3N1ZC

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase t201s mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
b'TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Active Site Threonine Facilitates Proton Transfer during Dioxygen Activation at the Diiron Center of Toluene/o-Xylene Monooxygenase Hydroxylase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
total genus 25
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3n1zC00
1T0QC 4P1BC 3Q3NC 3RNGC 2INCC 3Q2AC 3DHHC 3RNCC 3GE8C 3N20C 3RNBC 3Q3MC 3Q14C 2INDC 3I63C 3RMKC 1T0SC 3RNFC 3N1YC 3N1ZC 3N1XC 4P1CC 3RNEC 3GE3C 3RI7C 3DHGC 3RNAC 1T0RC 2RDBC 3DHIC 3Q3OC 3RN9C 3I5JC
chains in the Genus database with same CATH superfamily
3FAHA 1TS2A 2INPE 2ZNVB 2K39A 2N7EA 4KKJA 5IA7A 5G55A 2KJ6A 2MH7A 4TUUA 2XBBC 4RF0A 2WXKA 2YLMA 1EO6A 4WWMA 3FC4A 3IT6B 3K9OB 3ZYYX 3ZJUA 4RMAA 5FKAC 1E8ZA 2LGIA 2N0SB 1QLBB 2ZCBA 3A9KB 2IO3B 1QOFA 4ZRKA 3W5VB 2PIAA 3UQAA 1WR6E 1SB3C 2C60A 1U4AA 2G4SA 3BZDB 4F8CB 2KYWA 2OHFA 3JSVB 3ZTDA 3BK1A 4HK2A 4A3OA 3J9CA 3U8ZA 1K51A 3DVGX 2WXPA 2MJDA 1FXTB 4IOIE 4C56C 2IJ0A 2WDVB 4MEMA 2BQQA 4OZCA 1ZGUB 4GMVA 1V1PB 4N9F4 4EZLA 2N7DA 4A8XC 3FILA 4DBGA 3APDA 4DHZB 2BPSA 2WHIA 1FNWA 3DBRI 1UD7A 2RSUA 2INDC 3NY5A 1WXQA 3S2AA 3L08A 4EKUA 1YD8U 2QMTA 4MGIE 2WWZA 4US9A 2FUHB 3ZUNA 2IY1B 2ZVOA 4MT5A 2PVGC 3A1QB 3ZRCA 3AE2B 3E9SA 3DBSA 3TCAA 2W3SA 1EU4A 4PS3A 1FRDA 2KDMA 2D07B 2LASA 2QDFA 4ZRPA 3C19A 2FIDA 4YWGG 2WGSA 2LI5A 4DQOC 2WLBA 3P42A 5G5GA 3I3TB 4RFBA 2MCNB 2KLCA 2L1AA 2C5LC 2Q5WD 2TSSA 3CIRB 5EE3A 1XLOA 4K7UA 2Y5CA 3UQBA 4I6PA 3I63C 3U7ZA 4W9IA 1GJZA 1HQRD 1F1HA 2GI9A 4MJSB 1BXTA 2EMSA 3VUYA 1SF0A 1QILA 4E74A 1JW9D 2WXGA 2BW2A 2JUOA 4R3DA 3RNGC 1WXSA 2Y3AA 2L32A 5AUIA 2DZKA 3R2TA 2WXFA 3TJPA 3ZTCA 4TMAB 4FXCA 3AE1B 5LXIB 1RAXA 4PT5A 4XDDA 3DVNU 3BVGA 2AQ3B 1HTOA 4Q2JA 3QA8A 1V80A 4FHKA 1WXAA 3ZQ4A 5KHOA 5EE0A 3AEGB 1V97A 1GAQB 2K1FA 3AE6B 4E71A 2B3AA 2CU3A 2R2QA 2GBJA 1Q10A 1ZP0B 5E6JA 1WMHA 1F77A 4FN2A 3CWIA 3AEEB 2LGXA 4NJ7A 3C0RB 3LJ3A 3GZNB 2LFIA 3DBRB 4KIKB 1IUEA 1L4ZB 1RM6C 3MJWA 2CJNA 4REZA 2NTSA 4KDLB 1Q5WB 3Q69A 1D6EC 1PDXA 4WJPA 2O6VD 1WJNA 1V81A 1V1OA 3VAWA 4JWSC 1M4VA 2KQ4X 3ZXRA 1R7SA 3VUXA 5MPOA 4AJYB 3JW0X 3ECIA 2IO0B 2KOXA 3P4QB 1D4BA 2GBMA 4K3BA 1TBEA 2QILA 2DZJA 3B0AA 5EE9A 4AUQC 4M8NA 1F2RC 4WJQA 4WH4A 3AXCA 2I38A 3N32A 4ZHPA 1R4MI 2RDBC 2JY6A 4KDIC 2WS3B 3NVVA 3R8BA 1WWTA 3KH0A 4BFRA 2LVPA 1J19A 2N7JA 2QC8A 5E6NA 1PFDA 1IGCA 3URYA 2C7HA 1YIWA 3PRMB 2DX5B 3GOEA 3ZNZB 4J6IA 3PTFC 3MC9A 1QT9A 3B08A 1WYGA 2BBCA 4GIVA 2EMTA 4WURA 3B9JA 1T0YA 3PV1A 1ISNA 4HJGE 4W9HA 4GU2A 4IDIA 1TKGA 1WRIA 3WA0A 4GXBA 2WX1A 4CYEA 1E9MA 1UGMA 1OQRA 2MJEA 4AJWA 1KJTA 5J2RA 2JQRB 2KZRA 3U52E 1L2NA 3RPFC 2V3PA 3BY4B 4JL9A 2WQYB 5D3DA 2E3TA 4B9KA 4M0WB 1CMXB 1YJJA 3EECA 3PZDA 2AEHA 4TQ1A 4YSYB 4LNFA 2KO3A 4EZJA 1RFKA 4JPSA 3UIOB 4W9JA 1WXMA 2JF5A 1JWUD 1DGJA 2J52A 5D94A 3DHHC 5J17A 1UWMA 4NAWA 1RYJA 3W1SA 3PRZA 4XYCA 1FXIA 2VZKD 4USAA 1MFWA 4RM9A 2BWES 4DHJD 2OOBB 1KRHA 1EF1A 3CSTA 3I9V1 3EA6A 2RD0A 3CMMB 1SGHA 3UIPB 2BKRB 1OGWA 4YSXB 4HRSA 4ARCA 4MELA 4JIOU 2O6VB 2PMVA 3AEAB 3DVGY 3V6EB 5IKCM 1R4MB 4PS7A 2BGFA 3HHMA 4KZ0A 2LXCA 2NTTA 3VVWB 3ZRFA 1R4NB 5HI1A 4N58A 1T6BX 3AEDB 3EFUA 2NR2A 1WJ4A 1MG4A 3SEBA 1XF5L 2L8JA 3NVYA 2SAKA 2MBOA 4WQMA 1I35A 2BB6A 4LTUA 3WAPA 1D5ZC 2CR5A 3NVZA 3A4RA 2V3NA 4S0RA 5BYQA 4ANUA 1SXTA 4DXAB 1OFFA 3Q8AA 4WQOB 3AEFB 3AE8B 1KF6B 2LRWA 2KHWB 1J7AA 4NAMA 3AE5B 1N5XA 4NQKE 2V4IB 2QEJC 2JWZA 4N6EB 1MI0A 2V9HA 2X38A 1XEEA 2LGDA 2WU5B 2WXOA 2Z0DB 2UYZB 1I4PA 3L0WB 2CHXA 4XE0A 2FIFA 2HTME 2BYFA 4MM3A 4XGAB 2J4XA 3ZNHB 4GDLA 1MHXA 1UBQA 1V8CA 2LUMA 2KJRA 4GDKA 2GBKA 1K52A 3BVMA 1XQQA 2HD5B 4MGZE 2A4ZA 3EC8A 5JH5C 2Y5PA 3PSEB 1F0ZA 2LGSA 2MQJA 2JRIB 1B9RA 4P1BC 2YEPB 4EFOA 2KDBA 2Z0EB 3T3OA 1CK1A 2M0XA 1TZ1A 1OQYA 2CS4A 3PRPB 2O2VB 2C9WB 2FCNA 4C80A 4DDID 5BYRA 1D5XC 4MH8A 2WXIA 4CQNA 1DOYA 4ICVA 1WGDA 1N60A 3VFKA 2JZPA 4FJVB 4OVUA 3QARA 2KDFB 4OZBA 1IPGA 2NBVB 2NBWB 2KACA 1TJEA 2KAJA 2VZKB 2Z8LA 4JX1C 3W2DA 2L05A 3O65B 3IT4B 4P1CC 3AM9A 1KFYB 3DDCB 4DWFA 1JALA 3ZNGC 3HM6X 3DPDA 1T0QC 2G1EA 4KSKC 1QF6A 1MPEA 3DBHB 1WX8A 3K9PB 4IWOA 5CHVC 4KX6B 4DK5A 1GUAB 2V4LA 3U4EG 2NS5A 4WJOA 3VH3B 4W9DA 5BYSA 2KD0A 1ENFA 3U7DA 5FR6A 1MJDA 1MG8A 1WGGA 3MC0B 4P7IA 3VUWA 1QOAA 4NNJB 1E6EB 4HCNB 1HTQA 1NI2A 2A5UA 2M56B 4FBJB 4FHJA 1YN5A 1DOIA 5T8IA 3AEBB 4GGQA 5G2NA 3H9DA 1YQ3B 4OW0A 4S17A 1Z2MA 3EUB2 5KHQA 2LJIA 3A9KA 4BKSD 4AOFA 1UUPA 1JROA 2PEAA 1TS3A 3Q8CA 1E8WA 3JSVA 4A6QA 4GN1A 4LNNA 3AE3B 2KFKB 3VQIA 4FJYA 2YEPF 1WI0A 2ZPNA 3ABVB 2WXRA 4ANXA 3CF6E 5CHWA 4IWPA 2SEBD 5JZEB 2VH1A 2QCZA 1QZEA 3BIID 1FD6A 1WF9A 3PHXB 2EELA 1V1PA 1UBIA 3DVNV 3T8MA 5I4DA 4IG7B 2GMIC 2OEDA 2L76A 3NZUA 1T0RC 2PW9A 3HIZA 4FULA 4F7ZA 1GNUA 1FNUA 3M3JA 1E7UA 3TEZA 1TKEA 1PGAA 3QCAA 2LVQA 3VTWA 1N6ZA 3GZNI 4RF1A 3TMPB 1SSNA 4KGTA 3FKYA 2IY0B 3A1QA 4HEA1 1WE7A 5C3JB 5AZFA 3SFEB 1JWBD 1UNSA 1HZ6A 3IVFA 2EKIA 2NMQA 2ZJDA 2JVCA 2ZVNA 1E5WA 4W9CA 2IGGA 4E3CA 2I2YA 2J0MA 4ZRQA 1WIAA 4EOYA 1ZXHA 1LFDA 1YN3A 1SE4A 1UZXB 3RNBC 3B1LX 1C9FA 1J0GA 4RH6A 2K3UA 2ZPYA 1VD2A 4NPNA 3TEXA 2BYVE 2G4DB 1F2RI 2MP2B 2JWUA 1WGHA 2K9XA 2DAJA 1I4HA 2L0FA 2KN5A 1I4QA 4MSMB 2J0JA 4HROA 2WYQA 3Q3FA 2M19A 4MJSA 1WRDB 1V5TA 2N9EB 4IW0A 1I4GA 2WNMA 4WWPA 3HVZA 4OHJA 3RUIB 4A90A 3M63B 3QAQA 2GB1A 1K8RB 3KYCD 1XO3A 3H1UA 2QSDA 1ESFA 4IC7B 3DCGA 2H89B 5DPRA 1GB1A 1KOTA 3SDLC 4AP4C 3Q3JA 3QX1A 3MJ5A 4K7WA 2REXA 3X0WA 4ZDVA 1MVKA 1D5MC 1ZPSA 1JCKB 1NDDA 4XDCA 1L0XB 3L4PA 2ZCCA 1Y8RC 5AZHA 2L7RA 4ARIA 1L0YB 1SEBD 1Y56A 3RCZA 1WM2A 3EFCA 3OJ3A 5CTRC 4ZRJA 4LNOA 2K8BA 4KGRA 1T5XD 1HA5A 1XCTL 2DZMA 5FR3A 2VRRB 2AQ1B 4HPMB 2LEKA 4ICUA 4KIKA 2DENB 3ZJTA 1NYQA 4GB9A 1QOGA 4KV2A 1S1QB 2BS4B 4HCPB 4TQ0A 2DAFA 3PREA 2D3AA 3R66C 2PTLA 4IKGA 4WWNA 3IXSA 3CSFA 3Q8EA 4DXFA 1S3SG 1VR9A 5BMIA 3DWMA 1P7EA 1STEA 1TY0A 4WAAA 3EHVA 3VR9B 1IBXB 2KWVB 1E7VA 5EE1A 1KTKA 2MLBA 4BKGA 1YX6B 1V6EA 2V0GA 1H4RA 5CHFA 1VDVA 4NJ6A 3SU8X 1IGDA 5LLIA 1E10A 4ZHOA 2KX0A 2LD9A 3V60A 3RT3B 4NJCA 3I5JC 2INNE 3V6CB 2D2QA 1R4NI 4LJPB 5AZGA 2KANA 2LUEA 1KLUD 3A33B 1XT9B 2FCQA 1VZ7A 4EUTA 2R61A 4ZOHC 3ZO5B 3RULA 3VDZA 2BS2B 3EGRA 1UH6A 1G6JA 1CQVA 3RZFA 3SHQA 2E6XA 2JSVX 5CX3A 1FMAD 1XLNA 3TUOA 2VH2A 1C78A 1WH3A 2KWUB 4C00A 3OG5A 2ZW0A 5EDSA 2ON8A 3QK0A 4QAYA 1VJKA 3SD5A 4RM8A 3RYTA 1NBFC 1B1ZA 4DXGA 1XD3B 2KK8A 3AV8A 3ZW3A 2BTEA 2MRPA 4B95A 3SFDB 2PVOD 5IAAC 4M0WA 4ASWC 2MHJA 4HJKA 4ANVA 4G50A 1EF5A 4DHZE 4A9AA 1P7FA 1BMLC 2WP9B 3QIJA 4GLSC 4RGOS 3X23A 2HTHA 1L6UA 3H7PB 3QJZA 3IG3A 2CHWA 3NJTA 3IHPC 3PPAA 4MSQB 4W9KA 1UELA 3ZNID 2QHOA 3P2BA 2G3QB 3TSSA 1NYRA 2KVRA 2WU2B 1EM7A 3N3KB 3IFWB 2KX3A 1GOZA 3AE4B 3P1MA 1NENB 1RFAA 3H7SA 2KDIA 3QC8B 2XN9C 2MJ3A 2KQ7A 2KC2A 1PUTA 2AYOB 2OJWA 3KWVA 2JZZA 1FM0D 2WXQA 2DYBA 1NVID 1VZ8A 1H8CA 2IDYA 1TS5A 2NPTB 1WGKA 4HWIB 2O6VA 1RLFA 4LNKA 1X1MA 2KMMA 4PS8A 4C4VB 3RNAC 1YNTE 3W1SC 2ASQA 1GC7A 3U30A 1YN4A 1AYFA 4ITKA 1V49A 2IZVB 3Q3NC 4F1SA 3L54A 4LK0M 4BZAA 3GB1A 3DBHI 4I6LB 4W9EA 4LCDE 4P6VF 1HZ5A 4EE2A 4MGYE 5IO9A 3Q8FA 2MX2A 3AMZA 1C4PA 3ZJVA 1N5WA 1JQ4A 3PO0A 1EWYC 2PE9A 5C2TB 3APCA 3V3XA 4RGMA 1UWXA 4YSZB 2N9PC 3GE3C 2N4FA 1HEZE 2PKOA 1PGXA 1AN8A 1IYFA 1LO5D 1FFVA 1T3QA 2WXHA 2KFJA 5G5HA 3UGBB 1A5RA 2FNJB 2G45B 2JT4B 1UGJA 1V86A 2XK5B 3UF8A 4XC2A 2FBWB 4IUMB 4M8MA 2GBNA 2N9KA 4XX5A 4IWQA 3KUDB 1EUVB 2KN4A 4ZYNA 4G11A 3TEWA 3I57A 1JWSD 5DPWA 1FNVA 1FO4A 2O2VA 5D7GA 2IO2B 3A9JB 1SJED 1TKYA 4JLCA 1SE2A 1HE8A 2V3SA 4M01A 4I6NB 2BYEA 3VXWA 2PLPA 2BWFA 1I42A 2GBRA 3JVZX 3NRZA 3BINA 4IM2A 5LXHA 3NG0A 2D5GA 1L0VB 2W55A 2FCMA 3ZVVA 4N59A 1M94A 4GOCA 1YJIA 5BMHA 3UI3A 1C79A 3DBLB 2CHZA 2FE8A 1ROEA 1F52A 3WIMA 2DLBA 4A3PA 2K5PA 2ZZPB 2KJHB 2ICIA 5HHDG 3AB5A 1Z5SB 2KWDA 3OAWA 1KM7A 3RNCC 4FLHA 3OJ4B 3ZKJC 3AE9B 1ZOYB 2J53A 3NS8A 1TTNA 4K7SA 3IAS1 1WJ6A 2MA9B 2WDQB 5TR5A 3BWUD 2KTRB 2IO1B 2LHEA 1OEYJ 5E6OA 2ONQA 4KZCA 4YTPB 1CZPA 3BVZA 2KMCA 2RMMA 2FAZA 1JMLA 1GPXA 1WJUA 2M17A 2MBEA 4ZRIA 3NZ3A 1LQBA 2XEWA 1E8XA 3OLMD 2D3CA 4WWOA 2WXMA 1JWAD 2CKHB 4WIPA 1N61A 4GSWA 4G0NB 4A55A 3E56A 2K8CA 1Q1OA 1E7PB 4ANWA 2ZNVC 4US8A 2KFKA 2MWSB 1SIJA 1OTRB 2J42A 1WGRA 4HVBA 3ZXVA 1KLVA 1FCCC 2BT6A 4HPLB 4BAXA 4PK1A 2KMAA 4HDOA 3AU4A 2AQ2B 4W9FA 2N9LA 4LJOB 3AH7A 1WZ0A 2KXJA 2JRHA 5C1ZA 3P63A 2HJ8A 2AWTA 4FJZA 4XWTA 2M8SA 2FUG1 1C1YB 1I4RA 3Q8BA 4EEWA 1OEYA 2QIEB 4HLEA 5L95C 4FA6A 2MEKA 4K1RB 4LDTD 3LYYA 1K50A 1P3QU 2NBUA 3MHZA 3ZDMC 2CJOA 3PVLA 2R2OA 2AL3A 1WR1A 2KTFA 3N20C 1L6VA 3VR8B 3NVWA 1LXDA 1E8YA 2C7MB 2PJHA 3N1YC 3L17A 3PHWB 4JGHB 5H92C 1DOXA 5DPTA 1PGBA 1EWCA 2LMCA 2QJLA 4RGTA 3HUIA 4TSSA 2KQSA 2BKFA 3Q2AC 4JE3B 1TS4A 3B2FA 4RGNA 3H6NA 2MP2A 3VTUA 1C4CA 1VRAB 1WZ3A 4UDUC 4TKNA 3FILB 1T0SC 1TT5B 2KKCA 3MP9A 3DHGC 5BMGA 2D3GA 3P4RB 3WAOA 4XZ4A 4BOZB 3GP7A 1AW7A 4II2B 2FCSA 5IN7A 2UWQA 3PZ7A 3IBEA 3SR6A 2NCNA 4HPPA 4B0EA 2MBQA 1TGZB 5DCNA 3HM3A 2BS3B 3KUZA 2GOWA 2MW5A 2J0KA 1ZUD2 5C23A 3T3NA 3B2GA 1WGYA 4C7ZA 1E0ZA 5D6JB 2GRIA 4BBNC 1IP9A 2H88B 2RPVA 2JPHA 3V62A 4OVZA 1XCQL 4ZYSA 4P16A 5JXVA 2KDEB 3PLVA 3V61A 3UINB 3NZSA 3RMKC 3NHEB 3R7QA 4KGSA 4K3CA 1N63A 4BKSA 3AE7B 3TIXA 1L7YA 2D3BA 4D2KA 5FK9C 4HKZE 2G9HD 3HVDA 3R3MA 1VCBA 2DNFA 2HE7A 2DBYA 2JX5A 3NS1A 1ZDXA 3WANA 1HXYD 1WE6A 4A20A 4YL8A 2Z59B 1KH0A 2L52A 4BKTA 2RDHA 3R2IA 2BVCA 3C8YA 1WXVA 2MBHA 3O13A 3VRAB 1ZXIA 1N62A 2MSED 3MFGA 1IBXA 1FIQA 1QQRA 1LGRA 3IAM1 4M02A 2RGFA 3QQ8B 3A4SC 3AECB 2N9XA 5E6PA 1GG3A 2MBBB 3R7RA 4LDTB 3W1YA 2D11A 2K8HA 3RN9C 3Q6BA 3BYTB 3W9CB 4HXDA 1WMHB 2C7NB 1PYWD 3P4SB 1P0RA 1YQ4B 4PYUA 2D10A 4LNIA 5GMVA 1MHHE 4L1BA 2JYEA 2K25A 3MC8A 3L10B 2HDEA 1V9JA 5TSSA 2KC1A 1L4DB 2WDRB 3RD2A 1BT0A 1C76A 2I1KA 1ET9A 1XLQA 4X57B 2JU6X 1FEHA 4FADA 2JXTA 2NVUI 1WX7A 2K0PA 4ACFA 3TL5A 5HG2A 1ACCA 4BBNF 2DZIA 3LDZE 1Q0WB 1FCLA 3Q3OC 4CO7A 4DDGD 1KLGD 2L83A 2LRUA 1ET6A 1AWDA 2WDTB 1TIFA 1P9DU 3BK2A 3U2SC 5L83A 2UU7A 3PT2B 3WCQA 2LJ5A 5AEKB 1SJHD 4EZKA 4HDQA 1F9JA 3T9LA 4IM3A 2V1YA 3RI7C 1YQBA 3DQVA 4AQ7A 2BYTA 1V2YA 2K22A 2AX5A 3KVFB 1LM8B 1YJ1A 2JYTA 3H7PA 3M95A 1ZDVA 3VHTC 2W82A 3Q3MC 2W3RA 4RCOA 3HRDD 4OZAA 5HFYA 4URKA 1JRUA 1WM3A 4YTMB 1I4XA 3PS6A 4MGKE 4K81A 2M1MA 1ZW7A 3KQ4A 5BO4B 5AUKA 2PE6B 3ONSA 1YOVB 3H8HA 3MHSD 1K53A 1C4AA 3RZWC 2LHDA 3QHTA 3HK0A 2ZEQA 4HKQA 1TYGB 4LLGM 5D2MB 2IYDB 2NPTA 3PZ8A 2RPQA 4KKIA 2N1VA 3PLUA 1FFUA 2LZ6A 4IM0A 3VTVA 5JHBA 4C4VA 1UF0A 1L5PA 2EKEC 2W54A 3WAMA 4B0MA 2HJ1A 2DHZA 1RWSA 4II3B 5H8YE 3DBLI 1SBBB 2CU1A 4NAWB 1TZOA 2LWPA 3DOWA 4W9LA 4NZLB 2DYOA 3KYDD 5IP4D 4MDKE 4J3OD 4CHKA 3ENEA 4WJNA 1WX9A 1XLPA 2J7QB 3KW5B 1CJEA 5J18A 3ZDTA 3KLSX 5DPSA 4O1NA 3N30A 3ZIMA 4NY0A 1AARA 3RNFC 5D3IB 2WXJA 1QOBA 2IGDA 5HKHA 3AI5A 3DHIC 2K6DB 2ZW1A 1E90A 1JRPA 3ML9A 2IBIB 2LVOA 2IPKD 3M62B 1A70A 4YTNB 3ALBA 4OVVA 1ZE3D 1PQSA 2ACZB 3L16A 4H2AA 1FPYA 2KVZA 2Y5BB 3KWLA 3N9YC 2B76B 5JHAA 4XWWA 4L2YA 2PPHA 3WALA 3P4PB 4JWUC 3TBLD 2JZ3B 3PGEA 4AWJA 1J7CA 2BF8B 2XK5A 3AN1A 1WY8A 2DWQA 3VH4B 3NOBA 4BOSC 4BVUC 1OQQA 2AL6A 2IGHA 1EU3A 1GC6A 2L0TA 2RR9A 4M00A 1WYWB 4YT0B 1D3ZA 1RRBA 3A9JA 4JQWC 3ML8A 3AU5A 4NQLB 2KLGA 3ZLZA 2XNAC 1C77A 1P1AA 3DWGC 4MM3B 3W5UB 4GDLB 2M0AA 4MACA 4W9GA 3ZGZA 1P98A 1FRRA 3N1ZC 3ETRA 2LXAA 1VLBA 2X8XX 2WXLA 4G3XB 4GDKB 1TY2A 4TV3A 3KUCB 4YXDB 1WSPA 2WX0A 1SIFA 2RDGA 3GE8C 3QWZB 4L23A 2M4NA 1SE3A 4C7YA 2L3ZA 2BB5A 2LGYA 3LB8C 3N1XC 3RNEC 2JXXA 1WFYA 2KNBA 1VZ6A 3AULA 3VRBB 1DYQA 2KWCA 1ZKHA 1GB4A 2KT7A 2INCC 1SE9A 3RFZB 1YX5B 1NEKB 2K6QA 3OWEB 1QKZA 2KTRA 5GXGB 1I7HA 3TEYA 4DHJB 3V05A 2N1WA 1J7BA 3BYYB 2YVCA 4B6WA 4PYZA 2OJRA 3GS2A 1FXAA 2DYMA 3L13A 4KVGB 3NUHB 1BUIC 2GLSA 4AS1A 2L00B 4MH0E 4WAFA 5LNK1 3LXFA 2I1JA 3APFA 3Q14C 3MTNB 1NI3A 1JWMD 1YMHE 3D32A 4KSLC 2WXNA 2W9NA 1V5OA 4RNAA 1C3TA 3JYUA 5IOIA 1XXGA 1J8CA
chains in the Genus database with same CATH topology
1T0QC 4P1BC 3Q3NC 3RNGC 2INCC 3Q2AC 3DHHC 3RNCC 3GE8C 3N20C 3RNBC 3Q3MC 3Q14C 2INDC 3I63C 3RMKC 1T0SC 3RNFC 3N1YC 3N1ZC 3N1XC 4P1CC 3RNEC 3GE3C 3RI7C 3DHGC 3RNAC 1T0RC 2RDBC 3DHIC 3Q3OC 3RN9C 3I5JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0Q C;  4P1B C;  3Q3N C;  3RNG C;  2INC C;  3Q2A C;  3DHH C;  3RNC C;  3GE8 C;  3N20 C;  3RNB C;  3Q3M C;  3Q14 C;  2IND C;  3I63 C;  3RMK C;  1T0S C;  3RNF C;  3N1Y C;  3N1Z C;  3N1X C;  4P1C C;  3RNE C;  3GE3 C;  3RI7 C;  3DHG C;  3RNA C;  1T0R C;  2RDB C;  3DHI C;  3Q3O C;  3RN9 C;  3I5J C; 
#chains in the Genus database with same CATH topology
 3FAH A;  1TS2 A;  2INP E;  2ZNV B;  2K39 A;  2N7E A;  4KKJ A;  5IA7 A;  5G55 A;  2KJ6 A;  2MH7 A;  4TUU A;  2XBB C;  4RF0 A;  2WXK A;  2YLM A;  1EO6 A;  4WWM A;  3FC4 A;  3IT6 B;  3K9O B;  3ZYY X;  3ZJU A;  4RMA A;  5FKA C;  1E8Z A;  2LGI A;  2N0S B;  1QLB B;  2ZCB A;  3A9K B;  2IO3 B;  1QOF A;  4ZRK A;  3W5V B;  2PIA A;  3UQA A;  1WR6 E;  1SB3 C;  2C60 A;  1U4A A;  2G4S A;  3BZD B;  4F8C B;  2KYW A;  2OHF A;  3JSV B;  3ZTD A;  3BK1 A;  4HK2 A;  4A3O A;  3J9C A;  3U8Z A;  1K51 A;  3DVG X;  2WXP A;  2MJD A;  1FXT B;  4IOI E;  4C56 C;  2IJ0 A;  2WDV B;  4MEM A;  2BQQ A;  4OZC A;  1ZGU B;  4GMV A;  1V1P B;  4N9F 4;  4EZL A;  2N7D A;  4A8X C;  3FIL A;  4DBG A;  3APD A;  4DHZ B;  2BPS A;  2WHI A;  1FNW A;  3DBR I;  1UD7 A;  2RSU A;  2IND C;  3NY5 A;  1WXQ A;  3S2A A;  3L08 A;  4EKU A;  1YD8 U;  2QMT A;  4MGI E;  2WWZ A;  4US9 A;  2FUH B;  3ZUN A;  2IY1 B;  2ZVO A;  4MT5 A;  2PVG C;  3A1Q B;  3ZRC A;  3AE2 B;  3E9S A;  3DBS A;  3TCA A;  2W3S A;  1EU4 A;  4PS3 A;  1FRD A;  2KDM A;  2D07 B;  2LAS A;  2QDF A;  4ZRP A;  3C19 A;  2FID A;  4YWG G;  2WGS A;  2LI5 A;  4DQO C;  2WLB A;  3P42 A;  5G5G A;  3I3T B;  4RFB A;  2MCN B;  2KLC A;  2L1A A;  2C5L C;  2Q5W D;  2TSS A;  3CIR B;  5EE3 A;  1XLO A;  4K7U A;  2Y5C A;  3UQB A;  4I6P A;  3I63 C;  3U7Z A;  4W9I A;  1GJZ A;  1HQR D;  1F1H A;  2GI9 A;  4MJS B;  1BXT A;  2EMS A;  3VUY A;  1SF0 A;  1QIL A;  4E74 A;  1JW9 D;  2WXG A;  2BW2 A;  2JUO A;  4R3D A;  3RNG C;  1WXS A;  2Y3A A;  2L32 A;  5AUI A;  2DZK A;  3R2T A;  2WXF A;  3TJP A;  3ZTC A;  4TMA B;  4FXC A;  3AE1 B;  5LXI B;  1RAX A;  4PT5 A;  4XDD A;  3DVN U;  3BVG A;  2AQ3 B;  1HTO A;  4Q2J A;  3QA8 A;  1V80 A;  4FHK A;  1WXA A;  3ZQ4 A;  5KHO A;  5EE0 A;  3AEG B;  1V97 A;  1GAQ B;  2K1F A;  3AE6 B;  4E71 A;  2B3A A;  2CU3 A;  2R2Q A;  2GBJ A;  1Q10 A;  1ZP0 B;  5E6J A;  1WMH A;  1F77 A;  4FN2 A;  3CWI A;  3AEE B;  2LGX A;  4NJ7 A;  3C0R B;  3LJ3 A;  3GZN B;  2LFI A;  3DBR B;  4KIK B;  1IUE A;  1L4Z B;  1RM6 C;  3MJW A;  2CJN A;  4REZ A;  2NTS A;  4KDL B;  1Q5W B;  3Q69 A;  1D6E C;  1PDX A;  4WJP A;  2O6V D;  1WJN A;  1V81 A;  1V1O A;  3VAW A;  4JWS C;  1M4V A;  2KQ4 X;  3ZXR A;  1R7S A;  3VUX A;  5MPO A;  4AJY B;  3JW0 X;  3ECI A;  2IO0 B;  2KOX A;  3P4Q B;  1D4B A;  2GBM A;  4K3B A;  1TBE A;  2QIL A;  2DZJ A;  3B0A A;  5EE9 A;  4AUQ C;  4M8N A;  1F2R C;  4WJQ A;  4WH4 A;  3AXC A;  2I38 A;  3N32 A;  4ZHP A;  1R4M I;  2RDB C;  2JY6 A;  4KDI C;  2WS3 B;  3NVV A;  3R8B A;  1WWT A;  3KH0 A;  4BFR A;  2LVP A;  1J19 A;  2N7J A;  2QC8 A;  5E6N A;  1PFD A;  1IGC A;  3URY A;  2C7H A;  1YIW A;  3PRM B;  2DX5 B;  3GOE A;  3ZNZ B;  4J6I A;  3PTF C;  3MC9 A;  1QT9 A;  3B08 A;  1WYG A;  2BBC A;  4GIV A;  2EMT A;  4WUR A;  3B9J A;  1T0Y A;  3PV1 A;  1ISN A;  4HJG E;  4W9H A;  4GU2 A;  4IDI A;  1TKG A;  1WRI A;  3WA0 A;  4GXB A;  2WX1 A;  4CYE A;  1E9M A;  1UGM A;  1OQR A;  2MJE A;  4AJW A;  1KJT A;  5J2R A;  2JQR B;  2KZR A;  3U52 E;  1L2N A;  3RPF C;  2V3P A;  3BY4 B;  4JL9 A;  2WQY B;  5D3D A;  2E3T A;  4B9K A;  4M0W B;  1CMX B;  1YJJ A;  3EEC A;  3PZD A;  2AEH A;  4TQ1 A;  4YSY B;  4LNF A;  2KO3 A;  4EZJ A;  1RFK A;  4JPS A;  3UIO B;  4W9J A;  1WXM A;  2JF5 A;  1JWU D;  1DGJ A;  2J52 A;  5D94 A;  3DHH C;  5J17 A;  1UWM A;  4NAW A;  1RYJ A;  3W1S A;  3PRZ A;  4XYC A;  1FXI A;  2VZK D;  4USA A;  1MFW A;  4RM9 A;  2BWE S;  4DHJ D;  2OOB B;  1KRH A;  1EF1 A;  3CST A;  3I9V 1;  3EA6 A;  2RD0 A;  3CMM B;  1SGH A;  3UIP B;  2BKR B;  1OGW A;  4YSX B;  4HRS A;  4ARC A;  4MEL A;  4JIO U;  2O6V B;  2PMV A;  3AEA B;  3DVG Y;  3V6E B;  5IKC M;  1R4M B;  4PS7 A;  2BGF A;  3HHM A;  4KZ0 A;  2LXC A;  2NTT A;  3VVW B;  3ZRF A;  1R4N B;  5HI1 A;  4N58 A;  1T6B X;  3AED B;  3EFU A;  2NR2 A;  1WJ4 A;  1MG4 A;  3SEB A;  1XF5 L;  2L8J A;  3NVY A;  2SAK A;  2MBO A;  4WQM A;  1I35 A;  2BB6 A;  4LTU A;  3WAP A;  1D5Z C;  2CR5 A;  3NVZ A;  3A4R A;  2V3N A;  4S0R A;  5BYQ A;  4ANU A;  1SXT A;  4DXA B;  1OFF A;  3Q8A A;  4WQO B;  3AEF B;  3AE8 B;  1KF6 B;  2LRW A;  2KHW B;  1J7A A;  4NAM A;  3AE5 B;  1N5X A;  4NQK E;  2V4I B;  2QEJ C;  2JWZ A;  4N6E B;  1MI0 A;  2V9H A;  2X38 A;  1XEE A;  2LGD A;  2WU5 B;  2WXO A;  2Z0D B;  2UYZ B;  1I4P A;  3L0W B;  2CHX A;  4XE0 A;  2FIF A;  2HTM E;  2BYF A;  4MM3 A;  4XGA B;  2J4X A;  3ZNH B;  4GDL A;  1MHX A;  1UBQ A;  1V8C A;  2LUM A;  2KJR A;  4GDK A;  2GBK A;  1K52 A;  3BVM A;  1XQQ A;  2HD5 B;  4MGZ E;  2A4Z A;  3EC8 A;  5JH5 C;  2Y5P A;  3PSE B;  1F0Z A;  2LGS A;  2MQJ A;  2JRI B;  1B9R A;  4P1B C;  2YEP B;  4EFO A;  2KDB A;  2Z0E B;  3T3O A;  1CK1 A;  2M0X A;  1TZ1 A;  1OQY A;  2CS4 A;  3PRP B;  2O2V B;  2C9W B;  2FCN A;  4C80 A;  4DDI D;  5BYR A;  1D5X C;  4MH8 A;  2WXI A;  4CQN A;  1DOY A;  4ICV A;  1WGD A;  1N60 A;  3VFK A;  2JZP A;  4FJV B;  4OVU A;  3QAR A;  2KDF B;  4OZB A;  1IPG A;  2NBV B;  2NBW B;  2KAC A;  1TJE A;  2KAJ A;  2VZK B;  2Z8L A;  4JX1 C;  3W2D A;  2L05 A;  3O65 B;  3IT4 B;  4P1C C;  3AM9 A;  1KFY B;  3DDC B;  4DWF A;  1JAL A;  3ZNG C;  3HM6 X;  3DPD A;  1T0Q C;  2G1E A;  4KSK C;  1QF6 A;  1MPE A;  3DBH B;  1WX8 A;  3K9P B;  4IWO A;  5CHV C;  4KX6 B;  4DK5 A;  1GUA B;  2V4L A;  3U4E G;  2NS5 A;  4WJO A;  3VH3 B;  4W9D A;  5BYS A;  2KD0 A;  1ENF A;  3U7D A;  5FR6 A;  1MJD A;  1MG8 A;  1WGG A;  3MC0 B;  4P7I A;  3VUW A;  1QOA A;  4NNJ B;  1E6E B;  4HCN B;  1HTQ A;  1NI2 A;  2A5U A;  2M56 B;  4FBJ B;  4FHJ A;  1YN5 A;  1DOI A;  5T8I A;  3AEB B;  4GGQ A;  5G2N A;  3H9D A;  1YQ3 B;  4OW0 A;  4S17 A;  1Z2M A;  3EUB 2;  5KHQ A;  2LJI A;  3A9K A;  4BKS D;  4AOF A;  1UUP A;  1JRO A;  2PEA A;  1TS3 A;  3Q8C A;  1E8W A;  3JSV A;  4A6Q A;  4GN1 A;  4LNN A;  3AE3 B;  2KFK B;  3VQI A;  4FJY A;  2YEP F;  1WI0 A;  2ZPN A;  3ABV B;  2WXR A;  4ANX A;  3CF6 E;  5CHW A;  4IWP A;  2SEB D;  5JZE B;  2VH1 A;  2QCZ A;  1QZE A;  3BII D;  1FD6 A;  1WF9 A;  3PHX B;  2EEL A;  1V1P A;  1UBI A;  3DVN V;  3T8M A;  5I4D A;  4IG7 B;  2GMI C;  2OED A;  2L76 A;  3NZU A;  1T0R C;  2PW9 A;  3HIZ A;  4FUL A;  4F7Z A;  1GNU A;  1FNU A;  3M3J A;  1E7U A;  3TEZ A;  1TKE A;  1PGA A;  3QCA A;  2LVQ A;  3VTW A;  1N6Z A;  3GZN I;  4RF1 A;  3TMP B;  1SSN A;  4KGT A;  3FKY A;  2IY0 B;  3A1Q A;  4HEA 1;  1WE7 A;  5C3J B;  5AZF A;  3SFE B;  1JWB D;  1UNS A;  1HZ6 A;  3IVF A;  2EKI A;  2NMQ A;  2ZJD A;  2JVC A;  2ZVN A;  1E5W A;  4W9C A;  2IGG A;  4E3C A;  2I2Y A;  2J0M A;  4ZRQ A;  1WIA A;  4EOY A;  1ZXH A;  1LFD A;  1YN3 A;  1SE4 A;  1UZX B;  3RNB C;  3B1L X;  1C9F A;  1J0G A;  4RH6 A;  2K3U A;  2ZPY A;  1VD2 A;  4NPN A;  3TEX A;  2BYV E;  2G4D B;  1F2R I;  2MP2 B;  2JWU A;  1WGH A;  2K9X A;  2DAJ A;  1I4H A;  2L0F A;  2KN5 A;  1I4Q A;  4MSM B;  2J0J A;  4HRO A;  2WYQ A;  3Q3F A;  2M19 A;  4MJS A;  1WRD B;  1V5T A;  2N9E B;  4IW0 A;  1I4G A;  2WNM A;  4WWP A;  3HVZ A;  4OHJ A;  3RUI B;  4A90 A;  3M63 B;  3QAQ A;  2GB1 A;  1K8R B;  3KYC D;  1XO3 A;  3H1U A;  2QSD A;  1ESF A;  4IC7 B;  3DCG A;  2H89 B;  5DPR A;  1GB1 A;  1KOT A;  3SDL C;  4AP4 C;  3Q3J A;  3QX1 A;  3MJ5 A;  4K7W A;  2REX A;  3X0W A;  4ZDV A;  1MVK A;  1D5M C;  1ZPS A;  1JCK B;  1NDD A;  4XDC A;  1L0X B;  3L4P A;  2ZCC A;  1Y8R C;  5AZH A;  2L7R A;  4ARI A;  1L0Y B;  1SEB D;  1Y56 A;  3RCZ A;  1WM2 A;  3EFC A;  3OJ3 A;  5CTR C;  4ZRJ A;  4LNO A;  2K8B A;  4KGR A;  1T5X D;  1HA5 A;  1XCT L;  2DZM A;  5FR3 A;  2VRR B;  2AQ1 B;  4HPM B;  2LEK A;  4ICU A;  4KIK A;  2DEN B;  3ZJT A;  1NYQ A;  4GB9 A;  1QOG A;  4KV2 A;  1S1Q B;  2BS4 B;  4HCP B;  4TQ0 A;  2DAF A;  3PRE A;  2D3A A;  3R66 C;  2PTL A;  4IKG A;  4WWN A;  3IXS A;  3CSF A;  3Q8E A;  4DXF A;  1S3S G;  1VR9 A;  5BMI A;  3DWM A;  1P7E A;  1STE A;  1TY0 A;  4WAA A;  3EHV A;  3VR9 B;  1IBX B;  2KWV B;  1E7V A;  5EE1 A;  1KTK A;  2MLB A;  4BKG A;  1YX6 B;  1V6E A;  2V0G A;  1H4R A;  5CHF A;  1VDV A;  4NJ6 A;  3SU8 X;  1IGD A;  5LLI A;  1E10 A;  4ZHO A;  2KX0 A;  2LD9 A;  3V60 A;  3RT3 B;  4NJC A;  3I5J C;  2INN E;  3V6C B;  2D2Q A;  1R4N I;  4LJP B;  5AZG A;  2KAN A;  2LUE A;  1KLU D;  3A33 B;  1XT9 B;  2FCQ A;  1VZ7 A;  4EUT A;  2R61 A;  4ZOH C;  3ZO5 B;  3RUL A;  3VDZ A;  2BS2 B;  3EGR A;  1UH6 A;  1G6J A;  1CQV A;  3RZF A;  3SHQ A;  2E6X A;  2JSV X;  5CX3 A;  1FMA D;  1XLN A;  3TUO A;  2VH2 A;  1C78 A;  1WH3 A;  2KWU B;  4C00 A;  3OG5 A;  2ZW0 A;  5EDS A;  2ON8 A;  3QK0 A;  4QAY A;  1VJK A;  3SD5 A;  4RM8 A;  3RYT A;  1NBF C;  1B1Z A;  4DXG A;  1XD3 B;  2KK8 A;  3AV8 A;  3ZW3 A;  2BTE A;  2MRP A;  4B95 A;  3SFD B;  2PVO D;  5IAA C;  4M0W A;  4ASW C;  2MHJ A;  4HJK A;  4ANV A;  4G50 A;  1EF5 A;  4DHZ E;  4A9A A;  1P7F A;  1BML C;  2WP9 B;  3QIJ A;  4GLS C;  4RGO S;  3X23 A;  2HTH A;  1L6U A;  3H7P B;  3QJZ A;  3IG3 A;  2CHW A;  3NJT A;  3IHP C;  3PPA A;  4MSQ B;  4W9K A;  1UEL A;  3ZNI D;  2QHO A;  3P2B A;  2G3Q B;  3TSS A;  1NYR A;  2KVR A;  2WU2 B;  1EM7 A;  3N3K B;  3IFW B;  2KX3 A;  1GOZ A;  3AE4 B;  3P1M A;  1NEN B;  1RFA A;  3H7S A;  2KDI A;  3QC8 B;  2XN9 C;  2MJ3 A;  2KQ7 A;  2KC2 A;  1PUT A;  2AYO B;  2OJW A;  3KWV A;  2JZZ A;  1FM0 D;  2WXQ A;  2DYB A;  1NVI D;  1VZ8 A;  1H8C A;  2IDY A;  1TS5 A;  2NPT B;  1WGK A;  4HWI B;  2O6V A;  1RLF A;  4LNK A;  1X1M A;  2KMM A;  4PS8 A;  4C4V B;  3RNA C;  1YNT E;  3W1S C;  2ASQ A;  1GC7 A;  3U30 A;  1YN4 A;  1AYF A;  4ITK A;  1V49 A;  2IZV B;  3Q3N C;  4F1S A;  3L54 A;  4LK0 M;  4BZA A;  3GB1 A;  3DBH I;  4I6L B;  4W9E A;  4LCD E;  4P6V F;  1HZ5 A;  4EE2 A;  4MGY E;  5IO9 A;  3Q8F A;  2MX2 A;  3AMZ A;  1C4P A;  3ZJV A;  1N5W A;  1JQ4 A;  3PO0 A;  1EWY C;  2PE9 A;  5C2T B;  3APC A;  3V3X A;  4RGM A;  1UWX A;  4YSZ B;  2N9P C;  3GE3 C;  2N4F A;  1HEZ E;  2PKO A;  1PGX A;  1AN8 A;  1IYF A;  1LO5 D;  1FFV A;  1T3Q A;  2WXH A;  2KFJ A;  5G5H A;  3UGB B;  1A5R A;  2FNJ B;  2G45 B;  2JT4 B;  1UGJ A;  1V86 A;  2XK5 B;  3UF8 A;  4XC2 A;  2FBW B;  4IUM B;  4M8M A;  2GBN A;  2N9K A;  4XX5 A;  4IWQ A;  3KUD B;  1EUV B;  2KN4 A;  4ZYN A;  4G11 A;  3TEW A;  3I57 A;  1JWS D;  5DPW A;  1FNV A;  1FO4 A;  2O2V A;  5D7G A;  2IO2 B;  3A9J B;  1SJE D;  1TKY A;  4JLC A;  1SE2 A;  1HE8 A;  2V3S A;  4M01 A;  4I6N B;  2BYE A;  3VXW A;  2PLP A;  2BWF A;  1I42 A;  2GBR A;  3JVZ X;  3NRZ A;  3BIN A;  4IM2 A;  5LXH A;  3NG0 A;  2D5G A;  1L0V B;  2W55 A;  2FCM A;  3ZVV A;  4N59 A;  1M94 A;  4GOC A;  1YJI A;  5BMH A;  3UI3 A;  1C79 A;  3DBL B;  2CHZ A;  2FE8 A;  1ROE A;  1F52 A;  3WIM A;  2DLB A;  4A3P A;  2K5P A;  2ZZP B;  2KJH B;  2ICI A;  5HHD G;  3AB5 A;  1Z5S B;  2KWD A;  3OAW A;  1KM7 A;  3RNC C;  4FLH A;  3OJ4 B;  3ZKJ C;  3AE9 B;  1ZOY B;  2J53 A;  3NS8 A;  1TTN A;  4K7S A;  3IAS 1;  1WJ6 A;  2MA9 B;  2WDQ B;  5TR5 A;  3BWU D;  2KTR B;  2IO1 B;  2LHE A;  1OEY J;  5E6O A;  2ONQ A;  4KZC A;  4YTP B;  1CZP A;  3BVZ A;  2KMC A;  2RMM A;  2FAZ A;  1JML A;  1GPX A;  1WJU A;  2M17 A;  2MBE A;  4ZRI A;  3NZ3 A;  1LQB A;  2XEW A;  1E8X A;  3OLM D;  2D3C A;  4WWO A;  2WXM A;  1JWA D;  2CKH B;  4WIP A;  1N61 A;  4GSW A;  4G0N B;  4A55 A;  3E56 A;  2K8C A;  1Q1O A;  1E7P B;  4ANW A;  2ZNV C;  4US8 A;  2KFK A;  2MWS B;  1SIJ A;  1OTR B;  2J42 A;  1WGR A;  4HVB A;  3ZXV A;  1KLV A;  1FCC C;  2BT6 A;  4HPL B;  4BAX A;  4PK1 A;  2KMA A;  4HDO A;  3AU4 A;  2AQ2 B;  4W9F A;  2N9L A;  4LJO B;  3AH7 A;  1WZ0 A;  2KXJ A;  2JRH A;  5C1Z A;  3P63 A;  2HJ8 A;  2AWT A;  4FJZ A;  4XWT A;  2M8S A;  2FUG 1;  1C1Y B;  1I4R A;  3Q8B A;  4EEW A;  1OEY A;  2QIE B;  4HLE A;  5L95 C;  4FA6 A;  2MEK A;  4K1R B;  4LDT D;  3LYY A;  1K50 A;  1P3Q U;  2NBU A;  3MHZ A;  3ZDM C;  2CJO A;  3PVL A;  2R2O A;  2AL3 A;  1WR1 A;  2KTF A;  3N20 C;  1L6V A;  3VR8 B;  3NVW A;  1LXD A;  1E8Y A;  2C7M B;  2PJH A;  3N1Y C;  3L17 A;  3PHW B;  4JGH B;  5H92 C;  1DOX A;  5DPT A;  1PGB A;  1EWC A;  2LMC A;  2QJL A;  4RGT A;  3HUI A;  4TSS A;  2KQS A;  2BKF A;  3Q2A C;  4JE3 B;  1TS4 A;  3B2F A;  4RGN A;  3H6N A;  2MP2 A;  3VTU A;  1C4C A;  1VRA B;  1WZ3 A;  4UDU C;  4TKN A;  3FIL B;  1T0S C;  1TT5 B;  2KKC A;  3MP9 A;  3DHG C;  5BMG A;  2D3G A;  3P4R B;  3WAO A;  4XZ4 A;  4BOZ B;  3GP7 A;  1AW7 A;  4II2 B;  2FCS A;  5IN7 A;  2UWQ A;  3PZ7 A;  3IBE A;  3SR6 A;  2NCN A;  4HPP A;  4B0E A;  2MBQ A;  1TGZ B;  5DCN A;  3HM3 A;  2BS3 B;  3KUZ A;  2GOW A;  2MW5 A;  2J0K A;  1ZUD 2;  5C23 A;  3T3N A;  3B2G A;  1WGY A;  4C7Z A;  1E0Z A;  5D6J B;  2GRI A;  4BBN C;  1IP9 A;  2H88 B;  2RPV A;  2JPH A;  3V62 A;  4OVZ A;  1XCQ L;  4ZYS A;  4P16 A;  5JXV A;  2KDE B;  3PLV A;  3V61 A;  3UIN B;  3NZS A;  3RMK C;  3NHE B;  3R7Q A;  4KGS A;  4K3C A;  1N63 A;  4BKS A;  3AE7 B;  3TIX A;  1L7Y A;  2D3B A;  4D2K A;  5FK9 C;  4HKZ E;  2G9H D;  3HVD A;  3R3M A;  1VCB A;  2DNF A;  2HE7 A;  2DBY A;  2JX5 A;  3NS1 A;  1ZDX A;  3WAN A;  1HXY D;  1WE6 A;  4A20 A;  4YL8 A;  2Z59 B;  1KH0 A;  2L52 A;  4BKT A;  2RDH A;  3R2I A;  2BVC A;  3C8Y A;  1WXV A;  2MBH A;  3O13 A;  3VRA B;  1ZXI A;  1N62 A;  2MSE D;  3MFG A;  1IBX A;  1FIQ A;  1QQR A;  1LGR A;  3IAM 1;  4M02 A;  2RGF A;  3QQ8 B;  3A4S C;  3AEC B;  2N9X A;  5E6P A;  1GG3 A;  2MBB B;  3R7R A;  4LDT B;  3W1Y A;  2D11 A;  2K8H A;  3RN9 C;  3Q6B A;  3BYT B;  3W9C B;  4HXD A;  1WMH B;  2C7N B;  1PYW D;  3P4S B;  1P0R A;  1YQ4 B;  4PYU A;  2D10 A;  4LNI A;  5GMV A;  1MHH E;  4L1B A;  2JYE A;  2K25 A;  3MC8 A;  3L10 B;  2HDE A;  1V9J A;  5TSS A;  2KC1 A;  1L4D B;  2WDR B;  3RD2 A;  1BT0 A;  1C76 A;  2I1K A;  1ET9 A;  1XLQ A;  4X57 B;  2JU6 X;  1FEH A;  4FAD A;  2JXT A;  2NVU I;  1WX7 A;  2K0P A;  4ACF A;  3TL5 A;  5HG2 A;  1ACC A;  4BBN F;  2DZI A;  3LDZ E;  1Q0W B;  1FCL A;  3Q3O C;  4CO7 A;  4DDG D;  1KLG D;  2L83 A;  2LRU A;  1ET6 A;  1AWD A;  2WDT B;  1TIF A;  1P9D U;  3BK2 A;  3U2S C;  5L83 A;  2UU7 A;  3PT2 B;  3WCQ A;  2LJ5 A;  5AEK B;  1SJH D;  4EZK A;  4HDQ A;  1F9J A;  3T9L A;  4IM3 A;  2V1Y A;  3RI7 C;  1YQB A;  3DQV A;  4AQ7 A;  2BYT A;  1V2Y A;  2K22 A;  2AX5 A;  3KVF B;  1LM8 B;  1YJ1 A;  2JYT A;  3H7P A;  3M95 A;  1ZDV A;  3VHT C;  2W82 A;  3Q3M C;  2W3R A;  4RCO A;  3HRD D;  4OZA A;  5HFY A;  4URK A;  1JRU A;  1WM3 A;  4YTM B;  1I4X A;  3PS6 A;  4MGK E;  4K81 A;  2M1M A;  1ZW7 A;  3KQ4 A;  5BO4 B;  5AUK A;  2PE6 B;  3ONS A;  1YOV B;  3H8H A;  3MHS D;  1K53 A;  1C4A A;  3RZW C;  2LHD A;  3QHT A;  3HK0 A;  2ZEQ A;  4HKQ A;  1TYG B;  4LLG M;  5D2M B;  2IYD B;  2NPT A;  3PZ8 A;  2RPQ A;  4KKI A;  2N1V A;  3PLU A;  1FFU A;  2LZ6 A;  4IM0 A;  3VTV A;  5JHB A;  4C4V A;  1UF0 A;  1L5P A;  2EKE C;  2W54 A;  3WAM A;  4B0M A;  2HJ1 A;  2DHZ A;  1RWS A;  4II3 B;  5H8Y E;  3DBL I;  1SBB B;  2CU1 A;  4NAW B;  1TZO A;  2LWP A;  3DOW A;  4W9L A;  4NZL B;  2DYO A;  3KYD D;  5IP4 D;  4MDK E;  4J3O D;  4CHK A;  3ENE A;  4WJN A;  1WX9 A;  1XLP A;  2J7Q B;  3KW5 B;  1CJE A;  5J18 A;  3ZDT A;  3KLS X;  5DPS A;  4O1N A;  3N30 A;  3ZIM A;  4NY0 A;  1AAR A;  3RNF C;  5D3I B;  2WXJ A;  1QOB A;  2IGD A;  5HKH A;  3AI5 A;  3DHI C;  2K6D B;  2ZW1 A;  1E90 A;  1JRP A;  3ML9 A;  2IBI B;  2LVO A;  2IPK D;  3M62 B;  1A70 A;  4YTN B;  3ALB A;  4OVV A;  1ZE3 D;  1PQS A;  2ACZ B;  3L16 A;  4H2A A;  1FPY A;  2KVZ A;  2Y5B B;  3KWL A;  3N9Y C;  2B76 B;  5JHA A;  4XWW A;  4L2Y A;  2PPH A;  3WAL A;  3P4P B;  4JWU C;  3TBL D;  2JZ3 B;  3PGE A;  4AWJ A;  1J7C A;  2BF8 B;  2XK5 A;  3AN1 A;  1WY8 A;  2DWQ A;  3VH4 B;  3NOB A;  4BOS C;  4BVU C;  1OQQ A;  2AL6 A;  2IGH A;  1EU3 A;  1GC6 A;  2L0T A;  2RR9 A;  4M00 A;  1WYW B;  4YT0 B;  1D3Z A;  1RRB A;  3A9J A;  4JQW C;  3ML8 A;  3AU5 A;  4NQL B;  2KLG A;  3ZLZ A;  2XNA C;  1C77 A;  1P1A A;  3DWG C;  4MM3 B;  3W5U B;  4GDL B;  2M0A A;  4MAC A;  4W9G A;  3ZGZ A;  1P98 A;  1FRR A;  3N1Z C;  3ETR A;  2LXA A;  1VLB A;  2X8X X;  2WXL A;  4G3X B;  4GDK B;  1TY2 A;  4TV3 A;  3KUC B;  4YXD B;  1WSP A;  2WX0 A;  1SIF A;  2RDG A;  3GE8 C;  3QWZ B;  4L23 A;  2M4N A;  1SE3 A;  4C7Y A;  2L3Z A;  2BB5 A;  2LGY A;  3LB8 C;  3N1X C;  3RNE C;  2JXX A;  1WFY A;  2KNB A;  1VZ6 A;  3AUL A;  3VRB B;  1DYQ A;  2KWC A;  1ZKH A;  1GB4 A;  2KT7 A;  2INC C;  1SE9 A;  3RFZ B;  1YX5 B;  1NEK B;  2K6Q A;  3OWE B;  1QKZ A;  2KTR A;  5GXG B;  1I7H A;  3TEY A;  4DHJ B;  3V05 A;  2N1W A;  1J7B A;  3BYY B;  2YVC A;  4B6W A;  4PYZ A;  2OJR A;  3GS2 A;  1FXA A;  2DYM A;  3L13 A;  4KVG B;  3NUH B;  1BUI C;  2GLS A;  4AS1 A;  2L00 B;  4MH0 E;  4WAF A;  5LNK 1;  3LXF A;  2I1J A;  3APF A;  3Q14 C;  3MTN B;  1NI3 A;  1JWM D;  1YMH E;  3D32 A;  4KSL C;  2WXN A;  2W9N A;  1V5O A;  4RNA A;  1C3T A;  3JYU A;  5IOI A;  1XXG A;  1J8C A; 
#chains in the Genus database with same CATH homology
 1T0Q C;  4P1B C;  3Q3N C;  3RNG C;  2INC C;  3Q2A C;  3DHH C;  3RNC C;  3GE8 C;  3N20 C;  3RNB C;  3Q3M C;  3Q14 C;  2IND C;  3I63 C;  3RMK C;  1T0S C;  3RNF C;  3N1Y C;  3N1Z C;  3N1X C;  4P1C C;  3RNE C;  3GE3 C;  3RI7 C;  3DHG C;  3RNA C;  1T0R C;  2RDB C;  3DHI C;  3Q3O C;  3RN9 C;  3I5J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...