS A;  2PW9 A;  2G4S A;  3ONS A;  4FJV B;  3H7S A;  2RMM A;  2LAS A;  4BOZ B;  2OJW A;  2N1V A;  1MPE A;  2KTF A;  4OHJ A;  3V6C B;  4F8C B;  4ZRQ A;  3AE5 B;  4N59 A;  2K8C A;  3MTN B;  5G55 A;  4I6L B;  4USA A;  1J7C A;  4RH6 A;  1TZ1 A;  3E9S A;  4A3P A;  1VDV A;  1R4N B;  4NJ7 A;  2KLC A;  3VR9 B;  2M0A A;  3ABV B;  3ZUN A;  4KGT A;  1M4V A;  3JW0 X;  2B3A A;  2KN4 A;  1UWX A;  3U8Z A;  3AE2 B;  2WGS A;  4DDI D;  1I42 A;  3KYD D;  4RM8 A;  4ZHP A;  2GB1 A;  2LHE A;  1VZ8 A;  1NI3 A;  4IC7 B;  2MQJ A;  4C56 C;  1V9J A;  1JWM D;  2DWQ A;  3X23 A;  1VLB A;  5BYR A;  2XK5 B;  1Q10 A;  1QOB A;  3L4P A;  1BT0 A;  3MJW A;  1ZPS A;  2PE6 B;  2KDM A;  1TTN A;  3AMZ A;  2KX3 A;  3U4E G;  2XEW A;  2N9E B;  1WE6 A;  2PIA A;  4N9F 4;  3RN9 C;  2L0T A;  2HTM E;  3H6N A;  4KIK B;  4B6W A;  3R66 C;  3VUX A;  2EMS A;  2N7D A;  1JW9 D;  4HKZ E;  3R7R A;  1VD2 A;  2V4I B;  4B95 A;  1ROE A;  2WXH A;  3PVL A;  2KD0 A;  2WXF A;  1IP9 A;  2KJH B;  1EF5 A;  2ZCB A;  2KO3 A;  2C7H A;  1C78 A;  2E6X A;  3H9D A;  2C7M B;  2AL6 A;  3RNF C;  1WYW B;  2LJI A;  1E90 A;  2WU5 B;  2NBV B;  3ZRF A;  1LGR A;  2AQ1 B;  2WU2 B;  2MX2 A;  3PV1 A;  1D4B A;  3NG0 A;  2J0M A;  4REZ A;  4BFR A;  5BMH A;  4C00 A;  1HE8 A;  1WWT A;  2KNB A;  3NZU A;  1WE7 A;  1VR9 A;  3RPF C;  1KLU D;  2OJR A;  3QJZ A;  4MGK E;  2VH1 A;  3DWG C;  3K9P B;  4XZ4 A;  3IG3 A;  3DPD A;  2GOW A;  1TY0 A;  2ACZ B;  3SFE B;  2IO1 B;  1GPX A;  1C4P A;  2DHZ A;  1WIA A;  3C0R B;  1Z5S B;  4HVB A;  1RFA A;  3IT6 B;  1YJJ A;  2IZV B;  3Q14 C;  1FCC C;  3GE8 C;  1WGR A;  1V97 A;  4ASW C;  4Q2J A;  3Q8C A;  3RNC C;  4P16 A;  3ZXV A;  2LGX A;  4QAY A;  1GB4 A;  3NY5 A;  3W1S C;  1LQB A;  4FA6 A;  4L23 A;  3PRM B;  1XLN A;  3AUL A;  4TSS A;  2GBM A;  3VTV A;  4AUQ C;  2W3S A;  5D94 A;  2YLM A;  4C4V B;  3QQ8 B;  2BKR B;  3VFK A;  3L54 A;  4GN1 A;  1SIF A;  4D2K A;  4JL9 A;  2FBW B;  5D2M B;  1V1P B;  3AE9 B;  3AB5 A;  2KXJ A;  3AED B;  2BW2 A;  2FCM A;  1G6J A;  4HLE A;  1D5M C;  2KDB A;  2L1A A;  3Q8F A;  2M19 A;  1QOA A;  1SJH D;  3B2G A;  4RF0 A;  2KVZ A;  2N9L A;  1C4C A;  1FXT B;  1I4G A;  4HPP A;  2KYW A;  3OJ4 B;  5LLI A;  1GG3 A;  3AXC A;  3X0W A;  2UYZ B;  4H2A A;  1OTR B;  1RM6 C;  2LGI A;  5J2R A;  1XCT L;  2CHX A;  1CMX B;  3GE3 C;  2INP E;  4XWW A;  2K9X A;  2ZJD A;  2XK5 A;  5EE3 A;  1CJE A;  2MEK A;  1ET9 A;  4A55 A;  3GP7 A;  1GC6 A;  3R2I A;  3CST A;  4ZRI A;  3AEA B;  3KUD B;  3B9J A;  3PPA A;  3PHW B;  1YIW A;  3WAL A;  1FIQ A;  2LD9 A;  2E3T A;  1FD6 A;  1SJE D;  3Q6B A;  2KWU B;  1KLV A;  2HE7 A;  1YN4 A;  5E6J A;  3M62 B;  5L83 A;  4KIK A;  4AQ7 A;  2Y5C A;  4DDG D;  3EFC A;  2KZR A;  1QKZ A;  4IDI A;  1HZ6 A;  5CHF A;  4BAX A;  1ZP0 B;  1L7Y A;  3L13 A;  2I2Y A;  1SE3 A;  5HI1 A;  4OZB A;  1F52 A;  1VRA B;  2J42 A;  1WFY A;  4LJP B;  5HFY A;  2BWF A;  3QIJ A;  2PLP A;  2L83 A;  2NBW B;  3U7Z A;  1P0R A;  2LUM A;  3AE6 B;  4ACF A;  2PVO D;  4HJK A;  5E6N A;  2W55 A;  2FCN A;  3AU5 A;  3NZS A;  3AEE B;  3BZD B;  4W9H A;  3H1U A;  1NEN B;  1WGD A;  3PRZ A;  4KKJ A;  3VUY A;  2LVP A;  3ZKJ C;  2BPS A;  4ANV A;  3QCA A;  4KGS A;  3AEB B;  3APC A;  4DHJ B;  4B9K A;  4MEM A;  1STE A;  1Q5W B;  4ZHO A;  4YTM B;  4ZRK A;  1CZP A;  2UU7 A;  1H4R A;  1HEZ E;  1UGM A;  4TV3 A;  4PS8 A;  1OEY J;  2WX1 A;  2UWQ A;  3A9J B;  3EA6 A;  2WDR B;  2I38 A;  3RFZ B;  1EWC A;  1E8W A;  3KLS X;  3DHG C;  1TJE A;  5BYS A;  2D07 B;  3V05 A;  2BQQ A;  2V3S A;  2NS5 A;  2ONQ A;  4CHK A;  2NMQ A;  2Z8L A;  2CKH B;  3R3M A;  2WXN A;  4LNK A;  4BBN C;  1RLF A;  1ZDX A;  2WS3 B;  2OHF A;  1H8C A;  3TSS A;  1P7E A;  3KWV A;  2WXL A;  2O6V B;  1WJ4 A;  3PLV A;  1I4H A;  3BYY B;  1GJZ A;  2QSD A;  4L2Y A;  4C4V A;  4DHJ D;  1NEK B;  1A5R A;  3VTW A;  2JUO A;  3L10 B;  4FUL A;  4WJO A;  2AX5 A;  3AEG B;  1V1P A;  4NQL B;  1TKG A;  2KK8 A;  4HDQ A;  2QC8 A;  2JVC A;  3VQI A;  3L08 A;  2D3B A;  1DGJ A;  1WZ3 A;  2L52 A;  4NNJ B;  2N0S B;  3KUZ A;  1PYW D;  4EZL A;  2Z0D B;  3RUI B;  1F1H A;  1YQB A;  2L0F A;  1UWM A;  1TT5 B;  3RI7 C;  3AE3 B;  3UIO B;  1I4P A;  5CX3 A;  2SAK A;  4G50 A;  4IM2 A;  2LFI A;  3AM9 A;  2QJL A;  3DHH C;  2WXR A;  3ZJV A;  3PLU A;  3C19 A;  3H7P B;  1KF6 B;  2O6V D;  1AN8 A;  2VH2 A;  2C60 A;  1FO4 A;  1YJ1 A;  1FMA D;  4GDK A;  4NY0 A;  1MVK A;  4GOC A;  3AU4 A;  4RGM A;  2RDH A;  4EKU A;  2ZPN A;  2G1E A;  1OQQ A;  2VZK B;  3AE4 B;  4GU2 A;  1YN5 A;  3UQA A;  4PK1 A;  5J18 A;  1L4Z B;  4II3 B;  2N1W A;  3SFD B;  3TIX A;  3ENE A;  3VH3 B;  2EKI A;  1ACC A;  3ZLZ A;  1QIL A;  5JZE B;  4GLS C;  3L0W B;  4K3C A;  3CIR B;  2C5L C;  3MFG A;  1E8Z A;  4GSW A;  3VRB B;  2B76 B;  3M95 A;  3KVF B;  1YN3 A;  2NPT B;  4K1R B;  1X1M A;  1SEB D;  2ON8 A;  1TS3 A;  2DYO A;  5D3D A;  1MI0 A;  1DYQ A;  2LMC A;  3PRE A;  5BMI A;  2WDV B;  3BVM A;  3LB8 C;  2DBY A;  5MPO A;  2AEH A;  4MSQ B;  1FNU A;  2L8J A;  2WXG A;  2KFJ A;  3PT2 B;  2J7Q B;  2KAJ A;  2ZW1 A;  2FID A;  2R61 A;  2FUG 1;  4MGZ E;  2VZK D;  1WR1 A;  1FNW A;  1WX8 A;  3NUH B;  4URK A;  1BXT A;  1F0Z A;  2KWV B;  5CHV C;  2N9K A;  2K5P A;  2MBE A;  5IO9 A;  3P42 A;  5IA7 A;  1YX6 B;  3A9J A;  4OVZ A;  2KTR B;  4WAF A;  1SGH A;  1K53 A;  2IGH A;  4ZRP A;  3ZIM A;  4WIP A;  4DHZ B;  4ZYN A;  4P7I A;  3A1Q A;  3HRD D;  2WXI A;  2CS4 A;  1JRU A;  2Y5P A;  3W1Y A;  3ZVV A;  1FXA A;  2Q5W D;  1NYR A;  1YOV B;  3TUO A;  5I4D A;  1ZXI A;  2D2Q A;  2MRP A;  3QK0 A;  4AJY B;  1OEY A;  1IGD A;  2W9N A;  1ENF A;  3APF A;  2IND C;  4UDU C;  5BMG A;  2BYF A;  4PYZ A;  4FAD A;  2DYM A;  2O6V A;  2V4L A;  4LLG M;  4MH8 A;  3T3N A;  4NZL B;  3VXW A;  3B08 A;  2MBQ A;  4JIO U;  3OAW A;  2QDF A;  5L95 C;  2W82 A;  2D11 A;  2ZNV C;  2K1F A;  4YSY B;  1UUP A;  3LDZ E;  3I57 A;  2JYT A;  1WH3 A;  4DXA B;  3NJT A;  1P9D U;  1JRO A;  3Q2A C;  1LXD A;  3W9C B;  3I9V 1;  4YT0 B;  1T5X D;  2JWU A;  2FAZ A;  3N9Y C;  1N62 A;  4RCO A;  5TSS A;  2KWC A;  5G5G A;  1JWB D;  2XNA C;  4MH0 E;  3R8B A;  2JF5 A;  4EZJ A;  4FJZ A;  2IO2 B;  2M0X A;  4IWQ A;  4ZOH C;  4RMA A;  3ZTD A;  3PO0 A;  2DEN B;  3EC8 A;  1ZDV A;  1WXV A;  5IAA C;  3PZ7 A;  3AI5 A;  1KJT A;  3H7P A;  3EEC A;  1AYF A;  3AEF B;  2MJD A;  4FLH A;  1IPG A;  3NHE B;  1EF1 A;  2CJO A;  3UIN B;  1J7A A;  1SBB B;  1U4A A;  3M3J A;  1PUT A;  3IHP C;  1IBX A;  1E7P B;  2M4N A;  1HZ5 A;  2FE8 A;  5AEK B;  2DAJ A;  3ZJT A;  1XLQ A;  4AOF A;  2N9P C;  4HWI B;  4JLC A;  4M00 A;  3ZNZ B;  1RRB A;  2YVC A;  3EUB 2;  2JZZ A;  4IKG A;  2LVO A;  2MBO A;  5BO4 B;  4AWJ A;  3ZW3 A;  4J6I A;  4LDT D;  3QWZ B;  1XXG A;  1GOZ A;  1FM0 D;  5DPR A;  1PGX A;  5JXV A;  2C9W B;  3BWU D;  2CJN A;  1L4D B;  1PFD A;  4LK0 M;  2FCS A;  4WWN A;  3B1L X;  3N1Z C;  1V5O A;  3HIZ A;  2KQS A;  4MJS B;  5GMV A;  2NPT A;  3D32 A;  3NVZ A;  3WCQ A;  1E7U A;  1E10 A;  3Q8B A;  2OED A;  3RCZ A;  1P7F A;  2HD5 B;  4M0W B;  4ARI A;  1KRH A;  4RFB A;  2J52 A;  2AQ2 B;  4HK2 A;  2DYB A;  4JGH B;  3TEY A;  3DBR I;  1D6E C;  3ZNI D;  2RPQ A;  2K8H A;  4CO7 A;  5GXG B;  5G5H A;  1N6Z A;  3RYT A;  1PQS A;  1ZKH A;  4BZA A;  3ZNH B;  5KHO A;  3RNE C;  4A8X C;  4XX5 A;  4R3D A;  2V3P A;  2EMT A;  2IY0 B;  1M94 A;  1K50 A;  2RDB C;  1J0G A;  3LXF A;  2KTR A;  2BBC A;  3NVV A;  4HCN B;  4PS3 A;  4PT5 A;  2FIF A;  2IGG A;  1MG4 A;  3A9K A;  2J0J A;  3S2A A;  2MW5 A;  2M56 B;  1QQR A;  2WHI A;  2RSU A;  2JYE A;  3TEX A;  2VRR B;  3IAS 1;  1V81 A;  2JY6 A;  2K39 A;  1SE2 A;  3OJ3 A;  4IUM B;  4TUU A;  1WX7 A;  1YJI A;  3N1Y C;  1UNS A;  2A5U A;  2QMT A;  4GMV A;  4KGR A;  2KQ7 A;  2IDY A;  4WUR A;  1N63 A;  3H8H A;  3NZ3 A;  4HJG E;  5DPW A;  3ALB A;  1P98 A;  1T3Q A;  2BKF A;  2PPH A;  1AWD A;  2BS4 B;  4TQ1 A;  3NVW A;  5CTR C;  4M02 A;  4TQ0 A;  2IGD A;  4A9A A;  4TKN A;  1MHH E;  2LUE A;  1N5X A;  4MDK E;  3KWL A;  4IWO A;  5C23 A;  3U52 E;  1JCK B;  2LWP A;  1TIF A;  4B0E A;  4YL8 A;  2CHW A;  2JXX A;  2K0P A;  1WYG A;  3DDC B;  3SHQ A;  3RNA C;  3DBR B;  1P1A A;  4DK5 A;  1SE4 A;  3VVW B;  1NYQ A;  2JZ3 B;  3TBL D;  2D3C A;  3Q3F A;  1JQ4 A;  1D3Z A;  1I4Q A;  4W9K A;  4IOI E;  1P3Q U;  4JX1 C;  1VCB A;  2BT6 A;  1YX5 B;  2MBB B;  2ZEQ A;  3FC4 A;  4N6E B;  2MWS B;  2J0K A;  2LGD A;  2LGY A;  2DZM A;  2LI5 A;  1V49 A;  4MM3 B;  2KX0 A;  1D5X C;  1N60 A;  1E5W A;  3AE7 B;  2L00 B;  3N30 A;  4XGA B;  1S1Q B;  3HK0 A;  2FUH B;  2QCZ A;  3E56 A;  2KKC A;  2L05 A;  3GS2 A;  1PGB A;  1T0S C;  5EE0 A;  4DXG A;  2JU6 X;  3EGR A;  2GBR A;  1MG8 A;  2KWD A;  2DLB A;  1UGJ A;  5D3I B;  4C7Y A;  2L3Z A;  4II2 B;  1J19 A;  4RGO S;  4I6P A;  3V62 A;  3KQ4 A;  5IN7 A;  1PGA A;  4NAW B;  4FN2 A;  4AP4 C;  2YEP B;  1E9M A;  4C80 A;  3AE8 B;  2A4Z A;  4FXC A;  4EEW A;  1L0V B;  2Y5B B;  3SDL C;  4M0W A;  3PZ8 A;  3P1M A;  2YEP F;  1DOY A;  4LJO B;  1WRD B;  3FKY A;  2K6Q A;  2PE9 A;  2KHW B;  3V60 A;  2HDE A;  3Q3J A;  4M8M A;  1I4R A;  1EUV B;  2BB6 A;  1JWS D;  1V86 A;  2IY1 B;  5D6J B;  3HUI A;  4G3X B;  2ZZP B;  4BKS D;  3VH4 B;  4JPS A;  1XLO A;  3P4R B;  4W9G A;  4XDD A;  3ZQ4 A;  5FR6 A;  2GMI C;  1ZOY B;  1HA5 A;  1FNV A;  2KAC A;  4GGQ A;  2V9H A;  5LNK 1;  2DZJ A;  2ZW0 A;  1YNT E;  3RT3 B;  2EEL A;  4L1B A;  4NJ6 A;  1HXY D;  4ANU A;  1WJU A;  4N58 A;  2CU1 A;  1YMH E;  4DWF A;  1NDD A;  2C7N B;  1WJ6 A;  5IP4 D;  3AV8 A;  3ZO5 B;  2BS2 B;  4K7S A;  3WAP A;  3V3X A;  2LHD A;  2REX A;  4GXB A;  4S17 A;  1Y56 A;  1V1O A;  3O13 A;  1UZX B;  2N7J A;  3W2D A;  2MSE D;  1EU3 A;  1UF0 A;  3T8M A;  3LJ3 A;  2WWZ A;  1L5P A;  4A6Q A;  4JQW C;  3RZW C;  1AW7 A;  2IJ0 A;  1B9R A;  4YTP B;  1XT9 B;  3UF8 A;  3U30 A;  5DPT A;  3WIM A;  2D3A A;  3BVG A;  1ISN A;  1C79 A;  4RGT A;  4NAM A;  3OG5 A;  3DQV A;  3K9O B;  3Q3N C;  2V1Y A;  1ET6 A;  4KV2 A;  1F2R C;  4FHK A;  3P63 A;  1OFF A;  1UEL A;  3ML8 A;  4B0M A;  3HVZ A;  3PGE A;  3UGB B;  1N5W A;  4TMA B;  4EUT A;  2MP2 B;  2RPV A;  2KQ4 X;  2XBB C;  3A33 B;  1ZW7 A;  4NJC A;  2WXP A;  2WXJ A;  4XWT A;  4F7Z A;  2LXA A;  1E0Z A;  1SIJ A;  3IFW B;  2JX5 A;  1XLP A;  3DBS A;  4YSZ B;  3BK1 A;  5JHB A;  4RF1 A;  1LO5 D;  3M63 B;  3QAQ A;  4HKQ A;  2IBI B;  3P4S B;  4DQO C;  2DZK A;  2M8S A;  3DBH I;  4O1N A;  3RNB C;  1FFV A;  1Q0W B;  2JT4 B;  4OZC A;  3IAM 1;  5HG2 A;  2ZPY A;  3R2T A;  5G2N A;  2JSV X;  4CYE A;  3A4R A;  1FRR A;  4RGN A;  4WJP A;  2KMC A;  3O65 B;  3NS8 A;  3VTU A;  4FHJ A;  1Q1O A;  2XN9 C;  1TS4 A;  4GIV A;  3FIL B;  3RD2 A;  2I1K A;  4WJQ A;  4NAW A;  5DCN A;  2WDQ B;  1IUE A;  1S3S G;  1EM7 A;  3TMP B;  2BVC A;  4WWP A;  2HJ1 A;  1OGW A;  5C2T B;  2BWE S;  4S0R A;  1YQ4 B;  3TEZ A;  2KJR A;  2H89 B;  2X38 A;  1RWS A;  3MP9 A;  1XO3 A;  2G45 B;  2QHO A;  2K8B A;  2J53 A;  1GAQ B;  5HKH A;  4PYU A;  4IW0 A;  2KC1 A;  5E6P A;  3P4Q B;  1GC7 A;  4JE3 B;  1V80 A;  3W5V B;  4EE2 A;  4WH4 A;  1BML C;  3NRZ A;  2EKE C;  3MJ5 A;  3DWM A;  3Q3O C;  2TSS A;  4ITK A;  1CQV A;  1TY2 A;  4W9J A;  3PS6 A;  2AYO B;  1V5T A;  3VHT C;  3U7D A;  2BB5 A;  5FK9 C;  1ZGU B;  2MLB A;  5H92 C;  2WLB A;  1F9J A;  1N61 A;  1GB1 A;  3ZDT A;  1WY8 A;  3HHM A;  3DBH B;  4KSK C;  3GZN I;  2ZVN A;  2KMM A;  3WAO A;  3UQB A;  4CQN A;  2LXC A;  3N3K B;  1SSN A;  2W3R A;  4W9I A;  1UBQ A;  3KYC D;  2QEJ C;  3NOB A;  4OZA A;  5DPS A;  3WA0 A;  1R7S A;  1V6E A;  5FR3 A;  1K52 A;  3DVN V;  3SEB A;  1J7B A;  5JHA A;  1L0X B;  1GNU A;  1ZUD 2;  1OQY A;  1WXA A;  4LDT B;  3W1S A;  2N4F A;  4XC2 A;  1IGC A;  4HXD A;  3DCG A;  1E8X A;  1PDX A;  3IXS A;  5EE9 A;  1ESF A;  2IO3 B;  4BBN F;  2AWT A;  3SD5 A;  4WQM A;  2MP2 A;  4DHZ E;  2BF8 B;  1L2N A;  3C8Y A;  1SF0 A;  1VZ7 A;  2D5G A;  1C1Y B;  3OLM D;  3Q3M C;  1QLB B;  1RYJ A;  4G0N B;  4ZDV A;  1WI0 A;  2NVU I;  1ZE3 D;  4I6N B;  2LVQ A;  4JWU C;  2MJ3 A;  4MSM B;  4P1B C;  3ZTC A;  1WGH A;  3ZJU A;  1KTK A;  2HJ8 A;  2DAF A;  1OQR A;  2NTS A;  2BTE A;  2N7E A;  4XE0 A;  2BGF A;  4GDL B;  4IM3 A;  3RUL A;  3DHI C;  1HTO A;  1FFU A;  5D7G A;  4DBG A;  3FIL A;  3KH0 A;  4HCP B;  4AS1 A;  4K7U A;  1E7V A;  3Q69 A;  1TKY A;  3GZN B;  3JYU A;  1E6E B;  3BII D;  1F77 A;  2BYE A;  2LZ6 A;  4LNF A;  3VAW A;  4M8N A;  1KM7 A;  2IO0 B;  2KN5 A;  1I35 A;  3B2F A;  5JH5 C;  4F1S A;  1WGG A;  1XQQ A;  1BUI C;  3A4S C;  2IYD B;  3FAH A;  3MC0 B;  2D10 A;  4ZRJ A;  1XCQ L;  2INN E;  2K25 A;  1MJD A;  5AZF A;  1HQR D;  5C3J B;  3OWE B;  4ICU A;  3IVF A;  2QIL A;  2IPK D;  1JML A;  2WXO A;  3I3T B;  3T3O A;  1Z2M A;  2L76 A;  3GOE A;  1LM8 B;  3MHZ A;  2WDT B;  4KDL B;  1SB3 C;  2G3Q B;  4MGY E;  1FRD A;  5LXI B;  4HRS A;  4YWG G;  3SU8 X;  2MA9 B;  1QZE A;  4FBJ B;  1K51 A;  2WXK A;  4PS7 A;  3Q8E A;  5CHW A;  2D3G A;  1QF6 A;  3P2B A;  5IOI A;  4RNA A;  1I7H A;  2KC2 A;  1B1Z A;  3MC9 A;  3PTF C;  2L32 A;  2WP9 B;  2Z59 B;  4E71 A;  2JQR B;  4OVU A;  2MHJ A;  2ICI A;  2KDE B;  3AEC B;  3BY4 B;  3QX1 A;  4MGI E;  4W9L A;  2PJH A;  4WJN A;  4J3O D;  4AJW A;  1R4M I;  2SEB D;  2WYQ A;  3BIN A;  1CK1 A;  2PEA A;  3EHV A;  1L6V A;  3IT4 B;  2RD0 A;  1TYG B;  2MH7 A;  4K7W A;  4W9F A;  3N20 C;  3MC8 A;  3ZDM C;  1D5Z C;  1K8R B;  3DVG X;  4LNI A;  3JVZ X;  4RM9 A;  5C1Z A;  3V6E B;  4IG7 B;  4IWP A;  2KDI A;  2JRI B;  2WNM A;  4W9C A;  4MEL A;  1KOT A;  4WWM A;  3N1X C;  4LNN A;  4GB9 A;  1WJN A;  2NTT A;  5TR5 A;  4ANX A;  1WMH B;  1WF9 A;  2G4D B;  5H8Y E;  3BYT B;  2ZNV B;  3DVN U;  2JZP A;  3APD A;  1NBF C;  2K3U A;  3PHX B;  2K22 A;  3NVY A;  1JRP A;  1ZXH A;  3BVZ A;  2V3N A;  2AL3 A;  1L0Y B;  3BK2 A;  3TL5 A;  4NPN A;  2LRW A;  1EO6 A;  1MFW A;  4A20 A;  3EFU A;  3QHT A;  5AUK A;  4KKI A;  4OW0 A;  1VJK A;  2MBH A;  4GDL A;  2BYV E;  3ZXR A;  3HM3 A;  2KDF B;  2LJ5 A;  3RMK C;  2V0G A;  1LFD A;  1SE9 A;  4XYC A;  3T9L A;  1E8Y A;  4K81 A;  5AZH A;  2BYT A;  1WSP A;  4GDK B;  3ETR A;  3URY A;  1A70 A;  3RNG C;  2WQY B;  3J9C A;  4LTU A;  5HHD G;  2Z0E B;  2RR9 A;  3WAM A;  4MJS A;  4EZK A;  2O2V B;  1R4M B;  4E74 A;  4OVV A;  5IKC M;  4KSL C;  3W5U B;  2CU3 A;  2JXT A;  4EFO A;  1FCL A;  4US8 A;  1IYF A;  4HEA 1;  1KFY B;  3QC8 B;  3JSV B;  4ICV A;  2DZI A;  4KDI C;  2R2O A;  3VUW A;  2WXQ A;  3KUC B;  5E6O A;  4BKG A;  1T0Y A;  4W9E A;  4G11 A;  1C76 A;  3DVG Y;  1JWA D;  3QAR A;  2BS3 B;  2ZVO A;  3RZF A;  2INC C;  1TGZ B;  2L7R A;  2LGS A;  4IM0 A;  4C7Z A;  3ML9 A;  4WAA A;  3ZYY X;  1SXT A;  2MCN B;  5BYQ A;  2M17 A;  1T0R C;  2KOX A;  4BOS C; 
#chains in the Genus database with same CATH homology
 3I63 C;  3RNA C;  3GE8 C;  3Q3O C;  2INC C;  3N20 C;  3RNC C;  2RDB C;  3RNF C;  4P1B C;  3RNG C;  2IND C;  3N1Z C;  3DHH C;  3Q2A C;  3N1Y C;  1T0Q C;  3DHG C;  3Q3M C;  3RNB C;  1T0S C;  3RN9 C;  3Q3N C;  3RI7 C;  3GE3 C;  3DHI C;  3I5J C;  3N1X C;  3RMK C;  4P1C C;  3RNE C;  1T0R C;  3Q14 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...