3N1ZC

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase t201s mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toluene o-xylene monooxygenase component
publication title Active Site Threonine Facilitates Proton Transfer during Dioxygen Activation at the Diiron Center of Toluene/o-Xylene Monooxygenase Hydroxylase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
total genus 25
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3n1zC00
1T0QC 3RNBC 3RNFC 2INDC 4P1BC 2RDBC 3Q3NC 3RNCC 3GE8C 3RNGC 3N1XC 1T0SC 3N1ZC 3RMKC 3I5JC 3RNEC 3DHHC 2INCC 3DHIC 3N1YC 3Q3OC 3Q14C 3Q2AC 3DHGC 4P1CC 3RN9C 1T0RC 3Q3MC 3RNAC 3RI7C 3N20C 3I63C 3GE3C
chains in the Genus database with same CATH superfamily
1I7HA 5IO9A 2KJHB 4K7SA 2HJ1A 4LNKA 1AN8A 2WDTB 1F2RC 3TL5A 4KKIA 1FNWA 2AQ3B 2FAZA 3IXSA 3BVGA 2A5UA 2ZJDA 2WXQA 4M01A 3B08A 2CJNA 4HVBA 5HG2A 1WYGA 4KDIC 3APDA 1L0XB 1HTQA 3M95A 2LRUA 1SEBD 4C4VB 1STEA 3SFDB 3RNFC 2INDC 3C19A 3FAHA 2HTHA 1ZE3D 2UWQA 1L4DB 4AOFA 3APCA 2W82A 2L8JA 1WF9A 1PUTA 3A9KA 2L0FA 1C4AA 2LUMA 1FFVA 1Q5WB 4ZRJA 5IOIA 2JYTA 1FM0D 2LASA 1T0RC 2DHZA 1JALA 4XDDA 1ZDXA 3U30A 1A70A 3A9JA 1HQRD 3SU8X 2IDYA 4N58A 2D07B 1N60A 4WJQA 4A90A 3D32A 5L83A 4MSQB 1K51A 2M19A 2ZW0A 2KYWA 1R4NB 2WXLA 4HROA 2K6DB 3AEAB 3KW5B 1WJUA 2RDHA 1L2NA 4WURA 1VZ8A 1TBEA 1RFKA 3AECB 4FBJB 4GGQA 1KM7A 3HK0A 2VRRB 1UWXA 1JWBD 3OAWA 2YEPB 3H9DA 1TZOA 2SEBD 2C9WB 3DPDA 4C7ZA 3ZLZA 1SXTA 2G3QB 2IGHA 4KSLC 2RPQA 4K81A 3AEGB 3ZUNA 2KAJA 3L08A 1D5XC 2DENB 3Q8FA 3WANA 2V3PA 2N9LA 5BYQA 5FR3A 1UGMA 2LGSA 1C4CA 5HHDG 1WX8A 4NQKE 2KTRA 3A1QB 3NUHB 3AE5B 1C77A 2ZPYA 3W2DA 1YQBA 2J53A 1MHHE 4G11A 2LHEA 2MJ3A 2C60A 3VTUA 4DQOC 3B1LX 2PE9A 4WJPA 2KMCA 2D3CA 3TSSA 2N0SB 1QF6A 1J7AA 1ENFA 3J9CA 3I5JC 4NAMA 4XYCA 2BW2A 1OEYJ 4P1CC 1KF6B 1V5OA 4G0NB 2TSSA 4JE3B 2NPTB 2A4ZA 3VTVA 3EUB2 1ZP0B 3SEBA 4DDID 1VD2A 2MCNB 1FEHA 3QWZB 3QJZA 3Q3JA 3PRPB 1YQ3B 4UDUC 3VH3B 3TJPA 2AX5A 4HRSA 4KV2A 2BB6A 3WAOA 3UQBA 1WJ4A 4JPSA 3MC0B 4M0WA 3VHTC 3W5UB 1WGYA 1TGZB 4KGSA 1ZW7A 1D6EC 2GB1A 5KHQA 3HIZA 1ACCA 3W1YA 3AEFB 2DZJA 4PS3A 2WQYB 3TEXA 1JWMD 2G1EA 4HJGE 1UZXB 1YN3A 2DZMA 2WXKA 3MC9A 4KDLB 1K52A 2LGXA 2BKRB 2JRIB 1OEYA 1EF1A 3W1SA 1SE3A 4DXFA 4BBNF 3ZNHB 3DBLB 1GOZA 2WYQA 4XWTA 3T9LA 3ZTDA 4W9EA 3VTWA 3RULA 4EFOA 2DYMA 3X23A 1I4HA 4GDLB 1KH0A 2BVCA 3DHHC 2N1WA 1FD6A 2NCNA 1L5PA 1QILA 2Z0DB 2IBIB 1EU3A 4PYUA 2J42A 2NBUA 4M8MA 1E7VA 2CKHB 3VRAB 4YSXB 4ZRIA 5FK9C 3NVWA 5DCNA 1TT5B 4C7YA 4J3OD 4P6VF 2WP9B 4EEWA 2LUEA 4FADA 1F52A 2BBCA 2BB5A 3M63B 3NVZA 3CMMB 4OVVA 1IBXA 3U7ZA 2BT6A 1D3ZA 3BVMA 4W9CA 3ZRCA 3DBSA 4WAAA 2L76A 4AP4C 2KMAA 4M8NA 5AUIA 3ZXRA 4F8CB 1YN5A 2ASQA 1X1MA 4TSSA 2VZKD 3ZDMC 2JX5A 5J2RA 2J0MA 1C79A 1C3TA 2J4XA 4PK1A 5MPOA 4PYZA 5JHAA 1WMHB 1NYRA 2JYEA 3Q3FA 2JUOA 2J7QB 3L10B 4REZA 1XQQA 2H88B 1FMAD 2JXTA 1P7FA 2IY1B 1N62A 3RUIB 4W9KA 3PVLA 1GJZA 4W9IA 1B1ZA 1XLQA 1QZEA 4RCOA 2C7NB 4MJSA 1VRAB 2WHIA 3OWEB 2M56B 2GBRA 4RM9A 5C2TB 2PW9A 3HRDD 3L17A 4YWGG 1ZDVA 2DLBA 4KIKB 1HEZE 4N6EB 3OJ4B 2GRIA 4PT5A 2VZKB 1LXDA 1V80A 3VR8B 2EMSA 2OJWA 2FE8A 3ZJUA 2ZNVB 3AB5A 3DOWA 2JZZA 2QCZA 4N9F4 1WSPA 5AEKB 2DWQA 2CR5A 4USAA 2BQQA 3VH4B 2W3RA 2JU6X 4AWJA 3V62A 1I4RA 1NBFC 3DHIC 2B76B 5JZEB 4A3PA 1EM7A 1WXQA 3WA0A 4YL8A 1VDVA 1V2YA 2L0TA 3SHQA 3BINA 2D3AA 3GOEA 1NENB 5DPWA 2K6QA 2MBHA 4HXDA 2M0XA 2KDEB 2PLPA 1F1HA 3AEBB 1FIQA 3VAWA 4L23A 1D5MC 1GB1A 3LXFA 2JRHA 1YJ1A 4MELA 4B9KA 4OW0A 1DOIA 2RPVA 3QK0A 2FBWB 1U4AA 2ZZPB 5CHWA 1B9RA 2V4IB 2QJLA 3RFZB 1WWTA 1J19A 4EUTA 2K25A 4ZRPA 1ZGUB 1C4PA 4KZ0A 3NVYA 2LJIA 4G50A 1JCKB 5LLIA 4ZRKA 2KWVB 2ONQA 1JWAD 4XGAB 1TS3A 3DQVA 5H92C 5AZFA 1WX9A 3AU4A 2DYBA 1JROA 5E6PA 1V1PA 3EHVA 1MI0A 2RR9A 3AI5A 4IM2A 1RWSA 2ZEQA 4NQLB 3AE6B 5EDSA 4DBGA 4HDOA 3VUWA 1E90A 2WXGA 3N1ZC 2MJDA 4LJPB 1WXMA 1XO3A 1HZ5A 2BYEA 4HKZE 3N9YC 3TBLD 2GBJA 3PS6A 2Q5WD 3ALBA 4XDCA 3R2IA 2MW5A 3AE8B 2JT4B 1GAQB 4M0WB 1FXTB 3NS1A 1SIFA 1TYGB 3RYTA 4GLSC 2XNAC 3C0RB 3EC8A 3HUIA 1R4NI 4MSMB 2LI5A 4ICUA 1MPEA 1YNTE 1UF0A 1CK1A 2WXFA 4HK2A 4EZKA 2KDIA 2KC1A 4J6IA 1TZ1A 1DOYA 2KVRA 3KUDB 2BPSA 2MX2A 3KWVA 3O13A 1N5WA 3OLMD 2N9EB 1QOAA 2LWPA 4XZ4A 1RYJA 3T8MA 3C8YA 3VQIA 5BMIA 1D5ZC 1XXGA 1BT0A 1GB4A 3VDZA 3AXCA 3ZNGC 1LFDA 4A8XC 5G2NA 1WXSA 3FILB 2L3ZA 2KX0A 2FCQA 3QA8A 4C80A 1UWMA 2QC8A 2R2OA 3JYUA 3ZXVA 4F7ZA 1XD3B 4EZJA 2BGFA 4LK0M 1J8CA 2N1VA 1C9FA 1V9JA 4AQ7A 4X57B 4EOYA 1YQ4B 1IBXB 5DPTA 2INCC 2L32A 1WJ6A 4US8A 2LXCA 4MM3A 1SIJA 1F77A 5BO4B 5HI1A 2XBBC 3PGEA 2JQRB 2QMTA 1V81A 2IO3B 2RSUA 2KJ6A 3AE3B 1G6JA 2IY0B 4GXBA 3TUOA 2K3UA 2LHDA 4II3B 4JWSC 4FXCA 3QX1A 3IAM1 1H8CA 4N59A 3GZNI 4W9FA 3KH0A 3PZ8A 2KLCA 2FIFA 3WAMA 3KQ4A 4M02A 4W9HA 1FXAA 3PTFC 4Q2JA 2ZCCA 3K9OB 4IM3A 2CS4A 2ACZB 3RNCC 4L1BA 2MRPA 1LQBA 2C7HA 1WGGA 3JSVA 1L6VA 4MJSB 2VH2A 2KFKA 2KWUB 2LZ6A 4URKA 5EE9A 3MP9A 3I9V1 2Z8LA 3DBLI 5HKHA 2KX3A 4ICVA 1SGHA 1YD8U 3Q8AA 1VR9A 2X38A 1E9MA 2KWDA 3QARA 5C23A 4C56C 1SB3C 2CU3A 2N7JA 3VXWA 1WH3A 1ESFA 2MP2A 1ISNA 2PPHA 1VCBA 2K8HA 4NPNA 2G9HD 2LEKA 2KDFB 2WGSA 1HTOA 1QOFA 3KVFB 3NZ3A 4IWPA 2JXXA 3UQAA 1PFDA 3EFUA 1WGKA 1OTRB 2Y5PA 4D2KA 3DHGC 2BS2B 2KQ4X 5G55A 3TCAA 3CWIA 4B95A 4S0RA 1P1AA 1E0ZA 2LRWA 3IG3A 3DWMA 4CO7A 2KOXA 2IPKD 1LM8B 1SJED 2K8BA 3W9CB 1RM6C 2H89B 4NJ7A 3PO0A 4DHJD 1KTKA 1ZXHA 2GBMA 1TIFA 1NDDA 4W9DA 1EWCA 4WJNA 2ZW1A 3CIRB 4NNJB 1EO6A 3MHSD 3EFCA 3PLVA 3GE3C 2EKIA 3S2AA 2IGDA 4DK5A 3RT3B 2KDBA 3WIMA 3Q8CA 2RGFA 3DBHB 1Q10A 3AN1A 2WDQB 4O1NA 1MFWA 1FNVA 2L05A 1XT9B 3IFWB 3VUXA 3TEYA 1T0QC 5IA7A 1JWSD 4IOIE 3AV8A 3GE8C 4DHJB 5G5HA 2JSVX 4ACFA 1TS4A 5C1ZA 2R2QA 5D94A 4TUUA 2IO1B 1FNUA 4GN1A 3RN9C 4RGTA 3GZNB 4XC2A 1RRBA 4KSKC 4OVUA 3GP7A 3MJWA 3R7QA 3T3NA 1TKYA 4YT0B 4HKQA 4BAXA 2RDBC 4WWNA 4LNOA 4WQOB 3B9JA 2R61A 1FFUA 1N6ZA 3QIJA 3PHWB 4JX1C 5D3DA 3NHEB 4NAWB 2KMMA 2QIEB 2INPE 2HTME 4MGYE 3RNBC 3P63A 1WRDB 4AJYB 3HVZA 1E8XA 1WX7A 2WXIA 3E56A 2K1FA 3ZDTA 2LD9A 3Q8BA 3U7DA 3MC8A 1TY0A 3Q14C 1UD7A 1T0YA 3PHXB 3JVZX 3NG0A 1CMXB 2GLSA 1LO5D 1IGCA 2G4SA 3UGBB 3O65B 3I57A 1DOXA 4ZDVA 2AQ2B 4LCDE 4WWMA 3VVWB 4B0MA 3SDLC 3NZUA 2J0JA 4BKTA 2WXJA 1E7UA 4RGOS 1SJHD 4K7WA 4MGZE 4ZRQA 2KNBA 4KVGB 2I1KA 4MM3B 2LVOA 1TKGA 2WXRA 5JHBA 3N1YC 3U52E 4A6QA 4DXAB 3ENEA 4MDKE 5D3IB 3ZO5B 3IAS1 3HHMA 3MJ5A 5LXHA 1NYQA 2DAFA 4JWUC 1QT9A 4IKGA 3FC4A 2L7RA 3MFGA 1YJIA 2O6VA 1KLGD 5FKAC 2CHXA 5IP4D 1WR6E 2KQ7A 1ET6A 4CQNA 3R7RA 3BVZA 2MEKA 4HPLB 1JRPA 5EE0A 2EKEC 3M3JA 1PGXA 3ML8A 2KKCA 4RF0A 2L52A 4LDTD 2GBNA 4HCNB 2FIDA 1FO4A 3AE2B 1XLNA 4LLGM 3P1MA 1V5TA 5D7GA 3A9KB 4YSZB 2DZKA 2IJ0A 2WXHA 1WGDA 4LJOB 4A9AA 2WLBA 1I35A 3NZSA 3AULA 3RZFA 3A9JB 1MJDA 1IP9A 1WZ0A 1FRRA 2NVUI 3B2GA 1K53A 1I42A 2KZRA 2ICIA 1Q1OA 2GMIC 3KUCB 3PPAA 4DWFA 4RFBA 4MGIE 3DDCB 4IDIA 3A4SC 3AMZA 1K50A 3Q6BA 4LDTB 2YVCA 4ZOHC 2W9NA 2GBKA 1WZ3A 1VJKA 2LVQA 2O2VA 3QC8B 1IGDA 3BYYB 4WJOA 1P9DU 3N1XC 1TJEA 3H1UA 2LGDA 4ANXA 1FRDA 4B0EA 4MEMA 3BYTB 4BKGA 3PSEB 2LFIA 3PZDA 1P98A 2JPHA 4US9A 3NS8A 3U8ZA 5AZHA 1NI2A 5G5GA 2QILA 3R2TA 4EZLA 4ZHOA 2PTLA 4ZYSA 2K8CA 4YTNB 1E10A 3APFA 2KTRB 3RNGC 1C78A 4II2B 5CX3A 1MG8A 3L13A 2EELA 2M1MA 3H7SA 2MBEA 3ZVVA 2BYTA 3T3OA 1AYFA 4IWOA 2NMQA 3EGRA 1KLVA 2JY6A 4FULA 2JZ3B 2XK5A 4IC7B 2NBWB 4RMAA 4GMVA 1QOBA 2IO2B 4QAYA 1MHXA 2PKOA 3NVVA 3DVGX 2KD0A 1Y8RC 1UBIA 2WU5B 2IGGA 1IPGA 3A4RA 4YTPB 4HDQA 3PT2B 3FKYA 5DPRA 3RI7C 2YLMA 4OZCA 3W1SC 1TY2A 2FUHB 1PGAA 4JIOU 3AE4B 3K9PB 3OG5A 1WGRA 4MH0E 4PS7A 3N3KB 1GUAB 3ZYYX 1JWUD 3ZQ4A 3ECIA 5AUKA 3L0WB 1WM3A 3B0AA 1TS2A 1QLBB 1F2RI 1J0GA 1VLBA 1UNSA 1SE2A 2NBVB 4XWWA 3AH7A 3B2FA 4JGHB 1GNUA 2PMVA 1XEEA 4FN2A 4OVZA 3SR6A 1PYWD 2FCNA 1V6EA 2DAJA 2DBYA 4DXGA 3DVGY 3N32A 1V1OA 2DX5B 1J7CA 5E6NA 3KYCD 3NJTA 1YIWA 1YN4A 2L1AA 4DDGD 4ITKA 4K7UA 4GIVA 2HE7A 1P3QU 3V61A 2BKFA 3DVNV 4E3CA 2BF8B 5EE3A 3DBRI 2MH7A 2M17A 4FHJA 2INNE 2REXA 1P7EA 4W9JA 2KC2A 1WI0A 3MTNB 2VH1A 2Y5CA 3P4RB 3WAPA 5TR5A 3RCZA 2MA9B 4FJVB 1RFAA 1E8YA 4KGTA 2KTFA 5I4DA 2FCMA 3V3XA 2OEDA 3DBHI 3H7PA 4GDKA 4YXDB 1AW7A 3V6EB 2JWUA 3RPFC 1F0ZA 1MG4A 3AU5A 3ONSA 4RNAA 4RGMA 3ETRA 2Y3AA 1T6BX 3P2BA 3URYA 2JZPA 3AE7B 2ZVNA 2KLGA 1OQYA 3UINB 1BMLC 2KJRA 5BMHA 1AARA 3ZJVA 2V9HA 2OJRA 1ZUD2 4WH4A 2CU1A 2FUG1 3BWUD 4S17A 4EE2A 1WXAA 3ZW3A 1UUPA 5TSSA 3UI3A 4WWOA 3H8HA 4KKJA 1GC7A 2KN4A 4BBNC 3BY4B 1TS5A 1E7PB 1V49A 3U2SC 1ZXIA 1WMHA 1I4XA 3TEWA 2LXAA 3SFEB 3UF8A 3I63C 3Q69A 4I6LB 1LGRA 2LJ5A 1I4PA 5CHVC 2MHJA 4NJ6A 3DWGC 2QEJC 3RZWC 4CHKA 2N9XA 3ZIMA 3AE9B 1ET9A 4GU2A 2AWTA 3ZNID 1NVID 3UIPB 3ABVB 4KIKA 3AE1B 3BK2A 1L0YB 4ZHPA 3E9SA 4HEA1 4B6WA 5C3JB 1EU4A 5D6JB 4LNNA 2KQSA 1UGJA 1TTNA 1V86A 4H2AA 1ZKHA 2QHOA 2WS3B 2MBOA 4GOCA 2WXPA 1T5XD 1XCQL 2O2VB 2D10A 1WE6A 2BYFA 4G3XB 1KRHA 4JLCA 5BYRA 2AQ1B 3H6NA 3SD5A 2WX0A 3UIOB 4TV3A 1C1YB 2IO0B 2N7EA 3A33B 2I38A 2V0GA 4ANUA 3CSFA 4HLEA 2D2QA 3DBRB 4IG7B 3AM9A 4WAFA 2BS3B 1SF0A 5KHOA 1N5XA 3L4PA 5IKCM 4RH6A 2LMCA 2ZVOA 5EE1A 1RLFA 1R4MI 2CJOA 1KJTA 4FA6A 2MLBA 4P16A 3IVFA 3DVNU 3DCGA 2FNJB 2WX1A 2ZPNA 3ZRFA 1A5RA 1C76A 1V1PB 2XK5B 3X0WA 4P7IA 4F1SA 3ML9A 4XE0A 2NTSA 4EKUA 1WFYA 3TIXA 4DHZE 1T3QA 4IM0A 3RNEC 1PDXA 2PVOD 3L54A 2W54A 3CSTA 3HVDA 1L7YA 2KT7A 1MVKA 2V1YA 1I4QA 4OZAA 3LB8C 3P4SB 2E3TA 4LNIA 3VRBB 3KUZA 5CHFA 2KFJA 2D3BA 2KDMA 2PEAA 3LDZE 2KWCA 1JMLA 3PZ7A 3BZDB 4HCPB 5HFYA 3Q8EA 1FXIA 3I3TB 1GPXA 1KFYB 2W55A 1QKZA 1E5WA 4NY0A 1J7BA 2KANA 2HDEA 2L00B 2BWES 1M94A 4M00A 2DZIA 4IWQA 3P42A 2WDVB 3P4PB 5DPSA 2K5PA 3PLUA 3V6CB 2DNFA 1SE4A 1L0VB 4KX6B 2PIAA 3N30A 3Q3MC 1JRUA 2KHWB 5LXIB 1HZ6A 2MSED 2K39A 2E6XA 1Z5SB 4AJWA 1DGJA 2WXNA 4E71A 2C5LC 3EECA 1KLUD 1WYWB 2WXMA 2W3SA 2OHFA 2BYVE 4I6PA 2YEPF 1EWYC 5GXGB 1PGBA 1WM2A 2J0KA 5AZGA 2N9KA 3QAQA 4R3DA 3FILA 4FLHA 4MGKE 5BYSA 4MACA 2HJ8A 2AYOB 3IHPC 2NS5A 4TQ0A 3H7PB 4GDKB 2FCSA 3PRMB 4C00A 4HJKA 3P4QB 5L95C 1D4BA 4BFRA 1E8WA 2ON8A 2EMTA 5JH5C 2D5GA 3GS2A 4FJYA 1WJNA 2X8XX 2PE6B 3MHZA 3QCAA 2KK8A 1R4MB 2KXJA 4P1BC 2RDGA 2V3SA 3KYDD 1KOTA 3Q3NC 3R66C 4GB9A 2GI9A 4WQMA 1IYFA 1V8CA 4E74A 4LNFA 1HE8A 2KVZA 2WNMA 1WR1A 2ZNVC 3HM6X 1WXVA 3ZKJC 4CYEA 1YJJA 4PS8A 2LVPA 3AEEB 4BOSC 1H4RA 2Y5BB 2RD0A 2XN9C 1WGHA 1CZPA 3PRZA 5LNK1 3JSVB 2XEWA 4RM8A 2WU2B 4TKNA 2KFKB 4C4VA 2CHZA 4KGRA 2KACA 1FCLA 2MQJA 5J18A 2RMMA 1OFFA 1R7SA 4BZAA 4YSYB 1BXTA 3L16A 1P0RA 4BKSA 2QDFA 4JQWC 1HXYD 2MBQA 4ASWC 2LGIA 4MT5A 4TQ1A 2WDRB 5E6JA 1CQVA 1K8RB 1ZPSA 1AWDA 2K0PA 2V4LA 2MP2B 3PV1A 2AL3A 3VFKA 2N7DA 4HWIB 3OJ3A 1CJEA 3TMPB 5FR6A 4BVUC 3KLSX 2N4FA 2JVCA 1UH6A 2MJEA 3TEZA 1EUVB 3IT4B 3Q3OC 4IUMB 5T8IA 1E8ZA 2DYOA 3EA6A 1GC6A 3ZTCA 2B3AA 4WIPA 4K1RB 3VR9B 3WALA 2BWFA 1FCCC 4ANVA 4FJZA 3QHTA 3R3MA 2V3NA 3LYYA 3PREA 4A20A 4OZBA 2CHWA 1PQSA 1IUEA 3A1QA 3CF6E 1OGWA 3ZGZA 1OQRA 1VZ6A 4A55A 1GG3A 2SAKA 4JL9A 2IYDB 2JF5A 1T0SC 1Z2MA 4IW0A 1OQQA 5GMVA 2D11A 3IBEA 2AEHA 1JW9D 2IZVB 4TMAB 3JW0X 4DHZB 1S3SG 2PVGC 2K9XA 2OOBB 1Q0WB 3BIID 3ZNZB 1SSNA 3IT6B 3N20C 3BK1A 2NTTA 1TKEA 2M4NA 2NPTA 2G4DB 2D3GA 4LTUA 3R8BA 2G45B 4K3BA 4HPMB 1FPYA 4WWPA 2BTEA 1YX5B 4W9LA 5IAAC 3Q2AC 5CTRC 1F9JA 3VUYA 1M4VA 1EF5A 1QQRA 1RAXA 4HPPA 2KN5A 2I2YA 1XLPA 1YOVB 2GOWA 1N61A 1V97A 2MBBB 2J52A 3V05A 4MH8A 5IN7A 3RD2A 3U4EG 3KWLA 2NR2A 4I6NB 2ZCBA 4NJCA 2L83A 1NI3A 5D2MB 4AS1A 3NRZA 1L6UA 1XF5L 5J17A 3GB1A 4L2YA 2JWZA 3NOBA 1NEKB 1BUIC 4NAWA 1HA5A 2Z0EB 2WWZA 1YMHE 2N9PC 2PJHA 1N63A 1S1QB 3ZJTA 4ARIA 1XCTL 1UELA 2UYZB 2AL6A 1ZOYB 2M0AA 5H8YE 1QOGA 4K3CA 4A3OA 2BS4B 4GDLA 2QSDA 3RNAC 4BOZB 5JXVA 4YTMB 2O6VD 1YX6B 2UU7A 2MWSB 4RGNA 3W5VB 1VZ7A 4ANWA 2Z59B 1Y56A 4AUQC 3M62B 1XLOA 2LGYA 1I4GA 3NY5A 1SBBB 5E6OA 3AEDB 2HD5B 3RMKC 4ARCA 4GSWA 3LJ3A 4KZCA 2I1JA 4OHJA 4W9GA 4RF1A 1DYQA 1L4ZB 2M8SA 3V60A 1ROEA 3QQ8B 1WE7A 4ZYNA 1UBQA 2KO3A 1SE9A 5BMGA 1WRIA 1E6EB 2K22A 3HM3A 4XX5A 4NZLB 1JQ4A 1WIAA 3WCQA 4BKSD 2O6VB 2WXOA 1WY8A 2C7MB 4FHKA
chains in the Genus database with same CATH topology
1T0QC 3RNBC 3RNFC 2INDC 4P1BC 2RDBC 3Q3NC 3RNCC 3GE8C 3RNGC 3N1XC 1T0SC 3N1ZC 3RMKC 3I5JC 3RNEC 3DHHC 2INCC 3DHIC 3N1YC 3Q3OC 3Q14C 3Q2AC 3DHGC 4P1CC 3RN9C 1T0RC 3Q3MC 3RNAC 3RI7C 3N20C 3I63C 3GE3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0Q C;  3RNB C;  3RNF C;  2IND C;  4P1B C;  2RDB C;  3Q3N C;  3RNC C;  3GE8 C;  3RNG C;  3N1X C;  1T0S C;  3N1Z C;  3RMK C;  3I5J C;  3RNE C;  3DHH C;  2INC C;  3DHI C;  3N1Y C;  3Q3O C;  3Q14 C;  3Q2A C;  3DHG C;  4P1C C;  3RN9 C;  1T0R C;  3Q3M C;  3RNA C;  3RI7 C;  3N20 C;  3I63 C;  3GE3 C; 
#chains in the Genus database with same CATH topology
 1I7H A;  5IO9 A;  2KJH B;  4K7S A;  2HJ1 A;  4LNK A;  1AN8 A;  2WDT B;  1F2R C;  3TL5 A;  4KKI A;  1FNW A;  2AQ3 B;  2FAZ A;  3IXS A;  3BVG A;  2A5U A;  2ZJD A;  2WXQ A;  4M01 A;  3B08 A;  2CJN A;  4HVB A;  5HG2 A;  1WYG A;  4KDI C;  3APD A;  1L0X B;  1HTQ A;  3M95 A;  2LRU A;  1SEB D;  4C4V B;  1STE A;  3SFD B;  3RNF C;  2IND C;  3C19 A;  3FAH A;  2HTH A;  1ZE3 D;  2UWQ A;  1L4D B;  4AOF A;  3APC A;  2W82 A;  2L8J A;  1WF9 A;  1PUT A;  3A9K A;  2L0F A;  1C4A A;  2LUM A;  1FFV A;  1Q5W B;  4ZRJ A;  5IOI A;  2JYT A;  1FM0 D;  2LAS A;  1T0R C;  2DHZ A;  1JAL A;  4XDD A;  1ZDX A;  3U30 A;  1A70 A;  3A9J A;  1HQR D;  3SU8 X;  2IDY A;  4N58 A;  2D07 B;  1N60 A;  4WJQ A;  4A90 A;  3D32 A;  5L83 A;  4MSQ B;  1K51 A;  2M19 A;  2ZW0 A;  2KYW A;  1R4N B;  2WXL A;  4HRO A;  2K6D B;  3AEA B;  3KW5 B;  1WJU A;  2RDH A;  1L2N A;  4WUR A;  1VZ8 A;  1TBE A;  1RFK A;  3AEC B;  4FBJ B;  4GGQ A;  1KM7 A;  3HK0 A;  2VRR B;  1UWX A;  1JWB D;  3OAW A;  2YEP B;  3H9D A;  1TZO A;  2SEB D;  2C9W B;  3DPD A;  4C7Z A;  3ZLZ A;  1SXT A;  2G3Q B;  2IGH A;  4KSL C;  2RPQ A;  4K81 A;  3AEG B;  3ZUN A;  2KAJ A;  3L08 A;  1D5X C;  2DEN B;  3Q8F A;  3WAN A;  2V3P A;  2N9L A;  5BYQ A;  5FR3 A;  1UGM A;  2LGS A;  1C4C A;  5HHD G;  1WX8 A;  4NQK E;  2KTR A;  3A1Q B;  3NUH B;  3AE5 B;  1C77 A;  2ZPY A;  3W2D A;  1YQB A;  2J53 A;  1MHH E;  4G11 A;  2LHE A;  2MJ3 A;  2C60 A;  3VTU A;  4DQO C;  3B1L X;  2PE9 A;  4WJP A;  2KMC A;  2D3C A;  3TSS A;  2N0S B;  1QF6 A;  1J7A A;  1ENF A;  3J9C A;  3I5J C;  4NAM A;  4XYC A;  2BW2 A;  1OEY J;  4P1C C;  1KF6 B;  1V5O A;  4G0N B;  2TSS A;  4JE3 B;  2NPT B;  2A4Z A;  3VTV A;  3EUB 2;  1ZP0 B;  3SEB A;  4DDI D;  1VD2 A;  2MCN B;  1FEH A;  3QWZ B;  3QJZ A;  3Q3J A;  3PRP B;  1YQ3 B;  4UDU C;  3VH3 B;  3TJP A;  2AX5 A;  4HRS A;  4KV2 A;  2BB6 A;  3WAO A;  3UQB A;  1WJ4 A;  4JPS A;  3MC0 B;  4M0W A;  3VHT C;  3W5U B;  1WGY A;  1TGZ B;  4KGS A;  1ZW7 A;  1D6E C;  2GB1 A;  5KHQ A;  3HIZ A;  1ACC A;  3W1Y A;  3AEF B;  2DZJ A;  4PS3 A;  2WQY B;  3TEX A;  1JWM D;  2G1E A;  4HJG E;  1UZX B;  1YN3 A;  2DZM A;  2WXK A;  3MC9 A;  4KDL B;  1K52 A;  2LGX A;  2BKR B;  2JRI B;  1OEY A;  1EF1 A;  3W1S A;  1SE3 A;  4DXF A;  4BBN F;  3ZNH B;  3DBL B;  1GOZ A;  2WYQ A;  4XWT A;  3T9L A;  3ZTD A;  4W9E A;  3VTW A;  3RUL A;  4EFO A;  2DYM A;  3X23 A;  1I4H A;  4GDL B;  1KH0 A;  2BVC A;  3DHH C;  2N1W A;  1FD6 A;  2NCN A;  1L5P A;  1QIL A;  2Z0D B;  2IBI B;  1EU3 A;  4PYU A;  2J42 A;  2NBU A;  4M8M A;  1E7V A;  2CKH B;  3VRA B;  4YSX B;  4ZRI A;  5FK9 C;  3NVW A;  5DCN A;  1TT5 B;  4C7Y A;  4J3O D;  4P6V F;  2WP9 B;  4EEW A;  2LUE A;  4FAD A;  1F52 A;  2BBC A;  2BB5 A;  3M63 B;  3NVZ A;  3CMM B;  4OVV A;  1IBX A;  3U7Z A;  2BT6 A;  1D3Z A;  3BVM A;  4W9C A;  3ZRC A;  3DBS A;  4WAA A;  2L76 A;  4AP4 C;  2KMA A;  4M8N A;  5AUI A;  3ZXR A;  4F8C B;  1YN5 A;  2ASQ A;  1X1M A;  4TSS A;  2VZK D;  3ZDM C;  2JX5 A;  5J2R A;  2J0M A;  1C79 A;  1C3T A;  2J4X A;  4PK1 A;  5MPO A;  4PYZ A;  5JHA A;  1WMH B;  1NYR A;  2JYE A;  3Q3F A;  2JUO A;  2J7Q B;  3L10 B;  4REZ A;  1XQQ A;  2H88 B;  1FMA D;  2JXT A;  1P7F A;  2IY1 B;  1N62 A;  3RUI B;  4W9K A;  3PVL A;  1GJZ A;  4W9I A;  1B1Z A;  1XLQ A;  1QZE A;  4RCO A;  2C7N B;  4MJS A;  1VRA B;  2WHI A;  3OWE B;  2M56 B;  2GBR A;  4RM9 A;  5C2T B;  2PW9 A;  3HRD D;  3L17 A;  4YWG G;  1ZDV A;  2DLB A;  4KIK B;  1HEZ E;  4N6E B;  3OJ4 B;  2GRI A;  4PT5 A;  2VZK B;  1LXD A;  1V80 A;  3VR8 B;  2EMS A;  2OJW A;  2FE8 A;  3ZJU A;  2ZNV B;  3AB5 A;  3DOW A;  2JZZ A;  2QCZ A;  4N9F 4;  1WSP A;  5AEK B;  2DWQ A;  2CR5 A;  4USA A;  2BQQ A;  3VH4 B;  2W3R A;  2JU6 X;  4AWJ A;  3V62 A;  1I4R A;  1NBF C;  3DHI C;  2B76 B;  5JZE B;  4A3P A;  1EM7 A;  1WXQ A;  3WA0 A;  4YL8 A;  1VDV A;  1V2Y A;  2L0T A;  3SHQ A;  3BIN A;  2D3A A;  3GOE A;  1NEN B;  5DPW A;  2K6Q A;  2MBH A;  4HXD A;  2M0X A;  2KDE B;  2PLP A;  1F1H A;  3AEB B;  1FIQ A;  3VAW A;  4L23 A;  1D5M C;  1GB1 A;  3LXF A;  2JRH A;  1YJ1 A;  4MEL A;  4B9K A;  4OW0 A;  1DOI A;  2RPV A;  3QK0 A;  2FBW B;  1U4A A;  2ZZP B;  5CHW A;  1B9R A;  2V4I B;  2QJL A;  3RFZ B;  1WWT A;  1J19 A;  4EUT A;  2K25 A;  4ZRP A;  1ZGU B;  1C4P A;  4KZ0 A;  3NVY A;  2LJI A;  4G50 A;  1JCK B;  5LLI A;  4ZRK A;  2KWV B;  2ONQ A;  1JWA D;  4XGA B;  1TS3 A;  3DQV A;  5H92 C;  5AZF A;  1WX9 A;  3AU4 A;  2DYB A;  1JRO A;  5E6P A;  1V1P A;  3EHV A;  1MI0 A;  2RR9 A;  3AI5 A;  4IM2 A;  1RWS A;  2ZEQ A;  4NQL B;  3AE6 B;  5EDS A;  4DBG A;  4HDO A;  3VUW A;  1E90 A;  2WXG A;  3N1Z C;  2MJD A;  4LJP B;  1WXM A;  1XO3 A;  1HZ5 A;  2BYE A;  4HKZ E;  3N9Y C;  3TBL D;  2GBJ A;  3PS6 A;  2Q5W D;  3ALB A;  4XDC A;  3R2I A;  2MW5 A;  3AE8 B;  2JT4 B;  1GAQ B;  4M0W B;  1FXT B;  3NS1 A;  1SIF A;  1TYG B;  3RYT A;  4GLS C;  2XNA C;  3C0R B;  3EC8 A;  3HUI A;  1R4N I;  4MSM B;  2LI5 A;  4ICU A;  1MPE A;  1YNT E;  1UF0 A;  1CK1 A;  2WXF A;  4HK2 A;  4EZK A;  2KDI A;  2KC1 A;  4J6I A;  1TZ1 A;  1DOY A;  2KVR A;  3KUD B;  2BPS A;  2MX2 A;  3KWV A;  3O13 A;  1N5W A;  3OLM D;  2N9E B;  1QOA A;  2LWP A;  4XZ4 A;  1RYJ A;  3T8M A;  3C8Y A;  3VQI A;  5BMI A;  1D5Z C;  1XXG A;  1BT0 A;  1GB4 A;  3VDZ A;  3AXC A;  3ZNG C;  1LFD A;  4A8X C;  5G2N A;  1WXS A;  3FIL B;  2L3Z A;  2KX0 A;  2FCQ A;  3QA8 A;  4C80 A;  1UWM A;  2QC8 A;  2R2O A;  3JYU A;  3ZXV A;  4F7Z A;  1XD3 B;  4EZJ A;  2BGF A;  4LK0 M;  1J8C A;  2N1V A;  1C9F A;  1V9J A;  4AQ7 A;  4X57 B;  4EOY A;  1YQ4 B;  1IBX B;  5DPT A;  2INC C;  2L32 A;  1WJ6 A;  4US8 A;  2LXC A;  4MM3 A;  1SIJ A;  1F77 A;  5BO4 B;  5HI1 A;  2XBB C;  3PGE A;  2JQR B;  2QMT A;  1V81 A;  2IO3 B;  2RSU A;  2KJ6 A;  3AE3 B;  1G6J A;  2IY0 B;  4GXB A;  3TUO A;  2K3U A;  2LHD A;  4II3 B;  4JWS C;  4FXC A;  3QX1 A;  3IAM 1;  1H8C A;  4N59 A;  3GZN I;  4W9F A;  3KH0 A;  3PZ8 A;  2KLC A;  2FIF A;  3WAM A;  3KQ4 A;  4M02 A;  4W9H A;  1FXA A;  3PTF C;  4Q2J A;  2ZCC A;  3K9O B;  4IM3 A;  2CS4 A;  2ACZ B;  3RNC C;  4L1B A;  2MRP A;  1LQB A;  2C7H A;  1WGG A;  3JSV A;  1L6V A;  4MJS B;  2VH2 A;  2KFK A;  2KWU B;  2LZ6 A;  4URK A;  5EE9 A;  3MP9 A;  3I9V 1;  2Z8L A;  3DBL I;  5HKH A;  2KX3 A;  4ICV A;  1SGH A;  1YD8 U;  3Q8A A;  1VR9 A;  2X38 A;  1E9M A;  2KWD A;  3QAR A;  5C23 A;  4C56 C;  1SB3 C;  2CU3 A;  2N7J A;  3VXW A;  1WH3 A;  1ESF A;  2MP2 A;  1ISN A;  2PPH A;  1VCB A;  2K8H A;  4NPN A;  2G9H D;  2LEK A;  2KDF B;  2WGS A;  1HTO A;  1QOF A;  3KVF B;  3NZ3 A;  4IWP A;  2JXX A;  3UQA A;  1PFD A;  3EFU A;  1WGK A;  1OTR B;  2Y5P A;  4D2K A;  3DHG C;  2BS2 B;  2KQ4 X;  5G55 A;  3TCA A;  3CWI A;  4B95 A;  4S0R A;  1P1A A;  1E0Z A;  2LRW A;  3IG3 A;  3DWM A;  4CO7 A;  2KOX A;  2IPK D;  1LM8 B;  1SJE D;  2K8B A;  3W9C B;  1RM6 C;  2H89 B;  4NJ7 A;  3PO0 A;  4DHJ D;  1KTK A;  1ZXH A;  2GBM A;  1TIF A;  1NDD A;  4W9D A;  1EWC A;  4WJN A;  2ZW1 A;  3CIR B;  4NNJ B;  1EO6 A;  3MHS D;  3EFC A;  3PLV A;  3GE3 C;  2EKI A;  3S2A A;  2IGD A;  4DK5 A;  3RT3 B;  2KDB A;  3WIM A;  3Q8C A;  2RGF A;  3DBH B;  1Q10 A;  3AN1 A;  2WDQ B;  4O1N A;  1MFW A;  1FNV A;  2L05 A;  1XT9 B;  3IFW B;  3VUX A;  3TEY A;  1T0Q C;  5IA7 A;  1JWS D;  4IOI E;  3AV8 A;  3GE8 C;  4DHJ B;  5G5H A;  2JSV X;  4ACF A;  1TS4 A;  5C1Z A;  2R2Q A;  5D94 A;  4TUU A;  2IO1 B;  1FNU A;  4GN1 A;  3RN9 C;  4RGT A;  3GZN B;  4XC2 A;  1RRB A;  4KSK C;  4OVU A;  3GP7 A;  3MJW A;  3R7Q A;  3T3N A;  1TKY A;  4YT0 B;  4HKQ A;  4BAX A;  2RDB C;  4WWN A;  4LNO A;  4WQO B;  3B9J A;  2R61 A;  1FFU A;  1N6Z A;  3QIJ A;  3PHW B;  4JX1 C;  5D3D A;  3NHE B;  4NAW B;  2KMM A;  2QIE B;  2INP E;  2HTM E;  4MGY E;  3RNB C;  3P63 A;  1WRD B;  4AJY B;  3HVZ A;  1E8X A;  1WX7 A;  2WXI A;  3E56 A;  2K1F A;  3ZDT A;  2LD9 A;  3Q8B A;  3U7D A;  3MC8 A;  1TY0 A;  3Q14 C;  1UD7 A;  1T0Y A;  3PHX B;  3JVZ X;  3NG0 A;  1CMX B;  2GLS A;  1LO5 D;  1IGC A;  2G4S A;  3UGB B;  3O65 B;  3I57 A;  1DOX A;  4ZDV A;  2AQ2 B;  4LCD E;  4WWM A;  3VVW B;  4B0M A;  3SDL C;  3NZU A;  2J0J A;  4BKT A;  2WXJ A;  1E7U A;  4RGO S;  1SJH D;  4K7W A;  4MGZ E;  4ZRQ A;  2KNB A;  4KVG B;  2I1K A;  4MM3 B;  2LVO A;  1TKG A;  2WXR A;  5JHB A;  3N1Y C;  3U52 E;  4A6Q A;  4DXA B;  3ENE A;  4MDK E;  5D3I B;  3ZO5 B;  3IAS 1;  3HHM A;  3MJ5 A;  5LXH A;  1NYQ A;  2DAF A;  4JWU C;  1QT9 A;  4IKG A;  3FC4 A;  2L7R A;  3MFG A;  1YJI A;  2O6V A;  1KLG D;  5FKA C;  2CHX A;  5IP4 D;  1WR6 E;  2KQ7 A;  1ET6 A;  4CQN A;  3R7R A;  3BVZ A;  2MEK A;  4HPL B;  1JRP A;  5EE0 A;  2EKE C;  3M3J A;  1PGX A;  3ML8 A;  2KKC A;  4RF0 A;  2L52 A;  4LDT D;  2GBN A;  4HCN B;  2FID A;  1FO4 A;  3AE2 B;  1XLN A;  4LLG M;  3P1M A;  1V5T A;  5D7G A;  3A9K B;  4YSZ B;  2DZK A;  2IJ0 A;  2WXH A;  1WGD A;  4LJO B;  4A9A A;  2WLB A;  1I35 A;  3NZS A;  3AUL A;  3RZF A;  3A9J B;  1MJD A;  1IP9 A;  1WZ0 A;  1FRR A;  2NVU I;  3B2G A;  1K53 A;  1I42 A;  2KZR A;  2ICI A;  1Q1O A;  2GMI C;  3KUC B;  3PPA A;  4DWF A;  4RFB A;  4MGI E;  3DDC B;  4IDI A;  3A4S C;  3AMZ A;  1K50 A;  3Q6B A;  4LDT B;  2YVC A;  4ZOH C;  2W9N A;  2GBK A;  1WZ3 A;  1VJK A;  2LVQ A;  2O2V A;  3QC8 B;  1IGD A;  3BYY B;  4WJO A;  1P9D U;  3N1X C;  1TJE A;  3H1U A;  2LGD A;  4ANX A;  1FRD A;  4B0E A;  4MEM A;  3BYT B;  4BKG A;  3PSE B;  2LFI A;  3PZD A;  1P98 A;  2JPH A;  4US9 A;  3NS8 A;  3U8Z A;  5AZH A;  1NI2 A;  5G5G A;  2QIL A;  3R2T A;  4EZL A;  4ZHO A;  2PTL A;  4ZYS A;  2K8C A;  4YTN B;  1E10 A;  3APF A;  2KTR B;  3RNG C;  1C78 A;  4II2 B;  5CX3 A;  1MG8 A;  3L13 A;  2EEL A;  2M1M A;  3H7S A;  2MBE A;  3ZVV A;  2BYT A;  3T3O A;  1AYF A;  4IWO A;  2NMQ A;  3EGR A;  1KLV A;  2JY6 A;  4FUL A;  2JZ3 B;  2XK5 A;  4IC7 B;  2NBW B;  4RMA A;  4GMV A;  1QOB A;  2IO2 B;  4QAY A;  1MHX A;  2PKO A;  3NVV A;  3DVG X;  2KD0 A;  1Y8R C;  1UBI A;  2WU5 B;  2IGG A;  1IPG A;  3A4R A;  4YTP B;  4HDQ A;  3PT2 B;  3FKY A;  5DPR A;  3RI7 C;  2YLM A;  4OZC A;  3W1S C;  1TY2 A;  2FUH B;  1PGA A;  4JIO U;  3AE4 B;  3K9P B;  3OG5 A;  1WGR A;  4MH0 E;  4PS7 A;  3N3K B;  1GUA B;  3ZYY X;  1JWU D;  3ZQ4 A;  3ECI A;  5AUK A;  3L0W B;  1WM3 A;  3B0A A;  1TS2 A;  1QLB B;  1F2R I;  1J0G A;  1VLB A;  1UNS A;  1SE2 A;  2NBV B;  4XWW A;  3AH7 A;  3B2F A;  4JGH B;  1GNU A;  2PMV A;  1XEE A;  4FN2 A;  4OVZ A;  3SR6 A;  1PYW D;  2FCN A;  1V6E A;  2DAJ A;  2DBY A;  4DXG A;  3DVG Y;  3N32 A;  1V1O A;  2DX5 B;  1J7C A;  5E6N A;  3KYC D;  3NJT A;  1YIW A;  1YN4 A;  2L1A A;  4DDG D;  4ITK A;  4K7U A;  4GIV A;  2HE7 A;  1P3Q U;  3V61 A;  2BKF A;  3DVN V;  4E3C A;  2BF8 B;  5EE3 A;  3DBR I;  2MH7 A;  2M17 A;  4FHJ A;  2INN E;  2REX A;  1P7E A;  4W9J A;  2KC2 A;  1WI0 A;  3MTN B;  2VH1 A;  2Y5C A;  3P4R B;  3WAP A;  5TR5 A;  3RCZ A;  2MA9 B;  4FJV B;  1RFA A;  1E8Y A;  4KGT A;  2KTF A;  5I4D A;  2FCM A;  3V3X A;  2OED A;  3DBH I;  3H7P A;  4GDK A;  4YXD B;  1AW7 A;  3V6E B;  2JWU A;  3RPF C;  1F0Z A;  1MG4 A;  3AU5 A;  3ONS A;  4RNA A;  4RGM A;  3ETR A;  2Y3A A;  1T6B X;  3P2B A;  3URY A;  2JZP A;  3AE7 B;  2ZVN A;  2KLG A;  1OQY A;  3UIN B;  1BML C;  2KJR A;  5BMH A;  1AAR A;  3ZJV A;  2V9H A;  2OJR A;  1ZUD 2;  4WH4 A;  2CU1 A;  2FUG 1;  3BWU D;  4S17 A;  4EE2 A;  1WXA A;  3ZW3 A;  1UUP A;  5TSS A;  3UI3 A;  4WWO A;  3H8H A;  4KKJ A;  1GC7 A;  2KN4 A;  4BBN C;  3BY4 B;  1TS5 A;  1E7P B;  1V49 A;  3U2S C;  1ZXI A;  1WMH A;  1I4X A;  3TEW A;  2LXA A;  3SFE B;  3UF8 A;  3I63 C;  3Q69 A;  4I6L B;  1LGR A;  2LJ5 A;  1I4P A;  5CHV C;  2MHJ A;  4NJ6 A;  3DWG C;  2QEJ C;  3RZW C;  4CHK A;  2N9X A;  3ZIM A;  3AE9 B;  1ET9 A;  4GU2 A;  2AWT A;  3ZNI D;  1NVI D;  3UIP B;  3ABV B;  4KIK A;  3AE1 B;  3BK2 A;  1L0Y B;  4ZHP A;  3E9S A;  4HEA 1;  4B6W A;  5C3J B;  1EU4 A;  5D6J B;  4LNN A;  2KQS A;  1UGJ A;  1TTN A;  1V86 A;  4H2A A;  1ZKH A;  2QHO A;  2WS3 B;  2MBO A;  4GOC A;  2WXP A;  1T5X D;  1XCQ L;  2O2V B;  2D10 A;  1WE6 A;  2BYF A;  4G3X B;  1KRH A;  4JLC A;  5BYR A;  2AQ1 B;  3H6N A;  3SD5 A;  2WX0 A;  3UIO B;  4TV3 A;  1C1Y B;  2IO0 B;  2N7E A;  3A33 B;  2I38 A;  2V0G A;  4ANU A;  3CSF A;  4HLE A;  2D2Q A;  3DBR B;  4IG7 B;  3AM9 A;  4WAF A;  2BS3 B;  1SF0 A;  5KHO A;  1N5X A;  3L4P A;  5IKC M;  4RH6 A;  2LMC A;  2ZVO A;  5EE1 A;  1RLF A;  1R4M I;  2CJO A;  1KJT A;  4FA6 A;  2MLB A;  4P16 A;  3IVF A;  3DVN U;  3DCG A;  2FNJ B;  2WX1 A;  2ZPN A;  3ZRF A;  1A5R A;  1C76 A;  1V1P B;  2XK5 B;  3X0W A;  4P7I A;  4F1S A;  3ML9 A;  4XE0 A;  2NTS A;  4EKU A;  1WFY A;  3TIX A;  4DHZ E;  1T3Q A;  4IM0 A;  3RNE C;  1PDX A;  2PVO D;  3L54 A;  2W54 A;  3CST A;  3HVD A;  1L7Y A;  2KT7 A;  1MVK A;  2V1Y A;  1I4Q A;  4OZA A;  3LB8 C;  3P4S B;  2E3T A;  4LNI A;  3VRB B;  3KUZ A;  5CHF A;  2KFJ A;  2D3B A;  2KDM A;  2PEA A;  3LDZ E;  2KWC A;  1JML A;  3PZ7 A;  3BZD B;  4HCP B;  5HFY A;  3Q8E A;  1FXI A;  3I3T B;  1GPX A;  1KFY B;  2W55 A;  1QKZ A;  1E5W A;  4NY0 A;  1J7B A;  2KAN A;  2HDE A;  2L00 B;  2BWE S;  1M94 A;  4M00 A;  2DZI A;  4IWQ A;  3P42 A;  2WDV B;  3P4P B;  5DPS A;  2K5P A;  3PLU A;  3V6C B;  2DNF A;  1SE4 A;  1L0V B;  4KX6 B;  2PIA A;  3N30 A;  3Q3M C;  1JRU A;  2KHW B;  5LXI B;  1HZ6 A;  2MSE D;  2K39 A;  2E6X A;  1Z5S B;  4AJW A;  1DGJ A;  2WXN A;  4E71 A;  2C5L C;  3EEC A;  1KLU D;  1WYW B;  2WXM A;  2W3S A;  2OHF A;  2BYV E;  4I6P A;  2YEP F;  1EWY C;  5GXG B;  1PGB A;  1WM2 A;  2J0K A;  5AZG A;  2N9K A;  3QAQ A;  4R3D A;  3FIL A;  4FLH A;  4MGK E;  5BYS A;  4MAC A;  2HJ8 A;  2AYO B;  3IHP C;  2NS5 A;  4TQ0 A;  3H7P B;  4GDK B;  2FCS A;  3PRM B;  4C00 A;  4HJK A;  3P4Q B;  5L95 C;  1D4B A;  4BFR A;  1E8W A;  2ON8 A;  2EMT A;  5JH5 C;  2D5G A;  3GS2 A;  4FJY A;  1WJN A;  2X8X X;  2PE6 B;  3MHZ A;  3QCA A;  2KK8 A;  1R4M B;  2KXJ A;  4P1B C;  2RDG A;  2V3S A;  3KYD D;  1KOT A;  3Q3N C;  3R66 C;  4GB9 A;  2GI9 A;  4WQM A;  1IYF A;  1V8C A;  4E74 A;  4LNF A;  1HE8 A;  2KVZ A;  2WNM A;  1WR1 A;  2ZNV C;  3HM6 X;  1WXV A;  3ZKJ C;  4CYE A;  1YJJ A;  4PS8 A;  2LVP A;  3AEE B;  4BOS C;  1H4R A;  2Y5B B;  2RD0 A;  2XN9 C;  1WGH A;  1CZP A;  3PRZ A;  5LNK 1;  3JSV B;  2XEW A;  4RM8 A;  2WU2 B;  4TKN A;  2KFK B;  4C4V A;  2CHZ A;  4KGR A;  2KAC A;  1FCL A;  2MQJ A;  5J18 A;  2RMM A;  1OFF A;  1R7S A;  4BZA A;  4YSY B;  1BXT A;  3L16 A;  1P0R A;  4BKS A;  2QDF A;  4JQW C;  1HXY D;  2MBQ A;  4ASW C;  2LGI A;  4MT5 A;  4TQ1 A;  2WDR B;  5E6J A;  1CQV A;  1K8R B;  1ZPS A;  1AWD A;  2K0P A;  2V4L A;  2MP2 B;  3PV1 A;  2AL3 A;  3VFK A;  2N7D A;  4HWI B;  3OJ3 A;  1CJE A;  3TMP B;  5FR6 A;  4BVU C;  3KLS X;  2N4F A;  2JVC A;  1UH6 A;  2MJE A;  3TEZ A;  1EUV B;  3IT4 B;  3Q3O C;  4IUM B;  5T8I A;  1E8Z A;  2DYO A;  3EA6 A;  1GC6 A;  3ZTC A;  2B3A A;  4WIP A;  4K1R B;  3VR9 B;  3WAL A;  2BWF A;  1FCC C;  4ANV A;  4FJZ A;  3QHT A;  3R3M A;  2V3N A;  3LYY A;  3PRE A;  4A20 A;  4OZB A;  2CHW A;  1PQS A;  1IUE A;  3A1Q A;  3CF6 E;  1OGW A;  3ZGZ A;  1OQR A;  1VZ6 A;  4A55 A;  1GG3 A;  2SAK A;  4JL9 A;  2IYD B;  2JF5 A;  1T0S C;  1Z2M A;  4IW0 A;  1OQQ A;  5GMV A;  2D11 A;  3IBE A;  2AEH A;  1JW9 D;  2IZV B;  4TMA B;  3JW0 X;  4DHZ B;  1S3S G;  2PVG C;  2K9X A;  2OOB B;  1Q0W B;  3BII D;  3ZNZ B;  1SSN A;  3IT6 B;  3N20 C;  3BK1 A;  2NTT A;  1TKE A;  2M4N A;  2NPT A;  2G4D B;  2D3G A;  4LTU A;  3R8B A;  2G45 B;  4K3B A;  4HPM B;  1FPY A;  4WWP A;  2BTE A;  1YX5 B;  4W9L A;  5IAA C;  3Q2A C;  5CTR C;  1F9J A;  3VUY A;  1M4V A;  1EF5 A;  1QQR A;  1RAX A;  4HPP A;  2KN5 A;  2I2Y A;  1XLP A;  1YOV B;  2GOW A;  1N61 A;  1V97 A;  2MBB B;  2J52 A;  3V05 A;  4MH8 A;  5IN7 A;  3RD2 A;  3U4E G;  3KWL A;  2NR2 A;  4I6N B;  2ZCB A;  4NJC A;  2L83 A;  1NI3 A;  5D2M B;  4AS1 A;  3NRZ A;  1L6U A;  1XF5 L;  5J17 A;  3GB1 A;  4L2Y A;  2JWZ A;  3NOB A;  1NEK B;  1BUI C;  4NAW A;  1HA5 A;  2Z0E B;  2WWZ A;  1YMH E;  2N9P C;  2PJH A;  1N63 A;  1S1Q B;  3ZJT A;  4ARI A;  1XCT L;  1UEL A;  2UYZ B;  2AL6 A;  1ZOY B;  2M0A A;  5H8Y E;  1QOG A;  4K3C A;  4A3O A;  2BS4 B;  4GDL A;  2QSD A;  3RNA C;  4BOZ B;  5JXV A;  4YTM B;  2O6V D;  1YX6 B;  2UU7 A;  2MWS B;  4RGN A;  3W5V B;  1VZ7 A;  4ANW A;  2Z59 B;  1Y56 A;  4AUQ C;  3M62 B;  1XLO A;  2LGY A;  1I4G A;  3NY5 A;  1SBB B;  5E6O A;  3AED B;  2HD5 B;  3RMK C;  4ARC A;  4GSW A;  3LJ3 A;  4KZC A;  2I1J A;  4OHJ A;  4W9G A;  4RF1 A;  1DYQ A;  1L4Z B;  2M8S A;  3V60 A;  1ROE A;  3QQ8 B;  1WE7 A;  4ZYN A;  1UBQ A;  2KO3 A;  1SE9 A;  5BMG A;  1WRI A;  1E6E B;  2K22 A;  3HM3 A;  4XX5 A;  4NZL B;  1JQ4 A;  1WIA A;  3WCQ A;  4BKS D;  2O6V B;  2WXO A;  1WY8 A;  2C7M B;  4FHK A; 
#chains in the Genus database with same CATH homology
 1T0Q C;  3RNB C;  3RNF C;  2IND C;  4P1B C;  2RDB C;  3Q3N C;  3RNC C;  3GE8 C;  3RNG C;  3N1X C;  1T0S C;  3N1Z C;  3RMK C;  3I5J C;  3RNE C;  3DHH C;  2INC C;  3DHI C;  3N1Y C;  3Q3O C;  3Q14 C;  3Q2A C;  3DHG C;  4P1C C;  3RN9 C;  1T0R C;  3Q3M C;  3RNA C;  3RI7 C;  3N20 C;  3I63 C;  3GE3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...