3N29A

Crystal structure of carboxynorspermidine decarboxylase complexed with norspermidine from campylobacter jejuni
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
381
structure length
371
Chain Sequence
FYEKIQTPAYILEEDKLRKNCELLASVGEKSGAKVLLALKGFAFSGAMKIVGEYLKGCTCSGLWEAKFAKEYMDKEIHTYSPAFKEDEIGEIASLSHHIVFNSLAQFHKFQSKTQKNSLGLRCNVEFSGRYSRLGIRAKDFENVDLNAIEGLHFHALCEESADALEAVLKVFEEKFGKWIGQMKWVNFGGGHHITKKGYDVEKLIALCKNFSDKYGVQVYLEPGEAVGWQTGNLVASVVDIIENEKQIAILDTSSEAHMPDTIIMPYTSEVLNARILATRENEKISDLKENEFAYLLTGNTCLAGDVMGEYAFDKKLKIGDKIVFLDQIHYTIVKNTTFNGIRLPNLMLLDHKNELQMIREFSYKDYSLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of substrate specificity within a diverse family of beta/alpha-barrel-fold basic amino acid decarboxylases: X-ray structure determination of enzymes with specificity for L-arginine and carboxynorspermidine.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni 81116
molecule tags Lyase
molecule keywords Carboxynorspermidine decarboxylase
total genus 117
structure length 371
sequence length 381
chains with identical sequence B
ec nomenclature ec 4.1.1.96: Carboxynorspermidine decarboxylase.
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00278 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-terminal sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 3n29A01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3n29A02
3C5QA 3WQEA 2TODA 4ZGYA 2J66A 1VFTA 3R79A 5IRPA 2QGHA 3VABA 3B8UA 3WQDA 3BTNA 2PLKA 1XQKA 3WQFA 3E5PA 5GJPA 5FACA 1FTXA 5GJNA 4ILSA 4DZAA 2RJHA 2P3EA 1F3TA 3WQCA 4KBXA 2ODOA 3B8VA 1L6FA 3N2OA 3N2BA 2YXXA 1QU4A 4BF5A 1EPVA 3NZQA 1TUFA 1SZRA 4LUSA 2SFPA 1W8GA 1NIUA 1BD0A 5FAGA 1KO0A 1L6GA 4LUTB 4A3QA 3B8WA 3CPGA 2ON3A 2DY3A 1HKWA 2PLJA 1NJJA 3SY1A 1CT5A 3AWOA 1SFTA 2VD9A 1D7KA 4WR3A 5BWAA 4FS9A 4LUYA 4Y2WA 4PB5A 1RCQA 4LUSB 4XBJA 4BEQA 3MT1A 1XFCA 4PB4A 4V15A 4PB3A 2RJGA 3NZPA 3OO2A 3WQGA 4AIBA 3UW6A 1VFHA 7ODCA 3LLXA 4QHRA 3HA1A 3CO8A 1HKVA 4DYJA 1VFSA 3ANVA 1TWIA 2NV9A 3ANUA 3B8TA 4ECLA 3N29A 3GWQA 3HURA 3E6EA 1KNWA 2NVAA 5FAJA 3KW3A 2VD8A 3S46A 1B54A 4BEUA 2O0TA 4BHYA 5GJMA 4XG1A 3AWNA 4LUTA 2OO0A 1XQLA
chains in the Genus database with same CATH superfamily
3QGVA 3D46A 5C71A 4IMFA 1I2RA 3VM5A 1I75A 3AO0A 3HO8A 4JIPA 1LWHA 1H1YA 1I0DA 3PVFA 3E5PA 1VBUA 2WMKA 1YIXA 4RL3A 3MKKA 3M0LA 1MI3A 2Q01A 5BW6A 3GTHA 1GJUA 1MZHA 5LA0A 3TROA 2PDBA 3KRSA 1YDVA 3N14A 1KRBC 4W8AA 3TQKA 1C29A 3ABRA 3OVGA 3DFPA 3H2FA 3FJ4A 2Q8XA 1ITUA 4U28A 2O56A 2PE4A 4AZCB 1S2AA 4I8YA 4BEQA 3CTLA 3LHTA 1XFCA 3WLLA 2Y62A 1I2QA 1BQCA 3E49A 5FEZA 4LRTA 3ZT5A 3HPXA 2FTWA 4F3HA 2WO5A 3BW3A 3JRKA 4CU7A 3ELFA 3WH8A 5CZKA 4B90A 3A3HA 2VDHA 4BF7A 3WBEA 4DUWA 4RKAA 5A2BA 2NXHA 4LJ3A 1LLWA 4C6JA 4XIAA 4ZO8A 3AIQA 4GYPA 3CUZA 3F5LA 1YHTA 3OYZA 1EB3A 3GVRA 5F1UA 2ZUUA 4LOCA 1EBHA 5FF2A 3LCGA 3PBYA 4DZ5A 2R94A 1H5YA 2Y8KA 3AU2A 3IJ9A 4FX8A 1C8XA 4H41A 3CAKA 1HZYA 3QH2A 2HCVA 5GJNA 1HJVA 4U10A 1EP3A 4K1GA 1SSGA 1ZBCA 3FNDA 3PG9A 2WSYA 2Y89A 2VO5A 1KQYA 3WF2A 3PZTA 5G2HA 1W3IA 4YTSA 4Q4SA 1T41A 2ZX5A 1VF8A 2VRJA 1C91A 2FVLA 4BK9A 3VZXA 2ZADA 1TE6A 3LZ3A 1Q6LA 3LTPA 2BOFX 3N04A 4R7WA 1QW7A 4DWSA 2YA2A 3TU9A 6REQA 3VPLA 1G4PA 3F4CA 3W82A 2E9LA 5C2GA 4FXJA 3N73A 1MMFA 2D22A 2E7FA 4H01A 4NILA 3PZMA 1OFDA 1V0KA 4YTQA 1NQ6A 3G1DA 1OFEA 1SJDA 1HL8A 3RRXA 2PTDA 2YLLA 1ZL1A 4Q8PA 4NZ1A 1YPFA 1W5OA 4HNLA 3SBFA 1BHGA 2ACUA 3AYVA 3VGEA 5MF5A 1VFFA 1FWIC 2OSYA 3WDHA 3EXTA 4LXFA 2EPHA 2BVTA 4HA0A 2DZXA 4CCEA 1QJWA 2OWXA 3U7VA 1TA3A 1UC5A 1NM9A 4MB3A 4R33A 2FKPA 4RNHA 7TAAA 5FACA 4KESA 1OIFA 1A0DA 4EANA 2HMCA 3G18A 4LAZA 4D6DA 2EQDA 1LJYA 4US5A 2G41A 2QDDA 3B8VA 1J12A 3K5XA 4GQ0A 4QS5A 4UTWA 2QUNA 3G5EA 4UUIA 3CUJA 3WENA 4C60A 3UWZA 5HPOA 3TQVA 4B4HA 4OJYA 2G3MA 4GH1A 5BU6A 3NAVA 1E4LA 3DG6A 5C5YA 3PTKA 1DORA 2VWTA 1UMYA 1CLVA 1YXYA 1YX1A 2ZUWA 5I03A 1OFPA 3OLIA 4RDWA 4AIOA 4M24A 4DPQA 1Q8JA 3R8HA 1DYSA 1B57A 1PSCA 3UR2A 2PWVA 2OWCA 2VCBA 1ISYA 1CGWA 2WAGA 3E6EA 4I9AA 3MWAA 1Q6EA 4AD2A 5LHEA 1O1HA 3F5JA 5I5RA 4TMBA 4EP8C 5HWNA 4MADA 4Z17A 2VEMA 1GPWA 4ZQOA 4DLFA 3VZZA 4DN1A 5D9NA 3WJWA 5FEWA 3A22A 2O9TA 2PCQA 3KAOA 1F8MA 1Z8AA 1VENA 3VXGA 2ZUMA 5ABEA 1K8CA 1W1ZA 4PMZA 5KTLA 3WQFA 3WK1A 3AIEA 2QCEA 4UOJA 2BVYA 2BTMA 2A1YA 3SSZA 1ZUAX 1KW1A 2W9MA 1CX9A 3A9IA 1R3RA 3IJDA 3KBMA 5CSUA 3OQEA 3OBEA 2NV2A 1KO0A 2IMRA 4AXNA 3ZLHA 4M6QA 5DBUA 4C7DA 5CCZA 3LPGA 2J4GA 5I77A 3ORWA 3QSTA 2PP0A 2PD5A 3LS9A 5HNRA 2OQHA 1W8SA 4MYAA 4MWAC 4HMDA 4YHEA 3L67A 5HMSA 4E3TA 3FS2A 4M29A 2OWWA 4GMEA 2XHYA 3W7JA 3SCQA 2G95A 3FX4A 3I7SA 3L68A 2A6NA 3CYVA 1SVDA 3W07A 4JYFA 2WLYA 4US6A 2QCFA 2DSKA 3QR0A 3SN1A 3LV6A 2NLYA 4O54A 1U30A 1WCGA 3GG1A 4FNRA 1AVAA 2AKMA 5A8MA 3VOHA 2QAFA 3AROA 2AMXA 4UTFA 3H12A 7REQA 4K8GA 4OU1A 4OQVA 4JHMA 3BV4A 3GH5A 1MUMA 2F6UA 1L6YA 3UGRA 2JIEA 1F61A 3GR8A 4E2BA 3RHGA 3UJEA 3QZ6A 3P5ZA 5G5IA 1KM3A 4K2SA 2J78A 3DUGA 1HFBA 4JNYA 3CHVA 4CU8A 3VIHA 1CLKA 4HZMA 1FVPA 3Q58A 3URQA 2FZMA 3QR3A 4L6DA 2DUZA 2BDQA 2Z29A 5FAGA 1KB3A 2X7WA 2BGQA 2P8CA 5ABHA 3S1UA 2UV8G 1IQ8A 3BE7A 1J4EA 3QFWA 1REQB 2XGIA 4FS9A 2HVNA 3C2EA 3DCPA 1GZGA 4D8AA 5BMXA 1WUEA 1HN1A 3IUIA 1FCVA 5K7JA 3VUPA 3RAOA 1I60A 7ODCA 2I17A 2UBPC 3QQWA 3CH9A 1HTIA 3THQA 2CZDA 3WDQA 1JYXA 4HCHA 4C7GA 1PO9A 1WZMA 4O53A 5ABFA 3CTTA 3HQ1A 3IIVA 4IX2A 1TPDA 3BURA 2WCGA 1TG7A 1A3HA 1O6IA 3G1XA 1V8EA 3OZOA 4Z2LA 5GNYA 4DBUA 5DMLA 3U48A 4W5ZA 2NSXA 1UOZA 3E2QA 1V6XA 1SJBA 3AHTA 4GD0A 4F66A 4AIUA 3EA1A 4X60A 3ZLFA 3VNLA 1JCMP 3W1QA 2ZKMX 4MKSA 4Q4OA 3GUWA 2YX0A 2YPIA 1UASA 2A7PA 5DCEA 9CGTA 1OG0A 1NQKA 3GDTA 3JS3A 1F3TA 3E2RA 2ALRA 2PRLA 3VNJA 5LZLA 1Y5XA 4HTYA 1JR1A 4XKMA 3NCOA 2OZTA 4LF2A 4PULA 3R89A 5M5DA 1XI3A 2QIWA 5CH9A 3NFUA 2R1NA 2VNCA 2I14A 5DMNA 3UG4A 4ZB5A 3B8IA 2CLHA 1Y65A 1O94A 4YL2A 3OA3A 5BCAA 3GIPA 5PTDA 2JGYA 1S5TA 2OXNA 4YMZA 3NZPA 3TWAA 2ZXDA 2G3FA 4DX3A 5AZ1A 4Q8UA 1DQUA 4ONVA 1FRBA 1EO7A 1HJSA 5CC3A 3ZWSA 1J0HA 4ATLA 2VQUA 1O5KA 1EL3A 3M0HA 4UMBA 3WEOA 2YCLA 3SCPA 1OC6A 3EAUA 2BY1A 3OBAA 3LNPA 4PCFA 2V8ZA 1QO2A 4US5D 2J7HA 2PMQA 3SN0A 4MM1A 1AQFA 1E9ZB 2NQ9A 1XQLA 2QGYA 3WMBA 3OZYA 4LEFA 2H9AB 1X7IA 4N4QA 5D2TA 3WIJA 3E0IA 4K39A 2NQHA 5CG0A 1R2TA 2XIJA 1ZSXA 3KLLA 5HBFA 3NZ1A 2UY2A 4KBXA 3F4VA 2FGLA 3VA8A 1QAPA 3UA3A 1Q2RA 3AOFA 5JIWA 3GNDA 1LZOA 4AVFA 5AHLA 4B9YA 3QGKC 3L66A 2WZEA 4Q7IA 7A3HA 1RY8A 3AU6A 3UNTA 1BXCA 1G94A 2E77A 5JH1A 1GWJA 3AXIA 1WXJA 4ZB0A 3TYDA 3TNOA 4WIWA 4PFHA 4LUYA 4IMCA 3UPMA 1W1VA 1FWWA 4AY1A 1MEIA 1UR4A 3IWPA 1HKJA 3F4WA 4M82A 1K4GA 3OYXA 4WKFA 1F7BA 1A3WA 3BV7A 4K7YA 4KRUA 1E1CA 1R86A 3O8AA 1KBLA 4XSLA 1MXSA 4UTTC 3WLOA 3WBYA 5C2CA 4AW7A 4OUEA 1XBXA 1DE5A 4S38A 1OF8A 3UA4A 4TUFA 4QEHA 4ZXOA 2INFA 4GNKB 3URBA 3SCSA 3MSGA 2J7CA 5HJLA 3KCJA 1UKTA 1W3LA 3A24A 3UQNA 1G4EA 4MSSA 3BSHA 1QUMA 2YCEA 5K3VA 5I3IA 2WCAA 1V6YA 1X96A 1NDVA 5A6KA 3A3XA 3K4DA 3DFNA 1PTGA 2VCCA 3RIKA 1P6CA 1OVDA 1J5TA 1JCJA 1VYPX 2QULA 3EWCA 1R85A 1L6WA 5A6SA 3RFAA 5HMDA 4JTKA 1MNZA 5FJOA 3LHYA 3W7DA 1B90A 3BLIA 2FZNA 3N6QA 4WJXA 3QYQA 4MNJA 1LRQA 3ARQA 4PGLA 3WYZA 1ISWA 3UJFA 3CLMA 1E4NA 1SFSA 3FXYA 2VGIA 3CT2A 1O5XA 1KGUA 1XGEA 3K1GA 2OLSA 2JALA 1GKPA 4C6LA 3VCRA 1H09A 3EGJA 1UHVA 2GUYA 1TE1A 2WVUA 4EF9A 3EX4A 3MJYA 5AZ0A 3KP1A 1NEYA 2PC8A 9XIMA 1K7EA 1E1CB 5TNVA 3CB3A 4V2XA 5CBBA 1E6XM 4G2DA 2FZBA 1ELSA 5J8LA 3V35A 5FIPA 4OFCA 1CXKA 5AHNA 3TFXA 2WV8A 5FAJA 2WZIA 1XPGA 1Q7QA 4M19A 5FF3A 4S3AA 1OX5A 2VL4A 3K4AA 5DY2A 3SJNA 2PP1A 1XHGA 4O14A 1SJAA 1VYSX 2PWFA 1UWUA 3THUA 4S3EA 1VQTA 2PDUA 2FZDA 3NEHA 4E2VA 4M6PA 4DB7A 1SU5A 4POCA 4A2SA 3N25A 4GX8A 4NKCA 2WK2A 1QRQA 5EYWA 3IS4A 4FF7A 1B2YA 2RGLA 2Z00A 2GJXA 1MEHA 4O0QA 5C70A 2C14A 3WF3A 1E70M 3T2OA 3H2EA 1EGMA 4M81A 1JDCA 1R8LA 3EXSA 5CBIA 1UPPA 4F0KA 3EXRA 1FA2A 4LCQA 1R3VA 4AVNA 5BWAA 1XG3A 2MNRA 5LIXX 3G8RA 4X2RA 3JR2A 2J75A 2BWGA 3ZJ8A 3GG8A 3R0UA 1UH3A 4NAEB 4DF2A 1FWFC 1JPKA 5AECA 3ATYA 3TXVA 1NWTA 4L9XA 3GNNA 1E5JA 1EKOA 3FSTA 1D3CA 4BFAA 3MZ2A 4PTDA 3O63A 2QW5A 3T55A 3TE9A 4QE5A 2YBTA 1EOKA 2PWUA 4PZVA 4K1WA 1H7OA 5A5WA 5JVLA 3C0SA 5JU6A 4RDYA 3B9OA 4FLRA 3LPFA 1GJWA 4RLIA 2DH3A 4AD5A 3W1MA 1ZGDA 4M80A 4FLOA 4S3DA 4ZCWA 5CC6A 1DXFA 3R79A 2PTYA 3GX9A 3LGDA 4PTXA 1B3WA 1UD6A 1W1A1 3W2LA 4Y90A 2XN2A 3RR4A 4WD0A 1KBKA 2GSJA 2ANUA 3GSMA 1ZAHA 1BWLA 1BYDA 4GFSA 4AD3A 1RCOB 1UH2A 3TN3A 3W88A 4GPNA 2ZWZA 1E43A 1GVYA 3T0TA 2ONEA 3Q94A 5IBXC 4NT0A 5BNKA 3KRBA 4FP1A 4PN2A 1W31A 3T81A 2JBMA 4WR3A 1F9CA 2PTWA 3WDPP 2DZSA 2WHMA 1AH4A 2NX3A 1HJWA 3NIYA 1BAGA 4WJEA 3GC2A 4MAVA 1NDYA 1JZ2A 3LI1A 2ZZ6A 5T91A 1W1PA 2IW0A 4NNAA 2ZVIA 4QGCA 4QG9A 5T26A 2VEIA 3U8GA 3TJXA 1GTHA 3D3FA 3THCA 2Z26A 3DERA 3SR7A 4GISA 3QY6A 1UD5A 4GXPA 2V5DA 2RHGA 3NL6A 4GACA 3QVQA 4M1BA 2ZA2A 2DORA 1E73M 4JBRA 1VJSA 1IWBA 2YDQA 2ZRUA 1E71M 5D8ZA 1XLCA 1DHPA 2XH0A 1REQA 3PUDA 1JUBA 1O60A 2BHZA 3USZA 3OLEA 4UQ9A 1W91A 1YRRA 1IT7A 1H50A 2YW3A 3W7KA 1ONWA 1J18A 1VFOA 3ZS4A 4DZAA 4Q6JA 1HQTA 3C2OA 2A3EA 3OVRA 3QOMA 4L64A 2WM0A 4LQ1A 2WVTA 4KWSA 5BU9A 1SR9A 3LNMA 2DEPA 3MWCA 1H63A 1SZRA 3CZGA 3UWEA 4LUSA 4JFTA 4NAFB 1F4AA 3W7RA 4E4UA 4CEUC 1ISXA 3W01A 2PGRA 5A6JA 1Z48A 5MKGA 4WF7A 4S3CA 4OT7A 1SFTA 1SJCA 3GRIA 3BANA 1EQPA 2QKFA 3ZO9A 1A3XA 3QEZA 4XWUA 3TMLA 4CCZA 3VX0A 2IS7A 2GSEA 4FNUA 3DI1A 3V3WA 3EWDA 3B0XA 3MCMA 3BMXA 3BSGA 4LH8A 4CVUA 2CHNA 5U4NA 1CENA 1ECEA 4P8UA 3FYYA 4FR6A 3G6LA 3GVQA 3GXFA 1LRTA 1HP5A 5AN7A 2ZX9A 4QCEA 1DWAM 2VR5A 2OQYA 4F2BA 2EXOA 2CBUA 5C54A 4PR4A 4PCTA 2NUXA 4E8CA 1MDRA 4O18A 4D6HA 3PPHA 2V3GA 3NR0A 4QBXA 1DL3A 2XSXA 3KTXA 5C0QA 4A8LA 4S1FA 2X42A 1TZ7A 2D2HA 3T6CA 2NX9A 5CC5A 3W6MA 5IHRA 2Z1KA 4YN5A 3I10A 3NURA 3LENA 1RUSA 3DEQA 5H91A 3K1DA 3S47A 4E3VA 4FO4A 4U3CA 4LFYA 1J93A 1CZ1A 2GOUA 2D24A 2D2JA 3QMRA 1KRAC 4XBKA 3NOYA 3VOJA 2PURA 1PDZA 1JCYA 5GQBA 3WNOA 5LIYX 1AFSA 1DWGM 3AAMA 3W02A 2FMNA 1K70A 4PB5A 1AH3A 9XIAA 3KVKA 5G1YA 3A4XA 4V1YA 4MNLA 1EA9C 1FDYA 3VIGA 1D8WA 5A8NA 3LLXA 3G1RA 3HGOA 2YYTA 1IF2A 2IXUA 1HKVA 3U9IA 1UR3M 4PUDA 2OKTA 4AH7A 1M7OA 2V82A 3UWYA 1E15A 4R53A 3CIXA 3S6OA 2X8RA 3GXPA 1UP3A 4LS1A 1GHRA 1GG1A 1PKNA 4LU0A 4B91A 1N8FA 5HQLA 2O0TA 1XYAA 3O6DA 2JQXA 4FB7A 2QCCA 4DJDA 8RUCA 1Z42A 3O15A 2DIKA 2KAUC 1E6ZA 3UJSA 3VKBA 2NXGA 3ARYA 2WOQA 3PJXA 5LA1A 1LT7A 4UTWC 5A8PA 2FJUB 4AC7C 2C13A 2GDQA 1GKRA 4O8RA 3SRHA 1JDAA 3LMYA 2BZNA 2DIJA 2FPVA 5EMYA 3SSJA 3L0NA 1C8VA 5CPOA 3FA5A 4KKXA 4EAMA 4PUWA 3MCNA 3TC3A 3T2PA 3SRKA 4HGXA 1TPVA 3QY7A 4AD0A 5HMFA 4GXMA 2PDPA 1XYZA 4MG4A 3DKLA 2X09A 4KMQA 4C6FA 4AYGA 4Y9OA 2CLOA 2PZNA 3BJFA 5SWUA 1WOAA 4LAUA 5JUVA 1HVXA 3TKFA 2NVDA 3SCUA 3TLQA 4TVUA 1VFHA 1TPUA 4IIHA 3NQ7A 3B0YA 1HO1A 2IQ0A 1LTDA 4GQGA 3AI0A 4AF0B 2VXNA 1XINA 3PSVA 2OYMA 4N7QA 1H3GA 2I56A 1ZENA 4WJ8A 1UC4A 4J40A 1ZCCA 3S8HA 2MUCA 2C15A 3XINA 4DUVA 4A22A 2WWDA 2OZ8A 2RDXA 1BPLB 1KGWA 4J2MA 5AC4A 1NDZA 1MXGA 2VZVA 2H9AA 3URAA 5I6SA 2PEVA 2W0UA 3R7MA 4IG2B 3CV7A 3G1SA 2F8QA 1AG1O 1GOQA 3QLDA 5ABGA 3UNDA 4ORMA 3R25A 5A8QA 5EU9A 3N2BA 2PWGA 1TV4A 1TO3A 2YW4A 2PLMA 2BNJA 2FDMA 5FD0A 1I6NA 1E3XA 3F1QA 1JQXA 3TH6A 5B80A 3L23A 1LROA 2DT3A 3PSWA 3GFYA 1W54A 4IGSA 5BWFA 3ZJ6A 4JFWA 3L0KA 2A3CA 3GYEA 1L2QA 3SAZA 4YYFA 1Q63A 1Y5WA 1LQAA 3W1XA 1XBVA 3DENA 2Y88A 2GVGA 3WQOA 3WCZA 1QWGA 3ICJA 1LG2A 4LV4A 4X0VA 5JIPA 2PWEA 4ERGA 2C6QA 1YADA 3FAXA 2NUYA 4Z0SA 3WQ5A 5I78A 2JE8A 5H1WA 4Z2KA 4QEEA 1EC9A 2PB1A 3LSBA 4BJHA 3W37A 4ZOCA 3VO0A 3MYOA 4H6QA 4K3ZA 3KOWA 3P62A 3NQGA 5CZJA 4C6PA 4EPBC 1LP6A 3PZUA 5DXYA 2GVJA 4XAFA 5I3KA 1EFZA 1X1ZA 3AWNA 4KQNA 4BKNA 5FESA 4JTFA 1O95A 4DNHA 2YB4A 2ZTJA 4IPPA 1XCXA 3E12A 1EF2A 1THFD 3H2OA 3MKVA 2CWNA 3C3UA 1FFQA 1EUNA 4QJ5B 2XIOA 2CWXA 4JR5A 4ZSUA 3URNA 3VIMA 3QGAC 2FVKA 3KOFA 3FA3A 6XIAA 3MP4A 2ZZ4A 5A2AA 4ZBCA 1OINA 2VEFA 2JEPA 5ABFB 4J1OA 3PBWA 4TQTA 1JAEA 4S3JA 1J0YA 3VGGA 2ZXAA 2JKAA 3ARWA 1IR1A 2WBGA 2QF8A 4TX8A 3O9NA 1ICQA 1PBGA 3BMWA 3GC5A 2C79A 1QPQA 3AIUA 4D6CA 3SCNA 2ISVA 2FPTA 5I02A 1EJ7L 2BP1A 3MI3A 3NPVA 4HQVA 3FLUA 1EPXA 2VC6A 4ADUA 2BX7A 3W29A 5CPLA 1AZ1A 2PAJA 4HSHA 3IJIA 4YS1A 1NARA 1M68A 4ATDA 1A5OC 1KWKA 4GWEA 3B97A 2POTA 4WDWA 3QBUA 1ZP3A 1SMDA 4FX7A 2FHFA 4Z1CA 4LWWA 2I5QA 2WVVB 3S0CA 4E0CA 4J5NA 3K46A 2ZZ7A 4FNSA 3HQOA 3IVTA 4CLMA 2E6YA 3NM1A 4DI8A 4WXZA 3UFYA 4GOAA 3UR7A 3IK4A 1BSIA 3GE7A 2HQAA 3GS6A 4OOUA 2ASHA 2QV4A 1QU4A 2QVNA 5EMLA 1ZBVA 4LRSA 3UCQA 5IM51 4DRSA 3L4YA 2YCIX 2FDSA 3C0LA 4X0NA 4H8HA 6TAAA 4IGNA 2P0OA 1W3NA 2XVKA 1M03A 4CN4A 2GGIA 2GGEA 3HPAA 4UFLA 5AHMA 4DUOA 1C3FA 1RVKA 5HQMA 4L1XA 4HB7A 1KV8A 1DWIM 1W9PA 3AHYA 4HK5A 2IKHA 3QN3A 4UTMA 1QCWA 1XFBA 4XSMA 2AOSA 5A6LA 4PUUA 1ZJIA 1WDSA 1IEQA 1JF6A 3IV8A 2QCGA 3ARUA 1PWMA 4TX9A 3MANA 3PY2A 3H4WA 4U3AA 5GJMA 1IT0A 2INZA 2DZVA 4CEXC 1NWUA 3NPWA 4J4KA 3LRKA 1GOXA 2CNCA 1AMYA 4JIHA 1ZPTA 1AJZA 4MDOA 5J04A 2VYOA 2ZE0A 3U0HA 2IUZA 4B5VA 3RXZA 4KWUA 4NG3A 4RW5A 4LBUA 4QAIA 3S1WA 5G1TA 5EBAA 2QPUA 1LDCA 1U5VA 4FXFA 1EPVA 3GG0A 2F61A 3UCCA 3CYJA 4GC3A 4Q22A 4O12A 1B3XA 5AHFA 3SN4A 6XIMA 2QCDB 3AISA 4OECA 2DH2A 5HWMA 2ON3A 3STEA 3TR9A 4BA0A 1XKJA 3VGFA 1V0NA 1BYCA 2EPKX 4HHMA 3RCYA 3STFA 3MMWA 1YTDA 4PRTA 4B4FA 3OOQA 2PDCA 3D0CA 4NUWA 1EF3A 3HG2A 1W1B1 3H4XA 2EEXA 1EIBA 3EX6A 3P2VA 2VC5A 2AGTA 5IOBA 3GY1A 3PBUA 3RJYA 1E40A 4TO8A 1SW3A 1KTBA 2J79A 4UIOA 1OIMA 3R2GA 1JL8A 3KVLA 2BXYA 4AZ7A 3IK2A 2A3AA 4CQDA 1G1YA 3PF3A 5CEWA 3V4BA 4L65A 1WDQA 3NQMA 4REQA 1PDYA 2YFOA 2BHYA 2Z28A 4MKVA 4C1NB 2JIWA 4AMCA 2J66A 2FMOA 3O1NA 4G5DA 3M5VA 2DVUA 3A4WA 3EMQA 3VM7A 2J27A 4KS0A 2BOEX 3PNUA 1GHSA 1X1NA 4PFMA 4I6KA 3UJ2A 3E0LA 4PE8A 1UH4A 4O4VA 4JTGA 4ICCX 3NJ3A 1F76A 3W7CA 2GFTA 2PP3A 1ZBWA 1G67A 3PP7A 4OV9A 2Q3OA 1UYQA 3CAVA 2WSQA 3UXDA 5JBEA 3ABQA 3CPGA 2GJNA 5AHEA 4O1CA 7CGTA 3KBNA 5LNSA 3OVQA 1TFVA 1R3SA 1FXQA 2WWCA 4BI5A 4G8TA 3WQGA 1HUVA 4M7TA 1ME9A 1WZKA 1XLJA 4WLCA 2QJNA 2CETA 2O9OA 1OHLA 3M7WA 2Q8ZA 3CM4A 1OK6A 3PPGA 2ZYFA 3TN6A 3FHAA 2EPOA 3RRAA 1GQLA 4DWSC 4HPJA 1XJBA 3IAPA 5AC5A 1DQWA 1HVQA 3B0UX 3LGGA 2ZQ0A 3M6DA 1M01A 2CLIA 1ADOA 3R0KA 1RAKA 3L4ZA 4WZHA 3QMSA 2B4GA 3C0JA 3B8UA 1HG3A 4TR9A 3PZIA 4MFDA 4O15A 1DJHA 3GDMA 2HISA 1MW1A 1PVNA 1TRIA 5A3HA 2P3EA 4HJFA 4XZBA 3DOPA 3UZWA 1XCFA 1P1MA 4F4RA 3QY8A 3UY8A 4IM4A 1GQNA 3B8DA 1A5BA 4C5ZA 5JQ9A 4P8WA 3AIRA 5DT5A 1VBJA 5CJ5A 1AW5A 1H0GA 2X2YA 2VC7A 4BCEA 2ZUVA 5C6MA 2RDWA 4C6KA 3L4TA 1DIOA 4AC1X 5EPDA 6PTDA 4LYQA 3IJ8A 4LBSA 4E38A 3G24A 3NQBA 5D04C 4PL1A 4QSFA 3VIJA 1FWNA 1BKHA 3W7LA 2WHLA 5IDIA 3AUJA 3NXFA 4MHBA 3TQPA 4S2CA 2H3BA 2XINA 4F0LA 3FIGA 1HNYA 1IGSA 1DTUA 2OB3A 3EPNA 3WJSA 2OX4A 3E74A 3NZGA 3MQTA 5HR6A 3M47A 4UCGA 2EBNA 2QUMA 2PSNA 3THAA 4E2OA 3T0AA 4KWOA 1XIFA 3AMKA 4GYPC 4IJCA 1XC6A 2R24A 4E2DA 4Z08A 4PYSA 3SGZA 4HOZA 2DUXA 3MJMA 1HJXA 5D38A 1Z3NA 3C2YA 2O7QA 3MVIA 5FL0A 3KTSA 5AYXA 4GIRA 1NELA 4LVGA 1CXLA 2ZZ3A 4M56A 4PMYA 2DGAA 1QTWA 2V6AA 1BGAA 4HYWA 2CC0A 3GTXA 1Z44A 2I5IA 3M0ZA 1YBQA 4X9YA 1XISA 3LBMA 3GTNA 1EP1A 4XAGA 1L6GA 4IMEA 3QM3A 1XGZA 4Q8OA 3ARVA 3RK8A 1I45A 2V67A 5A69A 4TVCA 2OR2A 3HGJA 4FNPA 1D7KA 4HOWA 3O6AA 2FTPA 3DYOA 4CU6A 3VCNA 4LAMA 3BLPX 3L4XA 2ZXQA 4D6IA 4MJZA 1RHCA 5TF0A 1E3ZA 1R3QA 3LBOA 4NZJA 4M7SA 1T99A 4PUNA 2CLFA 3PAJA 1NP0A 2E6DA 1OYAA 1OT2A 5D9MA 2A6LA 3T42A 1FH7A 2VOTA 3WLJA 4K37A 4ERAA 1CYGA 1RJQA 3WK2A 1SO6A 1KNWA 4BR1A 4PMRA 1UWQA 1FWAC 1B54A 1G0CA 1E6RA 2AL1A 1S5WA 1TPB1 4PMQA 2ISWA 3E3HA 2VEPA 2OO0A 4H6RA 5DLCA 3WLQA 1OABA 1JPMA 4ENLA 1GG0A 7XIMA 1Q4WA 4NL1A 2YFNA 5DELA 3BGAA 2D2GA 1TMHA 2WMIB 3WLKX 1W17A 1LQ0A 3FHQA 4DWDA 1GZJA 1M3UA 3WD0A 3PBMA 4P8XA 4IJRA 1XYFA 4KCWA 3DFHA 1OFOA 4L4LA 4FK9A 2XSBA 3L9CA 3OIHA 3RCMA 1E9YB 5M1TA 4UFHA 3PBGA 5C7HA 3EMZA 3W70A 1Z7AA 1ZALA 3DC0A 1M7PA 5EL1A 2Z1BA 1MW0A 3FYPA 4C6NA 4I9MA 2A3HA 4O4WA 3SY5A 2F2KA 3QQ0A 3GU2A 4B5WA 3VDBA 4QM1A 4AMAA 4AZGA 1TJ2A 3DIPA 1ICSA 5MKGB 5D02A 4QNWA 1EBGA 3HBLA 3ARSA 2B7PA 3BLDA 1SGJA 4H4IA 1A0EA 4H8NA 4JNZA 3WD1A 4INFA 2W62A 3VD7A 1JI1A 1M6JA 1LL7A 1NWSA 4DWSB 3UWUA 4JDYA 1KFLA 3P6LA 4LALA 1Y5VA 3W9ZA 2GJPA 2LLEA 3CZKA 3KRZA 4RZ5A 1KTNA 1X39A 4XBSA 4QX4A 3MMTA 3BG9A 1TV8A 1UR9A 4I5XA 3TLLA 4WSHA 4GK8A 3SM0A 4F9DA 3BK0A 1K8XA 1C93A 3SDOA 2HVMA 3A12A 1GNXA 4AIEA 2FGBA 4GQRA 3SI9A 4JGDA 2O4QA 1AW2A 4OTKA 1JVNA 3EOLA 3LB0A 1LOLA 1K4HA 5ECUA 1TTQA 1OFAA 3V36A 1EC7A 4N02A 4PRRA 3QZEA 2HPMA 3NQ8A 4RE2A 3PZNA 3HG3A 3FYOA 4HK7A 4Y8EA 1HJQA 1N2VA 1QHPA 1G4TA 3OO2A 1UD8A 3JW7A 1MVYA 1IZJA 4B3LA 1FOBA 3ITYA 1PHQA 2NQJA 4EPEC 2Z1WA 1PL9A 3ZJ7A 3CMFA 1LOSA 1ZTVA 3GLCA 4JTEA 3ARXA 2VP8A 4JFVA 1BKSA 1J9YA 4B15A 4OE7A 4N2YA 3F7JA 1ZNNA 1GVFA 4PUJA 3W1RA 2ZA3A 2FZ9A 1DTNA 3RM9A 5EMUA 4F48A 4BHYA 4PMUA 2TMDA 1UR8A 1DXEA 1FP9A 3C2VA 5FF4A 3L4VA 3SQSA 4AD1A 4IMDA 1X7FA 4HA1A 3UZ5A 4ZZ9A 1P1XA 3TUUA 4C65A 4IWWA 1TR1A 1TRDA 3GU1A 1TTJA 3HV8A 2NXIA 1W56A 1AL8A 3RM8A 2CLKA 2QJMA 4OBTA 1IEIA 2GJRA 1CDGA 1JZ8A 3W76A 5HAOA 3T44A 3G0UA 1H61A 3VNMA 2GK1A 2OGJA 3UVAA 2DW7A 1DJQA 5AVNA 2FZ8A 4LVBA 2ZA1A 3RMEA 1JZ5A 2HBXA 1P0DA 2ZIDA 2UY4A 3ABSA 4GUIA 4G9PA 3WMCA 2OG9A 4PB4A 1PZ2A 1DJXA 3NZRA 4FIRA 1EIXA 4FAMA 1WX0A 3A9BA 1QMLA 3CUIA 3RLGA 1Q45A 4ZQPA 2ESCA 4KT2A 5FF0A 1G6CA 3ZSSA 3NDZA 1XYMA 4NJIA 3U4AA 5XINA 4UZUA 3EYPA 3MP5A 2PBOA 4JN7A 3M1ZA 4JNMA 1P0KA 3WH9A 1ITCA 1IIGA 2OSXA 4B5SA 4DO6A 1XSIA 3CL8A 3R13A 3G0SA 3BARA 2NWSA 4FA3A 5XIAA 4H2HA 1O12A 4QS6A 1MQPA 3LY0A 4HA3A 4X9SA 1TTIA 3DHPA 3W2KA 3I3DA 2YBUA 4CNNA 5FJIA 4GI6A 3FJNA 4I7VA 2XWDA 2J6VA 1UKOA 2X2GA 3MUY1 1U1HA 4LTSA 1GOMA 4FXRA 1NAL1 4CD5A 1XIGA 1IWAA 3RCNA 3W23A 4LC6A 1E1FA 3N2OA 4ACZB 4D9PA 1JPIA 1OFRA 4DXKA 5M03A 3ARTA 2X1IA 4IL2A 4Q8QA 5F4WA 3VINA 3KBSA 5JXQA 2ZX8A 4KEMA 4R9OA 2GJXB 3S9ZA 3D5HA 1Q66A 2O4MA 4OIFA 4QQ3A 1CT5A 3P81A 3UD6A 1W6TA 3W2JA 1JDDA 4GGBA 2O9RA 5D37A 4M6VA 4H7ZA 1RBOB 3Q4DA 3DFYA 1NY1A 1YQ2A 1UG6A 2QCNA 1WKFA 3MTWA 3WDRA 4XAYA 4A4AA 1RK5A 3T07A 1AW1A 1UA3A 1GPFA 4WY0A 4UBPC 3N34A 2AL2B 1G4SA 4Z2GA 4AD4A 2Y0FA 4LV9A 4QQUA 2HJPA 4K36A 1X6LA 3CHCA 1NFBA 4G7FA 5FCZA 1EJTC 4IGMA 1KFEA 3CUXA 3M0KA 3LTSA 5L9FA 1Q6GA 3UJRA 1X1OA 1R87A 4D6FA 1P4CA 4JTQA 3R0DA 1MUCA 2WNNA 5D9OA 2RAGA 3HPSA 3RPTA 3EKLA 1FHUA 3QZAA 2Q6ZA 2PLKA 1S5MA 2XVPA 2YIHA 4UTHA 3HFTA 4HU3A 1UZ4A 4XZIA 1C8QA 4RCXA 3SQMA 1QFEA 3NQVA 2PU1A 1WDRA 3V5FA 3REQB 2YZRA 1OEPA 1R0MA 5I3FA 1ZBKA 3GNOA 1Z32X 4DY1A 2FYMA 5HATA 3DH7A 1YDYA 4XZMX 4HN4A 3W22A 4R3UA 2D3NA 2X41A 4IX0A 1BF2A 3LHUA 2VCAA 3W85A 2W61A 2DZPA 3AS3A 4M5PA 3O6YX 4LT9A 4XO7A 4IQLA 4LF1A 1B9ZA 3KBJA 4HIBA 3MMDA 3N9SA 5HOSA 1QOQA 2J7DA 2ZX7A 3CV6A 1ODUA 3BLOA 3FKKA 5DF0A 4NJGA 4H83A 3UVIA 4HCLA 3MV11 1I1XA 5FJJA 1JFXA 4H9YA 2DJLA 4N42A 3FEMA 4LSBA 3BVJA 4NSBA 3LGEA 1OYBA 1WE5A 1UP2A 4GINA 3KWXA 3APTA 3TYCA 4YCPA 4ZQMA 3SUVA 3S5ZA 5ABTA 1GOKA 1YDOA 1GCYA 2HTMA 3KL3A 4LVFA 3QHMA 3WLPA 3N13A 1RQEA 3H53A 1TELA 3REQA 2O55A 1N7KA 3VILA 3JVAA 3UZZA 3MYPA 3MO4A 4K8EA 3MPGA 4NZFA 3HN3A 4CQCA 4GO8A 2JKPA 4GLEA 2GYIA 4EWND 1I2PA 3ALFA 5DXXA 3C8FA 2PLJA 1WA3A 6REQB 2R91A 1RQHA 3UYIA 7PTDA 1YE6A 2C1IA 4XIMA 4I9JA 2P50A 3GW0A 2BFGA 3PJUA 4HPNA 1JYVA 4NF7A 3DI0A 1YBQB 3ITXA 1FQ0A 1CGTA 2YKKA 5J5DA 4IGHA 5FJUA 1RH9A 1I0BA 2P10A 1ML1A 3AMLA 4P7OA 4B16A 1F3EA 2AL2A 3A21A 4RR4A 1XF0A 2R8WA 3WNMA 1XDJA 3UY7A 1TQXA 1FXPA 3DU0A 3M5YA 3C0QA 5K4XA 4D1JA 1UWSA 4EPKA 3CIWA 3F4NA 4D1IA 1KBBA 1UMLA 1W0MA 4YCOA 3GXIA 2Z6JA 3WEMA 5FL1A 4Q8NA 3BSMA 4Q4PA 3MDUA 1CLXA 1PYMA 2HE8A 3OVPA 4YTUA 4CNOA 5ENLA 2MANA 1EZ2A 1E9LA 2V30A 5A6BA 4W85A 2YLAA 4MYXA 2QZRA 3I7QA 5FOOA 2BOGX 1MFVA 3U5UA 4UFJA 1BRLA 1OK4A 1Q6DA 3GXTA 3MSDA 3OZMA 1RLCL 2J8FA 3TTYA 4HN8A 3KOYA 4Y9PA 1VB9A 4YVXA 5CPTA 2RGMA 2W4XA 2GQAA 4BQ5A 1OY0A 2ISSA 4Z1AA 3NQ2A 4GZ7A 4MZ8A 4ATWA 3LQGA 4N9BA 4V27A 2RJGA 2DZBA 4QJ4B 1XYLA 1RZMA 4J3TA 5E0KA 3B05A 4HU0A 5KETA 2DZTA 5E6ZA 3OJGA 2EGZA 3EDFA 1Q7MA 2ACSA 2FFCA 3QMTA 4F79A 4H9TA 3LSCA 3HURA 2VC9A 1YNYA 3KCLA 3UPBA 4CNSA 1XW8A 4WQ6A 1TB3A 2B7NA 4L4PA 3W28A 3AJ7A 1R46A 3N15A 3S2CA 3WFLA 1TPEA 3KX6A 3ZOAA 2VEGA 3I68A 3DFQA 3GU9A 1UD2A 2XVLA 3S5SA 1XX1A 3NUKA 4O11A 1XYCA 4XB3A 1R5YA 3RPMA 2X0HA 3NQFA 1WKEA 2VZSA 1P5BA 3EDDA 5HA7A 1B30A 4MY9A 5EY5A 3TP4A 4H9VA 3VNZA 3VOIA 1TZZA 3W73A 2Q3RA 1Q65A 4XKYA 3WDIA 4W7WA 4JL2A 1X8FA 1DJWA 2QCDA 2OTDA 3P61A 1JPDX 1QPKA 2X30A 3L65A 1YW1A 3FSUA 1FWHC 3AZSA 2BMBA 2TYSA 2I1OA 3BAKA 4KRZA 4LUTB 2NT0A 4DELA 4S23A 1H7WA 3GDLA 4ZA0A 2QJJA 4IPNB 5I0DA 4OGZA 4KCVA 1RK6A 5IBXA 4KFOA 3GNRA 3LCHA 1XYBA 2Y24A 5C9XA 1PJ9A 4C6DA 1Z9AA 1E55A 3EX2A 4GC4A 2IKIA 3UW6A 4H9XA 4UTTA 3AS0A 3W81A 4EOUA 2F6KA 1NF0A 3DZ1A 2BASA 1VFSA 3B0PA 4D71A 4P61A 1OC5A 3VC5A 2C7FA 5CAHA 3N2TA 1DIKA 1UWIA 1HL2A 1JCXA 1ZU8A 4B3KA 1QOPA 1WBJA 4Z0JA 3THDA 1ADSA 1JQVA 1VFMA 1M7XA 2GGJA 3PTDA 3S2LA 4Y96A 4JTRA 4WCJA 1XKYA 4LAKA 5T8GA 3AFBA 1CNVA 3W6YA 2PD9A 4WK9A 3P82A 4M1RA 1HX0A 2IKJA 3B04A 2Z7GA 4IOTA 4EK7A 3WNNA 3QHNA 2FPYA 1IT8A 2HDJA 1V0MA 3V7PA 4BF5A 5A6TC 4DYKA 3NZQA 3LCIA 4DZHA 2EAWA 1XH2A 4U4MA 3TTOA 5CPQA 3VOCA 4GKTA 4O1FA 4NZ3A 3WQPA 5DCDA 1I9CB 3W71A 4S3BA 2VDGA 1PKMA 3F2CA 2E68A 4D8ZA 1K02A 5E09A 1YPXA 2DZWA 1BWVA 1Z41A 2PTZA 3DN5A 4URIA 3SIMA 3FW6A 3IPWA 1LYXA 4K68A 3LXBA 5E6YA 3NO5A 4HPGA 4GVIA 4E5TA 1OG6A 2BV9A 1MUWA 2DV0A 2XG9A 4RDZA 4CNUA 4GZIA 1KCZA 1T7LA 4IFRA 2PRHA 4D6GA 3TTQA 3NO1A 5CXPA 4NVTA 5CSSA 2OYKA 1XSJA 4MUZA 2EKCA 3PNZA 3UZYA 3BAIA 3M43A 3K30A 4QG8A 4MUPA 1YNPA 3VDGA 2UZ9A 3KVMA 3PPFA 1ADDA 3TVAA 4JX6A 5HUPA 2VGGA 4FNTA 4N6FA 1WAWA 3LK6A 5C9WA 1AD1A 5A1AA 2WMGA 4HHLA 3TSBA 4C6OA 3H21A 1P43A 5C55A 1O5QA 4DJFD 2AAMA 3IIXA 5G1MA 1QNSA 3GZAA 4FALA 1ESWA 5AVHA 3B8SA 3VIFA 2DSZA 4IFOA 1V6UA 3RM4A 4GVFA 3WK3A 4AHQA 1WO2A 4CQ8A 2B0MA 2PF0A 2Y7DA 4N9EA 3H24A 3EOSA 4ZO9A 3TYEA 4DM2A 4F2UA 1XG4A 1MRAA 4AAJA 2WC7A 5G2WA 2D0HA 4WDUA 3WSUA 1WAUA 3QPYA 1VIZA 3P3BA 1AD4A 1GVOA 3H7RA 2E5CA 1XD1A 3WD4A 1JNEA 3GB6A 1ICPA 3CC1A 3TTSA 3V0UA 5EMMA 3VKCA 2ZZ1A 2Z27A 3AIVA 4Z2HA 3AICA 3ABXA 1M04A 1QI3A 1FKXA 3EDKA 2AGKA 1BLIA 3LPPA 3TW9A 2Y8VA 1ONXA 3EOUA 3S9YA 2I5GA 4JN8A 3QC3A 3BAJA 3BLLA 3RR1A 3ZVIA 1VHCA 5FEPA 3PWGA 2YXGA 3TOPA 5AC8A 1X38A 2XIBA 2HZGA 1EJVC 2CLPA 4JTCA 2VZUA 4KEUA 4JL1A 3ZVHA 1VCGA 2WYSA 1XIJA 3BGGA 2PF8A 5HQEA 1L0PA 2PDHA 1KRMA 2WSKA 1F74A 3AYTA 3CASA 2NZLA 1PX3A 4EKJA 4AX6A 4EIVA 5H6HA 2WZMA 4XVEA 4R5EA 2W63A 4TOQA 3H8AA 4CUCA 4CN1A 3BICA 3BZGA 3MB9A 1EDGA 2PC4A 3VKJA 1Q8AA 1U1JA 8XIAA 4NY2A 4LNYA 5T9CE 2UY3A 3DDMA 3MUAA 3GTFA 4KWWA 3W2NA 5DMYA 5CZSA 1DEDA 1HO4A 3TAKA 2OOFA 2FTYA 3WLRA 3TYZA 4LVAA 3CV2A 1G9HA 1DXIA 3E02A 1XRTA 5E70A 2DDXA 1JGIA 3KP0A 3BAXA 1H7PA 3GKFA 5AYBA 4AZCA 3PM6A 3ZWTA 4A8NA 5I24A 1OB0A 2QDHA 5EMJA 2WNWA 1Q7ZA 3GH7A 3QLLA 2FHBA 1UJQA 5KZMA 1R47A 1TQJA 2J9XA 3LI0A 4HNCA 3LV5A 1LUCB 3JZEA 5F2GA 4OV4A 1S1RA 3LXAA 1SQ7A 1UPMB 1XSKA 2V5KA 1OT1A 2Z25A 2YDAA 3S3GA 4AEOA 4F8XA 1AMKA 2WB5A 1GORA 1J0IA 3RG6A 4WKHA 2DVXA 3BJTA 5HXMA 4L6HA 4GUGA 3OG3A 2QUVA 4Y6GA 4C5YA 1ZCOA 4PH6A 5TD4A 4DJED 4AZ6A 4AZBA 1RVGA 2E09A 4GE8A 3CZLA 3R58A 3ONBA 3W7IA 3VKAA 1E56A 3O7UA 2FQIA 3LA4A 4O0ZA 1UJPA 1BD0A 1NVMA 5IXEA 1KCKA 3ID7A 4DBSA 3ITTA 3E2VA 4NJKA 1XH1A 2VVNA 2D3LA 4ERIA 5CKSA 1TSIA 1TWWA 3VIIA 4DUXA 2P1FA 3GHTA 1MSSA 4MY8A 3ZFHA 1KTCA 3AALA 3OHIA 1VP5A 1VFLA 2ACRA 1QPNA 1Q5MA 2E9MA 3K4WA 4AU0A 3GVVA 1XGDA 4PUKA 3FKRA 3PWIA 3OHMB 3PB2A 1AUSL 4A3HA 3PTQA 1TJPA 1XRSA 3QFEA 3HOJA 1IEVA 4QRNA 1V02E 2HWGA 5TIMA 1CEOA 2Z2UA 2J9YA 3P93A 4M0XA 7TIMA 2ZFAA 4L9ZA 2ZZ2A 4UQAA 1UIPA 3KTCA 3NG3A 3UEQA 2A85A 1TMLA 4J3XA 3SCTA 5KSWA 3GIQA 4E8GA 2XGBA 4QLLA 3MI2A 3C5QA 4P8VA 2C8NA 3CBWA 4LPCA 3WQDA 1LLZA 1VLIA 1YTKA 3GDRA 4PCPA 1Z69A 3AMGA 3UWVA 2V69A 1PTAA 1FWGC 4NP7A 3R8RA 4A35A 1A5LC 1BSLA 2INEA 4GIEA 1N82A 1ZJBA 2Y1HA 1BTCA 4PMDA 3LOTA 4PA8A 3VDHA 3SZ8A 4XO6A 3OA5A 3FGCB 4H7VA 5DN1A 3QSRA 3WUEA 3AZRA 3GM8A 3W2MA 2DP3A 1TUXA 4GABA 4ZOAA 3H2CA 2A0NA 3S1GA 3DGRA 3CO4A 5BOOA 3OPSA 2C19A 1ZLPA 1QVBA 2P5NA 4HNNA 2WJEA 4OWGA 3MT1A 1U1UA 4ML4A 1UWTA 3AS1A 3CPUA 1UUMA 1FP8A 2G4FA 1K7XA 2WQDA 1TV3A 1UR0A 1SW0A 1Q4NX 3W1PA 2GWNA 3W72A 4XZNX 5ECVA 1Q2SA 1SW7A 5HJYA 4ZSTA 1HGYA 1LG1A 3GWQA 2VOMA 4XD6A 1XIMA 2Y2WA 3M64A 1R9ZA 4F0RA 3AYRA 5BYWA 3WQ8A 2PDMA 4A3RA 2WJZA 2NV1A 3I6RA 3I65A 1X98A 4PMVA 2BBFA 1HGWA 4J9JA 1W5PA 1WXZA 1F73A 3L7RA 2KZHA 3N18A 2NLIA 3PFMA 3B4UA 1W3HA 1W9DM 2XFRA 2FH8A 1EJXC 1RY0A 1IXQA 4NQ1A 4AHPA 1LCOA 4WY0B 1B3VA 3EWBX 2YCLB 3KUMA 3VGHA 3QC0A 1TCMA 4YWIA 4CVWA 3O06A 4HPXA 5HJXA 4UQDA 1JAKA 4IHCA 4NAFA 2WHKA 4F0HA 2SFPA 4GCAA 1V5XA 2A21A 4NIRA 4ZR8A 4K6AA 3N3MA 3UU0A 2IPJA 1FFRA 3G1FA 4NYYA 3ES8A 4HU4A 1A50A 4FXSA 5DT7A 3S6DA 1TX0A 3WNPA 4JTIA 3SEPA 1JEZA 4ZL1A 3LD5A 2ZZ5A 2HROA 1EYWA 2QV5A 1W5NA 1NFGA 4W9TA 1H5VA 3GBEA 1NF7A 5LNWA 5LSMA 4F0SA 3RUBL 1Y0EA 3AHXA 2AMGA 3HZ3A 4C6EA 3EWXA 1W1IE 3QKEA 5HPCA 2C1GA 4HZ6A 4PL2A 5FA5A 4QP0A 1CXHA 2H8XA 1ZAJA 3G3DA 4L80A 2VGBA 3QOKA 1ZJAA 1S2VA 3HJEA 1GVQA 1EHNA 1DBTA 3DFOA 3AYSA 1J0JA 4PMOA 4IISA 5AYIA 2VWSA 4IMGA 3PPCA 1JDFA 1X97A 3VABA 4GZEA 2H8ZA 2C1HA 3N1AA 4FOUA 3VD3A 2J74A 3H7VA 4GA8A 3NPUA 2PGWA 3VUSA 3RGTA 2ZE3A 3ZT7A 3JZUA 1BG4A 3U4FA 1JD7A 4YYCA 1K9TA 2E28A 2E40A 2PTXA 3IAQA 1CWYA 4AY7A 1ZFJA 2EPLX 3TFCA 2Y7FA 4JAWA 4U2ZA 6ENLA 2OVLA 3VKKA 3W84A 3N2XA 3H55A 5E5CA 4JCMA 4RPQA 3KHDA 1R9XA 3DKJA 2XVGA 1ONEA 5CSYA 4EXQA 4TIMA 4B92A 1R7OA 4Y8FA 4Q7BA 2DSWA 3FDGA 1KRCC 5BRBA 3NYDA 3CO8A 4DJDC 4S3GA 2QDGA 4JIQA 2NV9A 1D3GA 3IRSA 4CNPA 3LBCA 5LXXA 5AOUA 3SO7A 1U22A 3KLKA 2P76A 2G50A 4RZ6A 4XZHA 3H7UA 3HMJG 3UPWA 3KW3A 2CIPA 4ALDA 2WW5A 5CLTA 2GVLA 1NH6A 2NWRA 3OQ8A 4AQLA 1F4HA 1CBGA 4WSJA 3W6LA 4UNIA 2OZ0A 3EA2A 3HQNA 2JF7A 3TOYA 7REQB 5I3JA 4KRTA 3OLDA 1LL4A 1XC4A 2A3BA 1QNQA 1W1TA 4O19A 1XIEA 1PYFA 1QWKA 1QI4A 4DF1A 3T4CA 4EACA 2B7OA 3ITOA 2VENA 4Q4RA 3QTGA 3VGDA 1EH9A 4QITA 3STGA 1V3JA 4R7OA 2D20A 2CFFA 4MNKA 4WXYA 1H4PA 3RO8A 4AY8A 1WKDA 2CERA 4JY8A 3LERA 3NGFA 4JKMA 3CHDA 4HOXA 1KBIA 4NJHA 2DIEA 3WLNA 1DJYA 1SPQA 1CIUA 3V0TA 1C9WA 3IGSA 3CB8A 4IL0A 4PODA 4NXKA 5I00A 2L5HA 3EEGA 1FKWA 4ZTYA 1NTHA 3ABZA 1H2JA 1SO5A 2XUCA 4OOZA 1T5AA 4JS3A 4JHOA 1KM6A 4FOKA 1OD8A 2G5WA 3AJXA 2OX1A 1TWIA 1J0ZA 3OEXA 4LGXA 3CUHA 3VIPA 1M7JA 2QMJA 3ITGA 2VX6A 1J79A 1SZEA 4Z1BA 2HEJA 1KR0A 2E4TA 3KS6A 3IIZA 2PDYA 3P67A 4ZTXA 4GYKA 4JPGA 4IIGA 4JTAA 4KF1A 2NUWA 4UFIA 2HSAA 1GVRA 1PHWA 4IIFA 2FLIA 2X0SA 1FWJC 3LU2A 4LUTA 3OP2A 1KKOA 5BMWA 1OFBA 1IYXA 1QNPA 2WPBA 4GIAA 4UOQA 3QV7A 5DO8A 1OX4A 3O07A 3ZVHB 1VHNA 4PSPA 3DG3A 2E5BA 3IUHA 4FLSA 3GK0A 3ITLA 3LMZA 4JTTA 3VNYA 3RJXA 4LW7A 1AL7A 1M65A 2CZVA 4D6EA 1VRDA 2GZXA 2Z0IA 1W8GA 2A3LA 4HKPA 4L7ZA 1ISZA 2GPTA 5D2VA 2YA0A 3LN3A 1KLZA 3IJ7A 1S38A 4IG2A 1UKQA 4JTLA 5FSDC 2DQXA 3AQUA 3NQDA 1NU5A 3FDKA 5E93A 4O28A 3O16A 2W67A 4RNJA 1C92A 4GBDA 2EJ1A 2ZRXA 1RA5A 1LT8A 1D7FA 2Y63A 3U7BA 4KETA 3M0XA 2PGEA 1ITXA 4ADTA 1V3MA 3MCOA 1QK2A 4KIEA 4FOJA 4L9YA 5FKYA 1TJ1A 4EXAA 3W7NA 4GYJA 3G1HA 2V5LA 3QR1A 3TC6A 2D69A 4LCRA 3ARRA 1J5SA 3UG5A 4YU1A 2PDNA 1UROA 4QROA 4AG0A 3GYCA 3TJLA 5IHSA 3WMLA 4O52A 1XBZA 4XTDA 3A5FA 4PTVA 1WXYA 2IXVA 4TV5A 3CS2A 1JZ4A 1ZAIA 4B5TA 3HIJA 1LM1A 1DJGA 5CBJA 4DO4A 1QK0A 2GQ9A 1UB3A 5CGQA 3P0XA 1JD9A 3W1TA 4NRRA 3WZ0E 3GHSA 1JNDA 3TR2A 5K2ZA 4H8VA 3EWZA 2J13A 1O1ZA 3GAKA 1IR2A 1PCWA 1IZCA 3IANA 4EPDC 2Y8UA 4AWTA 4X2PA 4RNFA 4RPPA 3USBA 4XX6A 1JG9A 1AQHA 3CV1A 1V3IA 2CESA 2QPSA 3UR5A 3BW4A 1NDWA 2CU0A 5F4SA 2G97A 1CGXA 1TV5A 5BXTA 1ISVA 3R5EA 4L1WA 3ZR6A 2RDUA 1UIOA 4DO7A 3PB0A 2YZ5A 1AODA 4GUJA 1GQIA 5REQB 3GFZA 1NP2A 4S3KA 1VEOA 1SYTA 1AH0A 2RFGA 3VKDA 3KHJA 4J2PA 2G96A 4LUIA 1S2WA 1Q6RA 4ML9A 3WBAA 1YMYA 1T8XA 2ZX6A 4ES4A 2IQTA 4UMAA 1UW9A 3CXOA 4ZOEA 5LIKX 1RSCA 4N9CA 1FUYA 1BQGA 1I8JA 4J28A 4UR9A 4YPJA 1B31A 1JYNA 3QKZA 3WH5A 3PZGA 1YTEA 4G1NA 3NWRA 3EB3A 1BTMA 4UTUA 1BVWA 1P6WA 3L21A 4J7RA 1WZAA 1AZ2A 1ZY9A 4IXHA 4I5RA 3PZOA 4JTUA 2Q09A 3K13A 1WYIA 3A13A 4TV6A 2CPUA 2Z1XA 3T0CA 3UBPC 2GDUA 1OYCA 3WQEA 1BVNP 4MLRA 3E38A 1GYLA 2E6AA 4H9ZA 1W9UA 1CECA 4PTMA 2QVHA 1GVEA 1JUKA 3A6OA 2HK0A 2Z2AA 3W7GA 3W27A 4B2DD 2R1KA 3VAVA 3N4FA 3BH4A 1UWRA 3HF3A 5LIUX 1X6NA 5D2WA 3NDYA 4H3DA 2YB1A 1VGAA 3H6OA 3N4AA 3GIYA 1DJZA 3CPRA 1CGYA 2BODX 4HMNA 3WQWA 4I9TA 4NYUA 3LM3A 2V0TA 1WDDA 3R6IA 4TXEA 1LWIA 2VT0A 3EWWA 4LANA 1XH0A 1E6SM 2YA1A 3MW7A 3COTA 4UFMA 2AQOA 3HMCA 1IE7C 1FWRA 1A5SA 4PRWA 3W75A 1UZHA 4YHGA 1EDQA 3LDVA 4IUGA 3WNLA 3ME3A 1B0IA 1FBAA 3S5OA 5AHIA 2Y6ZA 5BXRA 2W92A 1QW8A 1TV2A 4DBDA 1F6KA 2I9EA 4A2RA 1EJUC 4AWSA 2DT2A 1A5AA 1OQFA 4J3WA 1CXFA 5HUOA 1LWJA 5A94A 3NDOA 1FCUA 1GKQA 2YGYA 4HVXA 3FJ6A 3DESA 1F05A 2VX4A 3SY8A 4G7EB 3U2EA 2G3JA 2C0HA 2CBJA 5B7ZA 5E0FA 1G5AA 2GL5A 3U2CA 1Q6CA 2YXXA 2D73A 3E1F1 1RLDA 1US3A 1I1WA 4Y9MA 5FJTA 1WNOA 3GR7A 4R27A 4W7UA 4XTIA 1H1ZA 4G7EA 4G1KA 1FWCC 3K8KA 4YNGA 5J5RA 4HZ8A 3W24A 4DWSD 5CGTA 3CQKA 3SUSA 2EO7A 2P0IA 1K03A 3C6CA 1JCLA 1DV7A 3AWOA 1GW1A 1KFKA 1KM5A 4FR1A 3EOEA 4I7UA 4CD7A 3MO7A 4NRSA 4ZFCA 2P8BA 3CWHA 3P7YA 4XZLX 3QXBA 1D8CA 4X3ZA 2O9PA 4R85A 1UOKA 1OFQA 4LVDA 4H6EA 4V28A 2C91A 1XBYA 2XN0A 3SCOA 3HV9A 3LZ5A 3EMCA 3LHWA 1QHOA 2R6OA 4ZXLA 5GVJA 2DPEA 2VTFA 4NU7A 2XPKA 5A6MA 2DQWA 3E0WA 2W3ZA 3KOXA 5BZAA 2QEZA 2OODA 1QI5A 4JTDA 3V16A 3EA3A 1QO5A 3G77A 5IFPA 1K77A 2OOGA 3L2IA 5DCBA 4GUHA 2VDIA 1V08A 2W79A 3WEZA 4W5UA 3GD6A 1GK8A 4DO5A 1J6PA 3FEQA 3DXIA 2YDRA 3A3WA 2D0FA 4HU8A 1JI2A 3RX2A 1UCWA 2AQWA 1T8QA 3GFXA 1MO0A 4JQ1A 3TZNA 1V03A 3S6TA 3TX9A 3GXNA 3L2LA 1KBJA 2G3NA 2GUUA 4H19A 4MDPA 1KC7A 1B4EA 3N9RA 4AUBA 4XV0A 1MYRA 3AIWA 4GI4A 2J6XA 1N55A 4Q8WA 1YKWA 3CU2A 2PCEA 5F2MA 2A5HA 4JQ3A 2ICSA 1YXCA 2YSWA 2VJXA 1UZDA 4IMAA 4GCXA 3Q67A 3MHGA 4JD4A 4H04A 1H7NA 4HA4A 5DY3A 1VCVA 3WQ4A 1DIEA 3M16A 3AMDA 3G2GA 4RE4A 1QOXA 4LY4A 1HW6A 2J7BA 3BZJA 3OU8A 3W2UA 1RALA 3O05A 4IH3A 3N11A 3FXGA 3G1YA 5FEXA 4I3GA 3TK7A 3WF1A 3KM8A 4IPIA 5REQA 1RP9A 1AQMA 3DG7A 3SECA 2GK1B 2YCKX 1WBHA 4PEEA 4W8LA 3RF9A 3W7QA 1S1PA 3RPDA 2WMHA 2YL6A 5FSEC 4EF8A 4GO9A 1SUXA 3INPA 3W7OA 4NHVA 3ALGA 5DEZA 2OKOA 2QJHA 4AEEA 1E4MM 5G4WA 3D47A 3ABOA 2A7NA 3GXDA 2REQB 3TDFA 3LHZA 3FK4A 3WH7A 4FZIA 2JKEA 4M3PA 4AF0A 4J35A 5K4ZA 6ALDA 1QATA 2O92A 4FPSA 4DI9A 3T2QA 7ENLA 1NOWA 2JFEX 2R1PA 4HNVA 1V6VA 2HS8A 5H8UA 3G22A 4HCDA 3MP3A 1IXOA 5HNUA 4XBJA 3MUXA 3EWUA 2ZUTA 1GW9A 1OF6A 1XP3A 2BLEA 4A6GA 1WUFA 3HA1A 4JX4A 4AYSA 4C1LA 3ARZA 4QE1A 3NTYA 4LC8A 2V5BA 3S9IA 1NFPA 2R9RA 4PSRA 1Z89A 1TX2A 2VZOA 2CKRA 3I7RA 3HPZA 3F5KA 4YXGA 1MXDA 3ZM8A 2ISDA 3MKCA 5GNXA 1BGGA 3IACA 2J25A 3T8LA 1Q85A 3N2MA 3AHVA 2VRQA 1QR7A 4TTGA 4GKLA 2OU4A 2OFJA 1QBBA 3OIXA 4KEZA 2GDVA 1OCQA 1OC7A 5I09A 3QV8A 1RD6A 1KM2A 4G6CA 5HNTA 4JOMA 3GHUA 2B31A 1VYRA 3WJYA 2TPSA 4I8DA 3EDJA 2EPNA 1S3TC 4U31A 3W1AA 1V79A 2J9ZA 3AXMA 5HULA 5CPSA 3KL0A 3UCDA 5EBUA 1B5TA 3WFAA 2WXDM 4MB1A 1EXBA 5LIWX 1VD6A 3KS5A 4H00A 2HPIA 3NQCA 4Y2WA 1E0VA 1GVIA 5EB8A 3W83A 3ZJKA 4CCDA 4RK8A 4Q8VA 2V5CA 2WCSA 2HNHA 3VDCA 4AIBA 2ABBA 5DBTA 1MFUA 3POHA 1YXDA 4OVXA 3TYAA 3GBDA 3IEBA 2XFYA 2DVTA 5KMYA 2JEQA 5EA9A 1BXNA 3WLHA 4WRHA 3PR2A 1EHAA 4LS2A 4N0RA 2VHLA 2J7GA 3BXWA 4N9DA 4C6QA 3B4YA 2ZBTA 3LG3A 3R4IA 4XAPA 4O1BA 2Y61A 3E2SA 3HTWA 3GTIA 3U6WA 4UC5A 3CNYA 2CCRA 4KWVA 4LYKA 1W9BM 2J77A 4J3ZA 4BWLA 3NQEA 1OX6A 3SUTA 3Q65A 3PUGA 1LUCA 1R9YA 2J7FA 4UNKA 4TVDA 3W74A 3ITVA 1BWKA 5AFDA 5D2YA 2RJHA 4YIWA 4WHBA 2WMIA 4E8DA 3GZ3A 4H9UA 3TCEA 3F4DA 1J0KA 3PG8A 1M53A 3TQ0A 1W3KA 1JRBA 2XJ7A 1CGVA 3MA8A 1HT6A 1NWRA 3UF9A 4RNIA 1N8WA 4QTGA 1AA1B 3WL0A 3E5BA 1TV7A 4FI4A 5BXSA 2P3ZA 2W91A 2PODA 3W1NA 4KGJA 1S5VA 2Y5SA 1BVZA 3SRDA 2GUBA 4W7VA 2XH4A 3DYPA 3GNXA 4EXBA 4QJ1A 2CHRA 3WK0A 4L1GA 2VFDA 2WJFA 3BL3A 4V15A 3BOFA 3U3HA 1EOMA 1EGVA 3CZEA 2E1DA 1R3YA 1H49A 3KDNA 3P80A 4QDWA 1HL9A 4IIEA 3W87A 2XSAA 3CUGA 1GOOA 3P0WA 3CQ0A 4MLJA 1K9FA 5I79A 3SJ3A 4PMXA 1JRCA 1IXNA 3Q37A 1WZLA 3M41A 2I57A 3HGRA 5JMUA 1JXKA 4DNMA 1BYAA 3UYCA 1RR2A 4Y7EA 2HVOA 4V1XA 2QUTA 5CQ1A 1XLEA 3E0VA 1OGGA 2DW6A 1FWTA 2GJLA 5F1VA 2BSLA 2ZTKA 2V5JA 2OELA 5C8BB 4QSHA 4GY0A 1MEWA 3N19B 2OLAA 1T40A 2QMKA 5KINA 1XLKA 1CGUA 4NI8A 4FNQA 1VEMA 3WQVA 1KFJA 3WBWA 1TPC1 4OHQA 1SFJA 5MHBA 1OD0A 2W27A 4TMCA 1UD3A 3MUZ1 1KD0A 3GKAA 1GGOA 1IV8A 1KXQA 4TTUA 3K2GA 3M9YA 3W00A 1KXHA 1FWEC 4LYRA 1QPOA 2Z1VA 3EX1A 3W86A 3VD4A 2YL5A 4ZQNA 3O0FA 2G4JA 4F2TA 1YDNA 2QS8A 2DJXA 1QDSA 3LRLA 1GOIA 4ZE5A 3S1XA 5CPMA 3O2LA 4O16A 1SM9A 3RX3A 1TJRA 3VIKA 5DMMA 3CK5A 3H22A 4XVDA 4AZIA 1TA3B 4ZFMA 1C9DA 1IEXA 1TVLA 5TAOA 4JEJA 5CPNA 2VX5A 3PUEA 4ACYA 1V3KA 4H7CA 5D8WA 3SQLA 3T7VA 4IJBA 2DZUA 4A05A 3O3RA 1O7AA 2RDTA 1XUUA 4MB5A 1JIBA 4TU1A 3PBVA 1DP0A 3BO9A 4GZJA 1EEPA 1Q6OA 3C2RA 4MPQA 5A2CA 3Q45A 2QYGA 1TYGA 4LAOA 4L6OA 1KA9F 3WN6A 4JY9A 3L4WA 1V77A 1GOWA 4Q3MA 1E5NA 4JQAA 5EKYA 1YEYA 1CTNA 4CD8A 4QG6A 1KFWA 4CN6A 2E67A 2GQ3A 1BF6A 3KL5A 4RUBA 3UWWA 1QHZA 1LRNA 1VLWA 1JCNA 3T4WA 4UR7A 3MVTA 3R94A 3GR4A 1T96A 2J7EA 3MS8A 2J8TA 3UXLA 4DAFA 3HB9A 3NXLA 4W4QA 1NOFA 4H8UA 4YLWA 1EEXA 3TZFA 2BGSA 2VFHA 3GW3A 3S5YA 4G56A 1R6WA 1OADA 4JTHA 4MF4A 3DYMA 1C7SA 1JUEA 4HK6A 1JZ7A 3IGXA 4GRSA 4B3ZA 1UP0A 3DX5A 3PANA 1PKYA 2XVNA 4OZOA 5KZEA 1PPIA 3AXHA 2DSUA 3S2NA 3UERA 4MWAE 2OPJA 4J3SA 4CQAA 3PULA 2VZTA 3CT7A 5F2IA 2AQVA 3M44A 2WSPA 3VOFA 1AK5A 2NSOA 3PN8A 4GBUA 3AUOA 2OEJA 1ZB5A 4QE4A 2HK1A 3KDOA 2DFAA 4XISA 2VVSA 1E1EA 4NX0A 2E1WA 4AB4A 2EG6A 2R14A 3GAYA 1TPWA 1D3HA 1VR6A 2Y85A 4MOZA 1TREA 4GG9A 4V33A 4JYDA 1GQKA 1PIFA 2PI6A 2ZICA 2ODOA 2OEMA 4IUOA 4W84A 1BRLB 1O68A 3IGUA 3WMSA 2PDQA 2EHHA 3MZNA 1H1NA 3BC9A 2BGNE 1POJA 1K6WA 4JQ2A 3L5AA 1NIUA 4RXFA 2ZDRA 4C1NA 2BXZA 3KOZA 1TKKA 1RA0A 3S83A 4WGXA 4DHGA 3A47A 3LM7A 4HSOA 1B9BA 1GT8A 2XTKA 3H2NA 5BOEA 1DQXA 1JCTA 5D05A 4GNJA 1XPYA 2ZXBA 4GFIA 2BY0A 1CXEA 3WH6A 1R2RA 1BFNA 4HPHA 4O1DA 4ZEPA 1QASA 1A53A 4NNCA 3I3BA 4A21A 3GNPA 2E25A 2ZRZA 2Z24A 1P6BA 3CIVA 3IJLA 1BYBA 1QNRA 4AX7A 5D32A 4AWEA 4F9JA 3Q2DA 5FJPA 1IWPA 1E0TA 3I4EA 3CWNA 3ERPA 1PWLA 3WUFA 4KGLA 4LS0A 1R30A 2J8GA 3NSXA 2CHOA 5K9XA 1XRFA 1PIGA 3TV8A 3QJAA 3UG3A 4B5NA 2IPGA 1JGMA 1S2UA 4GI9A 1W2PA 3RU8X 3LYEA 1PX8A 1GJPA 3W0KA 4H9MA 1RJPA 2VUYA 2F6XA 3BAYA 4BF9A 4PMJA 2VM8A 4ZVJA 3QRHA 5I2UA 2XISA 3W38A 1G7UA 3OZPA 2QT3A 1W9VA 3UGVA 4ICMA 4RZBA 2XZ7A 3CJPA 3ATZA 1EJSC 2DUAA 2ADAA 4C6CA 1VH7A 4Y9NA 1L6FA 4PBEA 5LA2A 1IEWA 2C18A 3DGBA 4LYPA 3FOKA 2Y7EA 1HXJA 1TPFA 4YVVA 3N17A 3EX3A 1J11A 4PBGA 3RLVA 3N4EA 1W3JA 1NJJA 5CJNA 4DJEA 3BUVA 1HKIA 4UCFA 3RN6A 2PZ0A 4HNOA 2VFFA 1W2VA 5KEZA 3WLMA 4NZ4A 1RCXB 1DWHM 5LNUA 1GVSA 1XM3A 3PC0A 2FJKA 1CPUA 1XLLA 4Z1DA 1Q13A 1ALDA 4QDMA 2XGZA 4S39A 3VGBA 3PFRA 3B9DA 2QAPA 2X7VA 4LNCA 2ZUNA 2WC3A 3EPOA 1B4KA 1JFHA 4ZODA 4HYRA 1SSDA 2CKSA 1H7XA 3AZTA 3MBDA 3KWSA 4FF5A 1LORA 5GPRA 4OBSA 3TONA 1ZJHA 4JTSA 1O4UA 1RD5A 3EB2A 3B03A 3CLWA 4I6VA 2D2OA 2DZAA 2VKZG 4CD4A 5E0CA 3T08A 3VOGA 4JIIX 5DX7A 4JICA 1D2KA 3WX7A 4IQEA 3OB8A 2BY2A 2WQPA 3M0JA 1TWDA 1XRVA 1F3WA 1RBLA 2X1RA 1ECQA 2HV5A 3A5VA 4UTJA 1Y7VA 4NXSA 1L9WA 2HNEA 3WJZA 3A4AA 3LCWA 1VIWA 2WM1A 3WFZA 4LCSA 1TIWA 2Z6IA 2X16A 4GJ1A 3BG3A 3N6HA 4ZOBA 4BWLC 2PDGA 4W93A 1DJIA 1O5RA 3LQLA 1VBRA 3YPIA 2BXVA 5LKYA 2ISFA 1I2NA 2VI0A 4U33A 1R38A 2V2HA 1M1BA 2C0AA 4ZENA 5DFAA 2GVEA 2OT1A 3HU7A 2WANA 5AKQA 2QLYA 2QNEA 4ZQRA 4UZSA 4UR8A 3WJXA 1SZNA 3IJ6A 4IP7A 3IVSA 1POKA 2F9RA 1XWYA 2I7GA 3MY9A 3O6CA 5AC7A 5M2FX 3GVWA 4NZ5A 2OLHA 3MHUA 3ARPA 1EP2A 4Q32A 1L8NA 2D23A 1XL9A 2BY3A 1EC8A 2BVWA 5CAKA 5I3GA 1DHKA 5E9XA 5C9ZA 1HKMA 4PUMA 1S2CA 4FX6M 2BS9A 1ZZMA 1E6NA 1J6OA 5CSRA 4XD4A 3BG5A 4A8RA 1VFTA 4YTRA 2R82A 2HXUA 4GQBA 3E0FA 2AKZA 3PWAA 4XAZA 3RITA 4WX2A 4MPKA 3MMUA 3P8IA 4WEVX 1LOQA 4MGGA 2WHJA 4RW3A 2BVDA 2REQA 3TNBA 3UWQA 5GNZA 3T09A 1UBSA 5LNVA 3VIOA 5HDRA 4J3VA 3FGCA 3T8QA 4O1AA 1VPYA 3PZQA 2FHCA 1L2UA 1LL6A 4BQ2A 1FWBC 5F7UA 1GZ1A 2V3FA 3CHFA 1UWAA 2OEKA 1K9DA 1Q6QA 5LHFA 4HJWA 1DPMA 1XV8A 1PAMA 3ZYZA 4PTWA 3NO3A 2V2CA 1EGZA 3LCXA 3CQIA 4AWUA 2OSWA 3GUGA 1P48A 4KH2A 2XFWA 3E9AA 1E9IA 3R1ZA 1XIHA 1MDLA 4KEVA 1L6SA 3MC5A 3HJZA 1PXGA 3KZSA 3W7MA 5AC6A 1X8CA 1W9XA 3AXKA 3FVMA 4GVGA 3VK5A 1K9EA 3VE7A 3QTPA 1CW2A 1W5MA 2HRWA 4ZO7A 1TJ0A 8A3HA 1PX4A 2F84A 4QCFA 3DBNA 3M5ZA 2XIMA 4DIAA 3RMJA 2Y7GA 5LGZA 3L2MA 4PCSA 2XN1A 9RUBA 1TMQA 1W5QA 4PC8A 2A4AA 3KE0A 4U2YA 1WKYA 1RJRA 4WUIA 3GC4A 4XZWA 4C6MA 3NVDA 3M0VA 4QDPA 1ODZA 1SO3A 1UUQA 3WNKA 2VFIA 3ZSTA 4AZHA 5JBDA 1HP4A 1XLAA 1HIZA 5G2IA 3KZPA 4JIRA 4MJ2A 3OW1A 4UQBA 1T0OA 1EDTA 1MNSA 3BQ6A 2Z4GA 3V5OA 5FF7A 3H2MA 2PLCA 1H51A 2NQ5A 3W7HA 3P60A 4JQ4A 1KFBA 2A2IA 3GDBA 3W7EA 1OCJA 4NNBA 3O0KA 5A8OA 2PBGA 5EMKA 3N29A 5L6UA 1V4YA 4QISA 4QFUA 2YL9A 3UZJA 3CZ8A 5TQLA 2TSYA 1K6AA 2XFFA 3M46A 3MUIA 1P0EA 2FH6A 1FH8A 3N6JA 2DU2A 2KX9A 1PB0A 3ECQA 3BLFA 4REQB 3XISA 2C16A 3APYA 1FHVA 4LB4A 3OGVA 1B3ZA 3HFYA 2WVVA 2ACQA 1XQKA 2OGYA 1UBPC 3P14A 3WLTA 4C91A 3BJSA 3B0VC 1NSJA 1VRXA 3W26A 3C3NA 3BOLA 4O10A 4P2VA 4I7WA 4IZGA 2NT1A 3LCFA 4XKYB 5H8PA 5HNNA 1QT1A 2XM1A 3S2JA 1LLOA 2PRMA 4K7VA 4XUGA 4DQWA 4RV3A 5KITA 2WZTA 3W7PA 3B8WA 6A3HA 2CW6A 3LTYA 1GYMA 3PJTA 1WP6A 2QCLA 3BCDA 2DSVA 1DOSA 2CBVA 2VEKA 1RCQA 3FA4A 1VJZA 2Y5JA 3KBVA 4UTLA 4JYEA 1EUAA 3B3DA 1MW3A 1PEZA 3NYZA 3NQAA 3M6YA 1CI1A 3C2FA 3UT0A 1F07A 1OCBA 2B81A 2CLEA 4ECLA 4MVAA 3S5NA 2JF6A 1A5UA 1S39A 3STCA 3G3MA 3QYSA 1JZ6A 1QXLA 4IFKA 1F3XA 3A4JA 3NM3A 4P7RA 2GOKA 1PZ3A 2D0GA 3QV6A 3W25A 3WF4A 3R10A 2Y70A 4X61A 3H26A 1E0XA 1G69A 4QJ3B 4MJ4A 3VMNA 2EG7A 5D30A 5EFDA 3VD5A 3R8GA 4LBRA 3BMVA 4A8IA 1V7AA 4LUJA 3ZXWA 4GNVA 3R12A 1R3WA 1QI2A 3ENLA 1BEUA 2Q8LA 4GGHA 5I3DA 3OTRA 4C6BA 1UZ1A 4PBFA 5IFTA 4HSNA 3G6MA 4I90A 1F6PA 1HKWA 1SMAA 1H62A 2H3DA 3I6EA 1KM0A 4GUFA 4DBEA 3B9EA 4Q8MA 3P84A 1GQJA 4JX5A 2QDEA 4PTNA 2GLKA 3RLHA 3UZXA 1ONRA 4M6UA 2ZUSA 1VCFA 3L4UA 1CB7B 4U5IA 1MWOA 1LBMA 2J88A 4GQQA 3IRDA 1J2BA 1P7TB 1KR1A 3I4KA 3TJ4A 1JXJA 4HMEA 2XDFA 3TYUA 1KQZA 1XLGA 1U5HA 1QW9A 1QNVA 1DWFM 2OZ3A 3R43A 3M0IA 4Q33A 5DANA 2PA6A 1XLMA 4GVHA 3VD9A 1DVJA 4LEQA 3HG4A 4JKKA 1MW2A 3P5YA 2PGFA 2DT1A 4FLQA 4WOZA 3MBFA 3GHRA 5EGRA 3WO8A 1EJWC 1WB0A 3XIMA 1FTXA 3KBWA 3P74A 4XZ9A 5HK4A 1KXVA 1US2A 6TIMA 1WPCA 2E8ZA 2VFGA 1UQZA 3WLSA 3ZMRA 3VNIA 4FHAA 3ANYA 4JXCA 4JHZA 4L5ZA 3IVUA 1V3LA 4WDTA 3TN4A 3ZZ1A 4EX4A 4GYFA 3LHVA 1T6MA 4CNTA 3VC6A 1FDZA 1A4MA 1W3TA 1CCWB 1UA7A 3HQPA 3RX4A 3WUBA 5M17A 4NX5A 1K8YA 1UQYA 5JH2A 1TIMA 2ALDA 3SCWA 3ZR4A 1C7TA 2CXEA 4MAZA 2ZOXA 4UNLA 2QJGA 3WY1A 1ZS2A 1MQQA 4MZ1A 1JF5A 4PMNA 1V02A 4WOQA 2PUZA 4Q6XA 4W88A 3K8LA 3SCVA 4TX6A 5XIMA 3S4TA 2CYGA 3SUUA 3QV9A 2V38A 2QQ6A 1WDPA 4IF2A 1Z6KA 3NL2A 4R7JA 3FVDA 1PIIA 5JBFA 1KKRA 4WVXA 2VMFA 1W1YA 4AVOA 3AMCA 1VBGA 3PS7A 3SADA 5CLWA 4YWSA 1VKFA 3DFTA 4IQJA 4JFSA 5HMEA 2TODA 4D72A 2VQTA 4L4OA 2QGHA 2WMJA 1TCDA 2YL8A 1WDWA 4ORIA 3CEPA 1I2OA 1W32A 3DFSA 2OMAA 4KW2A 3CMJA 1XICA 4XQ6A 4F0MA 1XLIA 2PDXA 2WSRA 1RBAA 8TIMA 4K38A 3V1HA 3WKZA 3VYLA 4HNUA 2VFEA 4BQ3A 4XD3A 4W8BA 1K1DA 2P53A 2GSHA 4C7FA 4DAIA 1N8IA 1KFCA 4HZ7A 3GG7A 1L8PA 3DHDA 4F40A 3BLEA 4L56A 1A4LA 3GH4A 3ISIX 4DJDD 3DHFA 3H2AA 1AQ0A 2V63A 1A0CA 1NOUA 3TC7A 4KIRA 1TWZA 1M9HA 2GVYA 5CC7A 3CUFA 3D3AA 1LBFA 1XDMA 2PDWA 5HINA 3BOXA 1OZMA 1ME8A 3DC8A 3N12A 3NL3A 5T9BG 2WMFA 4FEZA 1H7RA 3T0DA 3PAOA 5B7YA 2PWHA 1FY6A 1FHLA 2X05A 3CL7A 1P7TA 1OSEA 4C1KA 2ATMA 4QAWA 1RXOB 3B40A 2G8ZA 4IXXA 4NASA 3I6TA 3FCPA 2XM2A 2CEQA 2GWGA 2VELA 1D9EA 3P8JA 3M4HA 1E6QM 4DVOA 2Z7KA 4XG1A 5I07A 4DBWA 3RNDA 3E96A 1EX5A 5H2ZA 1O66A 2W6RA 2NX1A 4OUIA 1KGXA 1B3OA 3MU7A 3SFKA 4ILSA 2YBVA 1JULA 3IIPA 3V18A 4ACZA 3AC0A 3IUDA 2HS6A 5HANA 3GXMA 1JJKA 1Q6FA 2EJAA 2OO6A 3G8EA 5U7SA 4R88A 5AY7A 3SFWA 4ASTA 3RU6A 3LLDA 1C8YA 1GEHA 3DECA 3SGUA 4D2JA 1G7VA 3CHEA 2WNZA 4H1ZA 1X6UA 1EQCA 3S2MA 8CGTA 3PZVA 4A3QA 4ZMGA 3IIOA 5HR7A 2BHUA 4QIUA 2J47A 1J8VA 3EWYA 2CZFA 5KZDA 3EOOA 1S3HA 3FJLA 2CLLA 5D03A 1TVPA 1E6PA 3V75A 2XH7A 4X22A 5F2LA 5M3WA 1ZQ5A 2B7QA 1S2TA 3C52A 4PB3A 1P0NA 2OT0A 3NVTA 4BS0A 2Y4SA 1EWEA 3WD3A 4U5KA 2NW0A 3ONCA 4O0KA 5I06A 1ZP4A 3PHAA 1GONA 4O13A 3B8TA 4IP5A 2ZCGA 1OZQA 3U2ZA 2G0WA 4HYVA 1CXIA 1PKLA 1ZRQA 3FFSA 1XIIA 3S46A 3F2DA 3VNDA 1JPHA 4D8LA 4GH3A 3MSYA 1B1YA 4CQBA 1J01A 3GDKA 4J3UA 3VMOA 3TMQA 5C9UA 4H6KA 3EZ4A 1XCWA 4N4PA 3II1A 3PZ9A 1TZ9A 3T9PA 2E5DA 4CQ9A 4HHPA 1KWGA 3H4GA 1EA0A 3HPFA 5G4HC 5IRPA 2G3IA 3NA8A 1WV2A 4HD5A 2UWFA 4MB4A 3NEVA 3KEHA 5GJPA 1R2SA 3LX9A 2VUNA 1QPRA 4ZE4A 3BCFA 4JTJA 4O17A 2WKLA 3C8NA 3G0XA 1R3TA 4QLKA 3VE9A 1WOBA 3UR8A 1MZRA 2VR2A 4W89A 4Z2JA 2YCJA 1FCBA 2F7FA 2QCHA 1XR2A 3POCA 2PDIA 3BQ5A 1U5JA 3RDKA 2QPXA 1W37A 4GXWA 1LF1A 3ZQ9A 2QIIA 2R1MA 4EWJA 1XIBA 3W3OA 1VPQA 2C3ZA 1XD0A 4Q4MA 3CQHA 2H90A 3TSDA 4IIDA 5D2XA 1IGWA 1EWDA 4MWAD 5DQPA 4HHHA 1TTPA 2ABAA 1K3UA 3SURA 4CGTA 1KV5A 1E72M 3KFTA 2XU2A 2XIIA 2FB2A 3VTRA 4EVZA 2NVAA 4MY1A 4Q7NA 1LQ2A 4HMCA 2YDSA 2QXWA 3QHOA 3QW4B 3SRFA 2X0YA 2PDFA 4CKQA 1UR1A 4YVPA 2XIQA 2FIQA 4UMCA 2WC4A 1KXTA 2TRSA 4IQDA 3RILA 4DJFA 3ITCA 3WG6A 1DIDA 4AFYA 3CEUA 1H0IA 1H60A 3QQ1A 3EKGA 3RLUA 3M07A 3WDJA 1UUOA 1FH9A 3IJQA 3OBKA 3PK7A 3B9AA 4O50A 3V5CA 2EKGA 3EKZA 4KCUA 1SZFA 1VPXA 2F2HA 4BI6A 3RYSA 1UR2A 1E4IA 3EEZA 1A5KC 3VZYA 3IV3A 1V6WA 5FI8A 3TW6A 1IHIA 2EPMX 1PS9A 2FGZA 4KFNA 4NAEA 1VAHA 4PEKA 2VD9A 5C7VA 2A79A 2I9UA 4O1EA 3PTMA 2XH2A 3M7SA 3CWOX 4MNMA 3N2CA 1RV8A 4QHRA 4DYJA 4RV8A 4UQCA 5KZ6A 1B3YA 2VRKA 4XD5A 4Q8TA 4WY0F 3BCJA 3MI6A 4OBRA 4ROPA 5FJRA 6CGTA 1RPKA 4UTKA 4FMVA 3L12A 1DJNA 5CGMA 4KERA 2BB0A 3BAWA 4RX0A 3KVJA 2PDJA 3B06A 1FHDA 1MRQA 1RQBA 2Z1SA 3QF0A 4DJEC 2WNQA 5AYZA 4WSKA 3T0BA 3VFCA 4JZ5A 2PDLA 4Y9AA 2EG8A 1UKPA 1KLYA 2PPGA 4UFKA 1J96A 4W86A 3H70A 2GQ8A 2P88A 3BPWA 2X1UA 4AISA 4ZO6A 4NJJA 4DF0A 3OGRA 4MTVA 2WVSA 3EB4A 3A64A 1OJXA 4GX9A 4KPLA 3AHZA 3MUCA 2E0PA 4MJMA 3L5MA 3PJWA