3N29A

Crystal structure of carboxynorspermidine decarboxylase complexed with norspermidine from campylobacter jejuni
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
381
structure length
371
Chain Sequence
FYEKIQTPAYILEEDKLRKNCELLASVGEKSGAKVLLALKGFAFSGAMKIVGEYLKGCTCSGLWEAKFAKEYMDKEIHTYSPAFKEDEIGEIASLSHHIVFNSLAQFHKFQSKTQKNSLGLRCNVEFSGRYSRLGIRAKDFENVDLNAIEGLHFHALCEESADALEAVLKVFEEKFGKWIGQMKWVNFGGGHHITKKGYDVEKLIALCKNFSDKYGVQVYLEPGEAVGWQTGNLVASVVDIIENEKQIAILDTSSEAHMPDTIIMPYTSEVLNARILATRENEKISDLKENEFAYLLTGNTCLAGDVMGEYAFDKKLKIGDKIVFLDQIHYTIVKNTTFNGIRLPNLMLLDHKNELQMIREFSYKDYSLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carboxynorspermidine decarboxylase
publication title Evolution of substrate specificity within a diverse family of beta/alpha-barrel-fold basic amino acid decarboxylases: X-ray structure determination of enzymes with specificity for L-arginine and carboxynorspermidine.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni 81116
molecule tags Lyase
total genus 117
structure length 371
sequence length 381
chains with identical sequence B
ec nomenclature ec 4.1.1.96: Carboxynorspermidine decarboxylase.
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00278 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-terminal sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 3n29A01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3n29A02
1F3TA 3C5QA 2OO0A 3E6EA 1HKWA 4PB5A 4BF5A 3KW3A 3ANUA 4LUSB 2VD8A 3B8TA 1VFSA 4DYJA 4BEQA 3AWNA 4AIBA 1FTXA 2NV9A 5GJNA 1TWIA 3GWQA 1XFCA 3SY1A 7ODCA 4V15A 1NIUA 2ON3A 4PB3A 4XBJA 1BD0A 4BEUA 4LUSA 1D7KA 2O0TA 4ECLA 2NVAA 2DY3A 1HKVA 1L6GA 5FAGA 4ZGYA 5BWAA 3N29A 1RCQA 2ODOA 3N2OA 3WQGA 1TUFA 5FAJA 3B8UA 5GJMA 1NJJA 4A3QA 1QU4A 4ILSA 3E5PA 3OO2A 4LUYA 4QHRA 4WR3A 3NZPA 2VD9A 1KNWA 1VFTA 1B54A 1SZRA 5FACA 1L6FA 1VFHA 2YXXA 4KBXA 3HURA 4BHYA 3R79A 3LLXA 1CT5A 1SFTA 1W8GA 2TODA 5IRPA 3WQFA 3B8WA 3CO8A 2RJGA 3S46A 2SFPA 2P3EA 4PB4A 3WQEA 4LUTB 1XQKA 2RJHA 3N2BA 3NZQA 2PLKA 3HA1A 1EPVA 3BTNA 4FS9A 3MT1A 2PLJA 3AWOA 3CPGA 5GJPA 4Y2WA 1XQLA 4XG1A 2J66A 3ANVA 3WQCA 2QGHA 3WQDA 1KO0A 4DZAA 3VABA 4LUTA 3B8VA 3UW6A
chains in the Genus database with same CATH superfamily
3DI1A 2YA2A 4JTKA 1B5TA 1JIBA 1RXOB 1W3KA 2C0HA 1TZZA 4AIOA 2QCGA 3S42A 3SUTA 3W00A 3W7RA 3TNBA 4K39A 2VZUA 4AX7A 2QCDB 4PGLA 5LIWX 3EOUA 3E0IA 2IQTA 5I79A 3VM5A 2PZ0A 2WW5A 4X2RA 1ZJAA 1P0EA 3NIYA 4NZ4A 4JTAA 4LOCA 3RN6A 3UR7A 1OYBA 4U4MA 2BGQA 1MWOA 4GY7A 2ZFAA 1EOKA 3ZWTA 2PGEA 3A5FA 3NUKA 4S3EA 5C6MA 2OYMA 2EG6A 4PC8A 3A13A 4Y8EA 4D6JA 1R2RA 1EYEA 1WZKA 2OZ8A 5DXXA 3W37A 1LQAA 1CNVA 2WYSA 2QYGA 1OGSA 4LNYA 4CUCA 4GQQA 1EHNA 3CQKA 4JQ1A 4PEKA 4DM1A 4F2UA 1EJRC 3LHZA 4JX4A 1IR2A 2ZKMX 1K70A 1J96A 2OPJA 1R46A 3CPGA 3GTHA 5EMYA 1TPH1 3W2LA 2FB2A 3QC3A 3SGZA 1A47A 3KBJA 3P84A 5C2GA 4UTWA 4B91A 2R1PA 3TTSA 2VJXA 3O6YX 3VGDA 3H2CA 3GFYA 3SFKA 3BAJA 2PBGA 1XWYA 4Z17A 3L67A 4O8AA 3WF4A 1RHCA 1CLXA 1BXNA 4QTGA 2BVWA 2ZRWA 4PB3A 4Q8MA 4R3UA 2XVLA 1TPWA 4ZEPA 1JL8A 3WLNA 1ZS2A 2I5QA 3L0NA 3QSTA 4AEOA 3RX3A 2WCGA 2QDHA 4RDWA 4GISA 3U57A 3GVQA 3A12A 4L4PA 6ALDA 3UXLA 3APTA 2J27A 2OWCA 3OGRA 4WEVX 1IEIA 4Y6GA 4HSOA 3ZJKA 1EP2A 3N6JA 3BPWA 4H8HA 3E2QA 5LHFA 4IGHA 3G2GA 2YLAA 1H7PA 1UWTA 1W3NA 3BDKA 3VE9A 1I6NA 4O19A 2W0UA 1BLIA 4QM1A 1JAEA 3F7JA 4D1JA 3WD1A 1ISWA 3OBKA 5G4HC 4EWJA 4R7WA 4XKYB 1JPDX 2OMAA 1QWGA 2HROA 2X16A 1MVYA 3GC2A 3SZ8A 1BG4A 3HIJA 2X0YA 3T09A 4REQB 2VFEA 1V03A 3M6YA 4FMVA 1RPXA 5MHBA 3NQGA 3PNZA 1JFHA 4P2VA 2WJDA 4BEQA 2NV1A 1OF6A 4MFEA 3LRKA 1VJIA 4HP5A 5FSDC 3LU2A 2YL8A 3W4RA 1ME8A 4L6DA 1PX3A 4LS1A 3O2LA 3RM9A 3IGHX 3VYLA 4DF0A 1KM6A 3WDQA 3PFMA 3OIHA 1OG6A 4WCJA 3WO8A 3WEZA 2OT1A 4TX6A 1M9HA 3BMXA 5L6UA 2O92A 3TC6A 4KFNA 2BB0A 2C1GA 1PX4A 4DWSB 4DLFA 3W73A 4P7LA 1FKWA 1G9HA 3R8HA 2QUVA 4I7VA 3CUIA 1E43A 4YVVA 4KESA 3TZNA 3GG7A 1L6FA 3MSDA 2ZUWA 4NL1A 4L6OA 5F4SA 4S3KA 3OGVA 1U1JA 3JZUA 4GMEA 3FAWA 4PL1A 2QJMA 1CENA 2FTPA 2OSXA 1MEWA 4NJKA 1LLZA 5CPMA 4FNRA 4HCLA 5I3HA 1A0DA 3LG3A 3FEQA 4J40A 2A7PA 2C18A 2RFGA 4IMAA 1SMDA 4NG3A 2VEMA 3OZMA 4AXNA 5AHNA 1MSSA 3OLDA 3KHDA 4IPNB 2WO5A 2EG7A 4GJIA 3F4CA 3R12A 3EB2A 2VOMA 3SBFA 4D6DA 3CH0A 4PBFA 4R88A 4L4MA 1TCDA 4XZNX 4N42A 2CLMA 4M81A 3P67A 2VDIA 3GDKA 1E4MM 2FIQA 3W23A 5DF0A 3VIMA 3EXRA 4S3DA 3MUXA 1E6NA 3KVKA 4MWAA 1JJKA 4CNPA 5G1YA 3W84A 3ABZA 3W2JA 2EPLX 1C90A 3GNPA 3AYRA 3BAXA 3M43A 3V1HA 2PDQA 1I2RA 2JKAA 1HKJA 1H2JA 1NF0A 1R6WA 4WKAA 2CLEA 2X1SA 1QBAA 1LUCA 2WPGA 3TLQA 4JFWA 2Z1VA 3L4ZA 3GHTA 5CGQA 4JOMA 4MY8A 1YKWA 1IT0A 3TU9A 4R85A 3C4UA 2YZ5A 3IEBA 4XZMX 3KCOA 3K4WA 5CZJA 4ENLA 1QHPA 4HKPA 2VCBA 1H1ZA 2ZX5A 3H55A 3RILA 4QG8A 3CHVA 3UWQA 1BWLA 3UWVA 4Z1DA 4NIRA 2ZZ3A 1AH3A 1FWRA 3C3UA 4O1EA 2ASHA 3LMYA 4C5ZA 3EDKA 4Q8PA 5F1VA 2ZDSA 3INPA 1LP6A 3IWPA 2GZXA 4FLRA 5D4YA 3EA2A 4ATLA 2XZ7A 4NNBA 2E6DA 4TIMA 4ATWA 2JF7A 4HNNA 4FF7A 4DEFA 2DT1A 4G1NA 4DBEA 4TUFA 4C6CA 4DX3A 1CXKA 1JD9A 4F66A 1X6LA 4M5PA 3UT0A 4GXMA 3PB0A 3W53A 4YYFA 3TUUA 3KW3A 4ZVJA 2W91A 1R47A 4TTUA 2OZ3A 2FLIA 4OV9A 3P5YA 4F4RA 2Y8KA 3TLLA 3UG8A 3WZ0E 5D9OA 2A3BA 4DWSC 4FIRA 8TIMA 2X2GA 1DIKA 1H7WA 3FYOA 1OVDA 3MMUA 4UOJA 1KFBA 3KE0A 1W9DM 1IE7C 1SUXA 2O7QA 3M5XA 2OKOA 1WDQA 3EXTA 2EF9A 1OCJA 1FXQA 1MRAA 2BY3A 1PIIA 3FK4A 2JE8A 5K2ZA 5H91A 2IPWA 3OQ8A 2FH6A 2V0TA 4IIHA 4AIUA 1W3JA 3NSXA 3Q37A 1UQYA 2VT0A 4JY9A 4FEZA 1YDVA 1C8YA 1BF2A 1XUUA 1KR0A 3FXGA 1P1XA 1XLAA 3BG3A 1UZ1A 5HMSA 2OEJA 4AC1X 3H4GA 4I7WA 4RDVA 3M47A 4H9XA 1V4YA 4UFLA 3BXWA 3BZJA 3B97A 4TX9A 2GL5A 1VAHA 2VVNA 2PRHA 1RA5A 1R30A 5LIUX 4JHMA 3H7UA 1HIZA 2O9OA 5BU9A 1JAKA 1OT1A 3M0LA 1OCNA 1EJ7L 2FZ9A 5GJPA 2GQ8A 1FWNA 3PTQA 3ZZ1A 3RR1A 2Q09A 1SU5A 1ZLPA 1I2QA 3IAPA 1EB3A 1I75A 3OVRA 4JFTA 3NGJA 2C16A 5CSYA 3F2BA 3GQYA 3A22A 1X8CA 2Q3RA 4CQDA 3VIOA 1KB3A 2Y62A 4E4PA 3VD7A 3VZYA 5J5DA 2AL1A 4YYCA 1ODUA 2O4QA 4XAFA 3VDHA 1DJXA 4JTHA 4BI5A 3N15A 4LV4A 2PC4A 1XX1A 1K3UA 1TVPA 2XIOA 1GEQA 1FY6A 2FH8A 3S1XA 3IVTA 4AZCA 2P0IA 4EXQA 3HO8A 2WMIB 1F6PA 2V30A 5HR7A 1E40A 2ZZ1A 3PZ9A 1V08A 5LXEA 3CL8A 2W92A 4KFOA 3TTEA 2I14A 3VCRA 2V3EA 4MPKA 2OOGA 2P88A 3BSGA 1HW6A 2IKGA 2P50A 1W1TA 4FOUA 5E1QA 5HQMA 3C0SA 1QMLA 1CTNA 1HO4A 3GVRA 4C1NA 1FHUA 5CQ1A 1UD3A 1Z41A 1Y5WA 4HPHA 3CT2A 3TSMA 1FHLA 2PWFA 1A5CA 1UUQA 2AAMA 3STPA 4OUEA 5D05A 4HNUA 5JH1A 3AMLA 5LNWA 3WG6A 4GH3A 2XN0A 2J7BA 5FF2A 2QGYA 4WY0B 2Y5EA 4M82A 5FL1A 2ZXDA 2R8WA 4IT1A 3T0CA 1TVNA 1UKQA 4U5KA 1OSEA 4N4QA 1NQ6A 2JIEA 1KKOA 5FJOA 1YTKA 3AFBA 5EA9A 3TFXA 3LCWA 4OOZA 2YKKA 3P93A 3KP1A 3ZJ6A 3U5UA 3WFAA 4HT3A 2AL2A 1BQCA 2PCEA 4NAEA 5D09A 3WIJA 3DYOA 1LCOA 1GWJA 1MEHA 3AS1A 3ALGA 2X7VA 4GI8A 2D2JA 4LVAA 4G7FA 1FXPA 1GW9A 3B05A 3UG3A 1VCGA 1ZU8A 4W8BA 5A6JA 4R34A 4LNCA 4CEXC 1PKMA 3SQMA 1B90A 1MZRA 1WKEA 1F74A 3FA3A 2BS9A 3WLTA 1K9FA 3RCYA 1V6VA 4L6HA 4F0HA 4RDYA 4A3YA 4D6IA 2OOFA 4S3GA 2D2OA 3QPYA 3GHSA 4FNQA 4FAMA 4DUOA 3UPMA 1BF6A 4M8UA 1Z6KA 4WDWA 1KWGA 5CZSA 5A2CA 4UQ9A 1N55A 3WLPA 1ECQA 1PZ3A 1TX2A 1ZBVA 3WF3A 1ICSA 1RK5A 4C6KA 2HS8A 4F40A 4LXFA 3GU9A 6REQB 2NX3A 4M1BA 1H0GA 1P1MA 2GJRA 2PU0A 3A5VA 4F3HA 4TOQA 3LN3A 2G4FA 2O9PA 3VNLA 3NDOA 3MQTA 1L2QA 3WLLA 4UQEA 5A6LA 1K8ZA 4GXWA 2J62A 4JDYA 3R7MA 1E1EA 3CAKA 1HF6A 1W17A 3L4YA 3N6HA 3QGVA 3PN8A 1KA9F 1C8VA 4DF1A 1XLCA 1UW9A 3AWNA 3W01A 2HPMA 5D04C 3BSHA 1PTAA 1K9DA 5I3KA 3JVAA 8A3HA 1Q7ZA 1N7KA 4EIVA 4LYQA 4JX5A 2PDNA 1H3GA 1QJWA 3W81A 3E9AA 3ARXA 4POCA 2I7GA 2ACSA 4E2OA 2VUYA 2DORA 5E6YA 1S2VA 3TC7A 4HSNA 3LS9A 3G8RA 5LNRA 2GGJA 2I57A 3L4XA 4UWMA 1PZ2A 2E4TA 2REQB 3RMEA 3CAQA 4TTGA 3IRSA 3EOEA 4H6EA 4UXDA 4YTRA 3T07A 3CHCA 4UFJA 4MB3A 3P82A 1H63A 1Q8JA 3UZYA 2FPYA 1ZALA 3VXGA 3M07A 1BRLA 4Y7EA 1G94A 2BVDA 3UCDA 4US6A 5C55A 4GRSA 4ZXLA 1MUMA 3DKJA 5HAOA 4Z0SA 3CMGA 1JDEA 3MT1A 3U5YA 3PBGA 2VRQA 1R3SA 2J66A 3MZNA 4L5ZA 1DIEA 1GTHA 2XH2A 2WM0A 2Q01A 3O63A 3B03A 4WLCA 3V18A 5LNVA 2WK2A 3KVJA 4QSFA 1NWRA 1TMHA 3BZGA 2W6RA 4O1CA 2QJHA 2EJ1A 4OZOA 3AMGA 4UOZA 4Z2GA 2H3DA 2BY1A 3TTOA 4RK8A 4YS1A 2ABAA 5DY2A 3KL5A 3W7NA 5AY7A 1LOSA 1CGVA 2B7NA 1TG7A 2YPIA 3URAA 3N25A 1ZJBA 2PDBA 4I5UA 1IHIA 3W83A 2XWEA 4JHOA 4DPPA 3MVTA 1O6IA 3WNLA 1M65A 2X1TA 3LCXA 4QHRA 3OZOA 1P0NA 2BVYA 3POCA 3UU0A 1XBXA 1QNPA 3QY6A 3T0DA 1J5TA 2Y0FA 1SFTA 3COTA 4JYEA 5J5RA 3QQ1A 4GI6A 1XGDA 4C6JA 2A0NA 4CD6A 4BQ5A 3PBMA 3ZLHA 3USZA 1LF1A 1HQTA 5IBXC 1ZRQA 2TSYA 3TJ4A 1R3QA 1ECEA 4XD6A 1BKHA 4IUOA 4N4PA 1EC9A 3CWNA 2P8CA 5TIMA 2WNQA 1CW2A 4EAMA 1W5NA 3PNUA 2J78A 2XH7A 1UKPA 5CCZA 3II1A 5U7SA 1J0YA 6CGTA 3BE7A 1PE1A 3EOLA 3GXPA 4J3VA 4B5WA 1QPNA 2VL4A 3VILA 3NZGA 4S3AA 1GQJA 5ENLA 3UCCA 5HJXA 2IMRA 3TOYA 1DIDA 4W9TA 5FEXA 1XFBA 4H9YA 3TYBA 4J4KA 3LTSA 1HJQA 5CBJA 3HFTA 5EFDA 4IFRA 3RU6A 2DUZA 4H83A 3HJZA 3QGAC 3H54A 5CG0A 3BLKA 5AFDA 1TPC1 3VOHA 1X96A 3NWRA 4WIWA 3WCZA 1EEPA 2X42A 2H6RA 3WLJA 3PZOA 1W5MA 5CXPA 2ZBTA 4B5SA 1PWMA 4PYSA 3LLXA 1EGZA 2FMNA 5CZTA 5T9BG 5LXXA 4KT2A 1H51A 3PZNA 4PSPA 5C2CA 1MDLA 5B80A 1JZ3A 4MIMA 4KGJA 2JGYA 4JZ5A 1QPOA 1QI3A 4C6FA 1BRLB 4HBKA 2FDMA 4LUTB 2XSBA 3RR4A 3BO9A 3H2OA 1XD1A 3M5ZA 3NEHA 1O5QA 2AAAA 3FCPA 3M16A 3UXAA 4GQRA 4W7WA 1WAWA 1FWCC 1W8SA 3FHAA 3NQDA 3EX1A 3M46A 2VMFA 3T55A 3C61A 4PULA 2JGQA 3VIKA 1F3EA 4EXBA 2OKTA 3MP5A 4Z2IA 2E5DA 3QOKA 1HJSA 1KRAC 4PTNA 1IEWA 3MKCA 2E6AA 1TTPA 2I1OA 3F03K 1B3VA 3BLFA 5EPDA 3QTPA 2OODA 3IGXA 5F4XA 2DZUA 5CJNA 3UY8A 3A24A 1RP8A 2RGLA 4UQAA 3CT7A 3HQOA 3R10A 3UEQA 2E7FA 1BVWA 2ZA1A 5AC7A 1D3GA 3APGA 5HNNA 3SJNA 3UWUA 4K38A 4TXEA 3W1MA 3WNMA 1QU4A 1FDZA 2WB5A 1GVRA 5LYRA 1R3RA 2YDAA 1UJPA 4TX8A 1VH7A 5K9DA 3TH6A 3WX7A 1WB0A 1N8IA 2G4JA 1SJCA 2FHFA 4JQ3A 2HV5A 3GYEA 1H7NA 4MDOA 3APYA 1REQA 5B7YA 3MS8A 3WNNA 1V0LA 3HPFA 3S9ZA 1UZ4A 1JZ8A 1N82A 4O17A 4XISA 3SDOA 3U9IA 2J47A 4PMOA 3WELA 2C7FA 4JHZA 4MG4A 3QXBA 2W62A 3MVIA 2VWTA 2D73A 2VEIA 1AODA 1AUSL 3RCNA 2QV5A 3R0DA 3H22A 3VKJA 3MO4A 3F4VA 4JNMA 4JTDA 1RCOB 4BA0A 3V0UA 4KMQA 1EL3A 1H41A 3N14A 2V5JA 2X1UA 1KR1A 1VYSX 4JIPA 2WMHA 4UTKA 3VOIA 1UH4A 3IIXA 1DWHM 4RE0A 4ECLA 1S46A 5TF0A 5CKSA 5D32A 1UD6A 1EA9C 2FFCA 3L21A 1W3LA 4L9ZA 5EMMA 2ANUA 2X41A 5HMDA 2QEZA 3NL6A 1UPMB 3WDIA 2O56A 4H9MA 3BARA 2XIBA 1L0PA 5AOUA 2Z29A 2F84A 1XKJA 4UNLA 1UD5A 3V75A 1HX0A 3BAWA 3AZTA 2BP1A 3UYCA 3YPIA 4DI8A 2RUSA 1F2JA 1Z3NA 2WHMA 1TA3B 2G41A 4J3TA 4Q4MA 4HNOA 3L7RA 1VRXA 4HIBA 3KDNA 4Y90A 3WDPP 1FRBA 4NRSA 3NO5A 4F0KA 4JNZA 3G1FA 2Z6JA 2CPUA 1OX4A 2R82A 3EX6A 3UR2A 4Z42C 4GIYA 2WMJA 2QUTA 2WKGA 2NQJA 3P6LA 3LPFA 1LRNA 2Y5SA 1X6NA 2OQLA 4DYJA 2CWXA 4AIBA 3LBOA 1BTMA 2XTKA 2ZE3A 3H2AA 4XBSA 2V2CA 4GI9A 4IP4A 3TVAA 1HKKA 1A0EA 3ECQA 4V15A 1GVIA 2GYIA 3ALFA 3VC6A 3KOZA 4JIEA 4UFKA 2NVAA 1QATA 4YHGA 3DHUA 3ZSTA 1UMLA 5FA5A 4A3RA 4IL0A 3WD0A 1SW0A 3IGUA 3FAXA 5A6TC 5FAJA 1OFOA 4RXFA 4GABA 3KLKA 3GVVA 1YBQB 1I2PA 4FX6M 4J3SA 1THFD 5FF4A 3PANA 1VC4A 1KRMA 1V93A 1EP3A 2YL6A 4L7ZA 3LMZA 4W5UA 3AQUA 4RKAA 3N18A 3K1GA 3GXFA 4FZIA 4N9BA 5DLCA 4FXRA 4RXGA 1XBYA 3L5MA 1JCNA 4RPPA 1DE5A 3B06A 2D22A 4PMDA 4B5NA 1UD2A 1NTHA 1QO5A 2JIWA 2FYMA 4ATDA 4DZAA 3BG5A 3GSMA 1E4NA 3A6OA 1P6CA 2QJGA 1SYTA 4MMWA 1SR0A 2ZDRA 4O1FA 4ZB0A 1MDRA 1UR9A 4NQ1A 1Q7QA 1WO2A 1UC5A 2WANA 3VD9A 2PD5A 4TQTA 4RV8A 3BGJA 1K9EA 4HZMA 3DG6A 3RMJA 1CX9A 3CWOX 3U2CA 1CPUA 3BOLA 4Z1YA 4B9ZA 3BANA 3C2FA 1A3HA 2Y6ZA 3V1PA 3VPLA 3GIQA 4RE3A 2VXNA 2E5CA 3UJRA 3UJSA 1MFUA 2F8QA 3CZJA 1A3XA 4HNVA 3C86A 4HU3A 3EKZA 4V33A 4LYPA 4IUGA 3CV2A 2V6AA 5HOSA 3HV9A 3QPEA 1W1A1 4PCSA 2ZICA 1YLVA 3UJEA 2PWVA 3A21A 3L66A 3ZR4A 2D0GA 1J2WA 1FHDA 5D2WA 3RNDA 2PE4A 4IQEA 2POZA 2VYOA 2W3ZA 2ZC8A 1XCFA 1PZ1A 2NLIA 5C7VA 2ACUA 2H8ZA 3GS6A 1E6ZA 2E77A 3MY9A 1SO6A 4MHBA 1VPXA 2PWHA 4UMBA 1GQNA 1ZP3A 3DXIA 3OODA 1SO3A 5CSUA 5E0CA 3WL1A 3VNZA 2WVSA 3G6LA 3B8TA 3LXCA 4XAGA 1E51A 4PH6A 3VIGA 3W1AA 1DWGM 3EWZA 1FCVA 5EMKA 4OT7A 1CXFA 5C8BB 3URQA 2WJEA 1OY0A 1ELSA 2RDUA 4JKLA 3ELFA 4LBUA 5C9XA 3UGRA 2CITA 4K2SA 3M4HA 3VNJA 2UY4A 1QK0A 1YXDA 4H6QA 4NAFA 1M6JA 2VQUA 1TPVA 3A4AA 2QS8A 3UWZA 1MW2A 2ZE0A 5G2WA 3KHJA 2YXXA 4WX2A 1BYCA 3I7QA 1GQLA 3EDEA 4CU8A 3MKKA 2WZMA 3VD5A 1XLIA 2CZVA 3AROA 3K4AA 3RFAA 1YE4A 4PBGA 3BGGA 2G5WA 3RDKA 3TK7A 4EPDC 1T0OA 1A5OC 3PZGA 3U7VA 5HMEA 4JFSA 1XF0A 1VBGA 4O1AA 4QS5A 1TWSA 1O5XA 3GU1A 2DZWA 3EEZA 3CH9A 1K6AA 2YX0A 3V4BA 4GD0A 1XUZA 2XFYA 1PUDA 2VURA 4PCNA 2IW0A 3NJ3A 4AWEA 4HA4A 3HGJA 3V5OA 2WSRA 4Q7IA 1GK8A 4QBXA 2J88A 4CGTA 3W7QA 9RUBA 4WGHA 1SW3A 1XG4A 4CCCA 3HG2A 3LX9A 1KTNA 3A3WA 4AD3A 2H90A 3EMZA 3L12A 3S2MA 4KF1A 2CBIA 3EWDA 3AU2A 4AVFA 3CMFA 4QISA 3VZXA 2XJ7A 1EXPA 1K03A 1Q6LA 2OELA 4CD8A 1S38A 3G6MA 3IJ6A 1C93A 3OBAA 4NJJA 4NZFA 2CXEA 4OBSA 3C0QA 2WZIA 1JZ5A 1LG1A 3ARRA 3GNRA 4LEFA 4LUYA 3NZPA 4WK9A 1UBPC 2YB1A 3CGTA 3TW6A 4F79A 3A23A 1P7TA 3E74A 3THDA 3PK7A 1MW0A 3MI2A 3AHZA 4E4FA 1TR9A 3FGCB 4LUJA 1PTDA 2JQXA 3NL5A 1GPFA 4Z1BA 2CCRA 4RZBA 3VTRA 4GVFA 3N9RA 2X8RA 4FPSA 2DVUA 4CQ8A 5BXSA 2RDWA 4AWTA 1BEUA 2DUAA 5E0KA 1SGJA 1Q8AA 4LAMA 4CQCA 4DYEA 1O95A 1WNOA 2NWSA 5DCEA 1K8CA 3C2RA 2QGHA 3LQLA 3GIPA 4XD5A 1B1YA 3N9KA 1GJWA 1LQ0A 1XBZA 2PMQA 2NQHA 2PB1A 3GTNA 4LALA 2DIKA 1FH9A 3MMWA 3E2VA 2W4XA 4Q4KA 2VEFA 1K4HA 1ZTVA 4S2CA 4JCLA 2YFNA 3WNOA 3ABQA 1V3JA 3FIGA 3HMJG 1X98A 1Z44A 4H7VA 3S9YA 2I17A 3VA8A 4RJEA 4JQAA 4YL2A 4EF9A 2O0TA 3LRLA 5KZ6A 2ZVRA 1B4EA 1Q6OA 3S1VA 4ZQRA 3G1YA 4A3HA 4RE4A 1ISZA 1EJSC 2BOEX 1FUYA 2VZTA 3U2EA 3HG5A 4PUNA 5JBEA 3H21A 4F8XA 3HGOA 1LBMA 1UKOA 3NQ7A 3IGSA 2UV8G 1Z7AA 3WH8A 5FJJA 3G3MA 1J4EA 5HULA 1DPMA 4NU7A 4XZHA 4HZ6A 2AGTA 4DJDC 2DJXA 1PB0A 2G37A 3AIEA 2DFAA 5RUBA 4HCHA 4Q7NA 2QJIA 4HPXA 2BOFX 1JI2A 3TJXA 4Q4OA 1U83A 2POTA 4GQGA 4QE4A 5A8GA 4U31A 2OQHA 4DIAA 1ZAJA 4DO4A 2YW3A 3PPHA 1YYAA 5F4WA 1W1ZA 1NDWA 4ADTA 2BHZA 1D8CA 3ARZA 1H50A 1C29A 2VO5A 4CNOA 2EEXA 1XXXA 1UA7A 1KLZA 4BWLC 2QUMA 2VCAA 1EP1A 3K8MA 3M0XA 4JPGA 1A5NC 3G24A 4GNKB 1SZEA 2Z1BA 4C6EA 3VAVA 1IXNA 4Q4PA 1IIHA 4FLOA 1BD0A 3ES7A 3B8IA 5I00A 3P0XA 3GZAA 1E4IA 3QV7A 1V3IA 2CXGA 2VX7A 4LV9A 4GNVA 3SEPA 1TMQA 3GNOA 3PWGA 2PEVA 4NX5A 3MB9A 4BI7A 2WCSA 5BW6A 5K4ZA 3TW7A 4MJ2A 4O4VA 1OC6A 4UTIA 3LTPA 3W70A 1BSIA 5HMFA 4HK6A 1RBOB 2C13A 5FJUA 4GH1A 1CGWA 3WD4A 4ZO9A 2ZUNA 2RJGA 3W07A 4HYWA 3UPBA 3ZIZA 5A6BA 2J4GA 1TSIA 1QUMA 4XX6A 4AHOA 1DWFM 3TYDA 3QFWA 2YA0A 4MJ4A 3RF9A 3MV01 5JU6A 4A05A 2FJKA 3R11A 1Z69A 4F9DA 1W5PA 3NVTA 3G1HA 3UXIA 1UASA 3ZJ7A 7TIMA 3MP3A 9XIMA 1G7VA 5AC6A 3DKLA 4XTDA 5H8UA 4MKNA 1G5AA 1LTDA 2D23A 3ZJ8A 2J77A 4QLKA 3UJFA 2XH0A 1NOUA 3MUY1 3E0FA 1NIUA 4CNNA 3TYCA 2WNZA 4KCVA 2NXIA 4LUSA 2DW7A 2BVTA 4MY9A 1FFQA 3FJ4A 1JZ4A 4RV3A 7REQA 4NXKA 5BWFA 3URBA 5HR6A 2GQ3A 3QBUA 2W27A 3DESA 1E70M 2Y24A 4QJ5B 4PMUA 1OIFA 5FCZA 3FJ6A 5CC5A 1GQKA 4OGZA 3LLFA 4JTGA 2FKPA 2JALA 2ZRZA 4QLLA 1YRRA 4HMEA 1F3XA 3UD6A 5FACA 1L6YA 1P4CA 4N9CA 3RX2A 3E49A 1OFEA 4PA8A 1O94A 4JQ2A 3MYOA 2HXUA 1OC5A 1I1XA 3SCWA 5JXQA 3S47A 4CVWA 3NPWA 2VR4A 4P8UA 1TTQA 4DWDA 1JPKA 1XD0A 1V8EA 3AS2A 2Z7KA 5REQB 5I02A 3TXZA 3AMDA 3KLLA 4J5NA 1EQPA 2CU0A 4CD7A 3NTYA 2XFWA 1S2CA 2PDIA 1KFWA 1DVJA 1GVSA 2Q8ZA 3O8AA 2YW4A 3L5LA 1IWBA 3VX1A 4QNWA 1UP2A 3W28A 1QNRA 3PZVA 4RZ6A 4C65A 2UZ9A 4RR4A 4LX4A 1RPKA 1OFBA 3CLMA 4U2YA 1V6YA 4QJ4B 4CN6A 3ARTA 1OHLA 4HYRA 4ZQCA 3VM7A 2H9AB 4WOQA 2FDSA 1ZQ5A 2DP3A 4TR9A 3IJDA 3MWAA 2VFIA 3SADA 3ABSA 4D6GA 1CGTA 4S39A 1IEXA 3VMOA 3F4NA 4DBWA 3CIWA 3NQEA 2B7QA 4ML4A 3OA5A 1W1YA 2NXHA 4K8HA 2XM1A 3AIQA 3WUBA 4A4AA 1CLVA 2CEQA 5CJMA 4I5RA 3GNXA 4KKXA 4IPPA 3D47A 3SY5A 4H2CA 3ONCA 4DQWA 1V51A 4BQ4A 4UC5A 3EDDA 3M0HA 3OP2A 2XN1A 1E6PA 3ZR5A 1UKTA 1LL4A 4KW2A 5LHEA 1KQYA 2QPXA 5GVJA 2FZMA 3CMJA 3VIIA 4KETA 4FK9A 1SZGA 5FEPA 3EOSA 4CNTA 4H41A 4PUMA 1SSGA 1UH3A 5D2TA 3FOKA 3S5ZA 2Z1SA 1A4MA 1LL7A 4JNYA 5LNUA 4Y9AA 2Z25A 4GPNA 4JIIX 1OG0A 4WSJA 5EKYA 1AMYA 3MJYA 4OBTA 3LI0A 2AMXA 4M3PA 3SY8A 3GDBA 4OQVA 2WOQA 3P80A 3LUTA 1GOMA 4MB5A 4EX4A 4U3CA 4PCPA 3MSGA 3LCLA 1VF8A 4YTSA 1XFCA 3AYTA 3DX5A 5FF7A 2XIJA 3BSMA 4PMRA 1QVBA 2JBMA 3IIVA 5DELA 2ISSA 1FWJC 1BSLA 4AH7A 1ODZA 1KM2A 4K8GA 4C6NA 2DPEA 3H2NA 3CQIA 4H04A 1XSKA 5DO8A 3N29A 7REQB 5A3HA 5C7HA 4XUGA 1R3TA 1A80A 3N4EA 3CB8A 4GYPC 5HWJA 4XSMA 3BAIA 3G18A 5A8NA 2R94A 3SRKA 3RHGA 1IIGA 1TUXA 2X05A 1U30A 4MLRA 3K8LA 3AMCA 1PYFA 1NH6A 4WUIA 5BOFA 4J3ZA 1F61A 2EPKX 2XVGA 1T5AA 3P62A 1IR1A 1M1BA 3U8GA 2CLOA 3F5JA 3KRSA 5FJIA 1DJQA 1X7IA 4I9MA 3L4VA 2Z1WA 4GZJA 1L8PA 2DGAA 4D6EA 3O06A 4EP8C 1Z89A 2GVLA 5JH2A 1TZ7A 1QR7A 3ITGA 2X09A 4JFVA 2O7SA 3RUBL 1X97A 1UIPA 3WH5A 4MADA 3QZAA 3KWSA 3S0CA 3IIZA 3S2CA 4D8LA 4IIGA 1KCKA 1TPB1 5AYZA 2AOSA 4WD0A 3MSRA 3TE9A 1UWRA 2GGGA 3P14A 3BLEA 5I6SA 4UTUA 2ZA2A 3KUMA 4KRTA 3KS5A 4IHCA 3KAOA 1M7XA 1V6UA 4CN4A 3AXKA 1E5NA 1ISVA 1G01A 1LWHA 1W0MA 3O15A 2ON3A 1I0DA 3AJXA 2PDWA 3KCLA 4YCPA 2DY3A 1J01A 3ITTA 4DELA 3LPPA 1HL9A 4AY7A 2FTWA 1DTUA 5HPCA 4IXHA 1MXDA 1Q2SA 3B8UA 2P1FA 3M5YA 4MUZA 2GJPA 1DORA 1W31A 3FHQA 4AF0A 1AD1A 4AZHA 5G4WA 3WBWA 1AQFA 1GOWA 4XK2A 1EUAA 4S3JA 3QY7A 4QLJA 3KOYA 5AN7A 1V3MA 5HXMA 5JIWA 3S9IA 4UTFA 3QZ6A 4GGHA 5A2AA 3WJSA 3MZ2A 1KCZA 4KEUA 4MJZA 1S5MA 1KBJA 3QR3A 1TZ9A 3WQ6A 4GC4A 4O11A 3KRUA 1CI1A 3PBVA 4Q8TA 5JVLA 1JRCA 4KWVA 4H9UA 4ZOAA 1BVZA 2J25A 2HRWA 4YVXA 3I4EA 3BJTA 3GM8A 3L2IA 4NT0A 2DJLA 2WBKA 1X39A 5AYYA 4LAUA 2CKSA 1D8WA 2W5FA 3BOFA 2OO0A 3O16A 3HTWA 3T78A 3UWWA 4BZYA 5LNSA 1VFSA 3DC8A 2CZ5A 2Y2WA 4H01A 3VGGA 5HNUA 3R13A 4GKTA 1TV2A 3QW4B 8XIMA 4QSHA 4FLSA 3IK4A 5AHIA 2DZPA 4W8AA 1NSJA 4DUWA 2QCFA 1H62A 4AWSA 3TV8A 3KL0A 3AMKA 3E02A 1BAGA 1F5ZA 2X0SA 2QIIA 2CETA 3AI0A 5I7GA 3SO7A 3W86A 1SJDA 3DDMA 4IL2A 2CKRA 3KCJA 3IV8A 2CLFA 4AHPA 2NQ5A 4CVUA 2DV0A 5F2LA 4ALDA 4O0QA 3NO1A 3LXBA 3E3HA 4MAVA 1TV5A 3PZQA 1CECA 3GHRA 4PTVA 4D9PA 4DJEA 3DFNA 2CBUA 3ICJA 1CB2A 1S1RA 4ZBCA 5CH9A 3PPCA 3IARA 4US5D 2D0FA 1A5MC 3VIHA 1AJ2A 5XINA 4O18A 3W7EA 2YBTA 5IM51 4OKDA 3F5LA 2ZZ5A 1DJYA 4WSKA 1PHWA 1VGAA 1TPDA 4GJJA 1FWFC 3S5OA 1JCLA 5CPNA 4GCAA 2NV9A 3VKDA 2DZAA 4XB3A 3AC0A 5BZAA 1ZBWA 1O66A 3LGGA 4JKMA 1JUEA 1Q6FA 4IISA 4MYXA 4XWUA 4P7NA 3AICA 3BH4A 3E0LA 3WQ4A 3DENA 5JMUA 2ZVIA 2QNEA 3ITCA 1H7RA 4GYKA 1O68A 4W84A 4DJDA 1NAL1 3HG4A 1P0KA 4IQDA 3N2OA 1TUFA 1JZ6A 2QDDA 2OEKA 4JY8A 3VDBA 1MRQA 2Y88A 3STFA 1C92A 1TX0A 1VENA 3GBEA 3C0JA 1S2TA 1QPQA 4PODA 4S2BA 1ENUA 1UHVA 4C6OA 5BMWA 1VQTA 2BGSA 4PTMA 5XIMA 4CQAA 1N2VA 4G7EB 5TAOA 1UP0A 5IRPA 1MXSA 2L5HA 4UTTC 2SFPA 3W9ZA 2IKJA 2J9ZA 4J7RA 4RCXA 3SIZA 3PWIA 4L1XA 1JZ7A 3N2BA 2HWGA 5LGXA 1UP3A 3MO7A 3SFWA 3T0TA 4G1KA 2TPSA 1SFLA 4CNSA 4DJFD 4HNCA 1A49A 4XG1A 3OU8A 4K3ZA 2PP3A 1BVNP 1MUWA 2FB3A 4NI8A 3H12A 5EMJA 4LFYA 6PTDA 4TU1A 1IGSA 1FWWA 3M0IA 3GKFA 1J6PA 4YVPA 2YR1A 3F4DA 3TN5A 2A6NA 2GVEA 1NWSA 1IEQA 4N9DA 3QLDA 2J7GA 5M5DA 1JD7A 2VOTA 3KBMA 5AB3A 1QPKA 3MYPA 2W61A 2Q71A 2Y7GA 1W54A 5KMYA 1L2UA 4FI4A 1QW9A 3PHAA 4IPLA 3MKVA 3W82A 3KOXA 3GR7A 4L64A 4FNPA 4C6PA 3VNYA 3NQMA 2E25A 1Y0EA 3O3RA 2WZTA 4MAZA 4HCDA 4FNTA 1T8QA 4IIBA 1IT7A 1HGWA 2XFFA 3LHUA 4I7UA 2IUZA 3CHEA 5AHEA 4BQ2A 5J04A 4K1GA 4AY1A 3PUOA 4MY1A 3T42A 3WJZA 1JPIA 4M24A 4R5EA 2OJPA 1WXJA 3LHTA 3NPUA 4HHHA 4D1IA 2PA6A 3T0AA 2HNHA 4JN6A 3GYCA 3EEGA 1K4GA 1K77A 3RITA 1UR8A 1E15A 2RAGA 1R0MA 2YIHA 4P8WA 4GE8A 2E1DA 4WKHA 3FW6A 4UFIA 3EZ4A 1KFCA 4FXSA 4QNEA 1WDWA 3UW6A 4KFPA 1X38A 3E6EA 2QCEA 3U6WA 3SURA 3TN3A 3GC4A 2WMKA 1VFFA 3IV3A 3TCEA 4Q8QA 1LT7A 1W3HA 2PTXA 4ACZA 1QAPA 1JGMA 4UZUA 4XO7A 2C19A 2OQYA 2C14A 4JTSA 1OFQA 4W86A 4K8EA 5C71A 4MOZA 3RK8A 4NNAA 1FA2A 2QR6A 4DRSA 4LRTA 1QRQA 1P0BA 4XAPA 2WZEA 2UY2A 2P53A 1HJWA 2GK1B 4P7OA 4PUKA 2DEPA 4QFUA 1HUVA 3RJYA 1XICA 2VCCA 3H2MA 2Q6ZA 2NQ9A 1A4LA 4UR8A 3E5PA 4NF7A 1KNWA 1VIWA 3OIXA 2CBVA 2VP8A 1MMFA 1QCWA 4HHPA 4HA0A 4ZODA 3S46A 3ARQA 2YXOA 3NM1A 2Y61A 3I3DA 2BXVA 1TR1A 3CXOA 4M56A 4U10A 3ONBA 1UWAA 3WF1A 4YWIA 1XW8A 1DXIA 3CL7A 2PDYA 4M7TA 4INFA 3C8FA 3I4KA 5EBAA 2IPJA 3USBA 1WZLA 3R6IA 1XRVA 1AQMA 2XM2A 3T2PA 4LBRA 3ZMRA 2ZADA 4I3GA 3TSDA 2I5GA 2EJAA 4C6LA 5CPSA 1HKMA 1MQQA 5E09A 4Q6JA 3GH5A 4AMAA 4GIRA 1F7BA 1GZ1A 3IVUA 1FKXA 1XISA 3WL0A 3W85A 4UFMA 5K3VA 4UTLA 5G5IA 3JRKA 9XIAA 1JCTA 3W6YA 4M6UA 1IEVA 3TYEA 2XFRA 4UQCA 5M17A 4UTMA 1K8YA 1A53A 1KGXA 5A95A 1PKNA 3PFRA 3B9AA 3WY1A 4PMZA 1LZOA 2PDXA 2E6FA 3WF2A 5KEZA 3LV5A 4C6BA 1KM3A 3AAMA 2X1IA 2J13A 3UJ2A 2NT0A 4Q8UA 4GZ7A 5D9PA 3GDLA 3PS7A 2PAJA 3NPVA 1KKRA 5A8PA 2PUZA 1OQFA 3E2RA 4GUFA 1CGYA 2D0HA 4Q8WA 4GUIA 1W9BM 3MI6A 3TMLA 5BOOA 4QG9A 4NX0A 3S83A 1EDGA 3TN4A 3SQLA 1TV7A 3DUGA 5KZDA 4IMDA 1E1CA 1OYAA 6TAAA 2HK1A 2IPFA 2WNNA 2JEPA 1S5NA 3THQA 1AW2A 5GQBA 1ONWA 2GSHA 3PBYA 1ZP4A 2WJFA 3RLHA 1TWIA 4E2VA 2FTYA 3EMCA 3L5AA 5HDRA 4RNHA 4UTHA 1IWAA 4YU1A 3NSMA 4HZ7A 3DAQA 3K2GA 4JEQA 3G77A 3VZZA 1B57A 3W7HA 2VGBA 5A5WA 4IJBA 1W3IA 4G56A 4PUJA 1QHOA 2CFFA 2PURA 2ZYFA 1I2NA 4HD5A 2CNCA 1JZ2A 1PO9A 4ERGA 3PB2A 3FNDA 2W66A 3D0CA 7CGTA 1GOQA 1MYRA 3I6EA 1B30A 1PDYA 2EPOA 3NOEA 3W2UA 5TQLA 4JXCA 1GEHA 3GR8A 3GTXA 4MKVA 1UB3A 2QMJA 3EWXA 4Y9MA 5DT5A 3LBCA 3R1ZA 3VINA 4IG2B 1DJGA 4KWWA 5IXEA 1UJQA 2WNWA 2ZUMA 4AZ6A 4U28A 4ZTXA 3OB8A 1X1OA 4F0RA 1XQLA 4H8UA 3W7DA 3CQHA 2J7FA 2D20A 1EZWA 1HKIA 3REQA 3SCQA 3Q67A 2WWCA 3ANUA 3ZSSA 3NCOA 4AD2A 4X0NA 4F2TA 4H00A 3I68A 1L6WA 4AZ5A 5ECVA 2XHYA 3TSBA 5LIYX 7ODCA 2YB4A 4NJGA 2DZVA 3GW3A 1R9ZA 5H2ZA 1J0JA 2Y4SA 3GU2A 3VNMA 4DJFC 4Q8NA 3U4AA 3NL2A 2Q02A 2Z26A 4RLIA 1E55A 1MEIA 3SRDA 1F8IA 1P5BA 3N4FA 2OWXA 1PTGA 2ESCA 4IH3A 4O28A 2QCMA 2A3HA 3L4WA 3BL3A 3IIOA 3CZLA 3N04A 3TZFA 3WH6A 2HJPA 3UBPC 1GQIA 3HURA 2PS2A 2OX4A 4JS3A 5DT7A 1EO7A 1EF2A 3LSCA 3UR8A 3W2NA 4EPEC 3ENLA 3PBUA 2WVVB 3SCOA 3N2TA 4HOXA 3L68A 4PB4A 1GGOA 5BXPA 2BY0A 4GWEA 3TMQA 4J35A 5BNKA 4L9YA 4AD5A 4HA3A 2W67A 2GPTA 3MCOA 4QDMA 4XVEA 2XGIA 3QZEA 1JULA 4MNLA 3LPOA 1AJ0A 3G1RA 1ICPA 5M2FX 4LCSA 1QO2A 5BRPA 2PD9A 4LJ3A 4O12A 3QH2A 5IOBA 1CWYA 4B2DA 1VBRA 4E3TA 2F61A 3DYPA 3KRBA 4NZ3A 1TWWA 3NQBA 3PF3A 5E6ZA 4QCEA 4HHLA 4RPQA 4H7CA 1GT8A 4MWAD 1XI3A 2C6QA 3NGFA 1W1IE 4O14A 2XISA 3RLGA 3VKKA 3LBMA 1PJ9A 1MXGA 4GACA 4X0VA 1OEPA 2Z2AA 3LHYA 4AC7C 3VD4A 1VBJA 1BKSA 1GKRA 3LCGA 2VDHA 1GOXA 1TIMA 3D5HA 4AD4A 2PFHA 2ZRXA 3K5XA 4Y9PA 4F0MA 2WHKA 2QJJA 2A3CA 3FVDA 4YJ5A 4C7DA 2WHJA 4P8XA 1VEPA 5FF0A 1VYPX 4WHBA 1I9CB 3JR2A 2CC0A 3IVSA 3L4UA 3AZRA 2GGEA 4WDXA 2KAUC 4NUWA 5HA7A 2G97A 1XINA 4ZQNA 3W74A 2CLPA 1H7XA 1LDCA 4OU1A 3CBWA 1WAUA 2KX9A 1OGGA 1X1ZA 4YN5A 5AC8A 3ARSA 1H7OA 3GFXA 4MNMA 2E8ZA 4CEUC 1GCYA 2C91A 1D9EA 2G3FA 5I07A 1JI1A 2CHRA 3S5NA 2DH2A 1VRDA 1IGWA 1G69A 5JUVA 5FF3A 4JTCA 5GJNA 4C6IA 4D71A 1RQHA 3N13A 2WHLA 3AYVA 4LBSA 4Y9NA 4H19A 3M41A 4YTTA 3OBEA 1D7KA 3DHPA 3IANA 2QPUA 3MJMA 4DUVA 3CNYA 2WVTA 1I60A 2R91A 4XZIA 1DQXA 4QR6A 4ZENA 1DWIM 1XP3A 5EGRA 1EF3A 1P48A 4URIA 2I56A 1HN1A 3PUDA 2OYKA 2FZ8A 1WX0A 2Y89A 4I6KA 5IHSA 2E9MA 3B0UX 1YNYA 1J2BA 3GDTA 4BF7A 2DVXA 2A3AA 4HN8A 1UWQA 3KZPA 4L9XA 4F2BA 5D02A 1RBLA 3M44A 1JCJA 4IIEA 1EWEA 3QHOA 1XRTA 1FCQA 3R94A 5LIKX 3R2GA 1V6WA 1V7YA 3VU2A 1YNQA 3RU8X 2GQAA 5AYBA 1WDDA 4IZGA 1NF7A 3QGKC 3DHFA 3B04A 2PDLA 1RAKA 4HU8A 1XIHA 4CQ9A 5CPLA 4PMQA 1UWIA 1F3WA 5HQLA 1GJUA 5BYWA 3SB0A 4GUHA 2YDQA 3NZRA 1I2OA 1MFVA 2OG9A 1FWBC 2OZTA 5LSMA 2CZFA 3GWQA 3M5VA 4O50A 2Q8LA 4M51A 1TE6A 3P0WA 1JRBA 1QW8A 1ZB5A 1WPCA 5HUOA 4QG6A 3AUOA 3W29A 3QQWA 1L6GA 5CC7A 2IKIA 1Q5MA 4KERA 9CGTA 2NLYA 4WQ6A 3I6TA 2JFEX 3ZLGA 1VKFA 7XIMA 3RPDA 3ERPA 1Q6GA 3DC0A 4XSLA 3SN4A 5CPQA 4H8NA 4GOAA 4TMBA 1FH7A 5DMNA 1OZMA 3AIRA 2ALDA 4ZA0A 1LM1A 5BRQA 4BK9A 2VC6A 4AZGA 3NOYA 2ZXAA 1JYWA 1XLEA 2WC7A 5D03A 1Q13A 2CBJA 3THCA 8XIAA 4LY4A 1XM3A 1Q45A 5ABGA 1RQEA 2ZRYA 4O57A 3LHVA 4ZQMA 3QPZA 4PMXA 4DNHA 1JCMP 2EG8A 1RQBA 3W7MA 4PRTA 4WSHA 2PLKA 3WMSA 4FIQA 4BS0A 4JN7A 2QW5A 1JQXA 5E5CA 3L65A 5ECUA 1V02E 4MWAB 3NQ2A 1QI0A 1UR1A 4CCEA 2VGGA 2G96A 3JUGA 2FPTA 4EACA 3C5QA 3W7OA 1M03A 3VNKA 3F2CA 1XDMA 4UOQA 2HK0A 1KBIA 2V82A 1XIBA 1LUCB 4C6QA 4QRNA 4LVDA 4FOKA 3UZ5A 3EX4A 1S5TA 2D1ZA 4L80A 3M0ZA 4DI9A 1UA3A 1DIOA 1KV8A 5BWAA 3DYMA 1LJYA 1C3FA 1PYMA 1AW1A 3S6TA 3WUGA 2LLEA 3ATYA 4QXIA 1DEDA 5I3FA 2GOUA 2R9RA 2XIMA 3A64A 2GVYA 4M1RA 1KTCA 4PUDA 2WMGA 2NX1A 2V81A 1U2YA 5T91A 2VZVA 3VMNA 4FNSA 3NL3A 2Y8VA 4GQBA 3SW6A 1K7FA 2QKFA 2VVSA 3H24A 2C15A 4E0CA 4HA1A 4AW7A 2Y63A 2YZRA 1S39A 2IQ0A 1EC7A 3W75A 4LVBA 3ZVHA 2GJXA 2QHAA 4IFOA 2BLEA 1E9IA 1FQ0A 3UZWA 1WBJA 1XQKA 2NT1A 4DBUA 4EOUA 5HPOA 1S3HA 1HTIA 4P5UA 3EDFA 3BGAA 5AYIA 3LZ5A 4ZCWA 2WSPA 1NFGA 3S6DA 1U5HA 4LC6A 5D37A 1GKPA 2INEA 1UD4A 4XAZA 4AZBA 1EJTC 1W37A 1YNPA 4Y9OA 3EKLA 4PEEA 3E96A 3JZEA 1QBBA 1H11A 3WLSA 4TO8A 1TE1A 4FXJA 4EXAA 1JR1A 4BEUA 3KWXA 1JXKA 5HBFA 3WLKX 1YDOA 5FJPA 4IX0A 5DQPA 1JVNA 1FCUA 4HTBA 1CZ1A 3N3TA 2NXGA 4EVZA 3SR7A 4KIRA 5A2BA 1KC7A 2EXOA 1TFVA 4A6GA 4E8CA 1IZKA 3FSUA 5AHFA 3FA4A 4B5UA 1M04A 4IIFA 1VJZA 3OQEA 5D30A 2A6LA 3GUWA 1NU5A 3VFLA 4E3VA 1CLKA 1Y65A 3SRHA 4C5YA 4JTTA 4TV6A 3WQWA 3KVMA 5GPRA 1XG3A 1I0BA 3S1UA 4HOWA 4GVGA 2CHNA 4ERAA 4MWAC 1MI3A 1G67A 2RDTA 2QF7A 4JD4A 4EE9A 3MMTA 2O4MA 1PEZA 5HQEA 4ASTA 1UR3M 5A8MA 3EPMA 1CXIA 2RJHA 3GR4A 3GXNA 4UMAA 1EJWC 3KTXA 4MUPA 2YCLA 1H49A 2DW6A 4GFSA 2V67A 2GDUA 5GNXA 4RNFA 1A5LC 3WQCA 3WQDA 5KZMA 5E9AA 1VBUA 3QHNA 1F3TA 2GVGA 6A3HA 1XIMA 5MKGA 3KS6A 2OSYA 4OV4A 3QSRA 3DFOA 4AZCB 2OCZA 3LERA 3O07A 3SGGA 2V3FA 3FDKA 2NZLA 3FN9A 5M03A 1V0MA 2J9XA 3QR0A 5F7UA 2CZEA 5CAKA 1A5UA 1US0A 3VDGA 3W72A 1DJNA 4R7OA 2ZWYA 3BQ5A 4ML9A 4LF2A 3C8NA 4R9OA 2ZTKA 3BURA 1LOLA 4PTXA 3QRHA 4C1NB 1KFLA 2QLYA 2YCEA 1HJXA 3HU7A 1VP5A 3DBNA 1OADA 4WOZA 3O0KA 3FA5A 3MI3A 4NY2A 2RH9A 5A6KA 1G4PA 1B3YA 1DJIA 1KGUA 5H1WA 2YSWA 3S5YA 4E4UA 2WKLA 2V8ZA 5G2HA 3WBAA 1KTBA 1SM9A 5A8QA 1XYMA 4AVNA 3TP4A 1AL8A 4IMCA 1WDRA 3NYDA 5K4XA 2J7HA 5I09A 3M7WA 4BKNA 1VHNA 2QCNA 3MDUA 3VE7A 2AL2B 1EBGA 1U22A 4NAEB 5I0DA 5DXYA 3OLEA 4A22A 4XKMA 3CUXA 5EBUA 2OWWA 3UCQA 3E2SA 4BQ3A 3B4UA 5JBFA 4H9TA 3BWWA 2P10A 3OEXA 3DG7A 5CPTA 1W9VA 2CW6A 2WSQA 4AVOA 1ONEA 3A3HA 1ZENA 3SN0A 4CU7A 3G0UA 2G3MA 2J8FA 1FTXA 4FR1A 3ME3A 4PMJA 4KIEA 1R5YA 3JU2A 4FHAA 5FIPA 1FWGC 2FGLA 3SCVA 2Y7EA 4CU6A 2Y7FA 3MUZ1 1J18A 2CYGA 4C7GA 5DN1A 3N2MA 3CL6A 4D8ZA 3TWBA 1BYBA 1VB9A 4O53A 1XYBA 2ZQ0A 3WEMA 4QAWA 2QCDA 2DQXA 3GH7A 1AQHA 1U1HA 4NZ1A 3G1DA 2VNCA 1AL7A 3OPSA 3IUDA 5C2XA 3R43A 1VFHA 1JNEA 2P5NA 2AKMA 3B3DA 2VFFA 3FDGA 1HT6A 2DU2A 2VX5A 2OLHA 4UQBA 1U5JA 5DRCA 2W79A 4Q3MA 1W9XA 3UGVA 4QX4A 3PTMA 1W3TA 4IX2A 3GG1A 5IFTA 1R3VA 4JAWA 3SRFA 3G1VA 3TKFA 1BTCA 3IJIA 2DSVA 4PRRA 1T99A 1WZMA 3GRIA 1FWIC 3N4AA 2YCLB 2WLZA 3ARPA 5AYXA 1YMYA 4GX9A 3ARUA 1E6QM 1ZNNA 1JQVA 4EPBC 1BXCA 4MWAE 3L2MA 1J5SA 4ICCX 1GZGA 3WBXA 5CGMA 3FJNA 2J8GA 4WRHA 2G0WA 4IGSA 2YJQA 4LYKA 3UNDA 4PBEA 3QJAA 4LUIA 1FWEC 3PBWA 2OFJA 2E9BA 1NFBA 3C2OA 4BFAA 3WMLA 1HG3A 2G3NA 3XISA 1ADSA 3EPOA 2DT2A 3GG8A 3PG8A 5A6AA 3TYAA 4PCFA 4W85A 1YW1A 1C9WA 4H1ZA 1N8WA 3B4YA 3C2YA 2BSLA 1NELA 3Q4DA 1SPQA 1XR2A 5I5RA 4DZ5A 1NVMA 4I9AA 3AISA 3UWYA 1H4PA 4UTJA 3GO2A 2DT0A 1UD8A 5H6HA 3B8DA 2DSZA 5C0QA 1A50A 1U1UA 3P60A 1DJHA 3K4DA 2JKEA 2VELA 1K7XA 1UROA 2QCLA 3T81A 2EQDA 3NQVA 1Q63A 1K7EA 3QF0A 2H8XA 1W5OA 2R1LA 1V6TA 2HSAA 1H0IA 2ZUVA 1RJQA 3SCUA 1L9WA 1Q6DA 4AUBA 2DIJA 1H1YA 4M19A 3T4WA 3LENA 1S3TC 1GHSA 1AZ1A 3UFYA 1XYCA 1YE6A 4XZBA 3HGRA 1E3XA 4JIRA 5TD4A 4XKYA 2ZC1A 4I90A 1O5KA 4UR7A 4BF5A 1LWJA 1OGBA 2V2DA 3FFSA 4AZIA 3DGBA 1FDJA 5D2XA 2OGJA 7A3HA 1X6UA 4KCUA 2Z00A 2ISWA 1WOBA 5CEWA 4BCEA 3EGJA 3W25A 1ZGDA 2V69A 4W8LA 3TFCA 3N12A 4REQA 3W02A 1T7LA 5XIAA 2BBFA 2NVCA 1V6XA 4GK8A 4LCRA 2D3NA 5DEZA 2QVHA 1NWUA 3OVGA 1XLLA 4FSAA 4V1XA 1PV8A 4RDZA 4QGCA 4AIEA 4NYYA 1C91A 2QCHA 3RJXA 3Q65A 3WK2A 2CERA 4YNGA 1EPXA 2BMBA 1Q4WA 1PPIA 4OBRA 2PSNA 3TDFA 1WDSA 4O1DA 2J9YA 5HINA 1VEMA 1HJVA 4DWSA 1POKA 3W1RA 4A2SA 3VNDA 3W1PA 2VC9A 3OGSA 4IJCA 1TJRA 3MUIA 3FKRA 4PTWA 3WQOA 1XGEA 2ZZ2A 2CZDA 1VIZA 3SUVA 5AZ0A 3WBEA 1Y5VA 3UG5A 5BXRA 2MUCA 3HF3A 7ENLA 4MF4A 2ZX7A 1OK4A 1MZHA 2VRKA 1OINA 3KVLA 4MJMA 4ZQPA 4GZIA 1XLDA 1GG0A 3WH9A 1JYNA 2WC3A 1O7AA 1BYDA 3LZ3A 3SY1A 1VFMA 4KRZA 3EDJA 2F6KA 1BG9A 1J0HA 3Q94A 1WZAA 3N11A 1JNDA 2ATSA 3O05A 2E9LA 3WSUA 5FEZA 3NZ1A 3SIMA 1ZBKA 3HN3A 1IZJA 2FVMA 4GUJA 1KM0A 1O4UA 4J2MA 4M0XA 4IF2A 3ABRA 4H3DA 2F6XA 4H2HA 3QN3A 3W7LA 3MCNA 1G4TA 2WBGA 1KQZA 5MF5A 3PZTA 2YFOA 3EWWA 1XLJA 1W56A 2QIWA 2RHGA 3B0YA 1JDCA 4U2ZA 3EA3A 1YPFA 3ANYA 2YBVA 3ZQ9A 2OO6A 4B15A 1LWIA 4HSHA 3OW1A 1ZZMA 5DMYA 2PDFA 5C9UA 4FOJA 1XYLA 4LQ1A 3T08A 1K9TA 4O13A 1J79A 1RD5A 1QNQA 1G0CA 3DFQA 1IQ8A 1W91A 1XC6A 4PB5A 1Q6EA 5HJLA 4PFMA 1G6CA 2XSAA 4ERIA 3LCHA 4FXFA 4HZ8A 4XQ6A 1DJWA 4L56A 1QOQA 4JKKA 3V0TA 2DSKA 3P3BA 4OJYA 2F7FA 4LT9A 2VHLA 4OIFA 4GQ0A 5E93A 3TQPA 1KM1A 1TRIA 1GONA 1UMYA 1ITUA 3HBLA 3LQGA 3NQ6A 1TV3A 1TREA 1VJSA 5HWMA 4B3KA 1PDZA 2PP1A 3MSYA 1Q6RA 2EKCA 1Q7MA 3MCMA 1E6XM 2TAAA 2XIIA 1Q65A 1VFUA 2DQWA 3G1AA 2HQAA 2QQ6A 2X2YA 3DH7A 3IRDA 2B7OA 5ABHA 1TQXA 4HTYA 5GJMA 3DFTA 5IFPA 2ZWZA 1JDDA 1REQB 3OLGA 6ENLA 4H6RA 2VD9A 1IXOA 5FL0A 3NQAA 3RRXA 3RG6A 3AXMA 1UR2A 4JL1A 4WVXA 5TNVA 3G3DA 1Z48A 3TQ0A 3QTGA 3GDMA 3B8WA 2E1WA 3R0KA 3CPRA 1LRTA 2P3EA 1TRDA 3W7JA 1EJXC 3LRMA 4HYVA 1EFZA 3LA4A 4Q4RA 4GVIA 1Q6QA 4GFIA 1LBFA 3ITOA 5HNTA 4Y2WA 4A29A 1OYCA 4V1YA 1R87A 2OB3A 3ID7A 8CGTA 3OYXA 1PIFA 1KW1A 3CIXA 4KS0A 1UIOA 2J8TA 1XH2A 2V68A 5D33A 2XINA 4B5TA 3RCMA 4UUIA 1OD0A 1Q6CA 3LNPA 3IJ8A 3MUCA 1PIGA 5K9XA 3ZXWA 4GC3A 1C7TA 3GH4A 3BUVA 3ZOAA 1H61A 1O60A 1JDAA 2OVLA 3FS2A 3HV8A 3K13A 1ALDA 2J74A 5AC5A 3GIYA 3KX6A 4IP7A 4ACYA 5JBDA 2VC5A 1B4KA 3ABOA 3KDOA 2J7CA 2ZIDA 3VDAA 2QXWA 3VI2A 2ZUTA 3OZYA 4X9SA 3THAA 1GOKA 1HFBA 4Y8FA 2B4GA 1TTJA 3I3BA 1P43A 1C8XA 2Z2UA 2GWGA 1DBTA 4D6CA 2E09A 2WMIA 1SJAA 2C1IA 1OK6A 1G1YA 1RY8A 3FV9A 1EJVC 1OX4B 2Y7DA 4NZ5A 4X9YA 1PSCA 3BLOA 2OT0A 3TOPA 3UESA 3LM3A 5I3GA 1XPGA 1ZAIA 5KTLA 4Q33A 3B9EA 3M0JA 4J1OA 2A4AA 3TYZA 4FX7A 2Z4GA 4IMGA 1XDJA 2FQIA 2HVNA 2OX1A 3SJ3A 5C70A 3UXKA 1BGGA 3Q45A 4LANA 5G4EA 4ZOCA 3BCJA 4NKCA 2O9RA 4KQNA 4WY0A 3SGUA 3URNA 5T26A 3MPGA 4H7ZA 3NEVA 4JBRA 4DVOA 1DXEA 4RNJA 1M41A 3RM8A 1B9ZA 3H4XA 1F9CA 3PZIA 2PTYA 5C9RA 1E0UA 4XBJA 4HNLA 3RLVA 1YADA 3TA6A 1EIXA 3N73A 2OXNA 2Y5JA 5FAGA 4X63A 3T0BA 1DQWA 1LRQA 4YCOA 2YYTA 1TO3A 1A5SA 3CUZA 1W1PA 2ZXBA 1HZYA 3H4WA 3HGSA 4DO7A 3LSBA 1EGMA 1GW1A 4A3UA 1WYIA 5T9CE 5D9NA 4LAKA 1KM5A 1K8XA 1CGUA 2X7WA 1ZCOA 3CM4A 3CWHA 4KBXA 4H8VA 3A9BA 1OBAA 3BLLA 5KINA 3WFLA 2UWFA 1T40A 1QOXA 1SJBA 4GY0A 3AOFA 4UCFA 2GWNA 3O6DA 4PMYA 4J28A 5CLWA 3BV7A 3HOJA 3GZ3A 1FWTA 4EPKA 3UWEA 3UNTA 1RVGA 4BI6A 5BROA 3S4TA 6REQA 3CYVA 3C2EA 4XVDA 1GNXA 4GY1A 1M7JA 3F4WA 4YHEA 4R9XA 3N9SA 3PR2A 2YLLA 4A8NA 2C79A 4DXXA 1L6SA 5A6SA 3E5BA 3VX0A 3DCPA 3NO3A 1VCFA 2I9EA 1GVYA 2J79A 1VFLA 4HN4A 4D72A 2DDXA 4EAYA 2DZXA 1HVQA 1F8MA 4XZLX 5IBXA 3T6CA 4A8RA 4DZHA 4Q8OA 1F05A 1TWZA 1LG2A 1XL9A 4OVXA 1KBKA 2VM8A 3TX9A 1J6OA 1RK6A 1CYGA 3CAWA 1OB0A 4H9ZA 3BAKA 1EC8A 3GB6A 4CD4A 3WBYA 3B9OA 4HHMA 2ZOXA 2BX7A 3W22A 3W88A 4ICNA 1XKYA 4N02A 3ZT5A 3ITYA 4AD0A 3AIBA 5EYWA 3A47A 3TROA 4NSBA 3DBPA 1AA1B 4PSRA 4ES4A 2XDFA 2AKZA 1J0ZA 3VGFA 2C0AA 2BHYA 2REQA 4DB7A 2RKXA 4CQBA 3V7PA 4C60A 2VEKA 1HXJA 1FVPA 1TJPA 1SO5A 3EKGA 1W9UA 2ISFA 3N19B 1A3WA 1KV5A 1N8FA 5FEWA 4LGXA 3L2LA 3VIJA 2RGMA 3SCRA 1PCWA 1FBAA 2QMKA 4GZEA 1SFSA 1KO0A 3K30A 2EPNA 1E4LA 3EB3A 4MLJA 1UZDA 3ZT6A 4GLEA 4PCTA 2EPMX 3RPTA 2XGZA 1YPIA 4JX6A 1OFRA 1XLFA 4NAFB 5KETA 4RX0A 3TAOA 4QROA 1QTWA 5A94A 4NRRA 2DH3A 3ZLFA 2QJNA 1EBHA 4ZO6A 4G6CA 1Z32X 3AS0A 2BHUA 1XIIA 4TMCA 4MB4A 1QK2A 4XBKA 3UZZA 1QHZA 3WK0A 6TIMA 1OC7A 1CB7B 1CIUA 2INFA 1ZY9A 2PC8A 3AYSA 3B40A 3CJPA 4O8RA 4AYGA 1DL3A 2BTMA 3HB9A 3F1QA 2E0PA 2P8BA 4IIDA 3CUFA 1DQUA 1WKDA 1WUFA 4D2JA 1A5BA 1EOMA 3D3FA 2VZSA 5A6BD 3GXIA 1T6MA 1TYGA 5DFAA 4QJ1A 1SW7A 1GUVA 4ZB5A 3AU6A 1JF5A 4J2PA 4AYSA 2PBOA 3CHFA 3IUIA 3KBSA 2WWDA 1E6SM 3NM3A 1ZPTA 4IPJA 1IV8A 3QHMA 1JYXA 3WQPA 1G4SA 2XH4A 4HNTA 2Z28A 3VGEA 1XRSA 4LAOA 3GVGA 2Y8UA 2FZNA 4ZTYA 1E9LA 2YYUA 2Z24A 3WLMA 5IHRA 1J93A 5CPOA 2PDCA 1H5VA 3CZEA 3PY2A 1GVFA 1P7TB 3O0FA 5CSSA 1V0NA 2G95A 3VDCA 1TB3A 3P2VA 2J6VA 2XVPA 5A6MA 3WNKA 1ICQA 2HE8A 3WD2A 1YHTA 1R85A 2R1MA 3R0UA 1RA0A 4P8VA 3UY7A 3MW7A 3BW2A 3UXDA 1XIFA 3OHMB 1KXQA 4AHQA 3BCDA 2R24A 2PCQA 2HBXA 3PP7A 3TQKA 7PTDA 4KWOA 4OUIA 3GBDA 4GKLA 3G0SA 3WLHA 3ARWA 4OOUA 4ADSA 4ZO7A 2J24A 3RM4A 3UP8A 2CESA 4QE5A 1LBLA 3STEA 1MNSA 1U33A 3NSNA 4GXPA 3AHXA 4LPCA 4B3LA 5L9FA 4U3AA 2F6UA 3HQPA 3V0SA 4MNKA 1W5QA 1DWJM 4GJ1A 2IXUA 4DHGA 4LUTA 2PGWA 4BR1A 1X1NA 4PUUA 2R1KA 3I10A 3P8JA 4QEHA 3ES8A 3H7RA 2ACQA 4ZB2A 4B3ZA 5H8MA 1QI5A 4XIMA 4DZIA 1D3CA 2BWGA 2W9MA 4HGXA 1GYNA 2FJUB 3CEPA 4MZ8A 4K7YA 2QZRA 4E2DA 2FZBA 3IJ9A 1BXBA 3PUGA 3THUA 1AH4A 1US2A 3SM0A 1O1ZA 3N6QA 4X61A 2XGBA 1UWUA 3G1XA 2RDXA 1HL2A 2GLKA 3UVIA 3WQGA 2E68A 2JEQA 3LTYA 3GAKA 3T44A 1GPWA 3TJLA 3R8GA 1OWQA 1JXJA 1WKYA 1XV8A 1PXGA 2Q8XA 3WNPA 4JTQA 4GBUA 2TYSA 1YPXA 4OFCA 2QULA 2CHOA 4ZXOA 4BJHA 4LB3A 2GJNA 4JTIA 4E8DA 2ZX6A 4L4LA 4B92A 3U7BA 1RD6A 4IICA 1TELA 2D24A 3S5SA 4JEJA 2NUWA 2P76A 1QI2A 2J6XA 1E3ZA 1MW3A 1V3LA 5I3IA 4PUEA 2DZSA 1PVNA 3GC5A 5AVNA 1OD8A 1P6BA 1QNSA 4PR4A 2VKZG 1KXVA 1IYXA 3M0MA 1YTEA 3T4CA 2FVKA 4HK5A 1US3A 4X60A 4FS9A 2OU4A 1PBGA 4ZOBA 4ZQOA 4B5XA 3UZJA 5LA2A 3ANVA 4NVTA 4PZVA 1QT1A 4J27A 3TEVA 3LCIA 2NW0A 1X8FA 3DU0A 1RJPA 3UF9A 4RZ4A 1F76A 3MBDA 4RW3A 1R3WA 4ZFCA 1ML1A 3GX9A 3UR5A 4IXXA 1XIJA 3W7IA 1DP0A 2FHCA 4TVCA 1VR6A 1BPLB 3S3GA 2OSWA 3I6RA 2XYLA 3GXTA 4PMVA 4UNKA 5I2UA 5I78A 3Q58A 3AJ7A 4GIEA 3BK0A 5BXTA 2PPGA 4QDWA 1PWLA 3PC0A 3GUGA 2TMDA 1Y7VA 1QNOA 3LGDA 1KGWA 3OJGA 1Q2RA 3QYQA 2XVKA 2YCJA 3NDYA 2Z0IA 1VEOA 4HPGA 4PUWA 4X2PA 4W4QA 1SSDA 3OG3A 1UWSA 4PFHA 4UIOA 4YTUA 3W27A 2PDJA 1EO5A 4Z2KA 4OE7A 3VOGA 4MFDA 4AY8A 3UERA 5C5YA 2DZTA 2B7PA 3BV4A 1HP5A 3S8HA 2OLSA 4JYFA 3QR1A 2WC4A 4XV0A 1TA3A 2PWGA 2BFGA 1SO4A 4IGMA 4AEFA 1V5XA 3GKAA 3DEQA 4G2DA 2VEGA 3CIVA 4LUSB 2GFTA 2PLCA 2MANA 4HK7A 4Q6XA 3H7VA 1NM9A 2VWSA 2PI6A 3QLLA 4P61A 2HPIA 1EDQA 4E2BA 1ZJHA 1XYFA 3LGEA 5D2YA 1OJXA 1FP8A 1MO0A 3H26A 1S5VA 3F2DA 4W7UA 2FHBA 2V5DA 3C52A 3VFCA 1GJPA 1EIBA 2UY3A 3PTKA 4G8TA 3SI9A 3WEOA 1YEYA 1KFKA 3HQNA 4K37A 4AZ7A 4E8GA 5FJTA 1D3HA 2V2HA 2ONEA 2DZBA 1XSJA 4M80A 3VUPA 3WK1A 5M1TA 4A8IA 2IPGA 2PGFA 4ZE4A 3ORWA 1VFTA 2Z2BA 3P81A 4S1FA 1R9YA 2E67A 1TPUA 3GNNA 1OFAA 3H6OA 3CQJA 4KCWA 4KEZA 2VGIA 3NG3A 4W88A 2GDVA 5DBUA 4OECA 1XLKA 2YCKX 3MV11 2DIEA 1YBQA 3LY0A 3BMVA 3AIVA 1KBLA 4KRUA 1QNVA 3NAVA 3P5ZA 1M7OA 4W5ZA 1J11A 3LM7A 3EB4A 1E73M 2JK2A 4HU0A 1R3YA 4C91A 4WDTA 3G22A 2V63A 4AWUA 1ITQA 3MP4A 1VS1A 3DN5A 3TR2A 5FOOA 3ZR6A 4I6VA 4DUXA 2CIPA 6XIMA 3BLIA 2HNEA 1BHGA 4LEQA 4O54A 1XJBA 1XDLA 3WUEA 3E12A 2DUXA 1JDFA 1IXQA 3TNOA 2A79A 3IJQA 3W1TA 1XIDA 2VX6A 2PODA 3DECA 3R8RA 4GO8A 4HMCA 3QC0A 3O6CA 1WP6A 3KTSA 3STCA 5I77A 3TCSA 3D3AA 3IIPA 3FEMA 1NEYA 4JIQA 5HWNA 3MTWA 2CLKA 1RCXB 1PZ0A 4UZSA 4JDBA 3T1GA 4P7RA 4Y96A 1DHPA 5JQ9A 1MQPA 1UYQA 2WSYA 5EL1A 2VFDA 2DSUA 1TPFA 1XS2A 5FSEC 1NY1A 2BGNE 1RVKA 3NXLA 1BWVA 4AD1A 1AQ0A 3KBWA 4RUBA 3A4JA 5FI8A 1WQ5A 4JL2A 3WDRA 1D2KA 1UZHA 1TVLA 3AS3A 1PCKA 1XSIA 2E5BA 4H6KA 3MHGA 4FR6A 3ZVIA 3PJXA 3FYPA 3WQEA 2CWNA 1TQJA 4LCQA 3MUAA 1QASA 3W1UA 4JCMA 4L4OA 4I9TA 1VFOA 4O1BA 3ZS4A 4DJED 1LT8A 2WQPA 1AZ2A 1WBHA 1XLHA 4LF1A 4E38A 1WKFA 3WLQA 4NASA 4GHRA 2H3BA 4MKSA 2WKJA 3S1WA 2FZDA 2HMCA 3WYZA 1XGZA 3SUWA 2BXZA 4U33A 4KWUA 1HNYA 1UCWA 4O4WA 3AXXA 4E5TA 1EXBA 2PRLA 3TA9A 4K36A 1J12A 1HL8A 2QUUA 2F2KA 3K8KA 1KXHA 1JCYA 4DO6A 1JPHA 3M1ZA 1HKVA 2C71A 1EYWA 3T7VA 2X1RA 3TONA 1XHGA 1E1FA 1YXYA 1RH9A 1XC4A 3BAYA 2OYLA 1GYMA 1UPPA 3I65A 3VCNA 4DJDD 1IXPA 2PP0A 3V16A 1RBAA 4WDUA 3VUSA 3M0YA 4B16A 3WLIA 4JQ4A 1W8GA 1Q3NA 2VRJA 3EPNA 1MQRA 3SCPA 3CO8A 1XYAA 4WXZA 1W2VA 1CXLA 2B0MA 4CCDA 2QT3A 1EQCA 1A5KC 1E6RA 3HFYA 1UH2A 1J0KA 4KH2A 3QM3A 3EX2A 2VR2A 2BODX 3ATZA 2JF6A 1HJUA 4IMEA 4QAIA 4JTJA 2NQZA 5ABEA 3BTNA 4XD4A 2YBUA 5C9WA 2PLJA 2V5KA 1GZJA 4MZYA 3WN6A 4O52A 4UBPC 3VKBA 1ZAHA 4H9VA 3QV9A 3W7CA 1UG6A 1RJRA 5FESA 2QV4A 1WE5A 3SCTA 1YDYA 2Y1HA 3NURA 5HANA 5F2MA 4M6QA 3HG3A 3LOTA 3PAOA 3RPMA 2FGBA 3TYUA 3HZ3A 4YLWA 3FJLA 2ISDA 1DTNA 4AF0B 3VOCA 2VEPA 1ADOA 3SECA 3WQ5A 3T2OA 1ZFJA 3M7SA 1RUSA 3DG3A 5CBBA 3L4TA 1QW7A 4F48A 4F9JA 3SUSA 4QITA 4XIAA 1NWTA 1KRCC 3Q2DA 2WSKA 2GUUA 3CZGA 4D6FA 2PTDA 4BWLA 3C6CA 3NPXA 5LZLA 1H09A 4L65A 1YTDA 4LS0A 4XUYA 3NVDA 4FX8A 2ZA3A 3LEPA 2V9DA 5G1MA 4JR5A 3QV6A 1CGXA 1RP9A 4AU0A 1H5YA 1JEZA 1IF2A 2DSWA 4ZE5A 2JKPA 2D2GA 1ITXA 1LYXA 4LSBA 1MNZA 3FGCA 3B0PA 3NYZA 3A9IA 4W7VA 3S6OA 3WLOA 4J3WA 1UUOA 2VDGA 2YDSA 3VMPA 4EWND 3GLCA 1WV2A 2DVTA 1NDYA 5CAHA 1HKWA 2QAFA 1AW5A 3GAYA 4XD3A 4QCFA 4A35A 1PAMA 4W87A 4NZJA 2X40A 3OHIA 4DAFA 3GTFA 5FD0A 4L1WA 2A85A 1CCWB 4FO4A 4MPQA 4LTSA 3G5EA 3LXAA 2PLMA 2XPKA 2Y85A 3GVWA 4H4IA 4X22A 2NVDA 2ZZ4A 3I3EA 4WXYA 3CK5A 1ESWA 4HMDA 2QDGA 1TV8A 4ORIA 1YQ2A 3WMCA 1VPYA 4C6DA 3CLWA 2PWUA 1NDVA 1R7AA 3W7PA 4LRSA 2EHHA 2XIQA 4J9JA 2ZXQA 1S2WA 2XSXA 4NJHA 3TW9A 3CV7A 2QVNA 4NI3A 3N2CA 2WVUA 1Y8BA 4IP5A 1WXZA 2WPBA 4M7SA 1JUKA 4YWSA 1PKLA 4MSSA 2IXVA 2AGKA 2R6OA 1XH1A 3CPUA 2A7NA 1JGIA 5E0FA 4XTIA 1ONRA 1Q66A 4DXKA 1LLOA 1TJ1A 1K1DA 4Z2LA 2Z27A 4C7FA 3NZQA 3PVFA 4RE2A 3H53A 3NDZA 2ZZ7A 2YCIX 3STGA 4NILA 5I3DA 4AX6A 3W71A 5T8GA 1S5WA 2C1HA 5D8ZA 2GDQA 2PWDA 1RLDA 1V7AA 1S1PA 4U5IA 3UZXA 1FWAC 3B8VA 3AHTA 2VENA 3OZPA 5DMMA 4IMFA 2NWRA 4Q4QA 1YIXA 4BY3A 3QMTA 5E9XA 4OWGA 3CTTA 5CZKA 3WDHA 1RLCL 4GG9A 1DXFA 1F07A 1OFPA 4WKFA 3U4FA 3MDWA 2YDRA 1OIMA 2FMOA 1BFNA 3UG4A 4GUGA 1IWPA 2PGRA 2AQOA 1PL9A 4JGDA 4ZMGA 3A3XA 1R8LA 5EFFA 3VIFA 4MZ1A 3VO0A 5D2VA 5F1UA 1RZMA 3DFSA 4G9PA 4MB1A 3ABXA 4WR3A 1SR9A 3VKAA 3DFHA 1TWDA 4AAJA 1W1B1 1DE6A 1W6TA 3R79A 3DHDA 4IWWA 2E6YA 3WLRA 4C1KA 2TODA 2BXYA 1C8QA 3PG9A 4K7VA 3GW0A 3ZYZA 3LPGA 3PWAA 2EKGA 2ZRUA 3KRZA 3UPWA 1DV7A 2YGYA 3TIMA 3PPGA 3O6AA 4YMZA 3BCFA 1QI4A 4HJFA 2HE5A 4DBDA 4QQUA 3DOPA 3KFTA 3OVPA 1R38A 3ITLA 2QAPA 3HQ1A 3FY1A 1M5WA 3MHUA 5DX7A 3W1XA 4B4FA 3HPZA 4TVDA 3S1GA 5CJ5A 2P3ZA 1R2SA 3T40A 3MMDA 4FP1A 3SQSA 2AQWA 3U0HA 3IJ7A 2G3JA 2HZGA 3GD6A 1Z42A 4N6EA 3HPAA 2XG9A 1OABA 3CEUA 2ABBA 4MDPA 1ISYA 1E56A 2YOCA 4CD5A 1NP2A 3DGRA 3TQVA 3EWYA 1O12A 2XVNA 1SFJA 1UUMA 4MM1A 4R27A 3BQ6A 3EAUA 2YL5A 3CUGA 3W1QA 3H2FA 3WFZA 2AMGA 3XIMA 4DJEC 3RO8A 1LOQA 4GYJA 1T8XA 3KEHA 2YXGA 2ZX8A 1KCLA 1OF8A 3CU2A 2TRSA 3B9NA 1IT8A 3SAZA 3CHDA 2BNJA 5BRBA 4KEVA 1E72M 2PDKA 3RXZA 1B31A 4YIWA 1E71M 4OTKA 3SSZA 2HXTA 5DANA 1DWAM 3QY8A 4S3BA 1UKSA 5I03A 3ARYA 3MC5A 2AQVA 3P7YA 3M0VA 4XO6A 2QPSA 2ZTJA 4S3FA 3W1NA 4DY1A 3WH7A 5AHMA 4CKQA 4K6AA 2Z6IA 4Z2JA 4AISA 3P74A 1KXTA 4IQJA 4YXGA 2WV8A 3WJYA 1Q85A 3R5EA 2PDGA 4DXVA 4GYPA 1W9PA 2PWEA 2EAWA 4ACZB 5D38A 3DFPA 3WDJA 2GUBA 5REQA 2V5LA 3TR9A 1AMKA 4AXKA 4GVHA 1SVDA 2WZHA 2QUNA 1R7OA 3DERA 5IDZA 1RALA 1MUCA 2HEJA 1POJA 3HPXA 1WCGA 1TV4A 3W87A 3L23A 3G8EA 1E0XA 1PKYA 4ZFMA 1GVQA 3V3WA 3W38A 3TN6A 4ZR8A 4AG0A 5I06A 1M7PA 5CGTA 3BJSA 1ZCCA 2W63A 1DOSA 3ITXA 1WXYA 3PPFA 3RIKA 3EBVA 3XINA 2I16A 4PE8A 3S2JA 3W24A 3LV6A 3CTLA 3W6LA 3RO6A 3CS2A 4A3QA 2PF0A 3LLDA 2H9AA 3JS3A 4JICA 4QEEA 3EXSA 3ZO9A 1VLWA 3PSVA 2XUCA 1TIWA 4A2RA 5F2IA 3E0WA 5HUPA 1LORA 5HNRA 4AFYA 4HPNA 6XIAA 3O7UA 4UCGA 1V77A 2UBPC 1JPMA 1YXCA 2HVMA 3PSWA 2FVLA 4PL2A 3AALA 1SZFA 4M6PA 3SCSA 1P0DA 3O1NA 1TMLA 4LH8A 3PUEA 1WA3A 2IQDA 2OZ0A 2R14A 3VABA 4F0LA 4KGLA 1ZSXA 1ZJIA 3QV8A 4N6FA 5GNZA 2ICSA 1TJ2A 2A3LA 2PDPA 3RGTA 3W6MA 3GK0A 4CCZA 3DI0A 4KEMA 3P8IA 4TVUA 3M64A 3CV6A 3T05A 4MYAA 2YA1A 1J9YA 4ZSTA 1KFEA 3HJEA 4LU0A 3VIPA 3QMSA 1B3WA 1XYZA 1E0VA 4B2DD 3PJWA 4HJWA 3J7HA 5LKYA 4Q32A 3WMBA 3AUJA 5CBIA 3EA1A 5A69A 2ADAA 3GE7A 4M29A 3C3NA 2HBVA 2MNRA 3BVJA 3UETA 1VPQA 2V5BA 1R9XA 2B31A 1PS9A 1CXEA 5ABFA 5CSRA 2C3ZA 3W2KA 4K1WA 1PHQA 1OM0A 4K68A 4UR9A 3PM6A 2QCCA 2ATMA 1KBBA 1TTIA 2A7RA 4GX8A 1AK5A 1UBSA 1E1CB 1ADDA 2NV2A 1RY0A 1BGAA 1FHVA 3B0XA 4QDPA 1W32A 3IK2A 1ME7A 3TXVA 1XRFA 2BZNA 1AFSA 1EUNA 2PTWA 2GSEA 3BLDA 3RRAA 1KRBC 3PTDA 2A3EA 1YX1A 2HISA 4V2XA 3ITVA 2VR5A 2VFHA 2PU1A 2VGFA 2GVJA 4EK7A 1EZ2A 2WJZA 5HATA 3MA8A 2OLAA 1H60A 1FWSA 1G7UA 4JTRA 1SZNA 2A2IA 3KTCA 5C9ZA 1EEXA 3IJLA 3NXFA 1MW1A 2HTMA 4RL3A 3HMCA 3WQ8A 5G1TA 2ZRVA 3H70A 4D6HA 3KL3A 4FNUA 4ZOEA 4GYFA 3F5KA 2VI0A 4ICMA 2BY2A 2A1YA 1W1VA 3EMQA 3OO2A 2I5IA 3UA3A 4O15A 2BV9A 3GFZA 1LLWA 4GO9A 4BF9A 4I8YA 1I4NA 1XBVA 2BDQA 1CT5A 4PRWA 3PJUA 4IM4A 3W1LA 1M01A 2P0OA 1UQZA 4FF5A 5FJRA 4ZZ9A 5U4NA 1EH9A 2PZNA 3NR0A 2XU2A 4ZL1A 3KBVA 3REQB 3NA8A 4OHQA 3LB0A 1T41A 3W76A 3VD3A 1QXLA 4NJIA 3U3HA 1ME9A 1P6WA 1VLIA 1KM4A 1B2YA 4HMNA 4JN8A 5HK4A 2VTFA 3OLIA 3UYIA 4B5VA 1GOOA 2VFGA 4C6MA 2GGHA 3RAOA 2PF8A 4Q4SA 3WENA 4WJXA 2EGZA 4C90A 4I9JA 3UQNA 4NYUA 3POHA 4UTTA 5LGZA 4QJ3B 3E1F1 3R4IA 4UNIA 4LVGA 1GYLA 1I45A 1FWHC 4W93A 3LNMA 3V5FA 3N17A 7TAAA 2X30A 1RR2A 4DF2A 3U2OA 3H2EA 4ADUA 2GJLA 5G2IA 1E0WA 3U2ZA 4EKJA 1Y5XA 3FXYA 4YPJA 3EWBX 3A4WA 4HOZA 4RNIA 1I1WA 1GKQA 3KP0A 3B8SA 1B54A 3BJFA 3R58A 1GORA 4WJ8A 3KXQA 5DBTA 3C0LA 4LB4A 2B81A 4XZ9A 5ABFB 3HPSA 1NFPA 3FX4A 2BOGX 4HB7A 3KOWA 4UFHA 2NX9A 2D2HA 4NZCA 3QOMA 2BG5A 1TCMA 1QPRA 3RYSA 1VCVA 2C8NA 4N2YA 5SWUA 2XZ9A 4AEEA 1XIEA 5C54A 4IOTA 2A5HA 4NXSA 5JIPA 5EB8A 3WKZA 5BOEA 2ZUUA 1F6YA 4LAZA 3VGHA 5DRIA 4GINA 4RW5A 2XWDA 1HVXA 1UOZA 1EDTA 1VYRA 5DCDA 2VD8A 1OCBA 2WLYA 4LY8A 1RV8A 1M53A 1UR0A 2PTZA 1NOWA 3W3OA 1NP0A 2A21A 1A5AA 2OTDA 1F4HA 2CLLA 3FSTA 3GXMA 4HVXA 5CC3A 1D7FA 1ONXA 1ZL1A 4WJEA 5EY5A 1B0IA 1I8JA 2KZHA 1W2PA 3OOQA 4JIHA 2ZUSA 2DT3A 4MTVA 4DM2A 2F9RA 2Z7GA 4Q7BA 1FX6A 4UTWC 2V3GA 1WUEA 4JTLA 2Y70A 4WF7A 3H8AA 2ZZ6A 1E9ZB 5I24A 3GNDA