3N29A

Crystal structure of carboxynorspermidine decarboxylase complexed with norspermidine from campylobacter jejuni
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
381
structure length
371
Chain Sequence
FYEKIQTPAYILEEDKLRKNCELLASVGEKSGAKVLLALKGFAFSGAMKIVGEYLKGCTCSGLWEAKFAKEYMDKEIHTYSPAFKEDEIGEIASLSHHIVFNSLAQFHKFQSKTQKNSLGLRCNVEFSGRYSRLGIRAKDFENVDLNAIEGLHFHALCEESADALEAVLKVFEEKFGKWIGQMKWVNFGGGHHITKKGYDVEKLIALCKNFSDKYGVQVYLEPGEAVGWQTGNLVASVVDIIENEKQIAILDTSSEAHMPDTIIMPYTSEVLNARILATRENEKISDLKENEFAYLLTGNTCLAGDVMGEYAFDKKLKIGDKIVFLDQIHYTIVKNTTFNGIRLPNLMLLDHKNELQMIREFSYKDYSLRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of substrate specificity within a diverse family of beta/alpha-barrel-fold basic amino acid decarboxylases: X-ray structure determination of enzymes with specificity for L-arginine and carboxynorspermidine.
pubmed doi rcsb
source organism Campylobacter jejuni subsp. jejuni 81116
molecule tags Lyase
molecule keywords Carboxynorspermidine decarboxylase
total genus 117
structure length 371
sequence length 381
chains with identical sequence B
ec nomenclature ec 4.1.1.96: Carboxynorspermidine decarboxylase.
pdb deposition date 2010-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00278 Orn_DAP_Arg_deC Pyridoxal-dependent decarboxylase, C-terminal sheet domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.37.10 Mainly Beta Beta Barrel Lyase, Ornithine Decarboxylase; Chain A, domain 1 Lyase, Ornithine Decarboxylase; Chain A, domain 1 3n29A01
3.20.20.10 Alpha Beta Alpha-Beta Barrel TIM Barrel Alanine racemase 3n29A02
3WQDA 1RCQA 3R79A 1NJJA 2O0TA 4BEUA 3ANVA 1EPVA 4FS9A 1QU4A 1CT5A 3C5QA 1L6GA 1KO0A 4PB4A 3E5PA 1VFSA 3NZPA 3N29A 1HKVA 4LUTB 4ECLA 1SZRA 4ZGYA 2PLKA 3B8VA 3CPGA 3LLXA 4Y2WA 4DYJA 4DZAA 4LUSA 2P3EA 3OO2A 5GJMA 5GJPA 3E6EA 3B8TA 4BF5A 4BHYA 3WQFA 5FAGA 2RJHA 3N2BA 1VFTA 3AWOA 3B8WA 5BWAA 3WQGA 2SFPA 3N2OA 2QGHA 3HA1A 5GJNA 4V15A 1XQLA 4XG1A 5IRPA 3BTNA 3ANUA 2NVAA 1NIUA 4KBXA 2PLJA 1XQKA 3GWQA 5FAJA 3SY1A 3VABA 4WR3A 3NZQA 2DY3A 1TUFA 4PB5A 1XFCA 3MT1A 3UW6A 2RJGA 3B8UA 1HKWA 3S46A 4ILSA 1W8GA 4XBJA 7ODCA 1TWIA 2OO0A 4LUYA 2ODOA 4LUTA 2VD8A 1L6FA 4QHRA 1D7KA 3WQEA 4BEQA 1KNWA 2TODA 4A3QA 4PB3A 1FTXA 5FACA 3WQCA 3KW3A 4LUSB 1F3TA 2J66A 1BD0A 3AWNA 4AIBA 2YXXA 2ON3A 2NV9A 1VFHA 1SFTA 1B54A 3CO8A 2VD9A 3HURA
chains in the Genus database with same CATH superfamily
3P93A 4UTFA 5AC5A 1XLDA 3HQPA 3THUA 3STCA 1W2VA 2J13A 3DFYA 4UTTC 2GGIA 3ENLA 2VT0A 1JD9A 5LHEA 2OG9A 4AX7A 1XGZA 1VBJA 2OWCA 1EWEA 4O12A 4PTDA 1A3XA 2VVNA 4E2BA 2CC0A 3MP4A 4KWVA 2IPJA 4RE0A 4GQBA 4PMQA 1R3VA 3VIPA 3W0KA 5A6JA 1R3SA 4MZYA 3LHWA 4N9DA 4JY8A 2CLFA 5GJNA 3N3TA 1XC6A 2YA0A 1FDJA 1KR0A 1Y5XA 2G3MA 3MBFA 3Q58A 2G41A 1BWLA 3W1QA 2FPYA 4CNPA 4FPSA 2ZX8A 2PRLA 2ZTJA 4ZCWA 1REQA 4J28A 3S1UA 4CD4A 3M4HA 4LUTA 4QR6A 4XZHA 3WH9A 3IV8A 3UWQA 4FEZA 1LQ0A 5LIYX 3M46A 5ABHA 5GQBA 1US3A 1PWMA 4Q4PA 1P6CA 2X8RA 3BXWA 1RP9A 4US5D 4AHQA 1L6GA 1HJWA 4C6EA 4MPQA 2GSEA 4O1DA 4YWSA 3DERA 5FJJA 1AH0A 1XUZA 3ITXA 2HVOA 4QM1A 3EDEA 1WXJA 3VD7A 3DOPA 1QRQA 2PLKA 1W9BM 4PR4A 2FIQA 1KKRA 2PD9A 4ZOAA 4ZO9A 4JIQA 2XVPA 1SJAA 1GG0A 4ACZB 4CEXC 2G3FA 1P1MA 1JZ6A 1EGZA 1A0EA 4YTUA 3URBA 4I6VA 3AIBA 1C8QA 2J9XA 1HKJA 4D6FA 2R1MA 2FVKA 4JTQA 1V7YA 5LKYA 2VO5A 1U5JA 5I02A 1L2UA 2PDQA 5JIWA 1CDGA 3B06A 1FWEC 4H2CA 5JBDA 4RZ6A 3WK3A 4IP5A 4UQEA 1Q6LA 1Y8BA 3NGFA 7REQA 2E6YA 2CERA 3TQVA 1FCBA 1Q6RA 4M6VA 1JAEA 4WCJA 3HPAA 3DYOA 5CSSA 4N9BA 1RZMA 3E3HA 1QW8A 3SBFA 4ROPA 2ESCA 3O6DA 2X1UA 4QP0A 1AL8A 3L4UA 3OLGA 1HUVA 1Q7QA 4JNMA 4CKQA 2DZPA 3LD5A 1GTHA 4JTAA 3SGZA 3F03K 5EBAA 2JBMA 1U30A 2ZXAA 5D38A 4LS0A 2EJ1A 3WQOA 2R1NA 1M04A 1Z32X 3IUDA 3GHRA 3W7OA 3GTIA 5A2CA 3HFTA 2GDUA 2PRHA 3M7WA 3W70A 3MI3A 2CLLA 4LC6A 4KEUA 1I2PA 3STGA 1CZ1A 4IGNA 3KRBA 3PBWA 2WAGA 2VC6A 1ODZA 3WF0A 1E6NA 2HCVA 1MSSA 1JCTA 2W67A 5A8PA 1GOQA 3ARYA 4PODA 4XG1A 1BTMA 1RCOB 1VQTA 4AZHA 2FGBA 1EBHA 4DWSB 1IEIA 5AC7A 1EA9C 1JQXA 2GQ9A 3H55A 4HJWA 1XF0A 3NYZA 4AY1A 3V36A 4UIOA 3M5XA 2ZZ7A 3CC1A 3BPWA 3KVLA 7A3HA 3FCPA 4H9TA 4KH2A 2VDGA 3B0PA 3SAZA 3SN1A 2ZUVA 2Z6IA 1OF6A 1W9DM 3HGRA 1BPLB 4OZOA 3G2GA 2PB1A 1BKSA 1JPDX 2XVKA 3ZXWA 1CEOA 3G0SA 3PG8A 3RUBL 4QXIA 4LYPA 1EOMA 2JFEX 5F4XA 2ZZ2A 3UNDA 3BOXA 1LL4A 4IUGA 4UTUA 5CJ5A 2ANUA 1Q7ZA 1R8LA 3VKJA 2NUXA 2WVUA 5LIUX 4C6OA 3M43A 2FFIA 3MBDA 1JGMA 3FXGA 2XFRA 4KS0A 1AD1A 3WKZA 2OXNA 5CSUA 1WAWA 1ZUAX 5HMFA 1X39A 2CHRA 5T91A 3QMSA 5A6SA 1NWSA 5HQMA 4QJ5B 4U28A 4C6DA 4JL2A 5I3GA 3S8HA 1KFWA 2BASA 4WJEA 3I7RA 5J8LA 1O5RA 3QPEA 4DF2A 5FA5A 3N13A 3N4EA 1YDVA 3PPCA 1JL8A 1PZ1A 5CKSA 4W85A 5BW6A 3M1ZA 5CPOA 3L0NA 4XSLA 1Z42A 1UWQA 3EWXA 5HWJA 3G1DA 2QDHA 5HNUA 2H8ZA 4RE3A 1OCQA 2VOMA 4U10A 4GNKB 4E4PA 4QE4A 1MDLA 4TUFA 4E6MA 2OCZA 3VUPA 1W5PA 2GZXA 4PZVA 5DEZA 4B9ZA 2QDGA 3C8FA 2HVMA 3NOYA 3BG5A 4M82A 5D04C 2ZUTA 1S3HA 3FEMA 4FNQA 3ITCA 1VGAA 4QBXA 7CGTA 3VCRA 4IPLA 2QJGA 3SQSA 2NUYA 2HE5A 3HG4A 2NT0A 4D8ZA 4GCXA 4XBSA 1F2JA 2V8ZA 3GR8A 4NQ1A 1NSJA 4O50A 3AS1A 3RG6A 3C2FA 2G3IA 2V5BA 4JIRA 2WPGA 4GZ7A 3GUWA 4IT1A 1PAMA 4Q8PA 3W1TA 3RPMA 3ARUA 2XGIA 4S3BA 3GDTA 1TA3B 3KOWA 3W85A 3IGUA 3DFHA 4J2PA 4ZE5A 2OT1A 3H24A 3DENA 3UETA 3CT7A 3GNPA 2DSZA 4IX0A 4QE5A 4E2DA 2X1SA 3WNMA 3LUTA 4REQB 5I5RA 1YE6A 3B9DA 4HBKA 4KRZA 1PTGA 1OIMA 3RF9A 1WPCA 1J96A 1WKEA 1K3UA 3AOFA 2G3NA 1RAKA 1RCXB 4A3RA 3GXPA 4NZJA 1YE4A 1H50A 1ZS2A 3LM3A 4HA3A 4S1FA 1AA1B 4MJ4A 2XM1A 3RJYA 5CBBA 2GPTA 3GYCA 4CU7A 3BAKA 3RRXA 3T8LA 3VIJA 2QW5A 4JY9A 2DH3A 5A2BA 2TODA 2WB5A 3HPXA 3S5YA 1S2CA 1CPUA 4AD0A 5TIMA 3F5JA 2Q02A 3FKKA 4GK8A 4ENLA 4H9VA 3WLKX 3KOZA 5HUOA 3ANYA 2OQHA 4DUVA 1W1YA 2PLMA 3PZGA 3C0LA 1G7UA 2GVJA 2Z7GA 3OIXA 3TJXA 4TVCA 1PCKA 2P50A 1T6MA 2PDMA 4NG3A 3GXFA 1I1WA 1KO0A 3LXAA 3G6MA 4NYUA 3VOGA 1ME7A 1NDWA 3BG3A 2VMFA 4W7UA 3S6OA 2VFEA 4C6CA 3FSTA 3CUZA 5DRIA 1BWKA 3N4FA 3SFWA 1TPDA 5D2TA 1WOAA 3BJFA 3FJNA 3L9CA 4TX9A 4O28A 1SO5A 3UYIA 2QPSA 3GE7A 4IMEA 3MMDA 4ZR8A 2FQIA 1WB0A 2OMAA 2YZRA 4MJ2A 1NDYA 1TWWA 4UXDA 1ZNNA 2V3DA 4Y7EA 3B8SA 2ZDRA 1B31A 2DIEA 2XZ7A 5BRQA 5LYRA 5FEPA 3K8KA 1KFJA 2GUUA 3CLWA 1NTHA 2CBVA 3SI9A 1ZALA 1NOUA 2GJNA 5AHMA 1DJQA 2XIQA 1BKHA 3G22A 2CKRA 4OIFA 5DFAA 2INFA 1BVNP 1FWGC 2B4GA 4HU0A 3BLDA 1QI3A 4JCLA 1G4SA 4HMNA 4KEMA 1WXZA 3EWUA 1CB7B 3BW3A 4B2DD 3FY1A 4IIHA 4J9JA 4K7VA 3BWWA 3WBEA 1J6PA 1FKXA 5DO8A 3S1WA 1JNEA 4KWUA 4D6DA 5EBUA 2OVLA 4FXRA 3K46A 3DHUA 1BYDA 5I00A 3CAKA 3MYPA 4RPQA 1E72M 4LCQA 1A5KC 3A47A 3LCXA 5C9XA 1GG1A 4NZ3A 4EE9A 3R13A 1PKNA 1UBSA 2Z00A 1RSCA 4DNMA 3B8WA 4N2YA 4CNUA 4Q4QA 3LGEA 1F6PA 2XPKA 4DZIA 5E93A 3WD2A 3NQCA 3STEA 4C5ZA 1MFVA 1W5NA 3PY2A 3E02A 3MSDA 1MZRA 4CNNA 1EJTC 3TJIA 2JGQA 3OZOA 4NNAA 2Q71A 4TO8A 3W53A 2NSOA 3EX4A 3K2GA 3DU0A 4UOZA 2IKIA 4EAMA 2IUZA 4IPPA 3MZNA 1B9BA 1UD3A 2RDWA 2NWSA 1Y5VA 1UD4A 4LAUA 3CB8A 3XIMA 2GQ3A 1K8XA 3GNRA 3TUUA 3C61A 1ENUA 1K8YA 2YDQA 4B4HA 3O9NA 4LXFA 5T8GA 3DFQA 1Q5MA 4B15A 3O6CA 2ZZ4A 1VLWA 1BRLB 3I3DA 4I9TA 4CD5A 3WH8A 3AXKA 1P0NA 3SCPA 3B8DA 1PUDA 1EP3A 2Y2WA 4JQ4A 3E5PA 2IQ0A 1D7FA 3F4WA 1GK8A 1B30A 2VP8A 4GMEA 1CBGA 3HPZA 1VIWA 3VNDA 2ICSA 3GTHA 5C2XA 1KLZA 3NG3A 3R2GA 3OBAA 3O15A 2E0PA 3W1UA 2WKGA 5G4HC 4WK9A 1UIPA 2X40A 3SCTA 2XWDA 5B7YA 1UD5A 3IANA 4HA0A 3OA3A 4B5SA 4BY3A 1RV8A 2OYMA 1BVZA 2C1IA 2UWFA 4AAJA 1TQJA 5K4ZA 2Z1XA 3W02A 8CGTA 5C2GA 4CNOA 1GT8A 5FJRA 2D69A 4PTMA 1N8WA 2GGGA 1UR8A 2RJGA 5K4XA 3WL0A 1VEOA 1W8SA 4F2TA 3NVDA 1XD0A 4UZUA 3NJ3A 3OJGA 1R9YA 1C93A 5AHFA 1LL6A 3UG5A 5BWFA 2FMOA 1E6QM 1LT7A 5MF5A 4CQAA 2FH6A 3BL3A 4ZOBA 3BAJA 3T42A 4G9PA 1OC6A 1YEYA 1F6KA 1RCQA 4O1AA 5CGMA 5LA1A 5EL1A 4DJDD 3F4VA 3MDUA 1H62A 1TELA 1CT5A 2PP0A 3L4WA 4UOQA 1V79A 3D5HA 3R7MA 3NTYA 1BYBA 1ONWA 4MSSA 2DT1A 4RDZA 5C8BB 5I03A 4HNCA 1UR9A 4MTVA 4ZL1A 2D73A 3MI2A 4JZ5A 1ZBVA 3TH6A 5LSMA 3MV01 1DJXA 3IJ9A 2BHZA 3CZKA 2FFCA 3S2CA 2VZVA 3AUOA 8XIAA 3MPGA 3GG8A 1E9IA 3MJYA 3WELA 4Z2GA 2W27A 1QWKA 2R6OA 4D72A 4Z1YA 3EB4A 2BGNE 4H8HA 3BGGA 1FVPA 3CIWA 4J3SA 4QRNA 2OWWA 4OOUA 3IIVA 5AZ1A 2FPTA 4B4FA 4IMAA 1WUFA 3UWEA 2J25A 1YTEA 3DZ1A 2WMIB 5G4EA 2QCCA 1TMLA 2WNWA 2Y8UA 4AF0B 1TE1A 1X6NA 2ZVRA 4IP4A 1HZYA 4GABA 3VNKA 5JIPA 1W3KA 1A5CA 4PMXA 3GFYA 1PB0A 4MNLA 4LC8A 4LV4A 3KDOA 1IEQA 1O1HA 5DY3A 4WY0B 2TRSA 1T8QA 4DJEC 2HXTA 2R1KA 2V2DA 1CGYA 3R89A 4FXFA 1B57A 4UTHA 1J0ZA 5F4SA 4XVDA 4UUIA 5BXPA 3M5ZA 4HCHA 2WWCA 5FCZA 4CEUC 3IACA 3CT2A 3BDKA 1QOXA 1X1OA 5CZSA 2W3ZA 3GK0A 3U57A 3IJ7A 1NFGA 4CQDA 4HTYA 3O0KA 5ENLA 1BXCA 1UJQA 3T81A 1ZAIA 1KFCA 1U33A 3NDYA 3WMLA 4GHRA 3P82A 3GU1A 1KBJA 3T07A 3W9ZA 5D9NA 4A2SA 3KCOA 2J8GA 1QHZA 3BTNA 5C0QA 5AVHA 2OLHA 3KP1A 3AQUA 5BNKA 4IQDA 3CMGA 4GY7A 1HL9A 5REQA 2VGIA 4WIWA 4M1RA 4CNTA 3BVJA 3C6CA 2YX0A 3V0TA 4UTWC 4Y6GA 1TWIA 1KXHA 1N2VA 4ZO7A 4NF7A 3IVTA 1PWLA 4D8LA 2DW7A 1YPIA 4P7RA 1QTWA 4AU0A 2D2GA 2VX5A 2GK1A 3FKRA 3LEPA 4YYFA 1PYFA 3MVTA 3T9PA 1TE6A 4LBRA 4U2ZA 1DQXA 1DWAM 1P4CA 4G6CA 2Y7EA 1GJPA 4Z1CA 3R79A 1GONA 1VRXA 1YW1A 5CC5A 4MYXA 2VRQA 1V02A 1SFSA 4GX8A 4HYRA 1H51A 3ATYA 2VGFA 3BK0A 4XAFA 1EQCA 4V33A 3F5KA 3EMCA 8XIMA 1XISA 1UH2A 2PGWA 4EWND 3TR2A 4QROA 1LOSA 4AZIA 3TYZA 3CU2A 4OU1A 2NQJA 2J62A 1WDQA 2QCFA 4NT0A 4S2CA 1K4HA 3HIJA 2CZFA 3K1GA 3JS3A 3VOCA 2AKZA 1R46A 2QLYA 1EUAA 1QW9A 3OGSA 5FJIA 4JBRA 1G67A 1P0DA 3PZQA 1DIEA 2ZTKA 5ABEA 3PZ9A 3GWQA 3FHQA 3HPFA 5D32A 3WUFA 1FH9A 1JGIA 2EF9A 1DE6A 3HB9A 3VNLA 4LT9A 3W75A 4LH8A 3G0UA 3R6IA 4PCTA 2IPFA 2V5DA 4J3UA 4XBJA 3O05A 7ODCA 1JI2A 1HP4A 1CXHA 3TYDA 3W26A 3GDRA 4E38A 1JD7A 4F8XA 3PM6A 1JUKA 2HZGA 1KFEA 3W82A 2AQOA 5L9FA 4HB7A 5H8UA 4ZFMA 2V68A 3A4AA 2BHYA 1ZENA 1ZGDA 2E7FA 3HZ3A 4DYKA 4NI3A 4ACYA 2GVYA 1JULA 5FSDC 3M0XA 1E1FA 4LB3A 5CG0A 3AIVA 2Q6ZA 2Y61A 3TXVA 3A3XA 4QDPA 3HGSA 3E49A 3TJLA 1SVDA 1ME9A 3P80A 5I7GA 4A29A 1W32A 3W86A 2FJKA 5A6BD 1WZAA 3WNKA 3W7IA 3R8HA 3PF3A 3RCYA 4GZIA 3STPA 1C92A 4OJYA 1I60A 1IZJA 2VZUA 3IIXA 3GG1A 3QN3A 3EMQA 3N2OA 3LCWA 3EKGA 1VYSX 3ABXA 4HU8A 4H6RA 1NU5A 2ZX5A 1BGGA 1WDPA 3EKZA 5DCEA 1GTEA 1M03A 2EXOA 2BFGA 3VI2A 5LXXA 4B90A 2AOSA 2XIBA 5D33A 1J2BA 1WKYA 5BXSA 1F8MA 3NZQA 2XM2A 3VIKA 4E8GA 2H90A 4JFVA 3R4IA 2V3FA 1D3GA 3URQA 5CPNA 3U5UA 2H3DA 1V8EA 1LCOA 5FOOA 3VKBA 4XKMA 2P88A 2DUXA 1F4HA 2QJHA 4XAZA 3FAWA 4IXHA 2A3BA 2DZVA 5DMMA 2PZNA 2PU1A 1HW6A 3MWCA 1QHPA 2OO6A 1WXYA 3EB2A 4RDWA 3W73A 1CXKA 3GYEA 2J88A 4ONVA 3T40A 2O7SA 4IQJA 3H23A 2PTDA 2WSRA 3II1A 3WQ6A 3N11A 3U6WA 2XSBA 3SUSA 2ALRA 3H2EA 4C1LA 3SCWA 5AHIA 1YTKA 3EB3A 1LTDA 3MY9A 3LHVA 2ZZ1A 1NF0A 2WC7A 1FFRA 3T78A 4GZEA 1HJQA 3JZUA 3ZS4A 4NAEB 2QJJA 3WMSA 5HR7A 3TWAA 4MNJA 4H9MA 1A80A 2KX9A 3B05A 3VOIA 4ZZ9A 1LLOA 2NSXA 1SR0A 3AICA 1UMLA 2I56A 4LY4A 2WQDA 1FFQA 3ME3A 1RQHA 2WK2A 3D47A 4HK6A 1TB3A 4BQ2A 3UP8A 2C8NA 3P61A 4KWSA 2DQWA 4CU8A 2ZX6A 4OBRA 3PJXA 6XIAA 1L9WA 4NUWA 3WY1A 5JH2A 4NJJA 4TX6A 2Y7DA 4PTVA 1HKKA 3GZ3A 1F4AA 1F6YA 3OZYA 3ARRA 4XUGA 3SY8A 2NXIA 3TW6A 3WL1A 5TQLA 2A1YA 3NXLA 4JL1A 3TLLA 1EX5A 4OUEA 1SJCA 2V5KA 2E5CA 4HCLA 1YXDA 1R2TA 3DDMA 5ABGA 3L7RA 2ZOXA 1OB0A 1OX6A 3CO4A 4L4LA 1H11A 1VP5A 4GI6A 1FWFC 2YJQA 1V0LA 1OZMA 1KRAC 1QBBA 4PFHA 3W2MA 1UJPA 2DUZA 1F07A 3LRKA 1R3RA 4JHOA 3WYZA 4DLMA 1VEPA 4QJ3B 1F9CA 1DE5A 4HSOA 2OZ0A 5EMKA 2X1RA 4XZLX 1ZZMA 4ZTXA 4KCUA 1WZKA 1U5VA 1T40A 3EBVA 4CN6A 5CGTA 2ZCGA 4CVWA 3GVVA 2XVNA 4AD3A 3W01A 3LCIA 2GOUA 3VIGA 3AFBA 4DUWA 1OABA 1DXFA 3SUWA 4L4OA 2CZEA 5IHSA 3BW2A 1XXXA 2E6FA 5CGQA 1OCBA 1XUUA 4WSHA 1B54A 3DI1A 4MLJA 4UMAA 1R6WA 2PGFA 3AHVA 1S46A 1NQKA 1TO3A 2FZNA 1AFSA 3VTRA 3P7YA 2UY4A 4HGXA 1DWGM 4EXBA 2WSKA 4MAZA 1IQ8A 3TTOA 4IX2A 4OBSA 1PV8A 5HANA 3PZUA 3KBMA 2XH7A 1LUCA 4F3HA 3O16A 4JPGA 2PTXA 3KP0A 1M68A 2OQLA 4YU1A 4DO6A 5I79A 1KM1A 4ADUA 3KAOA 1CENA 1J5TA 3GG0A 3LMYA 5HNNA 3LPFA 5DLCA 3CIXA 1GYMA 1S1PA 3A5VA 3BLFA 2A0NA 3TEVA 3CEUA 5DX7A 1H2JA 4MWAC 4JGDA 4H41A 3IK4A 4IF2A 4AYGA 2A3HA 1WCGA 5EMLA 3A13A 1GQNA 5CG7A 3DC8A 1Q4NX 3Q65A 4J3XA 3W6MA 3TIMA 1OT1A 3L2MA 4BS0A 3P81A 2W6RA 3PZOA 3C2YA 3D3AA 4D6HA 1I2QA 3N25A 2CW6A 4O0ZA 5K9XA 2R82A 5GNXA 3AXIA 2PTYA 3R11A 1XSJA 1Q65A 1OEPA 2WZMA 4DBWA 2GJLA 4M7SA 3QW4B 3CASA 2VRJA 5IBXC 4A8LA 4C6BA 5FIPA 2QF8A 3B40A 2OZ3A 2P8CA 4G7EB 3M0YA 4Q8WA 1AQ0A 3GUGA 1A4LA 4WY0F 1UH4A 3VIMA 2R8WA 3RCNA 3EMZA 3ONCA 3PNUA 3PB0A 4DJFC 2IKJA 4IQLA 4PCNA 4UQ9A 1OX5A 2YXOA 4W8BA 5LA0A 4KBXA 1ITXA 4RE4A 1XR2A 3KZSA 3M41A 2HTMA 1W5OA 4S3EA 1UW9A 2TAAA 1E6SM 1HKMA 3EYPA 4Z2HA 5KZEA 1ONXA 3T2PA 1EF2A 4JICA 4PTXA 3ITVA 2DZWA 4QDMA 3KZPA 4PMUA 1TYGA 2VD8A 2VWTA 4PUNA 3NFUA 1BGAA 2PDJA 3L0KA 1FTXA 1F3TA 1F3XA 2PDFA 3RM4A 1SFTA 3NAVA 2W91A 1EIBA 1E15A 1UIOA 4I7WA 2OKTA 1WDWA 4IL0A 2W92A 4QTGA 1B3VA 3EX6A 1XKYA 2QV4A 4IFOA 4B5NA 3R8RA 3MWAA 2GJXB 1W54A 3K5XA 3LLXA 1YPFA 1HN1A 1UUOA 5EA9A 1E40A 5FSEC 4RCXA 1XCXA 3R0KA 4M56A 3GDLA 4ZMGA 1H7OA 4HHPA 1IF2A 2V38A 1WV2A 3HO8A 2JIEA 3KL0A 3E38A 4M29A 1I8JA 5A8NA 2CNCA 1KC7A 1TJPA 3UZXA 1XYZA 4GINA 2AMGA 4YMZA 3ES7A 4PRRA 4XB3A 1D3CA 2R9RA 2XINA 3B8UA 5HMDA 3GAYA 1KFKA 3O8AA 3K1DA 3C0JA 1CLKA 2Y8VA 3H54A 3EDJA 2ODOA 1I9CB 1NARA 3VD5A 4OT7A 7ENLA 5C7VA 1XIMA 3DFNA 5BYWA 5LIXX 3MANA 1C29A 5FACA 3P5ZA 3LB0A 5EMYA 4ORIA 1DXIA 4TR9A 1W17A 3IIPA 2NV9A 4AZ7A 3LBOA 4C7FA 2PDCA 5DT7A 3C8NA 4GGHA 3W1RA 3CM4A 3OGVA 4XZIA 4YTTA 3A3HA 3T0TA 2DSUA 1K9EA 3GW3A 1DPMA 3S83A 5D09A 5DXXA 4M6QA 3UGRA 3ZVIA 2YA1A 5HWNA 2XJ7A 4BQ4A 3CTLA 3N6HA 4AX6A 1XRVA 3WQ8A 6REQB 4JKLA 1IEWA 4DYJA 1X7FA 1DJYA 3QR3A 1AW2A 3UR7A 4KETA 2MANA 3UQNA 1Z44A 2GYIA 4C7DA 4XKYA 5FJTA 1RH9A 1ZJAA 4H9UA 3KBNA 1P6WA 5U4NA 1O94A 3AHYA 4PULA 4HPJA 4N9CA 3VDGA 3NGJA 3W37A 1TJ2A 2VC9A 2OQYA 3LHTA 4H04A 4JQ1A 5IM51 4PB5A 3RIKA 3QYSA 3WJYA 4LAOA 5KZ6A 4KT2A 3H2FA 3WNLA 1KXQA 1FHUA 5HMEA 5AC8A 4H1ZA 4JX4A 3U4AA 5FF3A 3A4JA 4INFA 1JCJA 2EG8A 3VIIA 4U5KA 4AEEA 1VS1A 3B9NA 4MDPA 4AEOA 3FJ6A 3BOFA 4EWJA 1VRDA 2VR5A 5F1UA 4PCSA 5BMWA 2BZNA 1WP6A 2WSYA 1DHPA 1F8IA 2XIOA 1NQ6A 1QPNA 1LRTA 4HZMA 4GYFA 2Z28A 1RHCA 1F73A 1CI1A 4LW7A 4TXEA 1SZNA 1JF5A 2NQ9A 4KESA 4JNYA 4TVUA 2WWDA 3VU2A 6PTDA 2R94A 3GO2A 1TPEA 4RDVA 3APTA 2PWFA 4S3AA 5TD4A 3E0FA 1Q66A 5CLTA 1HVXA 3LHZA 3ZLHA 1V02E 1UH3A 3GHUA 1RQEA 2C1GA 1LBFA 1JPIA 2CPUA 3HV8A 1A53A 4NJGA 4QLKA 4X3ZA 3R0DA 1VC4A 4OVXA 5A6LA 4QNWA 2BVDA 1ZCOA 4H6EA 3AHXA 1AJ0A 2I5IA 2OYLA 1FWDC 1KBBA 3OGRA 2PDYA 3CHEA 3UW6A 2E9LA 4H01A 3ARQA 2P0IA 4J2MA 4ZEPA 2J75A 2CHNA 4GYKA 4PUKA 4IQEA 5LNRA 3IK2A 4KMQA 3H4GA 4DN1A 4ZSUA 1A3WA 3QOKA 1W1VA 5M3WA 3UVAA 3OW1A 4LEQA 4WZHA 1MMFA 3CQIA 3AUJA 3AWNA 4MVAA 5HPCA 3M5VA 3MC5A 4A22A 2YBTA 4MY9A 2Z25A 5HMSA 2E5DA 2F2HA 1G94A 2LLEA 3DIPA 1KFLA 4Q33A 4R27A 3WUBA 3JW7A 3VGBA 1EF3A 4FOUA 4Q4SA 3COTA 1E56A 5KMYA 4DPQA 3KFTA 3BAXA 4S3FA 5E5CA 1G9HA 5DBUA 2FDMA 2C0HA 1BTCA 4S2BA 3UZZA 5A8OA 5TAOA 1CYGA 3C86A 1MWOA 1MXSA 5BOEA 3VYLA 4BR1A 3KCLA 1SYTA 4XAYA 4D6JA 3AISA 1BQGA 1CXLA 5E6ZA 1ZRQA 4NY2A 3M0LA 3QV9A 2TPSA 3ZLGA 1P7TB 3E2RA 2ACRA 3MKCA 3WH5A 2WQPA 3THDA 4NP7A 2GUYA 2XN2A 2V30A 3KBVA 4KCTA 1REQB 4PRWA 3MJMA 2BBFA 1KXTA 1W3NA 2RDUA 1F7BA 2JK2A 1E0UA 3UWZA 3SUTA 2Y6ZA 2CZ5A 1XIJA 4AH7A 2DJLA 4HNVA 1TRDA 4DBUA 1SMAA 3J7HA 3BJTA 3M64A 1YDNA 4HU4A 1UPPA 1E6PA 2D24A 2QGYA 3RR1A 1US2A 4WF7A 3GTXA 3PZTA 2J66A 1S5WA 1BD0A 3NL6A 2PWDA 2V2CA 5HJLA 3GNOA 3B9OA 3LZ5A 3SSZA 2HSAA 1PE1A 4AUBA 4GFSA 1MQRA 5F2GA 4XTDA 1GYNA 4AY7A 3C5QA 1X96A 2J6VA 3G1FA 5FEZA 9CGTA 4U3CA 1B90A 3SCQA 3UWWA 1O68A 3CL6A 5XINA 3REQA 4LOCA 2WHJA 5J04A 1QOQA 3DN5A 1GZJA 3AMGA 4XD4A 1VZWA 3WQGA 1EX1A 3CMFA 4XD5A 4B92A 3RK8A 5HAOA 3R43A 2O9RA 2PWHA 5C2CA 4WHBA 3AXXA 3MUY1 2XN0A 1R0MA 4A3YA 1Y65A 4JFTA 1L2QA 3NDOA 4RKAA 3HG2A 2P5NA 2WJEA 3C0QA 3CV2A 3GM8A 4EACA 4UTTA 4H3DA 3L2IA 3DGBA 4W88A 3FAXA 1RPKA 3RM9A 3UZYA 3MKKA 5DF0A 2DEPA 1CGXA 2QNEA 3ZT5A 3D46A 3EDDA 3W3OA 1W9UA 4GXPA 1DKWA 3OZMA 1V6XA 5F2LA 2HS6A 2IQDA 4HMCA 1TPH1 2PBGA 1XFBA 1FWWA 1M9HA 5A94A 1TJ1A 2YXGA 4Q6XA 1EZ2A 1XCWA 3GTNA 2YLLA 4MKSA 1OINA 2IPWA 4AWSA 5ABFA 3CPRA 4DIAA 4GJIA 1H60A 3WLSA 1C9DA 2HE8A 2YGYA 1A5OC 1J0YA 2C79A 1O60A 3E2VA 3EEGA 1VFUA 4OTKA 4V27A 2IXUA 2OFJA 1UUMA 3WJWA 3KWXA 1IIHA 3KWSA 5M1TA 1B3YA 4JEQA 1TCMA 2PI6A 3QZAA 5DY2A 1XLMA 2DVXA 3A6OA 5D9OA 4L5ZA 5I2UA 1XSIA 1QWGA 4N6FA 3NQDA 3W7PA 4NZCA 1UASA 3L65A 4EVZA 1XQLA 4HIBA 1BYAA 4NZFA 4S3DA 3RX2A 3WF1A 4Z1AA 2J24A 2YL6A 1S5MA 3PSVA 2V5JA 2O56A 3H7UA 3MUXA 1SZFA 2H6RA 4KERA 2CLEA 3VOHA 4M3PA 3F4CA 4TIMA 1W8GA 4GUHA 1XRFA 3W2NA 3DG3A 1KM2A 2QCNA 1J5SA 4FR6A 1O95A 3NL2A 3PUOA 4L4PA 3TAOA 2YA2A 5CPSA 3VO0A 1AMYA 2Y89A 3KW3A 3WQ4A 4DYEA 2A85A 3T8QA 1QW7A 1F5ZA 1ITCA 1DV7A 2C1HA 5JVLA 3U8GA 2XZ9A 3KS6A 4XO6A 4MKVA 1J0HA 4EPDC 1JRCA 1K9TA 3VGGA 1BWVA 2KZHA 2PURA 5E9AA 1DBTA 4N7QA 4YLWA 3G6LA 3QY8A 4R7WA 1EGMA 2DSWA 4M19A 4YCPA 2PF0A 3LI0A 2E8YA 5DN1A 2P3EA 1I45A 3B8TA 3HF3A 2RJHA 2QPUA 1TWZA 1RY8A 2O9PA 2BNJA 3QW3A 3FFSA 4QLJA 1XIFA 1E51A 3INPA 2ZYFA 1KGXA 2EPKX 4GVFA 1JZ8A 3H2NA 4ADSA 1JF6A 4L9ZA 2D23A 3AIEA 5LIWX 3SRHA 3TYBA 3W7JA 1F61A 5FL1A 4QG6A 3P6LA 1S39A 3GU9A 5KINA 1N8IA 1JYVA 3QPZA 2J6XA 4C6JA 4M24A 3R94A 3RDKA 1CLVA 1VJSA 4DXXA 1EDTA 4QSHA 4I9JA 4DO7A 5T26A 4RK8A 4CD7A 4LBUA 1QDSA 4G1KA 1KCXA 3PBYA 3WDRA 1OYCA 4BWLA 4GPNA 2YXXA 3FS2A 4I9MA 1HX0A 4L4MA 5I78A 3AC0A 4HD5A 3W2UA 3TNBA 1EXPA 4GI8A 3N9KA 1VKFA 2Z1WA 1GOWA 4JHMA 3OTRA 1DHKA 4UB9A 2X09A 3ARPA 3ATZA 2HXUA 4H7CA 1JEZA 5A8GA 1MW1A 3S6TA 1EEXA 1H4PA 1POKA 2PRMA 2PODA 3F5LA 1M41A 3HGOA 1Y7VA 5B7ZA 2I1OA 2WHMA 3E74A 1RPXA 3UA4A 2OJPA 3WN6A 3TQKA 1TSIA 3WFZA 1ISZA 2XUCA 2INEA 3A5FA 3EXSA 2ISSA 2BV9A 1EP1A 3W2LA 1RD6A 1T41A 1T5AA 3QY7A 4KGJA 3VGDA 2GVLA 5CC6A 3B0YA 4GFIA 4O8RA 3VDBA 1FH8A 2NV2A 4JOMA 3SY1A 4EAYA 4GY1A 3IEBA 1I0DA 2PSNA 3UXDA 4K37A 3U2ZA 2PD5A 1GQIA 3RLGA 2QJNA 3LCFA 1W9XA 2CU0A 2ZZ6A 4GI9A 1GVOA 3CZGA 3K8MA 3BSHA 3H2OA 3NOEA 4O16A 1PKLA 1OK4A 4BEQA 1H49A 4MZ1A 2A3CA 2UBPC 3IIZA 4RW5A 1I2RA 1TVNA 2VX7A 3KVMA 3KCJA 3TOPA 1P0KA 3PAOA 4M7TA 3AZTA 1PZ2A 3UNTA 1EB3A 4MF4A 1WBJA 2AMXA 3GXDA 4U33A 1DJHA 4GG9A 1T0OA 1TJRA 1L8PA 4FLSA 4YTRA 1R9XA 3AIQA 4UR9A 3N29A 3P5YA 4AIOA 3EPNA 3IUHA 4AWEA 2C91A 4K7YA 1FXPA 3MCOA 1JCYA 4GIYA 3O06A 4R7OA 4HPNA 3QTGA 3C2RA 1E4MM 3O3RA 1ESWA 1LBLA 1EUNA 1FHDA 1XYBA 2X2GA 1SW3A 2VXNA 5B80A 1R87A 1GWJA 3TN4A 2XISA 4ZQRA 1VBHA 5KETA 4BZYA 1BAGA 5IRPA 1T8XA 3RX3A 1NIUA 1XQKA 2QAFA 1UWUA 2NX9A 5DCDA 1WYIA 4DF0A 4H8VA 3K4DA 1W9PA 3M0JA 3VOJA 2VR2A 3MHFA 4J3TA 4YTQA 3W1XA 3BC9A 3WF2A 2P0OA 1JRBA 2IKGA 4Y9AA 4JS3A 1R3TA 3NSNA 3CHFA 5D2VA 5I07A 1FWTA 4UFKA 2YDRA 7TAAA 3SCOA 1UKTA 4TVDA 3W81A 1PDZA 2YIHA 4JX5A 3LERA 4PBFA 3EOSA 2ZE0A 1XYLA 2VD9A 3NPXA 4POCA 3QHMA 1QNVA 4MADA 3AU2A 3A22A 3IAPA 5FF0A 4FS9A 1QOPA 4QEEA 3EX2A 5CSYA 1YKWA 5DELA 4DEFA 2PEVA 1XIEA 1K9FA 1A50A 1XLFA 3TC7A 5ABTA 3KE0A 4PN2A 3AALA 4ZB0A 3WMCA 5G1MA 1HQTA 1YPXA 3ECQA 1SR9A 2AL1A 1LZOA 1OD8A 1CLXA 3PWAA 1W6TA 3FJLA 1XDLA 2AL2B 3TVAA 4ES4A 2OTDA 1AD4A 4CQCA 3TDFA 3EOUA 2Q8LA 2DVTA 3HG5A 4J5NA 4L7ZA 4Q8OA 3WFAA 3LYEA 4YHEA 5TBOA 3S2MA 1ZBWA 3PVFA 4UQDA 1K7FA 1MFUA 1W91A 5LNSA 4UQCA 4GA8A 5H1WA 3TYCA 1OF8A 5I09A 2PMQA 4FIRA 1OADA 1WKDA 3LK6A 1QUMA 1PHWA 4QGCA 3FIGA 3O0FA 3BAWA 3LN3A 4H8NA 2PDPA 3W4RA 3V75A 4PSRA 1YHTA 4FNPA 4FK9A 1QPRA 3LPOA 3I4EA 4LYQA 4ASTA 2JKEA 2WZHA 4DX3A 1GW9A 1DYSA 3TFCA 3AIRA 3OPSA 4W7VA 4DZHA 3PULA 5DRCA 3UESA 1B2YA 1Q13A 5GNZA 5PTDA 2W79A 4Q7BA 2OSXA 3W00A 4JTTA 1HIZA 4RDYA 3WK1A 1E5JA 2EO7A 3K13A 1E9LA 2X42A 3V35A 4C65A 1LLWA 1VBUA 1ZU8A 1EJVC 3BLIA 1O5QA 2W66A 5FL0A 3PANA 1TRIA 1HJXA 3T4WA 3UGVA 1MZHA 2PDIA 3KTCA 4O18A 4WKHA 1BXNA 1XGEA 1ZP4A 1GVRA 2VEMA 1OGSA 1XJBA 4Y9MA 3PTQA 1TVLA 4OE7A 3MO7A 2QUNA 3NO1A 3CHVA 2EEXA 4NIRA 1BXBA 4A3HA 4MJMA 5FF4A 1JDCA 1MEIA 3HFYA 1RALA 4MY1A 4I6KA 3LM7A 1S2UA 4HZ7A 4PMJA 1Q6OA 1AL7A 4JR5A 4QLLA 4BJHA 3BLEA 4LNYA 5CQ1A 2V63A 3VVGA 1U2YA 4GUGA 3DGRA 4WKFA 4H7VA 4AMCA 3DHFA 4RLIA 1FWBC 3UYCA 2PTZA 4JXCA 1UROA 5C9UA 2J9YA 3DESA 4D6EA 1OFRA 1ZBCA 2ZX7A 5CXPA 5HJYA 1CGTA 5EYWA 2OYKA 4ZE4A 3KDNA 4DPPA 1V08A 2F7FA 4L80A 2D20A 3AMDA 4LS1A 2GL5A 3S42A 1LQAA 4AIUA 1NFBA 3H26A 4AY8A 3OHIA 1DEDA 3MDWA 4P8UA 1MEWA 4QAIA 4AIEA 2BSLA 2ZZ3A 4GIRA 3F7JA 3BGJA 2PBOA 3UCQA 3FA3A 5CLWA 3V5OA 2BDQA 2J4GA 1VBGA 4E0CA 4QCFA 3MCNA 3H2MA 1QPQA 3BMWA 3QXBA 4XISA 5BOFA 3VX1A 7XIMA 1RJPA 1Z8AA 1AJ2A 2QDDA 1M5WA 5BRPA 2DZSA 1ZSXA 3OZPA 4Q8MA 4RX0A 3VDHA 1V5XA 3L4ZA 3GXMA 2I9EA 3BH4A 1O7AA 3LTPA 4E3TA 1PL9A 3GH4A 3WX7A 1M7JA 1E9YB 3GVGA 3FK4A 4YVXA 3H12A 1C91A 1TMHA 1WX0A 3CHCA 1JCXA 2QDEA 3UFYA 4JN6A 5I3JA 5DBTA 2QVNA 3CS2A 1U1UA 4L1WA 2QEZA 2VFDA 3ERPA 1JZ4A 3PB2A 4JIEA 3LLFA 8RUCA 3W1PA 5K2ZA 1MW2A 4C6IA 2YR1A 4L6HA 2OR2A 1OFPA 4LFYA 4HSHA 3H53A 3ZT6A 3MYOA 3CV1A 1Q8AA 2AAAA 3W7CA 4PUJA 3OG2A 3FX4A 1CWYA 2G8ZA 3KRSA 4I8YA 3FOKA 3G1YA 4DXVA 3VXGA 4BEUA 2ABAA 4FX7A 5AKQA 4RZ5A 4OUIA 4Q32A 3F2CA 4O11A 1XGDA 1NFPA 2FLIA 1V3LA 1FDZA 1XH0A 1VFMA 5BCAA 4JTRA 1KBIA 2WCAA 1MYRA 4HNTA 2A3LA 5T9CE 1W1TA 1ONRA 2B7NA 2QCMA 2V6AA 2XVGA 5GJMA 3GZAA 3W1NA 2B7OA 3HPSA 2A4AA 3WUEA 2XH2A 2FZ9A 1UD6A 3ZSTA 4QITA 3URNA 1NEYA 5DT5A 1TV2A 2WM1A 3K4AA 1J10A 2QGHA 2GWNA 4B3ZA 1OCJA 2WNQA 3NM1A 2VZOA 1TJ0A 1AQFA 3ZT7A 1XPGA 3POCA 2ZVIA 4X63A 4AXNA 1UOZA 2H9AB 2DY3A 2YOCA 4IFKA 4LNCA 2D0FA 2YPIA 2CHOA 2ZXQA 2ISWA 1YNQA 4P8XA 3APGA 3ZWSA 1SO4A 1O6IA 2A3AA 3SURA 2VHLA 3BLKA 2VCAA 1ZL1A 3NURA 1KTNA 3MUAA 4B91A 5M5DA 5CPMA 4GE8A 2G97A 4WGXA 2F84A 4A3QA 4OOZA 3BLOA 3WQCA 4D71A 5HK4A 3TLQA 3S3GA 1EJUC 3CAVA 4TU1A 1K9DA 3BQ6A 3TN3A 1S38A 4DI8A 5LZLA 2VFHA 4UZSA 3NPVA 4LEFA 2QS8A 3V18A 1UZ4A 4RR4A 4WUIA 1M53A 2Y70A 1XINA 2BXVA 3QQ1A 4FX8A 4ZSTA 1VFOA 1OFEA 2RKXA 3W83A 1RBOB 1YYAA 1JPMA 2CFFA 3ITYA 4GYPA 3CQJA 1EJWC 3RMEA 5JUVA 3S2JA 5GNYA 4JTUA 1NP0A 4H9ZA 4K8HA 1J0IA 1UR4A 3OO2A 2XTKA 3LXCA 3AWOA 3GDBA 2YDSA 2BS9A 3NSXA 2OGYA 3GNNA 1UMYA 3B4UA 4EANA 4MPKA 5CC7A 3MUZ1 4F0HA 2ALDA 2V5CA 4XUYA 3NZ1A 1W1A1 3N2MA 5HJXA 2ZUMA 2NLIA 3W1AA 1LDCA 4AF0A 3FYPA 4WRHA 4JN7A 1E4LA 1MUMA 4DQWA 4AD4A 1KTBA 3ZM8A 4DM2A 4IJRA 3W74A 4KCVA 1OC7A 3EOLA 3E0LA 2R14A 3FLUA 1GZ1A 3STFA 4UFLA 2YCLB 2XFWA 1TA3A 3H7VA 2B31A 3MMUA 4CQBA 5HR6A 4A6GA 5HUPA 5EGRA 3FV9A 2OODA 3SIZA 1UBPC 1A3HA 3MVIA 2X1TA 2I14A 1FWAC 1DORA 4M6UA 1PIFA 1K02A 4HVXA 2P76A 1OG6A 4IG2B 1H7PA 5AC4A 3TA9A 3QVQA 3G3MA 4W86A 1VFLA 3W28A 3IRDA 5REQB 3EGJA 4N9EA 3UR2A 4GUIA 1QFEA 4DY1A 4ZQOA 4I3GA 2CLKA 4LSBA 2JF6A 3W7LA 3FSUA 3ID7A 4UTIA 4L9XA 4Q4RA 3AMKA 1PS9A 4JTSA 2W0UA 1HGWA 2VM8A 2WYSA 3TCSA 1LWJA 1NP2A 2FPVA 1LOQA 1L0PA 3QMRA 2RAGA 4XAGA 2E5BA 4M51A 1G4EA 5CZ0A 3FHAA 1BRLA 5FJOA 5D8ZA 1XD1A 4C6KA 1Q8JA 1HP5A 3Q2DA 2Y8KA 2VL4A 4JTHA 3OLEA 3QFWA 2QCGA 1RK5A 3N6JA 1SUXA 4JTEA 1YRRA 3LOTA 1NOWA 4DAIA 1VH7A 3V3WA 4J7RA 2OT0A 2CBJA 1TKKA 3DHPA 4FLQA 4NRRA 1UWSA 5JQ9A 3WK0A 3N2TA 5G2IA 2DVUA 1GOXA 5DMLA 2B7QA 3M16A 1LRNA 2BHUA 1B4EA 4CCDA 4IMDA 4UR8A 2DJXA 1VFSA 1GKQA 3M0MA 2GVGA 2HBXA 4GNVA 4MDOA 4W5UA 1UR3M 3M44A 3KVKA 3MO4A 5JU6A 1B3WA 1OFAA 4MFEA 5AY7A 4QISA 4JTGA 2DIKA 1QT1A 4DJDC 1AZ2A 3T55A 3L68A 3ABOA 5E09A 3OVRA 3W38A 3C2OA 2WZEA 2BWGA 4RV8A 2OX1A 5FF7A 2XSXA 4DZ5A 3QSRA 3HM7A 3TKFA 3CWNA 1M7PA 3GAKA 3M47A 1PZ0A 1V6WA 1SFJA 4S38A 3UT0A 4S23A 3O07A 1GQKA 2Y88A 4AISA 3KTXA 1RP8A 3MT1A 2J8TA 4ZQPA 3P84A 4B5VA 3F2BA 3SDOA 3PTDA 4HPHA 2PS2A 4Y9OA 3ZVHB 4Z1DA 2GLKA 3KOFA 3OIHA 2PGRA 1PX8A 3HJZA 3OBEA 1WBHA 1UZ1A 1WA3A 3TTEA 1R85A 4QS6A 3QFEA 1TREA 1IGWA 1RQBA 6A3HA 2G0WA 4Q22A 2PWGA 1TV4A 3IJ8A 2BB0A 2C3ZA 1EA0A 1DJNA 1ADSA 4GQQA 1UQYA 3TK7A 1SSDA 1KKOA 4ZO6A 2GJXA 3UD6A 4CU6A 4IPIA 3BUVA 5RUBA 3NQ2A 1AQHA 2Q3RA 4AXKA 3IS4A 4N4PA 5A2AA 4ICCX 1XM3A 3ARZA 2VDIA 5BROA 1CIUA 3HQNA 5CCZA 4LVGA 1J2WA 4IPNB 1CGWA 1FWNA 2ZZ5A 4CN1A 1UUQA 3GFZA 5EMMA 2NXGA 4O53A 4GH3A 3NQBA 4AWUA 5BU9A 4G8TA 3V5FA 1N8FA 2QAPA 3KRZA 3DECA 2V3GA 5BMXA 2DZUA 2X16A 3NQMA 3VMOA 4QDWA 1CW2A 3VA8A 1DQUA 2A79A 7REQB 1FXQA 2WCGA 1MEHA 3GQYA 1OYBA 3N9SA 1XBXA 4L6DA 3ISIX 4YHGA 5EKYA 1G69A 5F2MA 4HP5A 4V2XA 1NOFA 1QO5A 2HMCA 2G96A 2QUTA 4ATDA 4JTFA 4DNHA 4GQRA 1QI5A 5C70A 1BQCA 3UG4A 1FP8A 5ECUA 1GHRA 3RXZA 4NX0A 3CB3A 2PDHA 1V6VA 4PMOA 3V5CA 3DFTA 2RDTA 1XLBA 3JUGA 3MHUA 2Q8XA 4R88A 5D02A 4REQA 3PTKA 3AS2A 4I5RA 1DTNA 4FMVA 6REQA 4P7QA 1E1CB 1K03A 3AJ7A 3P0WA 3GU2A 5J5DA 4ORMA 4FXJA 1ISWA 1JAKA 4K1WA 5CPTA 4UWMA 4LAMA 1HGYA 2PU0A 3WF4A 1KM4A 1V93A 4W8AA 2O7QA 3MI6A 2YCLA 1EH9A 4FSAA 1ZFJA 2NQZA 4X61A 2C15A 1KWKA 5BU6A 4R34A 4YJ5A 3NPUA 1FCQA 1VHNA 5A3HA 4V15A 3PK7A 1VENA 3T09A 2IPGA 2REQB 5A69A 9XIMA 3S4TA 3NUKA 2EPOA 3LV5A 4PEEA 2FH8A 2DZAA 2Q09A 1N82A 1KTCA 1HO4A 3QC0A 1MO0A 4F0SA 1L6WA 2HK0A 3MU7A 3NQVA 3M9YA 4XWUA 1WAUA 2VURA 4W5ZA 4G7EA 1LT8A 1IT0A 2ZA1A 4GOAA 4XZWA 4MOZA 1UKOA 1ECQA 5HULA 3SADA 5D9MA 1X98A 1R47A 1V3JA 1E0WA 5F2IA 4F40A 4XZ9A 5HQEA 3W22A 4YTSA 4S39A 3OVPA 3U0HA 1FH7A 1R5YA 1TV8A 1AH4A 4JTKA 3IGSA 3PWIA 1LBMA 3U4FA 4LAZA 2NZLA 3NZRA 4Q8UA 5F4WA 5LXEA 4BI7A 2QCHA 2GSHA 3I65A 3ALFA 2GGJA 1EO5A 4A3UA 2CLHA 5A6BA 4ZXOA 2J9ZA 2PWEA 4ZGYA 3W6YA 4PMNA 3SJ3A 4H00A 2DQXA 4K6AA 3CUJA 2TSYA 3QQ0A 3T0CA 4LAKA 2RH9A 3CH0A 1ZTVA 4LRTA 2AAMA 3W25A 5CEWA 1P5BA 4DRSA 2VEIA 5JBFA 1RVGA 3ES8A 2FZMA 3APYA 3EOOA 2B81A 4FX6M 2ADAA 3VK5A 3A64A 3ZYZA 3W1LA 3IVSA 2TYSA 2YL8A 5C9WA 2F6KA 3L4VA 1M7OA 3I10A 2Y0FA 4RNHA 1FCUA 1GJUA 4ALDA 4PTWA 3W07A 3QGKC 3GFXA 3L12A 2C16A 4ILSA 3S2NA 1RJQA 4MM1A 2E4TA 5K9CA 1X38A 4Y90A 3GSMA 3LNPA 3AIUA 3WDQA 1XCFA 4DJFA 1SU5A 3W2JA 2I17A 1FKWA 1DVJA 5G5IA 4LV9A 2VENA 2YCKX 1JZ5A 2DZXA 1JDAA 3RU8X 3NPWA 5D37A 1GEHA 4FAMA 2V67A 3S1VA 1SJDA 4B2DA 2Z26A 1R3YA 1ZBKA 2OOGA 7PTDA 2ZQ0A 4EPBC 2QUVA 4UFHA 2C71A 4JYFA 1E4IA 2Q01A 3XINA 1XKJA 3EOEA 3NQEA 4ZQNA 4IHCA 1JVNA 1RY0A 3GRIA 1Z7AA 3L4TA 1XLKA 4YWIA 5I23A 3UY7A 3ARSA 4PMZA 1M6JA 4LTSA 1K6WA 1ICPA 5I3HA 4L6OA 4PYSA 1I2NA 3RHGA 3IARA 4JHZA 3S9YA 3T0BA 3DYPA 3OYZA 4LUSA 1YBQB 2YYUA 5CBJA 3BAYA 2FKPA 3SM0A 4P5UA 2V3EA 3MSYA 4DI9A 4J3WA 2FHCA 1Q6GA 4KGLA 3MUCA 2FVMA 4PEKA 3PJUA 4X60A 1JPKA 1QXLA 4AZCB 3G77A 2GUBA 3FYYA 1F05A 5I06A 2W63A 3FN9A 1DJGA 1P48A 1MXDA 1A5SA 5L6UA 1OFDA 3NEHA 4JTDA 4P2VA 3B4YA 2MNRA 4A35A 1XDMA 3GHTA 4GD0A 4EX4A 4MB4A 3LBMA 1C3FA 2VELA 3JR2A 3QYQA 3WD1A 4J4KA 3SR7A 3PZNA 5I3IA 3M0VA 4NJIA 3WLNA 2DFAA 3S5OA 1E55A 2YKKA 3DUGA 5KZDA 3QGAC 3UCDA 2GSJA 4PUDA 2IMRA 3BG9A 2DPEA 2WMKA 1Q7MA 4FZIA 2RGMA 1OX4A 3UJSA 3HJEA 2ONEA 3MV11 5D30A 3HQ1A 3OVGA 1E5NA 2JE8A 2WHKA 4JIHA 2UV8G 4L1XA 3WD3A 3PFRA 4MG4A 3BMXA 3DHDA 4RW3A 4L9YA 2VEGA 2RHGA 4HK5A 1E6XM 3GKFA 3S6DA 5I3FA 4H4IA 3UVIA 2ZRVA 3GNDA 5ABFB 3CZ8A 4MGGA 1H3GA 2BOGX 4XZMX 3VE7A 1JIBA 4UFMA 1E1CA 1AK5A 1D9EA 1R86A 4JQ3A 1P1XA 1S5NA 6TIMA 3THAA 2BTMA 1UWTA 4CCZA 3PUDA 3CIVA 3NXFA 1BVWA 3LCHA 4LVBA 4WXZA 4W7WA 1QNOA 3UJRA 3BCDA 5A6MA 4JD4A 4IUOA 1AG1O 4RL3A 1JQVA 3TMQA 3SSJA 3VOFA 3TV8A 2WZTA 3WLLA 2ZBTA 3TXZA 4HA1A 3MSRA 1TWSA 3S0CA 2PWUA 3EX3A 3RFAA 5LNVA 4IMGA 3UJ2A 3WDIA 4W93A 3WBXA 3OA5A 4ZFCA 1MUWA 4AVNA 2IKHA 4H6KA 4ACZA 1VB9A 2PPGA 4JTIA 3V4BA 2E25A 3BW4A 4MWAE 3BV7A 4AZGA 4MWAB 2ZC8A 2D1ZA 2JQXA 3AHTA 2EJAA 2GFTA 4GQ0A 3S2LA 1U22A 1HVQA 4GNJA 2EPLX 1SZRA 4NI8A 1EJSC 4P7NA 1PZ3A 3A23A 4AVOA 4PMDA 4AWTA 2YW4A 1S2AA 5BXTA 1VEMA 3TNOA 4ZQCA 5MHBA 1W5MA 1RUSA 3VZYA 3W84A 2C19A 3GBEA 1DWIM 1K7EA 1VPXA 3V0SA 3KHDA 4K38A 3V16A 4MNKA 3I68A 5AHNA 5CAKA 4F0LA 1CB2A 3PFMA 1NM9A 3A12A 2QQ6A 2D22A 3WCZA 1NWRA 4WD0A 3GR4A 3CGTA 3PPGA 3LSBA 3B0VC 2HPMA 5IFTA 3M0ZA 3QLDA 2QJMA 2VQUA 4LF1A 3N9RA 3HTWA 4S3CA 3WH7A 1E71M 4I9AA 1S1RA 2OZTA 1B3ZA 2DT0A 3G8EA 1XG4A 1JCNA 1S3TC 1D8WA 2DW6A 1E43A 2Z0IA 3WJXA 5H8MA 1VD6A 2VGBA 4GLEA 1KGUA 6XIMA 4W4QA 1RXOB 4J3VA 3HBLA 1EC8A 4LGXA 4GVGA 5G1YA 4Z2JA 3SCSA 4XKYB 3QV7A 5I0DA 3BCJA 5D2YA 1PX3A 2QPXA 1ONEA 3FDKA 3UR5A 3YPIA 1DQWA 2Q3OA 3FGCA 4N02A 3CZLA 3GTFA 2WBKA 4O1CA 3I3EA 4Z1BA 4PBGA 1CGVA 3EAUA 1V3HA 3UZWA 5FI8A 1H09A 3L4XA 3QRHA 5M2FX 1U1HA 4NX5A 3OLDA 4JFUA 1OHLA 1PJ9A 2WC4A 1SM9A 1VJIA 4PL1A 3TQ0A 4H2HA 4LJ3A 1SZEA 4H7ZA 1XIBA 1QO2A 1MUCA 2BVYA 5E9XA 2VEPA 2E77A 3GXIA 2PFHA 1OWQA 3TWBA 1TFVA 4V1XA 3GDKA 2BY0A 5D4YA 3VC6A 5EY5A 3NQFA 1X7IA 5KTLA 4JNZA 5FEXA 2GDQA 3UPMA 3WLQA 1O66A 1J4EA 3QLLA 2G4FA 3G1XA 4IIEA 2Z1BA 3LG3A 4OECA 1LQ2A 2AGKA 1D7KA 3WBWA 2XN1A 3V1PA 4MB5A 1PVNA 3EXTA 1IR1A 4B5WA 4DWSC 3W24A 2Z1SA 2V82A 2ZRUA 2O55A 3AXMA 1YIXA 3CWHA 3I7QA 3E2QA 3VGHA 4JN8A 3HURA 3F4DA 2DDXA 3EWYA 4E4FA 1E3ZA 3GC2A 3ANVA 2ACUA 1C8XA 2YCIX 1AH3A 1PEZA 4X9SA 3EWDA 1BEUA 3IUIA 3ITOA 4C1KA 2WJZA 3LMZA 1UR2A 3UY8A 3ZJKA 3EXRA 1P43A 1UKPA 4M0XA 1QCWA 1G6CA 4QNEA 4WJXA 2WLZA 2C6QA 3RCMA 3ZJ7A 4FA3A 3PTMA 3E6EA 4BF5A 4Z2KA 4Y9PA 3QM3A 5D2XA 3AJXA 1XW8A 1N7KA 3BICA 4NXSA 1GCYA 5JXQA 4XZNX 5I3DA 3FNDA 3G8RA 1UD8A 2WMIA 3ZOAA 1CX9A 1GJWA 1HFBA 3T4CA 4NZ5A 2YCEA 3WLRA 5CZJA 4UNIA 4CGTA 1IWBA 4HK7A 2J7DA 1N55A 1DJZA 2D2OA 4KFNA 1IT7A 4GY0A 2OLSA 3P60A 4XIAA 2J7GA 3M7SA 4BQ5A 4E4UA 4QAWA 2I5QA 2NVDA 4HOZA 1YX1A 3OQ8A 3EWZA 4C1NB 4W87A 3N18A 2HROA 3TN6A 3LXBA 3RRAA 3GLCA 1TTJA 2JF7A 1QNQA 3HU7A 3PG9A 4DBDA 1EZWA 2WVTA 3W1MA 4DWSD 4O14A 3TZFA 4PUUA 4XO7A 5E0KA 1W0MA 3KUMA 3QHOA 4G56A 3GC5A 4WXYA 1RVKA 4NZ4A 3EDKA 1TIMA 4PCFA 4R9XA 1TCDA 3VX0A 3UG3A 3FA5A 4TQTA 5MKGB 1UWIA 3UU0A 4O10A 3ZJ8A 1SFLA 4AZ5A 2HJPA 4L61A 3GVRA 1XLCA 3MZ2A 2V0TA 2EQDA 1HTIA 5GJPA 2OEKA 2WW5A 5CBIA 1GVFA 2VKZG 4WQ6A 4AHPA 1TMQA 5EFDA 3VD4A 2JEQA 3VIFA 3W88A 1UZHA 4AD2A 1D2KA 3U5YA 4YS1A 3UCCA 4GVIA 4WOZA 4Q8VA 1OJXA 1GVIA 1US0A 1D8CA 3BMVA 1LRQA 2BXYA 1P6BA 3PZMA 4Q8NA 2C14A 2F61A 5T9BG 4WR3A 1IWPA 4OHQA 4X9YA 3WFLA 3NA8A 1A5MC 6ENLA 2PDWA 4FIQA 4FF5A 2XVLA 3VKCA 3KX6A 3ZO9A 3QR1A 3QKZA 1R3WA 2DZTA 1X8FA 3VIOA 5AYIA 4PUWA 1TX0A 3Q4DA 2ZRWA 2WV8A 1W3HA 2HS8A 3U7BA 5LHFA 3SJNA 1JYWA 2NVCA 2OB3A 1VFHA 3P8IA 1HG3A 2YL5A 1VBRA 4NXKA 2D2JA 4FLOA 3R0UA 2OEJA 2J47A 3N2CA 1AVAA 1KB3A 5C9ZA 4MY8A 4FXSA 4GIEA 3VFCA 4EXAA 3GW0A 3C3UA 4GQGA 3AAMA 3CWOX 1TTIA 1TZZA 4C6LA 4G7FA 3W7GA 1HKVA 2XSAA 4GISA 1XSKA 1RBLA 2NQ5A 5AC6A 3H2AA 4HCDA 4O17A 2CETA 3LRLA 2CYGA 1NAL1 4O54A 4AZ6A 1JCMP 5HBFA 4PH6A 3GY1A 4ZO8A 4LPCA 3RYSA 2XGBA 1H5YA 3N12A 2G95A 2OOFA 4F79A 2O9OA 1H1ZA 4ROQA 2Z2AA 1T7LA 4PMVA 2JALA 2G5WA 2X0SA 4DB7A 3AIWA 2W9MA 4GUFA 1UOKA 3T44A 4BI5A 4X0NA 2PLCA 3CUHA 1K77A 4P7LA 1DOSA 2Z6JA 4DJFD 3VKAA 4HMEA 1HF6A 4B5UA 1FWCC 2VFGA 2Y1HA 1R30A 1LOLA 4GZJA 1LJYA 1XLGA 4O19A 1TWDA 1R9ZA 1V4YA 3H22A 4TOQA 4P8WA 1OVDA 2RDXA 1JZ2A 3F4NA 4F0KA 2YB4A 1QR7A 3C2VA 4XV0A 1NF7A 2WLYA 5AFDA 4W9TA 1G4TA 3GDMA 4DJED 3N15A 4QJ4B 1W2PA 2G4JA 2DH2A 3LHUA 3W6LA 1AODA 3BV4A 3RJXA 1V51A 5D8WA 4HHHA 2DV0A 1ML1A 2OKOA 3WNOA 3PSWA 3TCEA 5FJUA 3S47A 2A7PA 2VJXA 1FWIC 4CVUA 4XX6A 1ADOA 1M7XA 2BGSA 2RGLA 3ZMRA 4AB4A 3AMLA 3WJZA 1MDRA 1VIZA 3NQ8A 3T05A 2YBUA 1OFQA 4WSJA 1AZ1A 4JFWA 2QZRA 2IS7A 3Q37A 3GVQA 3DKJA 3LLDA 1ZAJA 4J1OA 5AYBA 4QJ1A 3ANUA 2HNEA 3SN0A 4D6GA 2G37A 1WZLA 4P8VA 1MQQA 3PR2A 1UR0A 3G24A 3NYDA 4LALA 2YLAA 1DP0A 3WQ5A 3CBWA 1J93A 2DORA 3RAOA 3N6QA 1XFCA 4K36A 3NQGA 3WIJA 4KQNA 1TPVA 2EKCA 4KWOA 3VCCA 4QG9A 2QULA 1XLHA 3S5ZA 1SGJA 2ABBA 3QMTA 4AHOA 3LCLA 4C6PA 1J12A 2ZX9A 2V2HA 1A5BA 2F38A 4F0RA 4ZXLA 3GB6A 3UEQA 5AHLA 1DIDA 3UPBA 3SY5A 3W7EA 3B9AA 4L1GA 1EEPA 1GZGA 3EZ4A 4US6A 1EPXA 1TVPA 1VPQA 1XV8A 1ALDA 4RUBA 1LROA 1ITQA 3K4WA 4LVDA 3GHSA 3IGXA 3QGVA 1QASA 3OEXA 1H63A 4AW7A 1UB3A 5U7SA 1UKQA 3M0IA 3RGTA 2WVSA 4OV4A 1BF2A 3G5EA 2FHBA 4LS2A 5TF0A 2ASHA 4IISA 1J11A 3WNPA 1BSIA 4NVTA 1KQZA 1TV3A 4GH1A 3SCVA 4IFRA 4HYWA 2WMFA 1GYLA 3LGDA 1WNOA 4FNTA 1GGOA 1UA3A 1JFHA 3E0VA 4W8LA 6TAAA 2UY3A 3WEMA 3IGHX 3SFKA 4MB1A 1KRMA 2ZICA 1H0GA 3IAQA 4C7GA 3I6EA 3JRKA 2YDAA 4RZBA 4GACA 3EWBX 3RO8A 1PXGA 1X1ZA 1HL2A 3RPTA 3MCMA 3LENA 2F2KA 3V0UA 4LUSB 1IHIA 4CUCA 1BFNA 4TV5A 1SMDA 3WBYA 5C71A 3RO6A 2XFFA 1XH1A 2Z1KA 3UWUA 4NKCA 4GBDA 2DU2A 3LQLA 2WSPA 4OGZA 4PB4A 1QNRA 4FF7A 1FWHC 1GVYA 2FGLA 1UG6A 5CH9A 4Z17A 4B3KA 3N19B 3ONBA 4FHAA 2DGAA 1XYMA 4IMCA 5G1TA 5I77A 3VINA 4F48A 3HV9A 1FDYA 1FHVA 1W3LA 2X7WA 1VPYA 1NY1A 2DP3A 2RFGA 3OG3A 1NELA 3OU8A 1IZKA 4D6IA 4IJCA 1RJRA 2YFNA 3SIMA 2WZIA 2FVLA 4I5XA 4PMYA 8A3HA 2ACSA 4B3LA 2A7RA 4PGLA 3THCA 2XYLA 4UTKA 2NX3A 2ACQA 2XFYA 2OGJA 3IJIA 4H6QA 4DXKA 2PCEA 1F3EA 2JGYA 2NQLA 2BVTA 4L64A 5KZMA 5BOOA 1A5AA 2VDHA 4NL1A 3W7KA 2ZUNA 1ME8A 3G0XA 3U48A 1GPWA 3AZSA 1KV5A 4UC5A 4QX4A 3N04A 2QCEA 3C56A 2BGQA 1WO2A 4R9OA 2BY2A 1T96A 3AMCA 3LRMA 2VX4A 4O0KA 4U3AA 4F9JA 1UC5A 1HXJA 1C90A 2FMNA 4ZOCA 3FYOA 3IJDA 3B9EA 1OFBA 4AMAA 5H2ZA 5KITA 3NZPA 2PDXA 2QCDB 4GC4A 3CPGA 2PWVA 3KM8A 2O9TA 4KEZA 1KRCC 3WJSA 5CSRA 1IV8A 1ZAHA 4WGHA 5IDZA 3AYTA 4MWAA 2E3ZA 4UBPC 1DXEA 3U2OA 3UA3A 3N2BA 4UCFA 3W23A 5K7JA 4W89A 4EF9A 4NRSA 1AJZA 3QF0A 3WLIA 3QSTA 2VC7A 4DO5A 3VMPA 4BCEA 1EC7A 4ML4A 3IVUA 4NU7A 3BQ5A 2Y62A 3UZJA 3SRKA 4Q4KA 2Z1VA 4IZGA 3B8IA 3BSGA 1KM6A 2J7FA 3WDHA 2FZDA 3HG3A 4K68A 4UCGA 1BF6A 4MWAD 1FY6A 1V03A 1B3XA 3M07A 1LWIA 1W3JA 3H7RA 4DWSA 5AECA 3D3FA 1TPB1 1IEVA 3KVJA 1TPWA 5CAHA 3H6OA 1KQYA 3TYUA 2J8FA 1M3UA 1OY0A 3MS8A 1XLAA 3P67A 3PAJA 3WDJA 4YVVA 3FDGA 2OEMA 1EXBA 3AROA 5KSWA 1WE5A 2ZRZA 3S1GA 2VOTA 1QPKA 2E09A 1SO3A 3ITGA 1HJVA 3R12A 3NQ7A 3WMBA 4HNUA 2BY1A 4QIUA 2VFIA 2XHYA 5E1QA 4HHMA 1PO9A 4Y2WA 2E67A 3MMTA 3QZEA 5C5YA 4BQ3A 3RX4A 1WOBA 3GNXA 4N6EA 2GVEA 3UJFA 1I6NA 3PUEA 4KW2A 1J6OA 4H9XA 5EB8A 3FVMA 1GVSA 4AD5A 2CITA 5AZ0A 2ISFA 1J79A 4FR1A 3USZA 4D6CA 2C18A 1OD0A 4AD1A 2OSWA 2DSVA 1GKPA 4IPJA 2QMKA 3WO8A 1K4GA 4NILA 2GJPA 4F2BA 1NWTA 1VLIA 4FOJA 3OLIA 1HJSA 5GVJA 3JU2A 3RPDA 3BZJA 1J01A 4I7UA 4KEVA 5IXEA 3KLKA 3LGGA 1IYXA 2KAUC 4XIMA 5D03A 3ZSSA 1MI3A 4A8RA 2WMHA 4PSPA 1A4MA 2CXGA 2E40A 3IRSA 3KBJA 2QT3A 4K2SA 4Q8TA 3TONA 4HPGA 4MHBA 4G2DA 5CZTA 2J7EA 2QF7A 1S2TA 3B97A 1W5QA 2BODX 3SB0A 3WD0A 3QH2A 3AU6A 1OGGA 1A0DA 3WZ0E 2W4XA 1E0XA 2VUNA 1CECA 1YLVA 1EHAA 4A4AA 1QI0A 4KFOA 3OP2A 1H1NA 5HXMA 3ZLFA 3ZWTA 1RK6A 1RA5A 4QEHA 3DFSA 3VM5A 5LNWA 1MNZA 2EAWA 1H61A 4DZAA 2UZ9A 2VEFA 2A7NA 1G7VA 5HNRA 3L2LA 1WDDA 1DL3A 4Z0JA 4BK9A 3GH7A 1DJWA 4ZB5A 1JNDA 1EOKA 3ITTA 4HZ8A 4TTUA 3TR9A 2EPNA 3TTQA 4EPEC 1W1PA 3QEZA 3GIPA 8TIMA 3IV3A 1W37A 4LWWA 3T08A 3PZVA 3RN6A 4B16A 1EP2A 4ERAA 2O4QA 1OFOA 4AQLA 4FOKA 2PDUA 4WDUA 3G3DA 3T2QA 3U2EA 3TJ4A 3POHA 2A3EA 1V77A 3NL5A 2WCSA 3EPMA 1HT6A 3QR0A 4RXFA 4IGHA 1TV7A 3FXYA 3NDZA 1Z69A 4OV9A 5J5RA 3SRDA 5G4WA 4LANA 5IDIA 2UY5A 4U4MA 4GYJA 4D8AA 4J35A 3RITA 3G1VA 1GEQA 1S2VA 1JYNA 4B5TA 1P7TA 1D3HA 4NAFA 3R8GA 3U9IA 3V7PA 3KEHA 1ISVA 3WEZA 5A5WA 3ZR5A 1H5VA 3G1SA 1Q85A 3JZEA 2ZFAA 2VWSA 3M5YA 2QIIA 2FDSA 3NR0A 3AYSA 3USBA 1G5AA 2WM0A 1K8CA 4JKKA 3UERA 1JXJA 2G3JA 1H7NA 3WQPA 4DJEA 3CUFA 3E0IA 4RNJA 1H41A 1W1B1 4Z0SA 2ZUWA 4RV3A 4LBSA 4XK2A 1H7XA 4EKJA 2X41A 3WLMA 2CIPA 1VYPX 1ZP3A 3SW6A 3TC3A 4A21A 4C6NA 1VF8A 1EL3A 4WDTA 1IXOA 2WMJA 1O12A 5EPDA 1FWSA 3B0XA 5CPQA 2ZDSA 4PFMA 3QPYA 1DJIA 3SCUA 3DFPA 2CLPA 1TTQA 1MRAA 1QMLA 3E12A 3NL3A 1JYXA 2HVNA 4GCAA 3N34A 3VAVA 4IIBA 4M1BA 1ICSA 4RE2A 3I7SA 1AQMA 1L6FA 4O4WA 3WQWA 4TMBA 2P1FA 1O5XA 2Z2UA 1KNWA 3QJAA 4YYCA 4YIWA 4YVPA 2XGZA 4Q7IA 2E6AA 3QBUA 4CLMA 3LBCA 2AGTA 2CZDA 4AIBA 2J79A 3CQHA 1XS2A 5M17A 4JIIX 3LA4A 1ZCCA 3KBWA 3CHDA 1EDGA 1JCLA 1DIKA 5C55A 2O0TA 5DCBA 3SQMA 2I9UA 1JZ7A 1EHNA 1JUBA 2QMJA 4MNMA 4DM1A 1WDSA 2I5GA 1JZ3A 2GJRA 3C4UA 1IT8A 1XYCA 4HOXA 4K39A 1ISYA 3VE9A 3GIYA 1QVBA 4QS5A 4DJDA 3CUIA 1B1YA 1OT2A 1VFTA 1S2WA 2X30A 2OELA 2REQA 4H9YA 5JBEA 4ZB2A 4BA0A 2JKAA 1M01A 1G0CA 3PN8A 3LCGA 2VCCA 4E5TA 4URIA 5EFFA 4NNBA 3UPWA 2VC5A 1EDQA 3ARWA 3CTTA 3ZZ1A 3UXLA 1K1DA 4WY0A 5C7HA 4S3GA 2Z27A 1XP3A 3DI0A 1ELSA 1NVMA 1ITUA 2WVVA 4A2RA 1IXQA 2DT3A 4R85A 1VCFA 5IOBA 1PPIA 2VX6A 3L67A 3O7UA 3PWGA 3PJTA 4BF7A 3R5EA 3CK5A 3M6YA 3L4YA 4HHLA 1J0JA 4CN4A 2J7HA 3OYXA 3BLPX 1UQZA 2XIJA 4D1JA 3QZ6A 4LVFA 5E0FA 1U5HA 1QJWA 3UWYA 3SUUA 1XIGA 1KW1A 2BP1A 1JI1A 3O6YX 2IW0A 5BRBA 3MMWA 1GOOA 3TTYA 4OWGA 3EA2A 4Q6JA 2NW0A 4Z42C 4D1IA 3ABQA 1PDYA 2Y5EA 3BJSA 1ZY9A 3UG8A 3VDCA 1PSCA 3CUGA 4LU0A 1L6SA 4V1YA 2FTYA 3SCRA 2CBUA 3CL8A 4N4QA 3VFLA 1Q6FA 3O63A 3KOXA 2FB2A 1Z48A 2XU2A 4TV6A 4C6QA 4GXMA 2AQVA 1Z89A 2FZ8A 4J27A 4RZ4A 2F6UA 2BG5A 1WKFA 3O6AA 4MYAA 1JDFA 2YYTA 4S3JA 4M6PA 3HN3A 3A21A 3I6RA 3I6TA 4IIGA 3N17A 1UYQA 1ZPTA 2G50A 4F66A 3ABRA 1GPFA 3A9IA 2FTPA 4MKNA 1R38A 3O2LA 2ZC1A 5FESA 4K8EA 3CLMA 1X6LA 4HMDA 3WF3A 4P7OA 2BMBA 5K9DA 3CAQA 4HNOA 1FX6A 5A6KA 1R7OA 4GVHA 1GOIA 4GGBA 4KF1A 3NIYA 2E1DA 5EMUA 4U31A 4EK7A 1XLEA 3S1XA 2POZA 1RLDA 2W5FA 2V9DA 2WPBA 1CTNA 3VKKA 2QJIA 3C3NA 3CO8A 4NAEA 2PP1A 2HK1A 1O4UA 4OFCA 1A5NC 2ZXBA 3VNYA 1UWAA 3MKVA 3TYEA 1T99A 3N14A 2X2YA 2PC8A 3VGEA 1TTPA 1M65A 4O52A 4ZOEA 2QIWA 1P0BA 3UXKA 1Q4WA 4TTGA 3QQWA 2PDNA 4GI4A 2EKGA 3OOQA 4DUXA 3TW7A 3LQGA 3CV6A 3IPWA 5FAGA 1CGUA 3TMLA 1EJRC 2GGEA 4LCRA 2SFPA 2P3ZA 1VYRA 3E0WA 4UOJA 3ZFHA 4JYDA 1E70M 1UD2A 2QR6A 3CH9A 2BLEA 1B9ZA 3LI1A 3T0AA 1V3MA 3OB8A 3TAKA 2NVAA 1E6RA 4YNGA 4E8CA 3AS0A 4J40A 2ZRXA 3WLHA 3TSDA 5LGZA 1DIOA 2POTA 1V7AA 1PIGA 2EHHA 1IZCA 2XH4A 3QOMA 1HKWA 3SEPA 4NSBA 2PGEA 3QV6A 4DELA 1OBAA 1GNXA 1RBAA 1V0NA 3MUIA 1POJA 2Y4SA 1KCLA 3L21A 2ATMA 1ZQ5A 1FUYA 1TR1A 3W87A 4QG8A 4PMRA 2VVSA 5HATA 3F2DA 4O57A 3LPPA 1OX4B 1IGSA 3LTSA 5A6TC 4PE8A 2WANA 5D05A 2WBGA 4AYSA 3Q94A 3ICJA 1G01A 1KBKA 3DAQA 1O5KA 2ZRYA 3PP7A 2QXWA 5H6HA 2HISA 3IJ6A 1PTAA 1A5LC 1E4NA 2CLIA 4ML9A 1EJXC 4X22A 1KGWA 4BHYA 4ADTA 3GD6A 1OM0A 5BWAA 5LA2A 3NQ6A 4GC3A 1M1BA 5FF2A 4U2YA 1LORA 4YL2A 4MUZA 3HMCA 2X0YA 3E2SA 3NEVA 3XISA 4MJZA 1UZDA 3GKAA 4PCPA 3DBPA 4TMCA 2C13A 5EU9A 2H8XA 2NWRA 2NT1A 4CCEA 1XLJA 4WVXA 2NXHA 3CXOA 4ERIA 1FQ0A 3UF9A 3W71A 1RR2A 3SGGA 4Q4OA 3VD3A 1QNSA 1Y5WA 4JDBA 1MW0A 1FBAA 3ARTA 4M8UA 1XIIA 1H1YA 3E5BA 1H7WA 1YMYA 4LRSA 2WSQA 2VI0A 3OODA 3WNNA 4UQAA 3NO3A 1BG4A 1VCVA 2HDJA 2ZADA 4NJHA 3DYMA 1CXEA 4GUJA 3ABSA 4Y96A 2ON3A 1OQFA 1C9WA 3TE9A 3DEQA 4AG0A 1W3IA 4FLRA 3FEQA 4C1NA 1X97A 3UZ5A 5EMJA 3RLUA 2CWNA 2CXEA 4GXWA 1NH6A 1XBZA 2HRWA 2O4MA 1Q6DA 3MTWA 3DCPA 3CEPA 1BSLA 4I8DA 1IIGA 4X0VA 3CNYA 3E96A 3NO5A 2HV5A 1SO6A 4MZ8A 4LUTB 3G18A 3E1F1 4UR7A 2ZWZA 3B8VA 2D0HA 5H8PA 4V28A 1KV8A 1AUSL 3L5AA 4QQUA 1Q45A 3W76A 3SN4A 4WKAA 1AW5A 1TPFA 1E73M 3MP5A 3K30A 4JX6A 3RLHA 4GIAA 3B04A 3VNJA 3TN5A 2V81A 1TR9A 4WEVX 4GX9A 2X7VA 2A6LA 2VEKA 4YCOA 4AC7C 1ADDA 5IBXA 3T1GA 1GW1A 2AL2A 4JQ2A 1SSGA 2J7CA 1V3KA 5CZKA 3L66A 1K7XA 4AC1X 3KBSA 4C90A 3C2EA 2CLOA 3S46A 3N73A 5E70A 2J27A 4KCWA 2PE4A 1UCWA 3W72A 3BAIA 3CYVA 3LS9A 3EKLA 4Z2LA 2DZBA 2AKMA 2E1WA 1O1ZA 4FP1A 1ZJHA 3GR7A 1OK6A 4E8DA 1MVYA 4XTIA 3QV8A 1AW1A 4GYPC 5F7UA 4UTJA 1C8YA 1PIIA 2I16A 4HNLA 4EF8A 2R1LA 2YFOA 1CCWB 2QUMA 2CWXA 1FHLA 1A0CA 1ECEA 3FGCB 3ORWA 1QI4A 2Y5SA 4HA4A 3WK2A 3L23A 2PCQA 2A21A 2MUCA 4ZA0A 3SGUA 1KM3A 2E9MA 3VZZA 1YXYA 5C54A 4N0RA 3H4WA 4C60A 1OSEA 2J74A 3KHJA 3LY0A 2EBNA 2HBVA 4GO8A 4IIDA 3G1AA 4N42A 1C7TA 2R91A 4RXGA 4ZTYA 3KL5A 3FVDA 3P2VA 2WJDA 2H3BA 1KBLA 1LWHA 1F76A 2NUWA 4GKLA 1TZ7A 2BXZA 3T0DA 4FI4A 2ZUSA 5I24A 1A47A 4WDWA 3VKDA 4HN8A 4MLRA 4MUPA 1FCVA 2EG7A 3GH5A 3L5MA 4I5UA 1RD5A 1OC5A 3D0CA 3MP3A 1QBAA 1FOBA 4CD8A 3L5LA 1KR1A 4Q8QA 3VABA 4IH3A 4U5IA 4W84A 4KRTA 4PRTA 1W1IE 3DH7A 3SZ8A 3S5SA 2FTWA 2OWXA 2PF8A 3LSCA 4A8NA 4LB4A 4CD6A 4JFSA 2P53A 1FWRA 2CLMA 1KLYA 1W1ZA 1RA0A 3IJQA 1R3QA 4QHRA 3EWCA 4OQVA 3G1RA 2YZ5A 2EGZA 5FKYA 2Z2BA 1LUCB 1C7SA 4ICNA 3U7VA 3VMNA 4O13A 2JKPA 3BLLA 3EDFA 1XBVA 2GGHA 1EYWA 4LY8A 3HGJA 2VZSA 1DTUA 1PYMA 2VTFA 2X0HA 3TOYA 2DUAA 1V6UA 4Z2IA 4LQ1A 2C7FA 4G1NA 3UWVA 3DC0A 1F74A 3FJ4A 3SRFA 3CQ0A 2ZUUA 3DBNA 4GJ1A 4PA8A 4GRSA 3EA3A 4EPKA 2ZIDA 1B0IA 1HJUA 4IWWA 2ZWYA 2GK1B 1Q63A 3ZVHA 4UFJA 4MMWA 3WH6A 4Y8EA 1VCGA 3SCNA 1JXKA 3BE7A 3VZXA 4AFYA 4NZ1A 3EA1A 2VZTA 3H2CA 2F6XA 4DBSA 2PP3A 3RLVA 5AVNA 2RUSA 3LNMA 1CXFA 3WD4A 3RM8A 4P61A 3UXAA 1R2RA 4Q7NA 1B3OA 1PKMA 5C6MA 4R5EA 4A05A 1TPUA 3AS3A 3R10A 1BLIA 3VC5A 4GKTA 4DHGA 1E9ZB 1QI2A 2VUYA 2Y7FA 4IXXA 4X2PA 3IJLA 4D2JA 1YTDA 4B5XA 3LV6A 3GC4A 4K1GA 1J18A 4O4VA 3Q67A 3TSMA 1XLLA 1LG2A 3N4AA 3TU9A 4QFUA 4A8IA 4PBEA 4C5YA 2PDBA 1EBGA 2E28A 3QKEA 2FYMA 3S5NA 5HOSA 1P0EA 1QATA 4LF2A 4LYKA 3WG6A 4HZ6A 3AZRA 4J3ZA 1WDRA 4EP8C 4LCSA 3T2OA 5DQPA 2VFFA 2D3LA 2XH0A 2E68A 4QQ3A 1JR1A 1IWAA 3M6DA 4KPLA 1YXCA 4EIVA 3PS7A 2PC4A 2YBVA 4O1BA 4US5A 5GPRA 1IXPA 4WSKA 1HKIA 4E2VA 5AYZA 3TYAA 3RMJA 3LPGA 3P0XA 3O1NA 2BOFX 1UP2A 2HWGA 3PZIA 4JCMA 3HA1A 3NQAA 3LZ3A 3H8AA 4X2RA 5I3KA 5A1AA 4IOTA 3N1AA 1V6TA 1FP9A 1NDZA 3SECA 1SPQA 2PDLA 4IGSA 2I57A 3GXTA 3ARVA 4FNUA 4OKDA 3DFOA 4ZVJA 5DANA 2OPJA 1OYAA 4JQAA 2ATSA 3H4XA 4WJ8A 2QYGA 3KXQA 4E2OA 4LUIA 1KRBC 3WENA 1GKRA 2QCDA 4NYYA 4GWEA 2YL9A 2IXVA 3MHGA 4UMCA 5FD0A 1LYXA 1DWFM 1KCZA 5HDRA 1I75A 4K3ZA 1VHCA 4S3KA 3B0UX 5HNTA 1VAHA 4FNSA 3URAA 1W3TA 1CNVA 4Z08A 1YDOA 4OBTA 4HNNA 6ALDA 1WUEA 5G2WA 2WJFA 3B3DA 3LHYA 3W29A 3PBMA 5E6YA 3BSMA 1EO7A 3THQA 1DWHM 3GS6A 4FO4A 2D0GA 2Q8ZA 4HKPA 3AO0A 1XYAA 3W7HA 4L56A 2UY2A 5HPOA 4Y8FA 4WOQA 2VNCA 4R7JA 2YCJA 2BX7A 2R24A 4HPXA 4JEJA 5HA7A 1G4PA 2HEJA 4IM4A 6CGTA 3DX5A 2J78A 2BOEX 3HOJA 4XD3A 2Y63A 4F0MA 3UXIA 2F8QA 1XLIA 1ZLPA 1R7AA 5LIKX 2VYOA 4BKNA 4CQ9A 1NDVA 1W31A 3N2XA 2Z29A 3M0KA 1OIFA 2CCRA 2OX4A 3GX9A 3SO7A 1BYCA 3MW7A 1LM1A 4WDXA 4R53A 2WMGA 3I3BA 3ZQ9A 4LVAA 3ZIZA 3GXNA 3LX9A 1LL7A 3OBKA 3PPFA 5TNVA 1J8VA 4TX8A 3RR4A 1B4KA 4BI6A 4AVFA 5D2WA 4I7VA 1BHGA 4PB3A 4D9PA 4KIRA 1JFXA 3TFXA 1J0KA 1EIXA 4F2UA 4CNSA 3TTSA 4IIFA 3UBPC 3WLTA 3QY6A 1ZHAA 4IP7A 3JVAA 4ZODA 1TPC1 3WQDA 5XIMA 2WVVB 1NJJA 3D6NA 3OQEA 1K70A 2QUUA 3ZJ6A 1WZMA 1EPVA 3L0GA 3GG7A 3W7QA 3T7VA 5AHEA 2ISDA 1YNYA 4C6FA 4ATLA 2EG6A 1TQXA 1ISXA 1PCWA 2Y24A 4HN4A 4EXQA 5IHRA 3P74A 3VD9A 5JMUA 4IG2A 1IEXA 3B03A 1X1NA 1XIDA 3G1HA 2ZKMX 1UP3A 3HMJG 3VIHA 3H70A 4DAFA 1L8NA 5A6AA 1DWJM 3CQKA 4YXGA 1TZ9A 3R1ZA 1YADA 4PL2A 2HQAA 2QV5A 1ZJIA 1A5UA 4HTBA 3MSGA 3WLOA 2NLYA 3AHZA 4Q4MA 5CJMA 3GBDA 3ABZA 4BF9A