3N1ZC

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase t201s mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Site Threonine Facilitates Proton Transfer during Dioxygen Activation at the Diiron Center of Toluene/o-Xylene Monooxygenase Hydroxylase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
molecule keywords Toluene o-xylene monooxygenase component
total genus 25
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3n1zC00
2INDC 3GE8C 1T0SC 3I5JC 3Q3NC 3RNBC 3RN9C 3RNAC 4P1BC 3Q3MC 3RMKC 3RNEC 4P1CC 1T0QC 1T0RC 2INCC 3RNGC 2RDBC 3I63C 3N1XC 3RNCC 3RI7C 3DHGC 3N20C 3GE3C 3DHIC 3N1ZC 3RNFC 3Q14C 3Q2AC 3Q3OC 3N1YC 3DHHC
chains in the Genus database with same CATH superfamily
2WX1A 4FHJA 2BT6A 1J19A 2GB1A 3TUOA 3BK1A 3TJPA 2WU2B 1I4PA 4RGNA 1I42A 1L4DB 1WGKA 1E10A 2BWFA 1FPYA 1U4AA 5D3DA 1IGCA 2FNJB 2JRIB 5H92C 4FHKA 3ZRFA 1G6JA 4BKGA 1CQVA 1AYFA 1KRHA 3AXCA 4NPNA 1VZ8A 2C60A 2ZCBA 1E8XA 3APDA 1FFUA 1UGJA 2HD5B 2JY6A 4XE0A 1LGRA 3PZDA 3LYYA 1TZ1A 2FIFA 3ZLZA 4WWOA 1OQYA 4REZA 1P9DU 3RZFA 1ACCA 1ZXIA 2ZNVB 2KYWA 3AEBB 4DHZE 1IBXA 1YJJA 3HK0A 3R3MA 3SDLC 4IDIA 2KLCA 1JQ4A 4ARIA 2LXCA 3IT4B 4LNKA 1QILA 3H7SA 2CHXA 1HA5A 3BK2A 3N30A 1ESFA 3Q3MC 5E6NA 2M1MA 4C80A 1WX7A 2M19A 3GB1A 5TSSA 1QKZA 1TKYA 5GXGB 2DZIA 2FCQA 1WJ4A 2KJRA 4I6LB 2UU7A 3X23A 2PMVA 2OJWA 2IY0B 3EFUA 2R2QA 4Q2JA 3NY5A 4BFRA 1WJNA 1V5TA 3SR6A 5BYQA 2DAFA 4HROA 3QK0A 2M56B 4N9F4 4MEMA 4W9JA 4YSZB 5IO9A 1PUTA 4FLHA 4FA6A 2WNMA 2M0AA 3BYTB 3OJ4B 4WJNA 1FRDA 2FE8A 3PPAA 4GDKA 2KN4A 5JHBA 2GBRA 1C76A 3KUZA 2MX2A 4N58A 2MRPA 5D3IB 4PT5A 2X38A 2NTTA 4ZYNA 3ETRA 4RGTA 1QOBA 2DZMA 4OVVA 2FCSA 1NI3A 3L0WB 1WH3A 2CU1A 4W9FA 1NI2A 3R7QA 2HDEA 1Q1OA 3ZJUA 3WAMA 1B1ZA 4BKSA 5J17A 2KWDA 2ZEQA 2KVRA 4TQ1A 3A1QB 2Q5WD 2QMTA 4D2KA 3IAM1 2KACA 1FNUA 1GOZA 1JALA 2WXPA 5D6JB 5BYSA 2REXA 1TY0A 4KKIA 3PHWB 3U52E 5DPRA 1ZGUB 3KYCD 2KX3A 1OQQA 1L6VA 1XO3A 3CMMB 1TKEA 2KDIA 2V3SA 4PS3A 1HXYD 1WGYA 1TS2A 5JHAA 4ZRJA 3VFKA 2LGDA 5LNK1 1M4VA 1XEEA 2DAJA 4FADA 1CZPA 2FCNA 1GB4A 4G0NB 2JPHA 1GAQB 4FJVB 4EE2A 4WURA 2K9XA 3Q3JA 1FXIA 4JQWC 3Q6BA 4ITKA 2G9HD 2BB6A 2MH7A 1L0YB 1F9JA 1K53A 3ZJTA 3W5VB 3A4RA 4KZ0A 2KD0A 2BYFA 1Z5SB 2AL6A 3V05A 2FUG1 2JWUA 3ZTCA 2G1EA 3MHZA 4ARCA 3TCAA 4GDKB 3B9JA 3VTUA 3RYTA 2WQYB 3UI3A 2N1WA 3R2TA 3B0AA 5BO4B 1YQ3B 1T0QC 1ZPSA 4MGZE 1V97A 4NJ7A 1TT5B 1VZ6A 2LEKA 1SF0A 2MQJA 5C1ZA 4AS1A 4K3CA 2WWZA 4I6NB 1L6UA 2HJ1A 3VHTC 1E0ZA 2K0PA 1I35A 2KJ6A 5JH5C 2J0MA 4DXAB 1ZOYB 3T9LA 3EECA 4C56C 2BS3B 4GOCA 3Q3FA 1WXQA 2K8CA 2A5UA 3AE1B 5AUIA 1TZOA 2LHDA 3NOBA 2RSUA 4ZRPA 2C5LC 3QWZB 4OHJA 2JRHA 1XF5L 4MGIE 3Q8AA 4NQLB 4DHJD 4OVUA 4HK2A 1V86A 3O65B 2V4LA 3CIRB 1YJ1A 2RDGA 2KHWB 2E3TA 3NRZA 1HQRD 2KDBA 1JMLA 2MEKA 1E9MA 4C7ZA 2DLBA 1NENB 3EGRA 5D7GA 3NVYA 1HZ6A 4G11A 1IUEA 1EF1A 2JX5A 2LMCA 1YN5A 4KSKC 1TY2A 4NJCA 4H2AA 4IWPA 2AQ1B 1RRBA 1MFWA 2MW5A 3UIPB 2KJHB 4RCOA 2IO3B 4S0RA 3N1XC 2G45B 2NVUI 2L00B 1Z2MA 5G2NA 4ICVA 1GUAB 3P4RB 1F2RI 3B2FA 1HEZE 4RFBA 4HKZE 1N63A 2INPE 2DENB 4L2YA 3UQAA 3QARA 3AM9A 4XGAB 2C7HA 2DZKA 2KTRB 3ZO5B 4P1CC 1LQBA 3DVNU 3VUXA 4KGTA 3ZDMC 4LNNA 3PHXB 3DHGC 4ZHPA 2MWSB 3C0RB 4GMVA 2NBWB 3K9PB 3TMPB 1I4QA 2W3RA 2Y5PA 5C3JB 2KN5A 2M8SA 5FK9C 2KMCA 5EDSA 1C3TA 4RGOS 2KZRA 1AN8A 1E8YA 3GZNB 4M00A 4M8NA 1EF5A 1MI0A 1XCTL 4EZLA 4BVUC 3N20C 1R7SA 2YVCA 2IYDB 2RD0A 2JYTA 4ICUA 4HCNB 3PS6A 4BOSC 4MSQB 1J0GA 1C77A 1LO5D 1I4XA 1OQRA 1TTNA 2JYEA 2MSED 1NBFC 3U2SC 1FO4A 3AEEB 1ZDVA 3PSEB 3DWMA 3SU8X 3URYA 3DCGA 2K8HA 3RT3B 3FILA 3WIMA 2QC8A 3W1SA 4IG7B 3M3JA 1ZKHA 1EM7A 2KANA 3WALA 2LGXA 3HRDD 1WFYA 3BINA 3RD2A 3DWGC 2AX5A 2LJ5A 3ZUNA 2IBIB 2BBCA 2L52A 3AE4B 2XN9C 3DPDA 3RI7C 4IM0A 2J0KA 2GBJA 2L7RA 2A4ZA 1FCLA 4FBJB 1XLOA 4A90A 3QHTA 3L13A 1WZ3A 1ZXHA 3H7PB 2NBUA 4JGHB 4BKSD 1PFDA 3NJTA 2QCZA 1XLNA 4E74A 3MJWA 2KTRA 2AEHA 5C2TB 1DYQA 2MBHA 1FFVA 2RPQA 4P6VF 3FKYA 2J42A 3NS1A 2C7NB 3CSTA 1Y56A 3RNBC 2WYQA 4KGSA 3APFA 2MA9B 2BYVE 3MC8A 4W9EA 1V1PA 2NPTB 4HLEA 1UD7A 2D11A 4GLSC 3SD5A 1C4PA 2PEAA 4TKNA 4LDTB 2LWPA 4XC2A 1ROEA 2SEBD 2ZPYA 3QCAA 2V3PA 3QIJA 3ZNID 2PVOD 2KMMA 3MC9A 2D5GA 2WXGA 2IGGA 2JXTA 2DYBA 5AEKB 2L76A 2W55A 1M94A 3SHQA 2INNE 2K8BA 3KUDB 2VH2A 5D2MB 3AMZA 2KX0A 1X1MA 1VD2A 2KC2A 2O6VD 3AEDB 2WXLA 1J7CA 1D6EC 2DYOA 2Z8LA 2I1KA 3AH7A 5CHFA 4XYCA 3DVNV 3RPFC 5CHVC 4J3OD 1WX8A 1K51A 1WMHA 2MLBA 2ZNVC 3R66C 3S2AA 4II3B 2IY1B 3V60A 4AWJA 1SB3C 3W5UB 1P7FA 3FAHA 3ABVB 1FNWA 1V6EA 4JX1C 4HPMB 2K25A 4W9DA 3MP9A 2LVOA 3V6CB 3IFWB 1RFAA 1FRRA 2QIEB 4NNJB 4FJZA 4M02A 2D2QA 3GZNI 3NVZA 1C79A 3MJ5A 4JWSC 3HUIA 1CMXB 2L8JA 1HTOA 3DHHC 4YWGG 3TEXA 1VRAB 4EZKA 1F0ZA 2BB5A 1WR1A 1WGGA 1RAXA 5HG2A 4F7ZA 1C9FA 4EUTA 1OFFA 4GGQA 1SE2A 3R2IA 2ON8A 3AV8A 1KOTA 1AARA 3N1YC 2KDFB 5IN7A 3L17A 1R4MI 2EMSA 1SIFA 2JQRB 2KK8A 5AUKA 1EWYC 2JSVX 3BVMA 4YSXB 4LJPB 4WWNA 1EUVB 3DBLI 4XWTA 3P63A 2N7EA 4A55A 2JF5A 2ONQA 5IAAC 1I4RA 2FUHB 3D32A 3J9CA 4MT5A 1FNVA 2JWZA 3DHIC 2JZPA 2JUOA 2KWUB 3KH0A 2VH1A 1E8WA 3ZDTA 4L23A 2LRWA 4WAAA 1WMHB 3ZKJC 5FR3A 2DZJA 4KV2A 1L5PA 3HIZA 1QOFA 1B9RA 4KVGB 4XZ4A 4XWWA 4C4VB 1K52A 2QSDA 3A33B 4MDKE 1F52A 3WANA 2QDFA 3I63C 3M63B 4NZLB 4GDLB 3BWUD 2N9XA 1HTQA 4E3CA 1XT9B 1OTRB 3N3KB 3IG3A 2CR5A 4W9KA 1EO6A 2N9PC 3DVGY 1UNSA 2ICIA 3AI5A 1TS4A 3JVZX 2MBOA 5J18A 3VXWA 2O2VA 5E6PA 4ZYSA 1FD6A 1E8ZA 4S17A 2EKEC 4DDID 2D3CA 2NMQA 4HVBA 4IUMB 4WJOA 2RMMA 4TUUA 3CF6E 1C1YB 3ZJVA 2OJRA 3SEBA 2CU3A 1MHHE 2GOWA 3AEAB 2AL3A 2Z0DB 4W9CA 4ANUA 2LGIA 3VTWA 1P3QU 5IA7A 4KIKA 2OHFA 3ALBA 2NS5A 1S1QB 1LXDA 2MHJA 2C7MB 4GB9A 1YN3A 1ZDXA 3NUHB 4GU2A 2O2VB 5EE9A 2G4SA 3H6NA 3AULA 2D3BA 2LVPA 1F1HA 2V4IB 4TMAB 1T0RC 3PLUA 2KNBA 1F2RC 2PPHA 3P4SB 3LB8C 1XLPA 4ANXA 1KM7A 4FULA 2L3ZA 2WDTB 4R3DA 1BT0A 1PGXA 1V81A 3C8YA 3Q8BA 2ZJDA 2JU6X 2J7QB 2L05A 4ASWC 2I1JA 1OEYA 1S3SG 3KUCB 2MJDA 2ZCCA 2CJNA 4A8XC 2KKCA 4M0WB 4B0EA 2B76B 2XNAC 2LGSA 3HM6X 2KWCA 2PE9A 4JIOU 3IHPC 1JRUA 4BBNC 3PRZA 2C9WB 4GIVA 3JW0X 3GE8C 4OVZA 2QJLA 2D3GA 3MC0B 3H8HA 3FILB 3NG0A 1SIJA 4AOFA 2KC1A 2LI5A 3RNCC 2BWES 2YEPF 4WJPA 1MJDA 1UELA 4OZBA 1VZ7A 1TS3A 4LCDE 4BAXA 3VUWA 2M4NA 3RULA 3TEWA 5EE0A 2J52A 3AE8B 1WE6A 3DBHB 3EA6A 1V8CA 3T3NA 1ZP0B 4DDGD 3GP7A 4YTNB 3KLSX 4IC7B 4M0WA 3H7PA 2LUEA 1WXSA 3VH3B 3NVVA 3UIOB 1D5MC 2KXJA 4G50A 1GB1A 4HPPA 3R8BA 1V2YA 1SBBB 3WA0A 5DPWA 4KIKB 2K1FA 1NYQA 5EE3A 3X0WA 4E71A 1ZE3D 4C7YA 1SJHD 4W9GA 4IWQA 3LXFA 3TEYA 1ET9A 1RLFA 3HVDA 2GBKA 3HM3A 2WXOA 4RMAA 4K7WA 2NR2A 1PGBA 1TKGA 1MPEA 3N1ZC 3AECB 4F8CB 1TIFA 2W82A 4PK1A 2NPTA 3PV1A 4B6WA 2SAKA 1NEKB 2KTFA 2ZVNA 4PS8A 4XDCA 1SE4A 2KOXA 1E90A 5HKHA 3I5JC 2LGYA 1CJEA 3RN9C 2V1YA 3RFZB 3VAWA 2DBYA 1YNTE 3TL5A 1C4CA 1FEHA 1FMAD 4IW0A 3QC8B 3ZGZA 2FIDA 3PZ8A 4CHKA 3NVWA 1UBQA 4YSYB 3DBLB 2BTEA 1BXTA 4BOZB 1GG3A 4NAWA 4HWIB 4TQ0A 2IO0B 1YX6B 4KX6B 1I4HA 4O1NA 2UYZB 2HTHA 3JSVB 2W3SA 1R4NB 4K1RB 4WIPA 1WYGA 1JRPA 1UGMA 3SFEB 3P1MA 2OOBB 3AE7B 1WM3A 2KQ7A 4A6QA 3ZXRA 4A3OA 5L83A 3VQIA 3VR9B 3V62A 3WCQA 3RUIB 1T0YA 2KMAA 3ONSA 4K3BA 4KKJA 4LNIA 2AYOB 4HDOA 2XK5B 4JPSA 4DBGA 1K50A 3BVGA 3EFCA 1BMLC 2EMTA 4EEWA 4RGMA 3JSVA 5BMIA 4ZRIA 3P42A 3BIID 1T3QA 1VDVA 3N9YC 2RR9A 2V9HA 4XX5A 2AQ2B 3RCZA 1D5ZC 2V3NA 3R7RA 3H1UA 1T0SC 5JXVA 4CQNA 4TV3A 5JZEB 1JWAD 2V0GA 4ZHOA 4MSMB 2ZW0A 1XD3B 1C78A 2WP9B 1WX9A 2JZZA 2G3QB 4FN2A 5D94A 3E56A 3ZQ4A 4AQ7A 2MP2B 1KFYB 4G3XB 5TR5A 2KQSA 3APCA 3P4QB 5E6OA 2LUMA 3IT6B 4P1BC 1GPXA 2AQ3B 2H89B 1F77A 2Z59B 1UF0A 4W9HA 2D07B 2RDHA 1N5WA 4A20A 1XQQA 2PW9A 4JE3B 2X8XX 1WGHA 2LHEA 1SEBD 2D3AA 1QQRA 3BZDB 3U4EG 2INDC 4II2B 4B9KA 2WXQA 1WM2A 1JWUD 5EE1A 3E9SA 4WJQA 1GC6A 2EELA 2JXXA 4RM9A 5GMVA 2LFIA 1JCKB 3ENEA 4PS7A 2WXJA 3EC8A 2K3UA 4GDLA 4EOYA 2GRIA 2WXMA 4L1BA 1LFDA 1YMHE 1WSPA 3AE6B 2JZ3B 2WXRA 4LTUA 2MJ3A 4MJSB 4QAYA 1WE7A 3W1YA 2FCMA 4TSSA 1D3ZA 2CJOA 3UF8A 3SFDB 1FCCC 1JWSD 1T5XD 4KGRA 2PKOA 2GI9A 3TSSA 3P4PB 2BW2A 1UWMA 3RMKC 5IOIA 2KT7A 4EFOA 1UUPA 3IBEA 3ZNHB 2PJHA 2B3AA 3BY4B 1SJED 2WU5B 3PLVA 1SGHA 2J4XA 4WQOB 2IO1B 1WRDB 1VJKA 5L95C 1XCQL 2IGHA 2VZKB 2M0XA 3W1SC 4ZDVA 3VRBB 3ML8A 4FJYA 4MJSA 1KF6B 3V61A 1E5WA 1QOGA 1AWDA 3ZRCA 4WH4A 3QA8A 1HE8A 4KSLC 1WY8A 3V3XA 2HJ8A 1AW7A 3PGEA 4WWMA 1IP9A 1UWXA 2RPVA 3ZW3A 3OG5A 3I3TB 1OGWA 1J8CA 2FAZA 1DGJA 1V80A 5CTRC 3AEGB 2QEJC 1N6ZA 2KLGA 4J6IA 4W9LA 4IWOA 1UBIA 2RGFA 3EHVA 3WAOA 4MGYE 4AUQC 5BYRA 1D5XC 2DWQA 1KLVA 2WHIA 1Q0WB 3ECIA 4AJYB 3T3OA 4US9A 1L2NA 3EUB2 3Q3NC 5DCNA 3CWIA 2DYMA 2LD9A 2QILA 4NY0A 5I4DA 4NJ6A 4ANWA 2LJIA 4MELA 4DXGA 1P7EA 4HRSA 3HVZA 3L08A 4FXCA 1N60A 2LASA 2GBNA 2XBBC 1E7VA 5C23A 2KFJA 2L32A 1MVKA 2CHWA 4HXDA 3TBLD 4BBNF 1J7BA 2O6VB 3W2DA 2INCC 2K5PA 2TSSA 4C4VA 2YLMA 4AP4C 4MACA 4RNAA 1QOAA 3AE2B 2L0TA 4KZCA 3Q2AC 3LJ3A 3GS2A 4N59A 2K22A 1PGAA 1SE9A 1SXTA 2BS2B 1V1OA 1I7HA 1XLQA 4ZOHC 3KVFB 3OAWA 2IZVB 5CHWA 1Y8RC 3MHSD 1TYGB 1HZ5A 4ACFA 3VTVA 4GXBA 2G4DB 3KWVA 1WWTA 4BKTA 4IKGA 3U8ZA 4DWFA 1QF6A 3AEFB 1KJTA 3L16A 3KWLA 4HDQA 4USAA 5AZGA 1STEA 1ISNA 1EU4A 2YEPB 4YTPB 2ASQA 1NVID 4JL9A 3ZYYX 1L0VB 1GC7A 5HI1A 2BQQA 2MJEA 1YX5B 4EKUA 2MCNB 2KFKA 1E6EB 1P98A 1H8CA 2WXIA 4HJGE 1T6BX 3DVGX 1DOXA 1E7PB 4LLGM 4MH0E 4NAWB 2KVZA 1N5XA 1YIWA 2J0JA 3PRPB 2LXAA 3KW5B 1UZXB 2N1VA 4GN1A 1YOVB 4LK0M 3AN1A 2N9EB 3U30A 1GNUA 3ZTDA 1L0XB 2GMIC 2N9KA 2E6XA 3NS8A 5FKAC 4ZRQA 3Q8EA 5BMGA 1DOYA 2BS4B 2WX0A 1KLGD 4OW0A 2KFKB 2WDRB 3GE3C 3ML9A 4I6PA 3ZIMA 2BYTA 2BPSA 2KDEB 3BVZA 3NHEB 1YN4A 4RF1A 2QHOA 3A1QA 3WAPA 1JROA 4IM3A 1ENFA 3DBHI 3RNAC 5LXHA 3AU4A 3RNEC 1KTKA 2ZZPB 3LDZE 3U7ZA 1E7UA 2MBEA 4RM8A 2PIAA 3Q3OC 3PT2B 2HE7A 1FXAA 1WRIA 4M8MA 4JWUC 3PRMB 2WDVB 3I57A 3Q8CA 3ZVVA 2WDQB 3B1LX 4RH6A 3VVWB 4YTMB 3RNGC 4W9IA 1TGZB 5J2RA 1ET6A 1FXTB 1R4MB 2ACZB 4M01A 1VLBA 2FBWB 3MFGA 4RF0A 5FR6A 1BUIC 2CKHB 1MG8A 2L1AA 2WXFA 2J53A 1NDDA 3PREA 1KLUD 3AE3B 5KHQA 1ZW7A 1PYWD 4XDDA 1RM6C 2WS3B 1IPGA 2WLBA 4YL8A 2N0SB 4DHJB 2HTME 1P1AA 4NQKE 2OEDA 2Y3AA 2JT4B 5T8IA 3T8MA 5BMHA 5HFYA 1J7AA 4IM2A 3L54A 1SSNA 4MM3A 1QLBB 3QX1A 3ZNGC 1TJEA 1JWMD 3V6EB 2LRUA 2MBBB 3A9JA 1JW9D 1OEYJ 4PYUA 3JYUA 3L4PA 2NBVB 1SE3A 3OLMD 4B0MA 1VR9A 2BYEA 2IPKD 1WXMA 3VRAB 3B08A 2I38A 1Q5WB 3B2GA 3QJZA 2WXHA 3FC4A 4HKQA 4P7IA 1CK1A 2GLSA 5KHOA 2VZKD 2R2OA 5AZFA 1N62A 2K39A 2WXNA 1WI0A 4X57B 4BZAA 2BF8B 2XEWA 3DBRI 4MM3B 2MBQA 3HHMA 3H9DA 4ZRKA 1IGDA 3DQVA 4MGKE 4IOIE 1K8RB 3IAS1 2N4FA 1RYJA 2W54A 1UH6A 4PYZA 5G5GA 1PDXA 2KO3A 2PLPA 4WWPA 1EWCA 1L7YA 4WAFA 3P2BA 2XK5A 3DBRB 4K81A 4A3PA 4K7UA 2DNFA 2L83A 2WGSA 5MPOA 2GBMA 3NZUA 1P0RA 4WQMA 1MG4A 5DPSA 4UDUC 4DXFA 3A4SC 1WJ6A 4LDTD 3DOWA 1YQ4B 1LM8B 3MTNB 3QAQA 3UQBA 3PVLA 1A5RA 3L10B 2BGFA 1FM0D 3IXSA 3TEZA 1XXGA 4A9AA 1KH0A 3C19A 3M62B 1R4NI 3Q14C 1C4AA 2BVCA 4LJOB 2CS4A 3RZWC 4DQOC 3UGBB 2R61A 4JLCA 4YT0B 5G5HA 1FIQA 2MP2A 2I2YA 2UWQA 4OZAA 1RWSA 2DX5B 3A9JB 2LVQA 2Y5BB 1WYWB 1H4RA 2AWTA 2IDYA 5CX3A 3RNFC 2BKFA 2JVCA 4C00A 4CYEA 4HEA1 1L4ZB 2NTSA 3CSFA 2ZPNA 1WF9A 4DHZB 3I9V1 3AB5A 2K6DB 3VR8B 2O6VA 5IKCM 5HHDG 1WGDA 3Q8FA 3PO0A 2KAJA 1IYFA 1V5OA 5DPTA 3IVFA 3OJ3A 3NZ3A 2Z0EB 1A70A 1WR6E 2N7JA 4P16A 2KQ4X 2VRRB 3TIXA 2EKIA 3Q69A 1YD8U 3VDZA 4YXDB 1TBEA 3M95A 5G55A 1TS5A 3ZXVA 2RDBC 4OZCA 2H88B 4US8A 3UINB 3O13A 1GJZA 1N61A 4URKA 3VH4B 4MH8A 3KYDD 1YQBA 1Q10A 4LNOA 2PVGC 2ZVOA 1WXAA 3ZNZB 3DBSA 1WXVA 1WGRA 4DK5A 3QQ8B 4F1SA 4ANVA 1JWBD 4LNFA 4NAMA 2BKRB 3K9OB 3U7DA 4CO7A 1RFKA 5AZHA 1QT9A 1V1PB 1V9JA 3W9CB 1PQSA 1IBXB 2IO2B 3GOEA 1D4BA 4HCPB 1ZUD2 2PE6B 3A9KA 1MHXA 2KWVB 3N32A 2Y5CA 4AJWA 3BYYB 2M17A 1V49A 2W9NA 5LXIB 1EU3A 2N9LA 1NYRA 3VUYA 5H8YE 2WXKA 2LZ6A 1WJUA 2D10A 3PTFC 4EZJA 4B95A 1WZ0A 2L0FA 4GSWA 2IJ0A 4HPLB 2N7DA 1I4GA 3DDCB 2KDMA 3AE5B 4K7SA 3OWEB 3AU5A 5LLIA 4KDLB 3AE9B 4KDIC 1WIAA 5IP4D 2DHZA 5E6JA 2CHZA 2NCNA 4HJKA 1VCBA 3A9KB 4N6EB 3PZ7A 2PTLA 3KQ4A 1YJIA 2K6QA 2IGDA 2ZW1A 1DOIA 1QZEA 3NZSA
chains in the Genus database with same CATH topology
2INDC 3GE8C 1T0SC 3I5JC 3Q3NC 3RNBC 3RN9C 3RNAC 4P1BC 3Q3MC 3RMKC 3RNEC 4P1CC 1T0QC 1T0RC 2INCC 3RNGC 2RDBC 3I63C 3N1XC 3RNCC 3RI7C 3DHGC 3N20C 3GE3C 3DHIC 3N1ZC 3RNFC 3Q14C 3Q2AC 3Q3OC 3N1YC 3DHHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IND C;  3GE8 C;  1T0S C;  3I5J C;  3Q3N C;  3RNB C;  3RN9 C;  3RNA C;  4P1B C;  3Q3M C;  3RMK C;  3RNE C;  4P1C C;  1T0Q C;  1T0R C;  2INC C;  3RNG C;  2RDB C;  3I63 C;  3N1X C;  3RNC C;  3RI7 C;  3DHG C;  3N20 C;  3GE3 C;  3DHI C;  3N1Z C;  3RNF C;  3Q14 C;  3Q2A C;  3Q3O C;  3N1Y C;  3DHH C; 
#chains in the Genus database with same CATH topology
 2WX1 A;  4FHJ A;  2BT6 A;  1J19 A;  2GB1 A;  3TUO A;  3BK1 A;  3TJP A;  2WU2 B;  1I4P A;  4RGN A;  1I42 A;  1L4D B;  1WGK A;  1E10 A;  2BWF A;  1FPY A;  1U4A A;  5D3D A;  1IGC A;  2FNJ B;  2JRI B;  5H92 C;  4FHK A;  3ZRF A;  1G6J A;  4BKG A;  1CQV A;  1AYF A;  1KRH A;  3AXC A;  4NPN A;  1VZ8 A;  2C60 A;  2ZCB A;  1E8X A;  3APD A;  1FFU A;  1UGJ A;  2HD5 B;  2JY6 A;  4XE0 A;  1LGR A;  3PZD A;  3LYY A;  1TZ1 A;  2FIF A;  3ZLZ A;  4WWO A;  1OQY A;  4REZ A;  1P9D U;  3RZF A;  1ACC A;  1ZXI A;  2ZNV B;  2KYW A;  3AEB B;  4DHZ E;  1IBX A;  1YJJ A;  3HK0 A;  3R3M A;  3SDL C;  4IDI A;  2KLC A;  1JQ4 A;  4ARI A;  2LXC A;  3IT4 B;  4LNK A;  1QIL A;  3H7S A;  2CHX A;  1HA5 A;  3BK2 A;  3N30 A;  1ESF A;  3Q3M C;  5E6N A;  2M1M A;  4C80 A;  1WX7 A;  2M19 A;  3GB1 A;  5TSS A;  1QKZ A;  1TKY A;  5GXG B;  2DZI A;  2FCQ A;  1WJ4 A;  2KJR A;  4I6L B;  2UU7 A;  3X23 A;  2PMV A;  2OJW A;  2IY0 B;  3EFU A;  2R2Q A;  4Q2J A;  3NY5 A;  4BFR A;  1WJN A;  1V5T A;  3SR6 A;  5BYQ A;  2DAF A;  4HRO A;  3QK0 A;  2M56 B;  4N9F 4;  4MEM A;  4W9J A;  4YSZ B;  5IO9 A;  1PUT A;  4FLH A;  4FA6 A;  2WNM A;  2M0A A;  3BYT B;  3OJ4 B;  4WJN A;  1FRD A;  2FE8 A;  3PPA A;  4GDK A;  2KN4 A;  5JHB A;  2GBR A;  1C76 A;  3KUZ A;  2MX2 A;  4N58 A;  2MRP A;  5D3I B;  4PT5 A;  2X38 A;  2NTT A;  4ZYN A;  3ETR A;  4RGT A;  1QOB A;  2DZM A;  4OVV A;  2FCS A;  1NI3 A;  3L0W B;  1WH3 A;  2CU1 A;  4W9F A;  1NI2 A;  3R7Q A;  2HDE A;  1Q1O A;  3ZJU A;  3WAM A;  1B1Z A;  4BKS A;  5J17 A;  2KWD A;  2ZEQ A;  2KVR A;  4TQ1 A;  3A1Q B;  2Q5W D;  2QMT A;  4D2K A;  3IAM 1;  2KAC A;  1FNU A;  1GOZ A;  1JAL A;  2WXP A;  5D6J B;  5BYS A;  2REX A;  1TY0 A;  4KKI A;  3PHW B;  3U52 E;  5DPR A;  1ZGU B;  3KYC D;  2KX3 A;  1OQQ A;  1L6V A;  1XO3 A;  3CMM B;  1TKE A;  2KDI A;  2V3S A;  4PS3 A;  1HXY D;  1WGY A;  1TS2 A;  5JHA A;  4ZRJ A;  3VFK A;  2LGD A;  5LNK 1;  1M4V A;  1XEE A;  2DAJ A;  4FAD A;  1CZP A;  2FCN A;  1GB4 A;  4G0N B;  2JPH A;  1GAQ B;  4FJV B;  4EE2 A;  4WUR A;  2K9X A;  3Q3J A;  1FXI A;  4JQW C;  3Q6B A;  4ITK A;  2G9H D;  2BB6 A;  2MH7 A;  1L0Y B;  1F9J A;  1K53 A;  3ZJT A;  3W5V B;  3A4R A;  4KZ0 A;  2KD0 A;  2BYF A;  1Z5S B;  2AL6 A;  3V05 A;  2FUG 1;  2JWU A;  3ZTC A;  2G1E A;  3MHZ A;  4ARC A;  3TCA A;  4GDK B;  3B9J A;  3VTU A;  3RYT A;  2WQY B;  3UI3 A;  2N1W A;  3R2T A;  3B0A A;  5BO4 B;  1YQ3 B;  1T0Q C;  1ZPS A;  4MGZ E;  1V97 A;  4NJ7 A;  1TT5 B;  1VZ6 A;  2LEK A;  1SF0 A;  2MQJ A;  5C1Z A;  4AS1 A;  4K3C A;  2WWZ A;  4I6N B;  1L6U A;  2HJ1 A;  3VHT C;  1E0Z A;  2K0P A;  1I35 A;  2KJ6 A;  5JH5 C;  2J0M A;  4DXA B;  1ZOY B;  3T9L A;  3EEC A;  4C56 C;  2BS3 B;  4GOC A;  3Q3F A;  1WXQ A;  2K8C A;  2A5U A;  3AE1 B;  5AUI A;  1TZO A;  2LHD A;  3NOB A;  2RSU A;  4ZRP A;  2C5L C;  3QWZ B;  4OHJ A;  2JRH A;  1XF5 L;  4MGI E;  3Q8A A;  4NQL B;  4DHJ D;  4OVU A;  4HK2 A;  1V86 A;  3O65 B;  2V4L A;  3CIR B;  1YJ1 A;  2RDG A;  2KHW B;  2E3T A;  3NRZ A;  1HQR D;  2KDB A;  1JML A;  2MEK A;  1E9M A;  4C7Z A;  2DLB A;  1NEN B;  3EGR A;  5D7G A;  3NVY A;  1HZ6 A;  4G11 A;  1IUE A;  1EF1 A;  2JX5 A;  2LMC A;  1YN5 A;  4KSK C;  1TY2 A;  4NJC A;  4H2A A;  4IWP A;  2AQ1 B;  1RRB A;  1MFW A;  2MW5 A;  3UIP B;  2KJH B;  4RCO A;  2IO3 B;  4S0R A;  3N1X C;  2G45 B;  2NVU I;  2L00 B;  1Z2M A;  5G2N A;  4ICV A;  1GUA B;  3P4R B;  1F2R I;  3B2F A;  1HEZ E;  4RFB A;  4HKZ E;  1N63 A;  2INP E;  2DEN B;  4L2Y A;  3UQA A;  3QAR A;  3AM9 A;  4XGA B;  2C7H A;  2DZK A;  2KTR B;  3ZO5 B;  4P1C C;  1LQB A;  3DVN U;  3VUX A;  4KGT A;  3ZDM C;  4LNN A;  3PHX B;  3DHG C;  4ZHP A;  2MWS B;  3C0R B;  4GMV A;  2NBW B;  3K9P B;  3TMP B;  1I4Q A;  2W3R A;  2Y5P A;  5C3J B;  2KN5 A;  2M8S A;  5FK9 C;  2KMC A;  5EDS A;  1C3T A;  4RGO S;  2KZR A;  1AN8 A;  1E8Y A;  3GZN B;  4M00 A;  4M8N A;  1EF5 A;  1MI0 A;  1XCT L;  4EZL A;  4BVU C;  3N20 C;  1R7S A;  2YVC A;  2IYD B;  2RD0 A;  2JYT A;  4ICU A;  4HCN B;  3PS6 A;  4BOS C;  4MSQ B;  1J0G A;  1C77 A;  1LO5 D;  1I4X A;  1OQR A;  1TTN A;  2JYE A;  2MSE D;  1NBF C;  3U2S C;  1FO4 A;  3AEE B;  1ZDV A;  3PSE B;  3DWM A;  3SU8 X;  3URY A;  3DCG A;  2K8H A;  3RT3 B;  3FIL A;  3WIM A;  2QC8 A;  3W1S A;  4IG7 B;  3M3J A;  1ZKH A;  1EM7 A;  2KAN A;  3WAL A;  2LGX A;  3HRD D;  1WFY A;  3BIN A;  3RD2 A;  3DWG C;  2AX5 A;  2LJ5 A;  3ZUN A;  2IBI B;  2BBC A;  2L52 A;  3AE4 B;  2XN9 C;  3DPD A;  3RI7 C;  4IM0 A;  2J0K A;  2GBJ A;  2L7R A;  2A4Z A;  1FCL A;  4FBJ B;  1XLO A;  4A90 A;  3QHT A;  3L13 A;  1WZ3 A;  1ZXH A;  3H7P B;  2NBU A;  4JGH B;  4BKS D;  1PFD A;  3NJT A;  2QCZ A;  1XLN A;  4E74 A;  3MJW A;  2KTR A;  2AEH A;  5C2T B;  1DYQ A;  2MBH A;  1FFV A;  2RPQ A;  4P6V F;  3FKY A;  2J42 A;  3NS1 A;  2C7N B;  3CST A;  1Y56 A;  3RNB C;  2WYQ A;  4KGS A;  3APF A;  2MA9 B;  2BYV E;  3MC8 A;  4W9E A;  1V1P A;  2NPT B;  4HLE A;  1UD7 A;  2D11 A;  4GLS C;  3SD5 A;  1C4P A;  2PEA A;  4TKN A;  4LDT B;  2LWP A;  4XC2 A;  1ROE A;  2SEB D;  2ZPY A;  3QCA A;  2V3P A;  3QIJ A;  3ZNI D;  2PVO D;  2KMM A;  3MC9 A;  2D5G A;  2WXG A;  2IGG A;  2JXT A;  2DYB A;  5AEK B;  2L76 A;  2W55 A;  1M94 A;  3SHQ A;  2INN E;  2K8B A;  3KUD B;  2VH2 A;  5D2M B;  3AMZ A;  2KX0 A;  1X1M A;  1VD2 A;  2KC2 A;  2O6V D;  3AED B;  2WXL A;  1J7C A;  1D6E C;  2DYO A;  2Z8L A;  2I1K A;  3AH7 A;  5CHF A;  4XYC A;  3DVN V;  3RPF C;  5CHV C;  4J3O D;  1WX8 A;  1K51 A;  1WMH A;  2MLB A;  2ZNV C;  3R66 C;  3S2A A;  4II3 B;  2IY1 B;  3V60 A;  4AWJ A;  1SB3 C;  3W5U B;  1P7F A;  3FAH A;  3ABV B;  1FNW A;  1V6E A;  4JX1 C;  4HPM B;  2K25 A;  4W9D A;  3MP9 A;  2LVO A;  3V6C B;  3IFW B;  1RFA A;  1FRR A;  2QIE B;  4NNJ B;  4FJZ A;  4M02 A;  2D2Q A;  3GZN I;  3NVZ A;  1C79 A;  3MJ5 A;  4JWS C;  3HUI A;  1CMX B;  2L8J A;  1HTO A;  3DHH C;  4YWG G;  3TEX A;  1VRA B;  4EZK A;  1F0Z A;  2BB5 A;  1WR1 A;  1WGG A;  1RAX A;  5HG2 A;  4F7Z A;  1C9F A;  4EUT A;  1OFF A;  4GGQ A;  1SE2 A;  3R2I A;  2ON8 A;  3AV8 A;  1KOT A;  1AAR A;  3N1Y C;  2KDF B;  5IN7 A;  3L17 A;  1R4M I;  2EMS A;  1SIF A;  2JQR B;  2KK8 A;  5AUK A;  1EWY C;  2JSV X;  3BVM A;  4YSX B;  4LJP B;  4WWN A;  1EUV B;  3DBL I;  4XWT A;  3P63 A;  2N7E A;  4A55 A;  2JF5 A;  2ONQ A;  5IAA C;  1I4R A;  2FUH B;  3D32 A;  3J9C A;  4MT5 A;  1FNV A;  2JWZ A;  3DHI C;  2JZP A;  2JUO A;  2KWU B;  3KH0 A;  2VH1 A;  1E8W A;  3ZDT A;  4L23 A;  2LRW A;  4WAA A;  1WMH B;  3ZKJ C;  5FR3 A;  2DZJ A;  4KV2 A;  1L5P A;  3HIZ A;  1QOF A;  1B9R A;  4KVG B;  4XZ4 A;  4XWW A;  4C4V B;  1K52 A;  2QSD A;  3A33 B;  4MDK E;  1F52 A;  3WAN A;  2QDF A;  3I63 C;  3M63 B;  4NZL B;  4GDL B;  3BWU D;  2N9X A;  1HTQ A;  4E3C A;  1XT9 B;  1OTR B;  3N3K B;  3IG3 A;  2CR5 A;  4W9K A;  1EO6 A;  2N9P C;  3DVG Y;  1UNS A;  2ICI A;  3AI5 A;  1TS4 A;  3JVZ X;  2MBO A;  5J18 A;  3VXW A;  2O2V A;  5E6P A;  4ZYS A;  1FD6 A;  1E8Z A;  4S17 A;  2EKE C;  4DDI D;  2D3C A;  2NMQ A;  4HVB A;  4IUM B;  4WJO A;  2RMM A;  4TUU A;  3CF6 E;  1C1Y B;  3ZJV A;  2OJR A;  3SEB A;  2CU3 A;  1MHH E;  2GOW A;  3AEA B;  2AL3 A;  2Z0D B;  4W9C A;  4ANU A;  2LGI A;  3VTW A;  1P3Q U;  5IA7 A;  4KIK A;  2OHF A;  3ALB A;  2NS5 A;  1S1Q B;  1LXD A;  2MHJ A;  2C7M B;  4GB9 A;  1YN3 A;  1ZDX A;  3NUH B;  4GU2 A;  2O2V B;  5EE9 A;  2G4S A;  3H6N A;  3AUL A;  2D3B A;  2LVP A;  1F1H A;  2V4I B;  4TMA B;  1T0R C;  3PLU A;  2KNB A;  1F2R C;  2PPH A;  3P4S B;  3LB8 C;  1XLP A;  4ANX A;  1KM7 A;  4FUL A;  2L3Z A;  2WDT B;  4R3D A;  1BT0 A;  1PGX A;  1V81 A;  3C8Y A;  3Q8B A;  2ZJD A;  2JU6 X;  2J7Q B;  2L05 A;  4ASW C;  2I1J A;  1OEY A;  1S3S G;  3KUC B;  2MJD A;  2ZCC A;  2CJN A;  4A8X C;  2KKC A;  4M0W B;  4B0E A;  2B76 B;  2XNA C;  2LGS A;  3HM6 X;  2KWC A;  2PE9 A;  4JIO U;  3IHP C;  1JRU A;  4BBN C;  3PRZ A;  2C9W B;  4GIV A;  3JW0 X;  3GE8 C;  4OVZ A;  2QJL A;  2D3G A;  3MC0 B;  3H8H A;  3FIL B;  3NG0 A;  1SIJ A;  4AOF A;  2KC1 A;  2LI5 A;  3RNC C;  2BWE S;  2YEP F;  4WJP A;  1MJD A;  1UEL A;  4OZB A;  1VZ7 A;  1TS3 A;  4LCD E;  4BAX A;  3VUW A;  2M4N A;  3RUL A;  3TEW A;  5EE0 A;  2J52 A;  3AE8 B;  1WE6 A;  3DBH B;  3EA6 A;  1V8C A;  3T3N A;  1ZP0 B;  4DDG D;  3GP7 A;  4YTN B;  3KLS X;  4IC7 B;  4M0W A;  3H7P A;  2LUE A;  1WXS A;  3VH3 B;  3NVV A;  3UIO B;  1D5M C;  2KXJ A;  4G50 A;  1GB1 A;  4HPP A;  3R8B A;  1V2Y A;  1SBB B;  3WA0 A;  5DPW A;  4KIK B;  2K1F A;  1NYQ A;  5EE3 A;  3X0W A;  4E71 A;  1ZE3 D;  4C7Y A;  1SJH D;  4W9G A;  4IWQ A;  3LXF A;  3TEY A;  1ET9 A;  1RLF A;  3HVD A;  2GBK A;  3HM3 A;  2WXO A;  4RMA A;  4K7W A;  2NR2 A;  1PGB A;  1TKG A;  1MPE A;  3N1Z C;  3AEC B;  4F8C B;  1TIF A;  2W82 A;  4PK1 A;  2NPT A;  3PV1 A;  4B6W A;  2SAK A;  1NEK B;  2KTF A;  2ZVN A;  4PS8 A;  4XDC A;  1SE4 A;  2KOX A;  1E90 A;  5HKH A;  3I5J C;  2LGY A;  1CJE A;  3RN9 C;  2V1Y A;  3RFZ B;  3VAW A;  2DBY A;  1YNT E;  3TL5 A;  1C4C A;  1FEH A;  1FMA D;  4IW0 A;  3QC8 B;  3ZGZ A;  2FID A;  3PZ8 A;  4CHK A;  3NVW A;  1UBQ A;  4YSY B;  3DBL B;  2BTE A;  1BXT A;  4BOZ B;  1GG3 A;  4NAW A;  4HWI B;  4TQ0 A;  2IO0 B;  1YX6 B;  4KX6 B;  1I4H A;  4O1N A;  2UYZ B;  2HTH A;  3JSV B;  2W3S A;  1R4N B;  4K1R B;  4WIP A;  1WYG A;  1JRP A;  1UGM A;  3SFE B;  3P1M A;  2OOB B;  3AE7 B;  1WM3 A;  2KQ7 A;  4A6Q A;  3ZXR A;  4A3O A;  5L83 A;  3VQI A;  3VR9 B;  3V62 A;  3WCQ A;  3RUI B;  1T0Y A;  2KMA A;  3ONS A;  4K3B A;  4KKJ A;  4LNI A;  2AYO B;  4HDO A;  2XK5 B;  4JPS A;  4DBG A;  1K50 A;  3BVG A;  3EFC A;  1BML C;  2EMT A;  4EEW A;  4RGM A;  3JSV A;  5BMI A;  4ZRI A;  3P42 A;  3BII D;  1T3Q A;  1VDV A;  3N9Y C;  2RR9 A;  2V9H A;  4XX5 A;  2AQ2 B;  3RCZ A;  1D5Z C;  2V3N A;  3R7R A;  3H1U A;  1T0S C;  5JXV A;  4CQN A;  4TV3 A;  5JZE B;  1JWA D;  2V0G A;  4ZHO A;  4MSM B;  2ZW0 A;  1XD3 B;  1C78 A;  2WP9 B;  1WX9 A;  2JZZ A;  2G3Q B;  4FN2 A;  5D94 A;  3E56 A;  3ZQ4 A;  4AQ7 A;  2MP2 B;  1KFY B;  4G3X B;  5TR5 A;  2KQS A;  3APC A;  3P4Q B;  5E6O A;  2LUM A;  3IT6 B;  4P1B C;  1GPX A;  2AQ3 B;  2H89 B;  1F77 A;  2Z59 B;  1UF0 A;  4W9H A;  2D07 B;  2RDH A;  1N5W A;  4A20 A;  1XQQ A;  2PW9 A;  4JE3 B;  2X8X X;  1WGH A;  2LHE A;  1SEB D;  2D3A A;  1QQR A;  3BZD B;  3U4E G;  2IND C;  4II2 B;  4B9K A;  2WXQ A;  1WM2 A;  1JWU D;  5EE1 A;  3E9S A;  4WJQ A;  1GC6 A;  2EEL A;  2JXX A;  4RM9 A;  5GMV A;  2LFI A;  1JCK B;  3ENE A;  4PS7 A;  2WXJ A;  3EC8 A;  2K3U A;  4GDL A;  4EOY A;  2GRI A;  2WXM A;  4L1B A;  1LFD A;  1YMH E;  1WSP A;  3AE6 B;  2JZ3 B;  2WXR A;  4LTU A;  2MJ3 A;  4MJS B;  4QAY A;  1WE7 A;  3W1Y A;  2FCM A;  4TSS A;  1D3Z A;  2CJO A;  3UF8 A;  3SFD B;  1FCC C;  1JWS D;  1T5X D;  4KGR A;  2PKO A;  2GI9 A;  3TSS A;  3P4P B;  2BW2 A;  1UWM A;  3RMK C;  5IOI A;  2KT7 A;  4EFO A;  1UUP A;  3IBE A;  3ZNH B;  2PJH A;  2B3A A;  3BY4 B;  1SJE D;  2WU5 B;  3PLV A;  1SGH A;  2J4X A;  4WQO B;  2IO1 B;  1WRD B;  1VJK A;  5L95 C;  1XCQ L;  2IGH A;  2VZK B;  2M0X A;  3W1S C;  4ZDV A;  3VRB B;  3ML8 A;  4FJY A;  4MJS A;  1KF6 B;  3V61 A;  1E5W A;  1QOG A;  1AWD A;  3ZRC A;  4WH4 A;  3QA8 A;  1HE8 A;  4KSL C;  1WY8 A;  3V3X A;  2HJ8 A;  1AW7 A;  3PGE A;  4WWM A;  1IP9 A;  1UWX A;  2RPV A;  3ZW3 A;  3OG5 A;  3I3T B;  1OGW A;  1J8C A;  2FAZ A;  1DGJ A;  1V80 A;  5CTR C;  3AEG B;  2QEJ C;  1N6Z A;  2KLG A;  4J6I A;  4W9L A;  4IWO A;  1UBI A;  2RGF A;  3EHV A;  3WAO A;  4MGY E;  4AUQ C;  5BYR A;  1D5X C;  2DWQ A;  1KLV A;  2WHI A;  1Q0W B;  3ECI A;  4AJY B;  3T3O A;  4US9 A;  1L2N A;  3EUB 2;  3Q3N C;  5DCN A;  3CWI A;  2DYM A;  2LD9 A;  2QIL A;  4NY0 A;  5I4D A;  4NJ6 A;  4ANW A;  2LJI A;  4MEL A;  4DXG A;  1P7E A;  4HRS A;  3HVZ A;  3L08 A;  4FXC A;  1N60 A;  2LAS A;  2GBN A;  2XBB C;  1E7V A;  5C23 A;  2KFJ A;  2L32 A;  1MVK A;  2CHW A;  4HXD A;  3TBL D;  4BBN F;  1J7B A;  2O6V B;  3W2D A;  2INC C;  2K5P A;  2TSS A;  4C4V A;  2YLM A;  4AP4 C;  4MAC A;  4RNA A;  1QOA A;  3AE2 B;  2L0T A;  4KZC A;  3Q2A C;  3LJ3 A;  3GS2 A;  4N59 A;  2K22 A;  1PGA A;  1SE9 A;  1SXT A;  2BS2 B;  1V1O A;  1I7H A;  1XLQ A;  4ZOH C;  3KVF B;  3OAW A;  2IZV B;  5CHW A;  1Y8R C;  3MHS D;  1TYG B;  1HZ5 A;  4ACF A;  3VTV A;  4GXB A;  2G4D B;  3KWV A;  1WWT A;  4BKT A;  4IKG A;  3U8Z A;  4DWF A;  1QF6 A;  3AEF B;  1KJT A;  3L16 A;  3KWL A;  4HDQ A;  4USA A;  5AZG A;  1STE A;  1ISN A;  1EU4 A;  2YEP B;  4YTP B;  2ASQ A;  1NVI D;  4JL9 A;  3ZYY X;  1L0V B;  1GC7 A;  5HI1 A;  2BQQ A;  2MJE A;  1YX5 B;  4EKU A;  2MCN B;  2KFK A;  1E6E B;  1P98 A;  1H8C A;  2WXI A;  4HJG E;  1T6B X;  3DVG X;  1DOX A;  1E7P B;  4LLG M;  4MH0 E;  4NAW B;  2KVZ A;  1N5X A;  1YIW A;  2J0J A;  3PRP B;  2LXA A;  3KW5 B;  1UZX B;  2N1V A;  4GN1 A;  1YOV B;  4LK0 M;  3AN1 A;  2N9E B;  3U30 A;  1GNU A;  3ZTD A;  1L0X B;  2GMI C;  2N9K A;  2E6X A;  3NS8 A;  5FKA C;  4ZRQ A;  3Q8E A;  5BMG A;  1DOY A;  2BS4 B;  2WX0 A;  1KLG D;  4OW0 A;  2KFK B;  2WDR B;  3GE3 C;  3ML9 A;  4I6P A;  3ZIM A;  2BYT A;  2BPS A;  2KDE B;  3BVZ A;  3NHE B;  1YN4 A;  4RF1 A;  2QHO A;  3A1Q A;  3WAP A;  1JRO A;  4IM3 A;  1ENF A;  3DBH I;  3RNA C;  5LXH A;  3AU4 A;  3RNE C;  1KTK A;  2ZZP B;  3LDZ E;  3U7Z A;  1E7U A;  2MBE A;  4RM8 A;  2PIA A;  3Q3O C;  3PT2 B;  2HE7 A;  1FXA A;  1WRI A;  4M8M A;  4JWU C;  3PRM B;  2WDV B;  3I57 A;  3Q8C A;  3ZVV A;  2WDQ B;  3B1L X;  4RH6 A;  3VVW B;  4YTM B;  3RNG C;  4W9I A;  1TGZ B;  5J2R A;  1ET6 A;  1FXT B;  1R4M B;  2ACZ B;  4M01 A;  1VLB A;  2FBW B;  3MFG A;  4RF0 A;  5FR6 A;  1BUI C;  2CKH B;  1MG8 A;  2L1A A;  2WXF A;  2J53 A;  1NDD A;  3PRE A;  1KLU D;  3AE3 B;  5KHQ A;  1ZW7 A;  1PYW D;  4XDD A;  1RM6 C;  2WS3 B;  1IPG A;  2WLB A;  4YL8 A;  2N0S B;  4DHJ B;  2HTM E;  1P1A A;  4NQK E;  2OED A;  2Y3A A;  2JT4 B;  5T8I A;  3T8M A;  5BMH A;  5HFY A;  1J7A A;  4IM2 A;  3L54 A;  1SSN A;  4MM3 A;  1QLB B;  3QX1 A;  3ZNG C;  1TJE A;  1JWM D;  3V6E B;  2LRU A;  2MBB B;  3A9J A;  1JW9 D;  1OEY J;  4PYU A;  3JYU A;  3L4P A;  2NBV B;  1SE3 A;  3OLM D;  4B0M A;  1VR9 A;  2BYE A;  2IPK D;  1WXM A;  3VRA B;  3B08 A;  2I38 A;  1Q5W B;  3B2G A;  3QJZ A;  2WXH A;  3FC4 A;  4HKQ A;  4P7I A;  1CK1 A;  2GLS A;  5KHO A;  2VZK D;  2R2O A;  5AZF A;  1N62 A;  2K39 A;  2WXN A;  1WI0 A;  4X57 B;  4BZA A;  2BF8 B;  2XEW A;  3DBR I;  4MM3 B;  2MBQ A;  3HHM A;  3H9D A;  4ZRK A;  1IGD A;  3DQV A;  4MGK E;  4IOI E;  1K8R B;  3IAS 1;  2N4F A;  1RYJ A;  2W54 A;  1UH6 A;  4PYZ A;  5G5G A;  1PDX A;  2KO3 A;  2PLP A;  4WWP A;  1EWC A;  1L7Y A;  4WAF A;  3P2B A;  2XK5 A;  3DBR B;  4K81 A;  4A3P A;  4K7U A;  2DNF A;  2L83 A;  2WGS A;  5MPO A;  2GBM A;  3NZU A;  1P0R A;  4WQM A;  1MG4 A;  5DPS A;  4UDU C;  4DXF A;  3A4S C;  1WJ6 A;  4LDT D;  3DOW A;  1YQ4 B;  1LM8 B;  3MTN B;  3QAQ A;  3UQB A;  3PVL A;  1A5R A;  3L10 B;  2BGF A;  1FM0 D;  3IXS A;  3TEZ A;  1XXG A;  4A9A A;  1KH0 A;  3C19 A;  3M62 B;  1R4N I;  3Q14 C;  1C4A A;  2BVC A;  4LJO B;  2CS4 A;  3RZW C;  4DQO C;  3UGB B;  2R61 A;  4JLC A;  4YT0 B;  5G5H A;  1FIQ A;  2MP2 A;  2I2Y A;  2UWQ A;  4OZA A;  1RWS A;  2DX5 B;  3A9J B;  2LVQ A;  2Y5B B;  1WYW B;  1H4R A;  2AWT A;  2IDY A;  5CX3 A;  3RNF C;  2BKF A;  2JVC A;  4C00 A;  4CYE A;  4HEA 1;  1L4Z B;  2NTS A;  3CSF A;  2ZPN A;  1WF9 A;  4DHZ B;  3I9V 1;  3AB5 A;  2K6D B;  3VR8 B;  2O6V A;  5IKC M;  5HHD G;  1WGD A;  3Q8F A;  3PO0 A;  2KAJ A;  1IYF A;  1V5O A;  5DPT A;  3IVF A;  3OJ3 A;  3NZ3 A;  2Z0E B;  1A70 A;  1WR6 E;  2N7J A;  4P16 A;  2KQ4 X;  2VRR B;  3TIX A;  2EKI A;  3Q69 A;  1YD8 U;  3VDZ A;  4YXD B;  1TBE A;  3M95 A;  5G55 A;  1TS5 A;  3ZXV A;  2RDB C;  4OZC A;  2H88 B;  4US8 A;  3UIN B;  3O13 A;  1GJZ A;  1N61 A;  4URK A;  3VH4 B;  4MH8 A;  3KYD D;  1YQB A;  1Q10 A;  4LNO A;  2PVG C;  2ZVO A;  1WXA A;  3ZNZ B;  3DBS A;  1WXV A;  1WGR A;  4DK5 A;  3QQ8 B;  4F1S A;  4ANV A;  1JWB D;  4LNF A;  4NAM A;  2BKR B;  3K9O B;  3U7D A;  4CO7 A;  1RFK A;  5AZH A;  1QT9 A;  1V1P B;  1V9J A;  3W9C B;  1PQS A;  1IBX B;  2IO2 B;  3GOE A;  1D4B A;  4HCP B;  1ZUD 2;  2PE6 B;  3A9K A;  1MHX A;  2KWV B;  3N32 A;  2Y5C A;  4AJW A;  3BYY B;  2M17 A;  1V49 A;  2W9N A;  5LXI B;  1EU3 A;  2N9L A;  1NYR A;  3VUY A;  5H8Y E;  2WXK A;  2LZ6 A;  1WJU A;  2D10 A;  3PTF C;  4EZJ A;  4B95 A;  1WZ0 A;  2L0F A;  4GSW A;  2IJ0 A;  4HPL B;  2N7D A;  1I4G A;  3DDC B;  2KDM A;  3AE5 B;  4K7S A;  3OWE B;  3AU5 A;  5LLI A;  4KDL B;  3AE9 B;  4KDI C;  1WIA A;  5IP4 D;  2DHZ A;  5E6J A;  2CHZ A;  2NCN A;  4HJK A;  1VCB A;  3A9K B;  4N6E B;  3PZ7 A;  2PTL A;  3KQ4 A;  1YJI A;  2K6Q A;  2IGD A;  2ZW1 A;  1DOI A;  1QZE A;  3NZS A; 
#chains in the Genus database with same CATH homology
 2IND C;  3GE8 C;  1T0S C;  3I5J C;  3Q3N C;  3RNB C;  3RN9 C;  3RNA C;  4P1B C;  3Q3M C;  3RMK C;  3RNE C;  4P1C C;  1T0Q C;  1T0R C;  2INC C;  3RNG C;  2RDB C;  3I63 C;  3N1X C;  3RNC C;  3RI7 C;  3DHG C;  3N20 C;  3GE3 C;  3DHI C;  3N1Z C;  3RNF C;  3Q14 C;  3Q2A C;  3Q3O C;  3N1Y C;  3DHH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...