3N1ZC

X-ray crystal structure of toluene/o-xylene monooxygenase hydroxylase t201s mutant
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active Site Threonine Facilitates Proton Transfer during Dioxygen Activation at the Diiron Center of Toluene/o-Xylene Monooxygenase Hydroxylase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Oxidoreductase
molecule keywords Toluene o-xylene monooxygenase component
total genus 25
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 3n1zC00
3Q2AC 3RMKC 3DHGC 1T0RC 3Q3OC 3RI7C 3RNGC 1T0QC 3RNFC 3RNEC 3DHIC 3N1XC 3I63C 3GE8C 2INCC 3RNAC 3RNBC 3GE3C 3DHHC 3I5JC 3Q3NC 3N20C 3Q3MC 2INDC 1T0SC 3RNCC 3N1YC 3RN9C 3Q14C 4P1CC 3N1ZC 2RDBC 4P1BC
chains in the Genus database with same CATH superfamily
2J52A 2KC1A 3ML9A 1TZ1A 3OJ4B 2AL6A 3PZDA 4ZRKA 2D3GA 3MJ5A 2HJ8A 1T0QC 2X8XX 3U7ZA 2AL3A 2KVRA 4HJKA 4W9FA 1V86A 2IJ0A 2Q5WD 1V80A 1E7PB 4LCDE 4W9KA 3DBLI 3W5VB 1IBXB 2K0PA 2BQQA 1SB3C 2HDEA 3VUXA 2YVCA 2Z59B 2K8HA 2FIDA 1UZXB 2BKRB 2L83A 2FCQA 1GC6A 1XQQA 4HEA1 4C4VB 3PT2B 4YSYB 3Q3NC 2WXJA 3M62B 3KWLA 5KHOA 1R4NI 2V1YA 1WX9A 3AI5A 2K1FA 4YTNB 3NOBA 3T9LA 5C1ZA 2LXCA 3MHSD 2IZVB 1TKGA 4KZCA 4WAAA 1V5TA 3R2IA 4WAFA 4KDLB 5EE9A 4PS7A 1QOGA 1JMLA 1NVID 3ZTDA 1V1OA 1NYRA 4R3DA 3RFZB 3VRAB 4A3PA 1PQSA 4KGSA 1TY2A 2MJ3A 2MBHA 1YQ3B 2N9KA 1P0RA 3Q6BA 4W9LA 3AE9B 3LB8C 2IO2B 2PW9A 2WDTB 3TUOA 3RNCC 2WX0A 1JW9D 4K7SA 2BBCA 2MWSB 4YTPB 3LJ3A 1T6BX 2ZVNA 5HFYA 1BMLC 4LDTB 3FAHA 5D94A 5HKHA 2K6QA 4JWSC 3CIRB 2JY6A 4AJYB 2AQ2B 2WXFA 1WE6A 4IW0A 3W1SA 2FNJB 5D7GA 3HM3A 3SR6A 1MPEA 1WYWB 3R3MA 2BWFA 2KTFA 3JW0X 4USAA 4MH8A 1FNVA 1QOFA 1LGRA 4ICUA 2ZEQA 2V0GA 2JWZA 3N1XC 3SDLC 3VXWA 2WXPA 3VUWA 3MC0B 2L0TA 3WAOA 1SGHA 3M63B 3NZSA 1I42A 3AXCA 4EFOA 5BO4B 4JGHB 4N58A 4OW0A 3BK2A 2KX3A 4KGRA 3A9KA 2MJEA 1WGGA 2M0AA 3WAPA 1N60A 3W9CB 2WXOA 4OZAA 1SIJA 2ASQA 1TGZB 4W9IA 4PYZA 3JSVB 1RWSA 2VRRB 2PE9A 4IOIE 4F7ZA 4S0RA 1ZKHA 2O2VB 4GGQA 4A8XC 1WXAA 3PLUA 3B1LX 3P4QB 2J7QB 2G3QB 2KDIA 2IGDA 2R2OA 3HUIA 2K3UA 3V62A 1DYQA 1TBEA 2GBNA 2LEKA 1WXVA 5EE0A 4A90A 2L05A 4G0NB 3WAMA 2K6DB 5FK9C 4JE3B 3BK1A 3QK0A 2D5GA 4FJZA 3RNFC 4EZLA 3B08A 1E7UA 4AJWA 3R8BA 4NJ7A 4TSSA 2WS3B 4GB9A 1ESFA 2DYMA 4M02A 3B9JA 4OZCA 1T3QA 2M1MA 2QDFA 2GLSA 3N9YC 3L17A 1XEEA 1NYQA 4YL8A 1TYGB 1KLGD 3DHGC 2BYEA 3NG0A 1NBFC 3RNEC 4FN2A 4TQ0A 2KTRB 3GE8C 5D2MB 4WJOA 5J17A 2DBYA 2KMCA 3ZDTA 5DCNA 1XCTL 3ZQ4A 3I9V1 2DX5B 3OWEB 3MHZA 3C19A 3JVZX 4GDKB 2DZJA 1TS3A 1DOYA 3BZDB 2I1JA 2BS4B 5GMVA 3NS8A 1WM3A 2KACA 1I7HA 2DZIA 4DQOC 4RH6A 2IO3B 3AU4A 1WFYA 4RF1A 4B0EA 3PZ7A 1Q1OA 2ZW1A 1V2YA 1YN5A 2E6XA 1PFDA 5AUIA 2AQ3B 3VH4B 2RD0A 3CSTA 4ITKA 3PV1A 1EO6A 1U4AA 2G4SA 3NZ3A 2IO1B 1A5RA 2PMVA 4REZA 1WY8A 3ENEA 2KJ6A 2KOXA 2PLPA 3LDZE 2LZ6A 2WXRA 2OJWA 2D11A 3Q3JA 1UNSA 2LVPA 4WWMA 3TJPA 2RR9A 3VQIA 3JYUA 4A20A 4RNAA 1LFDA 1ZXHA 4MGKE 3PSEB 1UWMA 4FJYA 1UGJA 3EECA 3EFCA 3WALA 1TIFA 1LM8B 2PVOD 2XN9C 3PHWB 5CHVC 2KDEB 2LHDA 4MSQB 1JCKB 3HK0A 2WGSA 1C78A 3WIMA 4A9AA 3Q2AC 1XCQL 1GJZA 4MJSA 1JWBD 1WIAA 1PGBA 1ROEA 1FPYA 2INNE 4LNOA 1RLFA 2JRHA 2RPVA 4IWOA 2PKOA 2A4ZA 1J7BA 3E9SA 4II2B 2LFIA 1YIWA 1C4AA 1AN8A 2WXGA 4TUUA 2NTSA 4BOZB 4LJOB 3RMKC 5CX3A 2CJNA 1WX7A 1DGJA 2NR2A 2C9WB 2FIFA 3A1QA 1GAQB 1HQRD 2KDMA 2GBKA 1AW7A 1XO3A 4JLCA 4B6WA 1ZW7A 3BYTB 2UYZB 3IFWB 2W55A 2JZ3B 4A3OA 1KTKA 2BGFA 2G4DB 3IG3A 4A55A 3T8MA 2PE6B 4IM0A 4XZ4A 2IBIB 1J8CA 2ZJDA 2D07B 3BINA 1WMHB 1P9DU 2ICIA 1AARA 1GPXA 2CKHB 1OEYJ 1E8XA 2HD5B 4A6QA 5E6OA 5AZFA 2NMQA 1WH3A 4DBGA 2R61A 4US8A 1E8YA 4HK2A 1F9JA 3ZNZB 5D6JB 1KRHA 1J0GA 3AN1A 3TCAA 4XDDA 3QIJA 3ZJUA 1WYGA 2M8SA 4DK5A 4AUQC 1HZ5A 3OG5A 3Q14C 4PS3A 4YT0B 4KX6B 1C77A 2G9HD 2LI5A 4C56C 3NUHB 3NJTA 2KMAA 4YTMB 4ASWC 3NVYA 1FO4A 2VH2A 3A4RA 1AWDA 2KN4A 2V4LA 3IBEA 1XT9B 2Y5BB 3AEFB 4B9KA 1LO5D 2YEPF 3AULA 1LXDA 4HWIB 3NHEB 4MSMB 1L6VA 1C9FA 3O13A 5IA7A 1K53A 4OHJA 1ISNA 4OVZA 1FXTB 3T3OA 2W82A 1WXQA 2K39A 3OAWA 3ONSA 3H1UA 1P7EA 2MA9B 2LGSA 1GB1A 1WE7A 2KQ4X 4WWPA 4XC2A 4ZRPA 2BYFA 1QOBA 1VZ8A 4GDLA 2GB1A 4WJQA 1GNUA 2N7DA 1SEBD 1IBXA 1SE3A 2IY0B 4BKTA 3PS6A 4YWGG 2B76B 2N9XA 5IOIA 3NY5A 4RGTA 3ZO5B 1I4GA 3C8YA 1F1HA 1VZ6A 5JZEB 5KHQA 1Y8RC 5TSSA 1P98A 2FUHB 4BBNF 2MBQA 3DBRB 3N1ZC 2WXIA 1SSNA 1GB4A 1I4RA 2NTTA 4G3XB 2I1KA 3U8ZA 2J0KA 1D4BA 3ZJVA 3AE2B 4C80A 2NBWB 3DDCB 3N32A 2WDQB 4HKZE 3RUIB 4NQLB 3HRDD 2LJIA 3ZXVA 4KIKA 1VLBA 1MFWA 1UUPA 4LLGM 3UIOB 1KLVA 3A9JA 4FULA 2C5LC 1WGDA 2ZCBA 2BPSA 3KYDD 2Y5PA 3ZNGC 2J53A 4JX1C 2FCNA 2MRPA 4C7ZA 2WDVB 2BW2A 2OOBB 1JRUA 3SHQA 2REXA 3VTVA 1XF5L 2LASA 2Y5CA 1WSPA 5FR3A 4DXGA 2G45B 4ANWA 1H8CA 2O6VA 4MGZE 2XK5B 1IP9A 1FXIA 4ZHOA 2KJHB 3AEAB 1L0YB 1E7VA 3DBHI 4HDQA 3URYA 2ACZB 1MI0A 1R4MI 1RYJA 1CJEA 4ZRIA 1TS2A 3VRBB 4CQNA 1QILA 2DAFA 1XXGA 2JX5A 4G11A 2UWQA 3V61A 2CU3A 1UF0A 3V05A 3ZDMC 2Z0DB 4LTUA 1UELA 1CK1A 3VUYA 2NBVB 3L4PA 1OGWA 4GXBA 4TQ1A 3U4EG 3I3TB 1T0RC 2KD0A 1EWYC 1AYFA 5HG2A 5HI1A 3TSSA 1Q10A 3AE8B 2QHOA 1WF9A 2KJRA 4ZDVA 4IG7B 4H2AA 4LNKA 3I57A 1R7SA 1HTOA 1D5ZC 5E6PA 4NNJB 1IUEA 3Q69A 5L95C 2MX2A 2KLCA 4FHKA 1V1PA 3AE1B 3JSVA 1ET9A 2J0MA 4K7WA 2LUMA 3RNAC 1YJIA 3AEBB 4D2KA 2LHEA 4IDIA 2Y3AA 4EZJA 1RM6C 3SEBA 1LQBA 1E9MA 3AEGB 1JQ4A 2K9XA 3B0AA 3RULA 1V5OA 3DVGX 1ACCA 1VCBA 4AWJA 4M0WB 3ALBA 2ZZPB 2CU1A 4LNFA 2N7EA 1FEHA 1WR6E 4C7YA 2BB5A 4MT5A 3AB5A 1WRIA 2NBUA 4XE0A 2MBEA 3VH3B 1XLQA 5DPTA 3RCZA 1D3ZA 4DXAB 4M00A 4LDTD 5CHWA 3S2AA 3PLVA 3TBLD 1A70A 4ZHPA 5LNK1 3QJZA 1J7CA 1SE4A 2EMTA 3BIID 1V81A 4KZ0A 3NZUA 2OJRA 4HKQA 2KMMA 2KZRA 2IYDB 3GP7A 3SU8X 2PEAA 1WGRA 1WJUA 1V9JA 4M8MA 1WX8A 2B3AA 2V3NA 4CO7A 3ZIMA 2RGFA 5AEKB 3N20C 4TKNA 2KYWA 1NENB 1Y56A 5C23A 3Q8FA 2QC8A 3UINB 1XD3B 4HDOA 4L2YA 4DHZE 2WU5B 2IGGA 4ARIA 2DENB 2N0SB 2I2YA 2ZVOA 4WWOA 1TY0A 3PPAA 4HPPA 3GZNB 4JL9A 2KFKB 3I5JC 3TEWA 3MC8A 1XLPA 3BVZA 3VHTC 4KKIA 4OVUA 1S3SG 2EMSA 1F0ZA 2L8JA 2JUOA 1QOAA 3KWVA 1ZDVA 4NPNA 2XEWA 1Z2MA 3A4SC 2LD9A 3LYYA 4RGOS 5MPOA 1I4PA 2N4FA 5G2NA 3RNBC 3K9PB 2CHWA 2AWTA 3PREA 4WJNA 4N59A 4IC7B 4P1CC 2XNAC 1MG8A 2GBRA 2BWES 1YX6B 1HE8A 3AE7B 4LJPB 5LXIB 1C1YB 1PYWD 4ZRJA 4BVUC 1KJTA 3PVLA 4K3CA 2CHZA 4F8CB 3L10B 3I63C 1I4XA 4URKA 1HTQA 1TKEA 3VTWA 2ON8A 4ARCA 4I6NB 5AZHA 3P4PB 3TMPB 1FCLA 2MBBB 3R66C 2KK8A 4WURA 3ZLZA 1K50A 4JIOU 4IWQA 5FKAC 2ZNVC 1YN4A 2C7HA 3DVGY 3PRPB 1EM7A 2K22A 5G5HA 2RDHA 1JWSD 4K3BA 3VAWA 2WDRB 2L52A 2N7JA 3QA8A 4EOYA 2D3AA 3N1YC 1P1AA 2J4XA 3IXSA 2GI9A 3DOWA 3IHPC 1XLNA 2PPHA 2QILA 3WA0A 1DOXA 4PS8A 4B0MA 3CWIA 2RPQA 5EE3A 1ZDXA 2LGXA 2WYQA 2N1VA 3ZNID 5BMIA 1FNWA 4RGNA 3T3NA 4IM2A 4K81A 1KH0A 3O65B 1QKZA 1D6EC 2INDC 1OQYA 2LWPA 5EE1A 2J42A 1V49A 3AEDB 4RM9A 2JXXA 3DWGC 4WWNA 3FILA 1F2RI 1FIQA 2CS4A 1TS4A 3AE4B 1ZXIA 4ACFA 3U30A 2CHXA 1E6EB 2VZKD 1BT0A 5JXVA 1V8CA 2LGYA 4US9A 1TT5B 4HCNB 4EE2A 3C0RB 2YLMA 3ZTCA 1WJ4A 1E90A 2V4IB 2RMMA 4CHKA 1FFVA 3EHVA 3ZW3A 4QAYA 3RN9C 2NS5A 1YMHE 2M0XA 2HE7A 3VR8B 3IT4B 2LMCA 1TKYA 3NS1A 1WR1A 3UQAA 1VDVA 4GDKA 3GOEA 4UDUC 4MM3B 2CR5A 1H4RA 2IDYA 3FKYA 4NAMA 4GSWA 4C00A 1RAXA 2BF8B 1NDDA 2DAJA 3AU5A 3IAS1 4L1BA 4ZYSA 5DPWA 2GBMA 3CSFA 3DPDA 1SXTA 5JH5C 3P4SB 4CYEA 1VR9A 1OFFA 1FRDA 2ZPYA 2SAKA 4M01A 1ZUD2 3DBSA 3KUCB 5DPSA 3Q8BA 3VR9B 4E71A 1JWMD 2HTME 3AE5B 2NVUI 2NPTB 4AQ7A 3L13A 2JZPA 2N9PC 3ML8A 3RNGC 1WM2A 3NVZA 2GOWA 2MJDA 4BBNC 2BB6A 1T0SC 4PT5A 3WANA 4O1NA 1SJHD 4ZOHC 1WWTA 4ANUA 5AUKA 4M8NA 3HM6X 2YEPB 4S17A 4N6EB 1CQVA 2M4NA 3X0WA 4ZYNA 3DWMA 3GE3C 2O6VD 1GG3A 1E0ZA 1OQQA 2DHZA 2L3ZA 5BMGA 4GN1A 2RDGA 1D5XC 1VJKA 2N9LA 1NEKB 4NAWB 1F77A 1VZ7A 3R7RA 3TEXA 5HHDG 3L08A 1EU3A 1X1MA 4ICVA 3B2GA 1YNTE 4RFBA 4MH0E 3CF6E 1OEYA 2EELA 3QAQA 3QQ8B 1BXTA 1JWAD 1G6JA 5H92C 4BOSC 2MP2B 3A9KB 1ET6A 4X57B 1FXAA 2KC2A 5JHBA 1FCCC 2R2QA 2LRUA 1MG4A 2SEBD 1M4VA 2JVCA 1VD2A 4DHZB 1HZ6A 2KWDA 4RF0A 3HIZA 2JQRB 4MJSB 2C60A 3P63A 1DOIA 3W2DA 1MHXA 4JQWC 1I35A 4FA6A 2QEJC 3ZKJC 1EF1A 3AE6B 3SD5A 2QSDA 4GDLB 4LK0M 2QJLA 2KTRA 4PYUA 2JYEA 3A1QB 4XDCA 2L76A 3Q3FA 3AV8A 1WGKA 3K9OB 4E3CA 2BYVE 3VDZA 3TIXA 1C3TA 5DPRA 5FR6A 3EFUA 1UBQA 3WCQA 4W9JA 2DYBA 1WJ6A 4MM3A 3KQ4A 4RGMA 1E10A 1XLOA 1SE9A 4N9F4 1T5XD 1ZOYB 1I4HA 2KVZA 2L1AA 2IPKD 3DBLB 3ECIA 4P1BC 1YX5B 4RMAA 4IWPA 2JT4B 3AH7A 4XX5A 2MW5A 5C3JB 2ZW0A 3LXFA 4P7IA 4B95A 3L0WB 1NI2A 2JPHA 4W9CA 3GS2A 2L0FA 1P7FA 5D3DA 2PTLA 2H89B 1WRDB 1V97A 4KV2A 5BMHA 2K5PA 3KUDB 2UU7A 4NJCA 4MGYE 1WGYA 2CJOA 3J9CA 1V6EA 2WXKA 3ZJTA 2KNBA 4KGTA 3OJ3A 1KLUD 5T8IA 1IGDA 3ZRFA 4XWWA 4BKGA 1OTRB 2KWCA 3Q3MC 4DHJB 4AS1A 3EGRA 5IO9A 1L0XB 1WI0A 4DHJD 1PGAA 2FCSA 1QLBB 1GOZA 4GLSC 4AP4C 2V3SA 1FD6A 4JWUC 3NRZA 4XGAB 4J3OD 3ABVB 2D10A 1EWCA 2JZZA 4LNIA 1T0YA 3PO0A 3A33B 4FADA 2WXQA 2GMIC 1UH6A 2WWZA 3AE3B 3IT6B 4HPMB 3W1YA 3PHXB 2PJHA 3X23A 1C76A 4KSLC 2KT7A 1CZPA 3BY4B 3M95A 5IKCM 2KO3A 3UIPB 1V1PB 4WIPA 3V6EB 4MDKE 1SIFA 4W9HA 2FCMA 2BVCA 2KN5A 3ZRCA 4YXDB 3KVFB 1L4ZB 1N63A 2C7NB 1ENFA 4EEWA 4PK1A 2X38A 2KFJA 2GBJA 3KUZA 1J19A 2KFKA 3DBRI 5I4DA 1IGCA 2MCNB 5LLIA 2JRIB 4GOCA 4NQKE 2KANA 3U52E 2KDFB 1E5WA 2AEHA 4E74A 5LXHA 1FM0D 2BT6A 2DNFA 4TMAB 2N1WA 1PUTA 1C4CA 1FFUA 4P16A 3HVZA 1KFYB 2IY1B 5D3IB 5G55A 1K8RB 2WP9B 5EDSA 5IN7A 4NAWA 3ETRA 4P6VF 4HVBA 1C4PA 1ZPSA 4FBJB 3VFKA 1UD7A 2FUG1 5BYSA 4RM8A 2ZNVB 2WNMA 3RYTA 1RRBA 1N5WA 3DQVA 2HTHA 1YJ1A 3VVWB 3ZVVA 3IAM1 5BYQA 3Q3OC 2VZKB 3KYCD 2KHWB 4ANXA 3APDA 3GB1A 4HXDA 3DHIC 4C4VA 5AZGA 1FRRA 4MGIE 3NVVA 2D2QA 2AYOB 3RD2A 2DZMA 1N61A 3V3XA 3ZGZA 2FAZA 2DZKA 2LXAA 4KDIC 1KF6B 3RPFC 3E56A 4L23A 2WLBA 2A5UA 3PZ8A 1YD8U 5CHFA 3BVGA 3ZUNA 2RSUA 2KAJA 1WMHA 2MQJA 1JROA 4AOFA 1WGHA 3P42A 4EZKA 1N6ZA 1MJDA 1B1ZA 2KKCA 2DYOA 3PTFC 3D32A 2ZPNA 5E6JA 4YSZB 1QF6A 2V9HA 3EC8A 3APFA 4YSXB 4G50A 2EKEC 2KWVB 3RZWC 2O2VA 2J0JA 5G5GA 4WJPA 2L00B 2QCZA 1TTNA 3Q8CA 4FHJA 4ANVA 1NI3A 4DXFA 4MEMA 5GXGB 1WXSA 4DWFA 2V3PA 3AMZA 5JHAA 3QHTA 2LRWA 4F1SA 1N5XA 2BYTA 1WZ3A 1K51A 3HHMA 1WXMA 4FJVB 2JF5A 3HVDA 1MVKA 2KDBA 4MELA 2D3BA 1FNUA 1UWXA 1QZEA 4FLHA 1Z5SB 4IKGA 3BVMA 2KQ7A 3UQBA 3Q8EA 3PRZA 4KVGB 2BS3B 1R4MB 3UI3A 1IYFA 1JALA 3KH0A 3P2BA 4GMVA 3FILB 1HXYD 5J18A 1J7AA 1Q0WB 1L7YA 4HJGE 4HPLB 1YJJA 3H7SA 2BKFA 2WHIA 2C7MB 3NVWA 4II3B 4RCOA 2WQYB 2Z8LA 2QIEB 1TJEA 3DHHC 3B2FA 3BWUD 3BYYB 4BAXA 4EKUA 5TR5A 1JWUD 2KQSA 1L5PA 1PGXA 2W54A 4EUTA 2JXTA 4KSKC 4BKSD 3M3JA 2M17A 3R7QA 5CTRC 3MFGA 2MSED 1RFKA 4M0WA 2NPTA 1HEZE 1ZE3D 2WXLA 4K1RB 1SBBB 3H6NA 1D5MC 4FXCA 1GC7A 2BTEA 3H9DA 2WXHA 4W9EA 1SF0A 1L0VB 3MTNB 1FMAD 3P4RB 1ZGUB 3MP9A 4LNNA 3RZFA 1YN3A 3MC9A 1SJED 3DCGA 1JRPA 2ONQA 4OVVA 2LGIA 2K8BA 3AEEB 3W5UB 5E6NA 1BUIC 2LVOA 3V60A 2KX0A 2MEKA 1EF5A 1VRAB 1I4QA 1CMXB 2WXMA 2RDBC 3UF8A 4HLEA 1UBIA 1B9RA 2FE8A 2IO0B 2KXJA 1SE2A 3TEYA 4WQOB 4WH4A 2DLBA 3R2TA 3EUB2 3U2SC 2H88B 1QT9A 3GZNI 3OLMD 4K7UA 2NCNA 1N62A 1L4DB 2GRIA 3DVNV 4J6IA 2XBBC 3DBHB 3U7DA 3ZXRA 4HRSA 1F52A 2OEDA 2TSSA 1KOTA 5C2TB 5L83A 3N30A 2VH1A 3IVFA 3ZNHB 2EKIA 3N3KB 2WXNA 4BFRA 2HJ1A 2LVQA 2FBWB 4WQMA 4I6LB 1YQBA 1UGMA 2XK5A 2MLBA 1WJNA 3AM9A 1RFAA 3TL5A 3EA6A 3Q8AA 1Q5WB 1E8WA 1QQRA 2LUEA 2N9EB 3L54A 3QWZB 4ZRQA 3PRMB 3H7PB 4W9GA 2PVGC 1EU4A 2KWUB 1MHHE 2DWQA 4BKSA 4XYCA 2L32A 2QMTA 1YQ4B 1TZOA 5BYRA 3QARA 4IM3A 2Z0EB 1HA5A 2D3CA 2M56B 3RT3B 1PDXA 4HCPB 4GU2A 2WU2B 4KKJA 1STEA 3PGEA 4XWTA 4Q2JA 1TS5A 2G1EA 2JSVX 5IAAC 2LGDA 2MP2A 2JU6X 3MJWA 3H7PA 4NZLB 3H8HA 1L2NA 4BZAA 3A9JB 2JYTA 4IUMB 4OZBA 3QCAA 1KM7A 4KIKB 3P1MA 1R4NB 3ZYYX 2JWUA 2W3SA 1EUVB 4MACA 3DVNU 2INCC 2BS2B 3V6CB 3UGBB 4W9DA 2OHFA 2INPE 2K25A 2AX5A 2W3RA 1OQRA 2WX1A 2MH7A 3QX1A 3KW5B 1L6UA 2E3TA 3RI7C 3TEZA 2K8CA 4NY0A 1GUAB 2MBOA 2I38A 4I6PA 1C79A 2M19A 1P3QU 2MHJA 3SFDB 2AQ1B 3APCA 3W1SC 4DDID 4DDGD 1WZ0A 2L7RA 4NJ6A 3CMMB 5H8YE 4TV3A 2ZCCA 1M94A 3KLSX 3FC4A 1IPGA 4HROA 2PIAA 1F2RC 2LJ5A 3SFEB 1S1QB 4JPSA 2O6VB 3L16A 2W9NA 5J2RA 3QC8B 1YOVB 3VTUA 1E8ZA 3AECB 2KLGA 1K52A 1ZP0B 4GIVA 5IP4D 2IGHA
chains in the Genus database with same CATH topology
3Q2AC 3RMKC 3DHGC 1T0RC 3Q3OC 3RI7C 3RNGC 1T0QC 3RNFC 3RNEC 3DHIC 3N1XC 3I63C 3GE8C 2INCC 3RNAC 3RNBC 3GE3C 3DHHC 3I5JC 3Q3NC 3N20C 3Q3MC 2INDC 1T0SC 3RNCC 3N1YC 3RN9C 3Q14C 4P1CC 3N1ZC 2RDBC 4P1BC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q2A C;  3RMK C;  3DHG C;  1T0R C;  3Q3O C;  3RI7 C;  3RNG C;  1T0Q C;  3RNF C;  3RNE C;  3DHI C;  3N1X C;  3I63 C;  3GE8 C;  2INC C;  3RNA C;  3RNB C;  3GE3 C;  3DHH C;  3I5J C;  3Q3N C;  3N20 C;  3Q3M C;  2IND C;  1T0S C;  3RNC C;  3N1Y C;  3RN9 C;  3Q14 C;  4P1C C;  3N1Z C;  2RDB C;  4P1B C; 
#chains in the Genus database with same CATH topology
 2J52 A;  2KC1 A;  3ML9 A;  1TZ1 A;  3OJ4 B;  2AL6 A;  3PZD A;  4ZRK A;  2D3G A;  3MJ5 A;  2HJ8 A;  1T0Q C;  2X8X X;  3U7Z A;  2AL3 A;  2KVR A;  4HJK A;  4W9F A;  1V86 A;  2IJ0 A;  2Q5W D;  1V80 A;  1E7P B;  4LCD E;  4W9K A;  3DBL I;  3W5V B;  1IBX B;  2K0P A;  2BQQ A;  1SB3 C;  2HDE A;  3VUX A;  2YVC A;  2Z59 B;  2K8H A;  2FID A;  1UZX B;  2BKR B;  2L83 A;  2FCQ A;  1GC6 A;  1XQQ A;  4HEA 1;  4C4V B;  3PT2 B;  4YSY B;  3Q3N C;  2WXJ A;  3M62 B;  3KWL A;  5KHO A;  1R4N I;  2V1Y A;  1WX9 A;  3AI5 A;  2K1F A;  4YTN B;  3NOB A;  3T9L A;  5C1Z A;  2LXC A;  3MHS D;  2IZV B;  1TKG A;  4KZC A;  4WAA A;  1V5T A;  3R2I A;  4WAF A;  4KDL B;  5EE9 A;  4PS7 A;  1QOG A;  1JML A;  1NVI D;  3ZTD A;  1V1O A;  1NYR A;  4R3D A;  3RFZ B;  3VRA B;  4A3P A;  1PQS A;  4KGS A;  1TY2 A;  2MJ3 A;  2MBH A;  1YQ3 B;  2N9K A;  1P0R A;  3Q6B A;  4W9L A;  3AE9 B;  3LB8 C;  2IO2 B;  2PW9 A;  2WDT B;  3TUO A;  3RNC C;  2WX0 A;  1JW9 D;  4K7S A;  2BBC A;  2MWS B;  4YTP B;  3LJ3 A;  1T6B X;  2ZVN A;  5HFY A;  1BML C;  4LDT B;  3FAH A;  5D94 A;  5HKH A;  2K6Q A;  4JWS C;  3CIR B;  2JY6 A;  4AJY B;  2AQ2 B;  2WXF A;  1WE6 A;  4IW0 A;  3W1S A;  2FNJ B;  5D7G A;  3HM3 A;  3SR6 A;  1MPE A;  1WYW B;  3R3M A;  2BWF A;  2KTF A;  3JW0 X;  4USA A;  4MH8 A;  1FNV A;  1QOF A;  1LGR A;  4ICU A;  2ZEQ A;  2V0G A;  2JWZ A;  3N1X C;  3SDL C;  3VXW A;  2WXP A;  3VUW A;  3MC0 B;  2L0T A;  3WAO A;  1SGH A;  3M63 B;  3NZS A;  1I42 A;  3AXC A;  4EFO A;  5BO4 B;  4JGH B;  4N58 A;  4OW0 A;  3BK2 A;  2KX3 A;  4KGR A;  3A9K A;  2MJE A;  1WGG A;  2M0A A;  3WAP A;  1N60 A;  3W9C B;  2WXO A;  4OZA A;  1SIJ A;  2ASQ A;  1TGZ B;  4W9I A;  4PYZ A;  3JSV B;  1RWS A;  2VRR B;  2PE9 A;  4IOI E;  4F7Z A;  4S0R A;  1ZKH A;  2O2V B;  4GGQ A;  4A8X C;  1WXA A;  3PLU A;  3B1L X;  3P4Q B;  2J7Q B;  2G3Q B;  2KDI A;  2IGD A;  2R2O A;  3HUI A;  2K3U A;  3V62 A;  1DYQ A;  1TBE A;  2GBN A;  2LEK A;  1WXV A;  5EE0 A;  4A90 A;  2L05 A;  4G0N B;  3WAM A;  2K6D B;  5FK9 C;  4JE3 B;  3BK1 A;  3QK0 A;  2D5G A;  4FJZ A;  3RNF C;  4EZL A;  3B08 A;  1E7U A;  4AJW A;  3R8B A;  4NJ7 A;  4TSS A;  2WS3 B;  4GB9 A;  1ESF A;  2DYM A;  4M02 A;  3B9J A;  4OZC A;  1T3Q A;  2M1M A;  2QDF A;  2GLS A;  3N9Y C;  3L17 A;  1XEE A;  1NYQ A;  4YL8 A;  1TYG B;  1KLG D;  3DHG C;  2BYE A;  3NG0 A;  1NBF C;  3RNE C;  4FN2 A;  4TQ0 A;  2KTR B;  3GE8 C;  5D2M B;  4WJO A;  5J17 A;  2DBY A;  2KMC A;  3ZDT A;  5DCN A;  1XCT L;  3ZQ4 A;  3I9V 1;  2DX5 B;  3OWE B;  3MHZ A;  3C19 A;  3JVZ X;  4GDK B;  2DZJ A;  1TS3 A;  1DOY A;  3BZD B;  2I1J A;  2BS4 B;  5GMV A;  3NS8 A;  1WM3 A;  2KAC A;  1I7H A;  2DZI A;  4DQO C;  4RH6 A;  2IO3 B;  3AU4 A;  1WFY A;  4RF1 A;  4B0E A;  3PZ7 A;  1Q1O A;  2ZW1 A;  1V2Y A;  1YN5 A;  2E6X A;  1PFD A;  5AUI A;  2AQ3 B;  3VH4 B;  2RD0 A;  3CST A;  4ITK A;  3PV1 A;  1EO6 A;  1U4A A;  2G4S A;  3NZ3 A;  2IO1 B;  1A5R A;  2PMV A;  4REZ A;  1WY8 A;  3ENE A;  2KJ6 A;  2KOX A;  2PLP A;  3LDZ E;  2LZ6 A;  2WXR A;  2OJW A;  2D11 A;  3Q3J A;  1UNS A;  2LVP A;  4WWM A;  3TJP A;  2RR9 A;  3VQI A;  3JYU A;  4A20 A;  4RNA A;  1LFD A;  1ZXH A;  4MGK E;  3PSE B;  1UWM A;  4FJY A;  1UGJ A;  3EEC A;  3EFC A;  3WAL A;  1TIF A;  1LM8 B;  2PVO D;  2XN9 C;  3PHW B;  5CHV C;  2KDE B;  2LHD A;  4MSQ B;  1JCK B;  3HK0 A;  2WGS A;  1C78 A;  3WIM A;  4A9A A;  3Q2A C;  1XCQ L;  1GJZ A;  4MJS A;  1JWB D;  1WIA A;  1PGB A;  1ROE A;  1FPY A;  2INN E;  4LNO A;  1RLF A;  2JRH A;  2RPV A;  4IWO A;  2PKO A;  2A4Z A;  1J7B A;  3E9S A;  4II2 B;  2LFI A;  1YIW A;  1C4A A;  1AN8 A;  2WXG A;  4TUU A;  2NTS A;  4BOZ B;  4LJO B;  3RMK C;  5CX3 A;  2CJN A;  1WX7 A;  1DGJ A;  2NR2 A;  2C9W B;  2FIF A;  3A1Q A;  1GAQ B;  1HQR D;  2KDM A;  2GBK A;  1AW7 A;  1XO3 A;  4JLC A;  4B6W A;  1ZW7 A;  3BYT B;  2UYZ B;  3IFW B;  2W55 A;  2JZ3 B;  4A3O A;  1KTK A;  2BGF A;  2G4D B;  3IG3 A;  4A55 A;  3T8M A;  2PE6 B;  4IM0 A;  4XZ4 A;  2IBI B;  1J8C A;  2ZJD A;  2D07 B;  3BIN A;  1WMH B;  1P9D U;  2ICI A;  1AAR A;  1GPX A;  2CKH B;  1OEY J;  1E8X A;  2HD5 B;  4A6Q A;  5E6O A;  5AZF A;  2NMQ A;  1WH3 A;  4DBG A;  2R61 A;  4US8 A;  1E8Y A;  4HK2 A;  1F9J A;  3ZNZ B;  5D6J B;  1KRH A;  1J0G A;  3AN1 A;  3TCA A;  4XDD A;  3QIJ A;  3ZJU A;  1WYG A;  2M8S A;  4DK5 A;  4AUQ C;  1HZ5 A;  3OG5 A;  3Q14 C;  4PS3 A;  4YT0 B;  4KX6 B;  1C77 A;  2G9H D;  2LI5 A;  4C56 C;  3NUH B;  3NJT A;  2KMA A;  4YTM B;  4ASW C;  3NVY A;  1FO4 A;  2VH2 A;  3A4R A;  1AWD A;  2KN4 A;  2V4L A;  3IBE A;  1XT9 B;  2Y5B B;  3AEF B;  4B9K A;  1LO5 D;  2YEP F;  3AUL A;  1LXD A;  4HWI B;  3NHE B;  4MSM B;  1L6V A;  1C9F A;  3O13 A;  5IA7 A;  1K53 A;  4OHJ A;  1ISN A;  4OVZ A;  1FXT B;  3T3O A;  2W82 A;  1WXQ A;  2K39 A;  3OAW A;  3ONS A;  3H1U A;  1P7E A;  2MA9 B;  2LGS A;  1GB1 A;  1WE7 A;  2KQ4 X;  4WWP A;  4XC2 A;  4ZRP A;  2BYF A;  1QOB A;  1VZ8 A;  4GDL A;  2GB1 A;  4WJQ A;  1GNU A;  2N7D A;  1SEB D;  1IBX A;  1SE3 A;  2IY0 B;  4BKT A;  3PS6 A;  4YWG G;  2B76 B;  2N9X A;  5IOI A;  3NY5 A;  4RGT A;  3ZO5 B;  1I4G A;  3C8Y A;  1F1H A;  1VZ6 A;  5JZE B;  5KHQ A;  1Y8R C;  5TSS A;  1P98 A;  2FUH B;  4BBN F;  2MBQ A;  3DBR B;  3N1Z C;  2WXI A;  1SSN A;  1GB4 A;  1I4R A;  2NTT A;  4G3X B;  2I1K A;  3U8Z A;  2J0K A;  1D4B A;  3ZJV A;  3AE2 B;  4C80 A;  2NBW B;  3DDC B;  3N32 A;  2WDQ B;  4HKZ E;  3RUI B;  4NQL B;  3HRD D;  2LJI A;  3ZXV A;  4KIK A;  1VLB A;  1MFW A;  1UUP A;  4LLG M;  3UIO B;  1KLV A;  3A9J A;  4FUL A;  2C5L C;  1WGD A;  2ZCB A;  2BPS A;  3KYD D;  2Y5P A;  3ZNG C;  2J53 A;  4JX1 C;  2FCN A;  2MRP A;  4C7Z A;  2WDV B;  2BW2 A;  2OOB B;  1JRU A;  3SHQ A;  2REX A;  3VTV A;  1XF5 L;  2LAS A;  2Y5C A;  1WSP A;  5FR3 A;  4DXG A;  2G45 B;  4ANW A;  1H8C A;  2O6V A;  4MGZ E;  2XK5 B;  1IP9 A;  1FXI A;  4ZHO A;  2KJH B;  3AEA B;  1L0Y B;  1E7V A;  3DBH I;  4HDQ A;  3URY A;  2ACZ B;  1MI0 A;  1R4M I;  1RYJ A;  1CJE A;  4ZRI A;  1TS2 A;  3VRB B;  4CQN A;  1QIL A;  2DAF A;  1XXG A;  2JX5 A;  4G11 A;  2UWQ A;  3V61 A;  2CU3 A;  1UF0 A;  3V05 A;  3ZDM C;  2Z0D B;  4LTU A;  1UEL A;  1CK1 A;  3VUY A;  2NBV B;  3L4P A;  1OGW A;  4GXB A;  4TQ1 A;  3U4E G;  3I3T B;  1T0R C;  2KD0 A;  1EWY C;  1AYF A;  5HG2 A;  5HI1 A;  3TSS A;  1Q10 A;  3AE8 B;  2QHO A;  1WF9 A;  2KJR A;  4ZDV A;  4IG7 B;  4H2A A;  4LNK A;  3I57 A;  1R7S A;  1HTO A;  1D5Z C;  5E6P A;  4NNJ B;  1IUE A;  3Q69 A;  5L95 C;  2MX2 A;  2KLC A;  4FHK A;  1V1P A;  3AE1 B;  3JSV A;  1ET9 A;  2J0M A;  4K7W A;  2LUM A;  3RNA C;  1YJI A;  3AEB B;  4D2K A;  2LHE A;  4IDI A;  2Y3A A;  4EZJ A;  1RM6 C;  3SEB A;  1LQB A;  1E9M A;  3AEG B;  1JQ4 A;  2K9X A;  3B0A A;  3RUL A;  1V5O A;  3DVG X;  1ACC A;  1VCB A;  4AWJ A;  4M0W B;  3ALB A;  2ZZP B;  2CU1 A;  4LNF A;  2N7E A;  1FEH A;  1WR6 E;  4C7Y A;  2BB5 A;  4MT5 A;  3AB5 A;  1WRI A;  2NBU A;  4XE0 A;  2MBE A;  3VH3 B;  1XLQ A;  5DPT A;  3RCZ A;  1D3Z A;  4DXA B;  4M00 A;  4LDT D;  5CHW A;  3S2A A;  3PLV A;  3TBL D;  1A70 A;  4ZHP A;  5LNK 1;  3QJZ A;  1J7C A;  1SE4 A;  2EMT A;  3BII D;  1V81 A;  4KZ0 A;  3NZU A;  2OJR A;  4HKQ A;  2KMM A;  2KZR A;  2IYD B;  3GP7 A;  3SU8 X;  2PEA A;  1WGR A;  1WJU A;  1V9J A;  4M8M A;  1WX8 A;  2B3A A;  2V3N A;  4CO7 A;  3ZIM A;  2RGF A;  5AEK B;  3N20 C;  4TKN A;  2KYW A;  1NEN B;  1Y56 A;  5C23 A;  3Q8F A;  2QC8 A;  3UIN B;  1XD3 B;  4HDO A;  4L2Y A;  4DHZ E;  2WU5 B;  2IGG A;  4ARI A;  2DEN B;  2N0S B;  2I2Y A;  2ZVO A;  4WWO A;  1TY0 A;  3PPA A;  4HPP A;  3GZN B;  4JL9 A;  2KFK B;  3I5J C;  3TEW A;  3MC8 A;  1XLP A;  3BVZ A;  3VHT C;  4KKI A;  4OVU A;  1S3S G;  2EMS A;  1F0Z A;  2L8J A;  2JUO A;  1QOA A;  3KWV A;  1ZDV A;  4NPN A;  2XEW A;  1Z2M A;  3A4S C;  2LD9 A;  3LYY A;  4RGO S;  5MPO A;  1I4P A;  2N4F A;  5G2N A;  3RNB C;  3K9P B;  2CHW A;  2AWT A;  3PRE A;  4WJN A;  4N59 A;  4IC7 B;  4P1C C;  2XNA C;  1MG8 A;  2GBR A;  2BWE S;  1YX6 B;  1HE8 A;  3AE7 B;  4LJP B;  5LXI B;  1C1Y B;  1PYW D;  4ZRJ A;  4BVU C;  1KJT A;  3PVL A;  4K3C A;  2CHZ A;  4F8C B;  3L10 B;  3I63 C;  1I4X A;  4URK A;  1HTQ A;  1TKE A;  3VTW A;  2ON8 A;  4ARC A;  4I6N B;  5AZH A;  3P4P B;  3TMP B;  1FCL A;  2MBB B;  3R66 C;  2KK8 A;  4WUR A;  3ZLZ A;  1K50 A;  4JIO U;  4IWQ A;  5FKA C;  2ZNV C;  1YN4 A;  2C7H A;  3DVG Y;  3PRP B;  1EM7 A;  2K22 A;  5G5H A;  2RDH A;  1JWS D;  4K3B A;  3VAW A;  2WDR B;  2L52 A;  2N7J A;  3QA8 A;  4EOY A;  2D3A A;  3N1Y C;  1P1A A;  2J4X A;  3IXS A;  2GI9 A;  3DOW A;  3IHP C;  1XLN A;  2PPH A;  2QIL A;  3WA0 A;  1DOX A;  4PS8 A;  4B0M A;  3CWI A;  2RPQ A;  5EE3 A;  1ZDX A;  2LGX A;  2WYQ A;  2N1V A;  3ZNI D;  5BMI A;  1FNW A;  4RGN A;  3T3N A;  4IM2 A;  4K81 A;  1KH0 A;  3O65 B;  1QKZ A;  1D6E C;  2IND C;  1OQY A;  2LWP A;  5EE1 A;  2J42 A;  1V49 A;  3AED B;  4RM9 A;  2JXX A;  3DWG C;  4WWN A;  3FIL A;  1F2R I;  1FIQ A;  2CS4 A;  1TS4 A;  3AE4 B;  1ZXI A;  4ACF A;  3U30 A;  2CHX A;  1E6E B;  2VZK D;  1BT0 A;  5JXV A;  1V8C A;  2LGY A;  4US9 A;  1TT5 B;  4HCN B;  4EE2 A;  3C0R B;  2YLM A;  3ZTC A;  1WJ4 A;  1E90 A;  2V4I B;  2RMM A;  4CHK A;  1FFV A;  3EHV A;  3ZW3 A;  4QAY A;  3RN9 C;  2NS5 A;  1YMH E;  2M0X A;  2HE7 A;  3VR8 B;  3IT4 B;  2LMC A;  1TKY A;  3NS1 A;  1WR1 A;  3UQA A;  1VDV A;  4GDK A;  3GOE A;  4UDU C;  4MM3 B;  2CR5 A;  1H4R A;  2IDY A;  3FKY A;  4NAM A;  4GSW A;  4C00 A;  1RAX A;  2BF8 B;  1NDD A;  2DAJ A;  3AU5 A;  3IAS 1;  4L1B A;  4ZYS A;  5DPW A;  2GBM A;  3CSF A;  3DPD A;  1SXT A;  5JH5 C;  3P4S B;  4CYE A;  1VR9 A;  1OFF A;  1FRD A;  2ZPY A;  2SAK A;  4M01 A;  1ZUD 2;  3DBS A;  3KUC B;  5DPS A;  3Q8B A;  3VR9 B;  4E71 A;  1JWM D;  2HTM E;  3AE5 B;  2NVU I;  2NPT B;  4AQ7 A;  3L13 A;  2JZP A;  2N9P C;  3ML8 A;  3RNG C;  1WM2 A;  3NVZ A;  2GOW A;  2MJD A;  4BBN C;  2BB6 A;  1T0S C;  4PT5 A;  3WAN A;  4O1N A;  1SJH D;  4ZOH C;  1WWT A;  4ANU A;  5AUK A;  4M8N A;  3HM6 X;  2YEP B;  4S17 A;  4N6E B;  1CQV A;  2M4N A;  3X0W A;  4ZYN A;  3DWM A;  3GE3 C;  2O6V D;  1GG3 A;  1E0Z A;  1OQQ A;  2DHZ A;  2L3Z A;  5BMG A;  4GN1 A;  2RDG A;  1D5X C;  1VJK A;  2N9L A;  1NEK B;  4NAW B;  1F77 A;  1VZ7 A;  3R7R A;  3TEX A;  5HHD G;  3L08 A;  1EU3 A;  1X1M A;  4ICV A;  3B2G A;  1YNT E;  4RFB A;  4MH0 E;  3CF6 E;  1OEY A;  2EEL A;  3QAQ A;  3QQ8 B;  1BXT A;  1JWA D;  1G6J A;  5H92 C;  4BOS C;  2MP2 B;  3A9K B;  1ET6 A;  4X57 B;  1FXA A;  2KC2 A;  5JHB A;  1FCC C;  2R2Q A;  2LRU A;  1MG4 A;  2SEB D;  1M4V A;  2JVC A;  1VD2 A;  4DHZ B;  1HZ6 A;  2KWD A;  4RF0 A;  3HIZ A;  2JQR B;  4MJS B;  2C60 A;  3P63 A;  1DOI A;  3W2D A;  1MHX A;  4JQW C;  1I35 A;  4FA6 A;  2QEJ C;  3ZKJ C;  1EF1 A;  3AE6 B;  3SD5 A;  2QSD A;  4GDL B;  4LK0 M;  2QJL A;  2KTR A;  4PYU A;  2JYE A;  3A1Q B;  4XDC A;  2L76 A;  3Q3F A;  3AV8 A;  1WGK A;  3K9O B;  4E3C A;  2BYV E;  3VDZ A;  3TIX A;  1C3T A;  5DPR A;  5FR6 A;  3EFU A;  1UBQ A;  3WCQ A;  4W9J A;  2DYB A;  1WJ6 A;  4MM3 A;  3KQ4 A;  4RGM A;  1E10 A;  1XLO A;  1SE9 A;  4N9F 4;  1T5X D;  1ZOY B;  1I4H A;  2KVZ A;  2L1A A;  2IPK D;  3DBL B;  3ECI A;  4P1B C;  1YX5 B;  4RMA A;  4IWP A;  2JT4 B;  3AH7 A;  4XX5 A;  2MW5 A;  5C3J B;  2ZW0 A;  3LXF A;  4P7I A;  4B95 A;  3L0W B;  1NI2 A;  2JPH A;  4W9C A;  3GS2 A;  2L0F A;  1P7F A;  5D3D A;  2PTL A;  2H89 B;  1WRD B;  1V97 A;  4KV2 A;  5BMH A;  2K5P A;  3KUD B;  2UU7 A;  4NJC A;  4MGY E;  1WGY A;  2CJO A;  3J9C A;  1V6E A;  2WXK A;  3ZJT A;  2KNB A;  4KGT A;  3OJ3 A;  1KLU D;  5T8I A;  1IGD A;  3ZRF A;  4XWW A;  4BKG A;  1OTR B;  2KWC A;  3Q3M C;  4DHJ B;  4AS1 A;  3EGR A;  5IO9 A;  1L0X B;  1WI0 A;  4DHJ D;  1PGA A;  2FCS A;  1QLB B;  1GOZ A;  4GLS C;  4AP4 C;  2V3S A;  1FD6 A;  4JWU C;  3NRZ A;  4XGA B;  4J3O D;  3ABV B;  2D10 A;  1EWC A;  2JZZ A;  4LNI A;  1T0Y A;  3PO0 A;  3A33 B;  4FAD A;  2WXQ A;  2GMI C;  1UH6 A;  2WWZ A;  3AE3 B;  3IT6 B;  4HPM B;  3W1Y A;  3PHX B;  2PJH A;  3X23 A;  1C76 A;  4KSL C;  2KT7 A;  1CZP A;  3BY4 B;  3M95 A;  5IKC M;  2KO3 A;  3UIP B;  1V1P B;  4WIP A;  3V6E B;  4MDK E;  1SIF A;  4W9H A;  2FCM A;  2BVC A;  2KN5 A;  3ZRC A;  4YXD B;  3KVF B;  1L4Z B;  1N63 A;  2C7N B;  1ENF A;  4EEW A;  4PK1 A;  2X38 A;  2KFJ A;  2GBJ A;  3KUZ A;  1J19 A;  2KFK A;  3DBR I;  5I4D A;  1IGC A;  2MCN B;  5LLI A;  2JRI B;  4GOC A;  4NQK E;  2KAN A;  3U52 E;  2KDF B;  1E5W A;  2AEH A;  4E74 A;  5LXH A;  1FM0 D;  2BT6 A;  2DNF A;  4TMA B;  2N1W A;  1PUT A;  1C4C A;  1FFU A;  4P16 A;  3HVZ A;  1KFY B;  2IY1 B;  5D3I B;  5G55 A;  1K8R B;  2WP9 B;  5EDS A;  5IN7 A;  4NAW A;  3ETR A;  4P6V F;  4HVB A;  1C4P A;  1ZPS A;  4FBJ B;  3VFK A;  1UD7 A;  2FUG 1;  5BYS A;  4RM8 A;  2ZNV B;  2WNM A;  3RYT A;  1RRB A;  1N5W A;  3DQV A;  2HTH A;  1YJ1 A;  3VVW B;  3ZVV A;  3IAM 1;  5BYQ A;  3Q3O C;  2VZK B;  3KYC D;  2KHW B;  4ANX A;  3APD A;  3GB1 A;  4HXD A;  3DHI C;  4C4V A;  5AZG A;  1FRR A;  4MGI E;  3NVV A;  2D2Q A;  2AYO B;  3RD2 A;  2DZM A;  1N61 A;  3V3X A;  3ZGZ A;  2FAZ A;  2DZK A;  2LXA A;  4KDI C;  1KF6 B;  3RPF C;  3E56 A;  4L23 A;  2WLB A;  2A5U A;  3PZ8 A;  1YD8 U;  5CHF A;  3BVG A;  3ZUN A;  2RSU A;  2KAJ A;  1WMH A;  2MQJ A;  1JRO A;  4AOF A;  1WGH A;  3P42 A;  4EZK A;  1N6Z A;  1MJD A;  1B1Z A;  2KKC A;  2DYO A;  3PTF C;  3D32 A;  2ZPN A;  5E6J A;  4YSZ B;  1QF6 A;  2V9H A;  3EC8 A;  3APF A;  4YSX B;  4G50 A;  2EKE C;  2KWV B;  3RZW C;  2O2V A;  2J0J A;  5G5G A;  4WJP A;  2L00 B;  2QCZ A;  1TTN A;  3Q8C A;  4FHJ A;  4ANV A;  1NI3 A;  4DXF A;  4MEM A;  5GXG B;  1WXS A;  4DWF A;  2V3P A;  3AMZ A;  5JHA A;  3QHT A;  2LRW A;  4F1S A;  1N5X A;  2BYT A;  1WZ3 A;  1K51 A;  3HHM A;  1WXM A;  4FJV B;  2JF5 A;  3HVD A;  1MVK A;  2KDB A;  4MEL A;  2D3B A;  1FNU A;  1UWX A;  1QZE A;  4FLH A;  1Z5S B;  4IKG A;  3BVM A;  2KQ7 A;  3UQB A;  3Q8E A;  3PRZ A;  4KVG B;  2BS3 B;  1R4M B;  3UI3 A;  1IYF A;  1JAL A;  3KH0 A;  3P2B A;  4GMV A;  3FIL B;  1HXY D;  5J18 A;  1J7A A;  1Q0W B;  1L7Y A;  4HJG E;  4HPL B;  1YJJ A;  3H7S A;  2BKF A;  2WHI A;  2C7M B;  3NVW A;  4II3 B;  4RCO A;  2WQY B;  2Z8L A;  2QIE B;  1TJE A;  3DHH C;  3B2F A;  3BWU D;  3BYY B;  4BAX A;  4EKU A;  5TR5 A;  1JWU D;  2KQS A;  1L5P A;  1PGX A;  2W54 A;  4EUT A;  2JXT A;  4KSK C;  4BKS D;  3M3J A;  2M17 A;  3R7Q A;  5CTR C;  3MFG A;  2MSE D;  1RFK A;  4M0W A;  2NPT A;  1HEZ E;  1ZE3 D;  2WXL A;  4K1R B;  1SBB B;  3H6N A;  1D5M C;  4FXC A;  1GC7 A;  2BTE A;  3H9D A;  2WXH A;  4W9E A;  1SF0 A;  1L0V B;  3MTN B;  1FMA D;  3P4R B;  1ZGU B;  3MP9 A;  4LNN A;  3RZF A;  1YN3 A;  3MC9 A;  1SJE D;  3DCG A;  1JRP A;  2ONQ A;  4OVV A;  2LGI A;  2K8B A;  3AEE B;  3W5U B;  5E6N A;  1BUI C;  2LVO A;  3V60 A;  2KX0 A;  2MEK A;  1EF5 A;  1VRA B;  1I4Q A;  1CMX B;  2WXM A;  2RDB C;  3UF8 A;  4HLE A;  1UBI A;  1B9R A;  2FE8 A;  2IO0 B;  2KXJ A;  1SE2 A;  3TEY A;  4WQO B;  4WH4 A;  2DLB A;  3R2T A;  3EUB 2;  3U2S C;  2H88 B;  1QT9 A;  3GZN I;  3OLM D;  4K7U A;  2NCN A;  1N62 A;  1L4D B;  2GRI A;  3DVN V;  4J6I A;  2XBB C;  3DBH B;  3U7D A;  3ZXR A;  4HRS A;  1F52 A;  2OED A;  2TSS A;  1KOT A;  5C2T B;  5L83 A;  3N30 A;  2VH1 A;  3IVF A;  3ZNH B;  2EKI A;  3N3K B;  2WXN A;  4BFR A;  2HJ1 A;  2LVQ A;  2FBW B;  4WQM A;  4I6L B;  1YQB A;  1UGM A;  2XK5 A;  2MLB A;  1WJN A;  3AM9 A;  1RFA A;  3TL5 A;  3EA6 A;  3Q8A A;  1Q5W B;  1E8W A;  1QQR A;  2LUE A;  2N9E B;  3L54 A;  3QWZ B;  4ZRQ A;  3PRM B;  3H7P B;  4W9G A;  2PVG C;  1EU4 A;  2KWU B;  1MHH E;  2DWQ A;  4BKS A;  4XYC A;  2L32 A;  2QMT A;  1YQ4 B;  1TZO A;  5BYR A;  3QAR A;  4IM3 A;  2Z0E B;  1HA5 A;  2D3C A;  2M56 B;  3RT3 B;  1PDX A;  4HCP B;  4GU2 A;  2WU2 B;  4KKJ A;  1STE A;  3PGE A;  4XWT A;  4Q2J A;  1TS5 A;  2G1E A;  2JSV X;  5IAA C;  2LGD A;  2MP2 A;  2JU6 X;  3MJW A;  3H7P A;  4NZL B;  3H8H A;  1L2N A;  4BZA A;  3A9J B;  2JYT A;  4IUM B;  4OZB A;  3QCA A;  1KM7 A;  4KIK B;  3P1M A;  1R4N B;  3ZYY X;  2JWU A;  2W3S A;  1EUV B;  4MAC A;  3DVN U;  2INC C;  2BS2 B;  3V6C B;  3UGB B;  4W9D A;  2OHF A;  2INP E;  2K25 A;  2AX5 A;  2W3R A;  1OQR A;  2WX1 A;  2MH7 A;  3QX1 A;  3KW5 B;  1L6U A;  2E3T A;  3RI7 C;  3TEZ A;  2K8C A;  4NY0 A;  1GUA B;  2MBO A;  2I38 A;  4I6P A;  1C79 A;  2M19 A;  1P3Q U;  2MHJ A;  3SFD B;  2AQ1 B;  3APC A;  3W1S C;  4DDI D;  4DDG D;  1WZ0 A;  2L7R A;  4NJ6 A;  3CMM B;  5H8Y E;  4TV3 A;  2ZCC A;  1M94 A;  3KLS X;  3FC4 A;  1IPG A;  4HRO A;  2PIA A;  1F2R C;  2LJ5 A;  3SFE B;  1S1Q B;  4JPS A;  2O6V B;  3L16 A;  2W9N A;  5J2R A;  3QC8 B;  1YOV B;  3VTU A;  1E8Z A;  3AEC B;  2KLG A;  1K52 A;  1ZP0 B;  4GIV A;  5IP4 D;  2IGH A; 
#chains in the Genus database with same CATH homology
 3Q2A C;  3RMK C;  3DHG C;  1T0R C;  3Q3O C;  3RI7 C;  3RNG C;  1T0Q C;  3RNF C;  3RNE C;  3DHI C;  3N1X C;  3I63 C;  3GE8 C;  2INC C;  3RNA C;  3RNB C;  3GE3 C;  3DHH C;  3I5J C;  3Q3N C;  3N20 C;  3Q3M C;  2IND C;  1T0S C;  3RNC C;  3N1Y C;  3RN9 C;  3Q14 C;  4P1C C;  3N1Z C;  2RDB C;  4P1B C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...