3N2GB

Tubulin-nsc 613863: rb3 stathmin-like domain complex
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stathmin and interfacial microtubule inhibitors recognize a naturally curved conformation of tubulin dimers.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
total genus 114
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3n2gB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3n2gB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3n2gB01
4F6RB 4ZHQA 4WBNA 5C8YB 4DRXA 4B45A 3JALB 3HKBA 4IIJA 4O2AA 4TV8A 4I55B 3HKCB 3JARB 1TVKB 4ZOLB 5LXTA 4KWEA 5BMVA 3N2GB 1RQ2A 2RHHA 3RYFB 3V3TA 4FFBA 5LP6B 2BTQA 4LNUB 5LP6C 3WGKA 4B46A 1JFFB 4TV9B 4HNAB 5LA6A 5JH7A 4EB6A 4I50B 5JVDA 3VOAA 3HKEB 2RHOA 3WGNA 1Z5WA 3HKDA 3WGMA 4X1YB 5J2UB 3N2KB 4EB6B 4ZI7B 4HNAA 2VAWA 1W59A 4YJ2A 2VAMA 3C8LA 4O4IA 4U3JB 5KMGA 3R4VA 1W5FA 3N2GA 3RYIB 5LYJB 3CB2A 5GONA 2GVIA 4O4IB 3VOBA 4YJ2B 4O4JB 3HKBB 4IIJB 4DRXB 3N2KA 5EIBD 3ZBQA 3E22B 4O2AB 1W5BA 4EI8A 4X1YA 4X1IB 3ZIDA 4EI9A 4O4LA 5GONB 4TUYB 4IHJA 3HKEA 4XCQA 5EYPB 5JQGB 5LOVA 5JCOC 1FFXB 5MN6A 4O4HA 5CA0B 5JVDB 4O2BB 5JH7B 2XKAA 5IJ0B 4E6EA 5LP6A 2R751 2RHLA 2XKBA 1Z5VA 4O2BA 2BTOA 4O4HB 5CA0A 5CA1B 3WGLA 4X20B 3VPAA 5EZYA 1SA0B 5ITZB 3WGJA 4ZOLA 3HKCA 3JARA 4IHJB 3M89A 4TV8B 1W5AA 3RYCA 4WBNB 4F6RA 3E22A 4I4TA 3RYHB 5KX5A 5M7EA 5LYJA 4U39A 3VO9A 4X20A 3JASA 5CB4B 3RB8A 5IJ0A 5J2TA 1RLUA 3JAWB 5IJ9A 5J2UA 3JATB 2Q1XA 1TUBB 4X1KA 4YJ3B 5IYZB 4TUYA 3UT5B 1TUBA 4M8IA 4X1IA 1FSZA 3M8KA 4I50A 1OFUA 4O4JA 5J2TB 5FNVB 4DXDA 5EIBC 4LNUA 2BTQB 3JAKA 4FFBB 5CB4A 3RYFA 3RYIA 2R6R1 3JASB 2VXYA 1W581 2Q1YA 3JAKB 1TVKA 4U3JA 5KMGB 4I55A 5LXTB 5FNVA 2RHJA 5MN4A 4ZI7A 5C8YA 1RQ7A 1W5EA 4ZHQB 3RYCB 3HKDB 3UT5A 5IYZA 4YJ3A 4X1KB 2VAPA 1SA0A 5EZYB 5ITZA 3JATA 5CA1A 5IJ9B 3JAWA 5LA6B 1JFFA 4TV9A 5MN5A 1FFXA 5JQGA 5EYPA 5BMVB 5LOVB 3VO8A 3ZBPA 3RYHA 4I4TB 5KX5B 5JCOA 4EI7A 4O4LB 3JALA
chains in the Genus database with same CATH superfamily
1Z0UA 1QIGA 5IC5A 2C4TA 5CB4F 2LDXA 2JI7A 5I4CA 1VB5A 3F73A 1VKNA 2FW1A 3SEZA 5BR7A 1XILA 3OX2A 4G5RA 3DQZA 3U3KA 3IAAA 1QH8A 1Z82A 5DLDA 4H37A 2HN9A 4TTRA 5TGZA 4EUFA 1ZCFA 1TYCA 3B2NA 3TQRA 4HNAB 3QIAA 3QX7A 1ZYUA 1VSVA 4YLEA 1LZLA 3ZH2A 5F4BA 3SIPA 2AMLA 4LHSA 3OMIB 5IK2A 5EY5B 1ECCA 3WKDA 1M3SA 3ZG6A 3HA7A 1J2EA 1G3QA 4KE8A 4GKJO 1TMYA 1QPZA 4RD6A 3PCTA 4JUCA 3U26A 1G42A 2IEGA 2FR1A 3GD7A 3K9LA 5HKAA 4ZDIA 1GRQA 2Q7GA 2ISCA 4FM2A 3OOHA 5SY4A 4JENA 1H0SA 4MUMA 3O92A 4CQLB 3FPEA 3UGTA 1VG9B 2NP7A 4H15A 4EDFA 1PZEA 2V4UA 5FHQA 1L4FA 5EERA 4EJFA 4IJ6A 3UXHA 4D0GA 3U3DA 1VQMV 1JEQB 4LF5B 2REBA 3GN1A 3I5UA 4QVIA 1OILA 2FQ1A 6GPBA 3E3MA 3CCQV 4H1UA 3FPGA 1B06A 3OTQA 3H19A 4FLVA 3I55F 2LCFA 2W70A 3OTGA 1XZHA 2F3UA 2GJKA 4KIWA 4IAOA 4A03A 4O2BB 2HIMA 2R1TA 3DEHA 3H0CA 5LUBA 5LZ9A 2CDBA 1GZVA 3U09A 3A7DA 3L1VA 3VC2A 4YRGA 1JNXX 4JZ2A 4HWTA 1BKDR 4ZHYB 1EZJA 4G8BA 4XX1A 4ZCSA 5GPBA 2I4NA 1WHTB 5FWAA 1WSWA 3ZHQA 4JAAA 4YCMA 4M3NA 2ZE7A 1NPYA 2GCOB 2V98A 2R7LA 1LBHA 4ARUA 3IFXA 1LX6A 5KYXA 1IPAA 2YYSA 3X2EA 3RM3A 4Z9FA 1GT91 1QRRA 1R4MB 2PMWB 4JUAA 3UCSC 3CZ9A 4C4OA 3PUWA 1QVRA 1U4SA 4QPPA 3CGWA 4E30A 3QYJA 1UBTS 2CNDA 1D6SA 2GZ1A 4MCHA 4RACA 1KMHA 2PUDA 2XVAA 1BO6A 1U5CA 2YASA 3D7MA 3QOYA 2PL9A 1QMPA 2HBZA 3K0CC 2KB0A 2QKAA 4J1QA 1N9KA 5D3MB 2YS6A 2Q7HA 3PGJA 5TPZA 3C9RA 2BFFB 2QN3A 1YASA 2HMAA 1J90A 3FR8A 4KQGA 1S7GA 2IYTA 2VHWA 1LK5A 3QVVA 4INJA 2HO5A 2XCLA 1BCRB 1KC1A 2GBLC 4O4JA 3AKEA 3QWAA 4GOJA 3RS7A 4DNXA 3QEBZ 1YRYE 1YUBA 2B25A 3K4PA 1R6NA 3CC8A 5LYJF 3T5TA 1VC2A 2WIGA 2JLYA 1V1RB 4FYKA 4MNTA 4DGQA 5D7BA 1OWOA 2R60A 4H7FA 4PX9A 4BNWA 4I9GA 1R0RE 4AMUA 3FVQA 4WCEV 4GKVA 4QGHA 5CDGA 3ADBA 4BT5A 3IUJA 1HK7A 4UXJA 2C42A 1JEYA 4J11A 2Q73A 3TJTA 4BR6A 1P80A 1CU1A 2PLAA 3F5SA 1PM9A 2M6RA 2BCCH 1SK8A 2D1SA 2PS9A 4UUMA 1I2DA 1TQDA 4FR2A 3QKRA 3U48A 3N2YA 1OXUA 1XZQA 3ONWA 3D6AA 3ZHZA 5COAA 1Y8ZA 4CQNA 2F4NA 2QQ5A 1CULC 4Z4QA 4EI2A 4WFBV 4KQCA 5FFNA 3C41J 2ZRIA 3LBFA 1GY8A 1U4NA 3RUAA 2P5YA 1M7GA 3FTQA 1PGQA 4HNVA 1BMTA 5BXQC 4JELA 1CUXA 4CMIB 1T1EA 4J7CA 5EP3A 2PGDA 2PTHA 3OWHA 4PBRA 2LIPA 2Q5IA 2EG9A 4DA0A 2DPHA 3IR9A 5C8YB 1G3MA 2FZWA 4TMZA 4CM9A 3RODA 4MVQA 3WS7A 3UW1A 5HCNA 1JQ5A 2VWPA 3GP3A 2ZCVA 4W1QA 4V1CB 4IFBA 5ICFA 1HWYA 1IN8A 1B93A 4MWGA 4TM7A 1OHHA 4KMOA 3E58A 5BSRA 2OM2A 1N0NA 3WU2Z 3AHDA 1RPNA 2OK7A 4Z4IA 4XCXA 4IS2A 3R5TA 4ZXPA 1P17A 3CLUC 5B2FA 2VJLA 5FUVA 3ZRSA 5IF9A 4QUDA 4AF6A 3HY6A 5BWCA 4Y2PA 2EZ9A 3GUZA 1IZ3A 1IVSA 1QCCA 3CMAF 1R5BA 3PQCA 5F7ZA 4M22A 1JIQA 1LPNA 2GD6A 3RJZA 3TRFA 5JADA 3EEFA 1J5XA 3GDGA 4HAZA 2Y8EA 4PO1A 4RF3A 2E1RA 1KDZA 1OV4A 3ELDA 3DMFA 4MRMB 1W5FA 4A0FA 1IBMB 1GG5A 1PDVA 4JWTA 1I80A 5KDDA 2OSVA 3FNQA 2QTVA 1WKCA 4KQKA 2NV6A 4N18A 1ZN9A 4G63A 3CZRA 3U9LA 3GLFA 4X1OA 1FJXA 2FSGA 3CYFA 3T5AA 1WP7A 2C3YA 3QLUA 3QXXA 1Y66A 5BV8A 5HUHA 1RACA 1MA1A 1OH8A 4TYYA 3QG1A 1P84F 5G3ZA 1JG6A 1DTSA 2C92A 2JAWA 4KUEA 1B0PA 1QF6A 2GNPA 4JBLA 3FW1A 2NO6A 1VLLA 4KHPB 1T6NA 2GHIA 3B6ZA 5HEKA 3ND8A 2EL9A 3P27A 2Q4PA 3TK1A 2IODA 1NLFA 3DB1A 5DX8A 4YJFB 1P8AA 5J1TB 5KJCA 3IEWA 3A32A 4CIBA 5DPMA 5A4KA 5IH3A 5JECA 4BE4A 3KBOA 4P53A 1N4CA 1AQIA 4YCCA 2XUKA 3H6KA 3R8XA 1U3UA 1K33A 3OUZA 4P2BA 3H3JA 4NLLA 3RU3A 1LW6E 4BJ6A 4GBGA 3TNLA 2V1UA 2AC2A 2QRPA 5CVUA 2FG5A 2CZQA 2O5RA 2R4QA 4H35A 3DOHA 4S35A 1ACJA 4Y0NA 3UEOA 5J1SB 2PE5A 3GJ7A 2B92A 2UYNA 2H8KA 5ILOA 4ZHQF 3EA5A 4FB4A 5FOQA 2FXVA 4IX9A 1M0WA 3G0CA 3O75A 1PR2A 5CHYA 2WOJA 3TQFA 4E32A 1TI7A 2I8LA 3CF2A 4D4HA 4RQOA 4EIWA 4DBLC 3ADPA 1QHXA 4I4NA 1KE2A 4V2UA 3OQ1A 2GBCA 2JKZA 5FA8A 1QGDA 1K1EA 1UBEA 2HKIA 4L5IA 3THWA 3EY4A 4L8WB 3TIXB 3C3JA 1G5HA 2FUCA 1GKFA 2X2FA 3A4LA 5GOTA 3HZRA 4HYOA 2GVNA 1GA6A 2PLRA 3CPHA 1PS9A 3BTSA 1DUSA 5KWIA 1V5GA 3HU2A 2XVXA 2ZE5A 1YJWV 3CUEF 3EVNA 4TYMA 3ZI0A 4E13A 3VZPA 1FX1A 3RARA 4PQYA 3X1WA 1YI2F 1JVBA 5JLAA 4U7FA 1RQLA 2CW5A 2PUWA 5C1IA 3ED5A 1XKXA 4YY3O 3H1EA 1NFQA 1WVIA 4DE5A 3KQWA 1IFXA 4NATA 2IYAA 4UC0A 1JHYA 2FF5A 4BP9A 3HLYA 1KMCA 1NYTA 5IAKA 2ECKA 4O4LF 3I5XA 5B64A 3U44A 2J41A 2VF8A 3A31A 2DQSA 5EBLC 1NKTA 2AF4C 5EYPA 4RK6A 1NBIA 4YWJA 3SJAA 1W0CA 4DJDC 4LF6B 4XW2A 4Q9IA 1RI3A 5K0FA 4ENUA 3LSUA 1DKOA 4LF5O 2L2QA 4PSVA 2J45A 4IDNA 1ELOA 1PHPA 3KDPA 3MCQA 3AI3A 5KVCA 3R9XB 1GGVA 3EWIA 4YAIA 3EZ6A 2NXWA 3PDJA 1RJGA 4G25A 4C0HA 1U11A 5AFSA 1HE2A 4DW8A 4NU5A 4L8JA 10MHA 4B46A 5JCJA 3DWFA 5CX4A 4TLMB 1HEUA 2G9VA 1QR9A 1K7YA 2WAAA 3CBQA 5B30A 4J7KA 5GWXA 4KXVA 4WXRA 1N5MA 3RIYA 1DIRA 4AW9A 1DDIA 3GB7C 5AXCA 2PL3A 3BD6A 4PU0A 4XQGA 4N01A 5H5NA 2PYIA 2VYVD 4ZKIA 1IE3A 1SCAA 3WGQA 4BZZA 4CLRB 2A4KA 2CVPA 2O52A 2V3WA 4R7GA 3FD5A 2PI4A 3D81A 2HREA 4LGVA 4PG8A 2XZDA 3C5VA 3CWQA 3KR2A 3SR3A 3H8JA 2ACVA 2W2MA 5A71A 1LZKA 1NF2A 4G4SP 2IYFA 2QM4A 4O1HA 4OI4A 4QUGA 3THSA 2P0EA 1DQNA 4E1BA 3BSSA 3PC2A 1MZFA 2F3RA 3EGXB 3KSMA 3LWZA 1LNSA 4G01B 2O3RA 4B1FA 5G4LA 4BVAA 4GKBA 1LK0A 1NUPA 4QBKA 1Z83A 1Z4OA 3KRTA 4WERA 5JSYA 3CQ9A 1ESNA 2HPAA 1CUBA 3HZOA 1E2IA 3QVXA 5KHAA 3VHQA 1UK9A 2C0CA 2J48A 3MCAA 5DX1A 1RE1A 1I8TA 3GGGA 4X92A 3HBMA 4YRPA 5KNCD 1NLZA 2QLBA 3ID6C 4MA4A 4MJXA 2O3UA 3GVMA 3P3NA 1CIPA 4L4YA 4M86A 3WDKA 3ZC3A 4MRNA 1S02A 2NU7B 2A78A 4MP6A 3TRJA 3LVRE 2ZSAA 3AGKA 2GVZC 1LW7A 1QJCA 2C9BA 2PAAA 1QIIA 2AI2A 1IUOA 5JRDS 2QR5A 3VAZA 1TT5A 1IAVA 4I1VA 4MV3A 2X0FA 2GRUA 4FYVA 3WRWA 4LFBO 1P9OA 4H08A 3L7MA 3V5NA 1USWA 1I7NA 2QLLA 3NOVA 2AFIE 4JY7A 2FSVA 1VL8A 3HLKA 2XCTB 1NRWA 2VS0A 1AHIA 5AICA 5DRTA 2HMTA 5DXFA 3S2GA 1XCOA 1KMIY 2UZ1A 3GGJA 4HXYA 5AI6A 1Q1NA 2UV8A 5B1AC 3KQQA 3JATB 2NXNA 2PR2A 4OL0A 3TFQA 3RNLA 1KAEA 1KJYA 4DWJA 1A97A 4EF6A 4P35A 2I54A 4Q9JA 2X22A 5B1SA 2GKOA 3S4YA 3FTFA 5M34A 4HVCA 4I50A 2HM7A 3D8TA 3I30X 3ZY2A 4D4JA 3D8CA 1I24A 4F46A 4GH5A 2C3MA 2Q3EA 2C59A 4UATA 4QT4A 4B3BA 2CSLA 2ASEA 4CT4B 3IC7A 3UV7A 4EVRA 4TYWA 3F9CA 3I0MA 3Q8HA 4ZK7A 1NP6A 2Y99A 3AJ8A 3IUMA 3K35A 4M55A 4G0UA 4I2NA 5CXUA 5FI1B 5BY1A 1FUEA 1VXRA 1ZOOA 2FLVA 2I2WA 2Y1CA 4ER0A 3MYYA 3H5VA 1ZXXA 4I4IA 4A91A 1ORRA 2WWHA 2ETNA 3KKEA 1YVWA 4PC3A 2YDXA 2HPHA 1GZ3A 3A14A 1KD1H 3CLTD 4JYMA 4R2LA 4WKNA 4DM3A 1U99A 3CX7A 3ESZA 4OQLA 4RMJA 4W1RA 4ECAA 2KS6A 2QI2A 4DMLA 5EIOA 4NCAA 5MN5A 5LUAA 1AI7A 2OTLV 4R8SA 1FSPA 1HQDA 2X0IA 5CYGA 1XBLA 4FP9A 2B82A 1AR4A 4MVJD 2JIPA 4ZVUA 1NOKA 1H4SA 1DDGA 1W44A 2DH6A 2GA8A 3TX2A 1QU9A 1YDWA 3I0NA 1TJ3A 2QTRA 1HYQA 2O3SA 2P3OA 1PFQA 2QG4A 3A6JA 3KT6A 4NENB 4KWEA 3PD1A 1F14A 3WNZA 2HMSA 3HDVA 3DLAA 1Q0TA 1QHFA 3FYDA 1D09A 2HBRA 1TVMA 3LUGA 4ASUD 3PJRA 2ZUUA 4Y9TA 2BFBA 5T8KC 3BIFA 5DKFA 1OYWA 2ORWA 3STVA 1HTBA 1X8XA 5G2OA 3KLPX 1FS5A 2CC2A 3HKEB 1Y9ZA 3HJTA 3N58A 3H6HA 3M1YA 3DR5A 1ISPA 1FX0A 5BSEA 3HKDA 3DE1X 1T0IA 4MXDA 4JYAB 1K8YB 2ZRLA 3AU9A 3W3ZB 3VMFB 3L71H 1R73A 2FUEA 2NVBA 2HCBA 1AXGA 2VAWA 4LX8A 5FO0A 3RTGA 3HV2A 1YS1X 1J7KA 4WTOA 4YLGA 4M98A 1UPAA 3V4PB 1JKJA 1JIUA 3BA6A 4KTTE 5JDIA 4G28B 4IRXA 3PZBA 2JAOA 5C5IA 3OMNB 2JATA 1M2WA 2V7WA 1EDZA 4PD4F 1UPBA 4TLDA 1YFLA 3M2PA 5KYGA 1ZAYA 1JQAA 2QUKA 1VPDA 4PYNA 4UULA 3Q11A 3GVCA 1PZHA 4E4RA 3W1VA 4DDVA 5DN6D 4OPAA 2J0UB 1YS7A 2HSWA 2ZUWA 4HYQA 4IIHA 2WWIA 3L5OA 5JQGB 2F9ZC 3IA2A 5FB3A 1V7CA 2HT6A 4EP1A 3T8YA 2VQ3A 5F64A 1JJBA 1OWLA 1TK3A 3M4JA 3EIWA 2XNHA 4LZPA 4RJLA 4U5QA 1T35A 4C2AA 3TD3A 2WNIA 1EHIA 1D6MA 1L7QA 3CONA 3IEPA 4L5BA 1OHHG 4ZRDA 4DA4A 3OM3B 5HZMA 3CZ5A 2O2IA 3HXLA 4JLDA 1MNGA 4FLZA 1KP2A 2KLBA 1QQCA 3I0ZA 1UODA 3KEFA 2IUSA 2OLKA 1KPGA 3AFHA 4YO7A 1A71A 4YMIA 1Z2GA 3SG0A 1AKYA 1Q0QA 3BE4A 2FFBA 3QXGA 1NY5A 1VCMA 2M1ZA 3E5RA 5JO9A 3FKSD 1FP2A 2ACKA 1VP3A 3PF8A 4MK4A 2C7PA 4OSOA 2NXJA 4R9RA 3NTXA 5DM0A 1BCSB 3IHLA 3QA9A 2IXFA 3OFVA 4PPYA 4JB2A 3NK6A 3IP5A 3SX0A 5BV1A 3L4JA 3CC7V 5E2BA 4G9EA 1C8KA 1GGJA 2RHTA 3L0SA 3SWWA 4C6TA 3E03A 1RM1B 2HJRA 3NK7A 2D0DA 3RRJA 3RU7A 3S2IA 1F2TA 4PO3X 2OOKA 3D64A 1DLBA 1EEHA 3QVLA 4V38A 3K9HA 1QGAA 3N2NA 4MV5A 4DWVA 3IPAA 1JH8A 4OGKA 4U7PB 4OM7A 4Y6LA 4F5DA 2W2QA 1PT7A 1MA0A 4U2KA 1XTBA 1QHIA 3HCOA 4LYHA 3IQDB 1BQ3A 4BVQA 1RLMA 3FFQA 2GETA 5LQKA 4RKEA 2OHIA 3IVXA 2A1IA 4BNMA 1VMIA 2XQVA 2RB9A 5KU7A 2R68A 4ZOBA 3BERA 1PK9A 1ESCA 5CB6A 2GZ3A 4IYJA 4S24A 2QLNA 1DQSA 2QKSA 1M2EA 5DOZA 2V7GA 2OHVA 1R0KA 2EW8A 3LUAA 4JKYA 3SSAA 4C04A 1G3RA 3D54A 1IXZA 3A9WA 3DFZA 3WK6A 2UYHA 1OTYA 4O08A 4UV8A 4HVAA 3BAZA 2NYUA 1Y34E 1Q3HA 2A7XA 5SZKB 1L5HB 4BWVA 3HFJA 1H3NA 2YFQA 1TTPB 5IBPA 1XN1A 1Y3AA 2VF2A 3D9QX 4R1LA 2PWAA 2VDUE 3LNNA 1VQ1A 2OCAA 1PU2A 2J46A 3EVZA 2WLNA 4FW8A 2WZCA 4L72A 3ZWWA 4EKEA 3U60B 1W4ZA 2G4CA 2RAFA 4CXMA 5LXTA 1R3DA 4DS3A 1GO0A 2D74A 3GJ5A 1XKQA 1MH1A 2ATXA 2FN8A 3F3KA 4QPNA 3WZ2A 3OZIA 1E1QG 3PPIA 4LEIA 1WCV1 2WPDD 1W36D 2PZFA 3ZYZA 4K46A 3OIFA 4BE7B 3KTFA 4MCIA 5LM3A 3G2LA 1T8UA 3A1FA 3WHPA 5KYWB 2UUAB 3N2LA 1S5PA 1G0NA 3AG7A 1JKIA 3B1FA 2C29D 3GAFA 4HX9A 5P21A 4JEMA 4DLWA 5B4VA 5J9FA 3E0XA 1DLIA 1PG2A 4YQZA 4B31A 1JU4A 3I2YX 3KR0A 4LXUA 3CCEF 5D5HA 3HG7A 3VO2A 1TJYA 2NTEA 2WU8A 3GCWA 4EZBA 1TZBA 2BMDA 2CUTA 4ICIA 2UXBB 3T1YB 2JGJA 4P0PB 3MQWA 3NYWA 4YS6A 5DXAA 4B85A 1AF7A 5MHTA 4CIAA 4NE9A 4NE2A 2QVBA 4A23A 2ANBA 2P3QA 2W6PA 1GTG1 1Y4ZA 2P3SA 3AVOA 4KIUA 1D07A 1GG8A 3A1DA 1IQUA 1DF5A 1KQFA 1YL6A 5B58T 1EM8B 4IXWA 1RVDA 2A9RA 5JJ5A 3DE7X 2Z9CA 4BT2A 4C08A 1W0JD 3TJMA 2WWFA 2XXAB 3J7AU 1PGPA 2FRDC 2IDJA 2FR8A 2I2FA 3PFCA 1JLKA 1QGZA 2FEOA 1FNDA 2CCGA 1BCCH 4NSNA 2WICA 4UFOA 2B8WA 4BP8A 2UXNA 1XHLA 4PSKA 5JC8A 3WPXA 5DE3A 2HXSA 4RUFA 2PNFA 4RY9A 4EPVA 2DFVA 1M34A 4FSHA 5AHRA 4O33A 4A16A 5C5DA 1NONA 4GL2A 3Q7SA 2DULA 4C81A 3KLMX 3N75A 3FGZA 4CFSA 1SBCA 1MRZA 3CO0S 2M6KA 2WB2A 4CMEA 2I62A 4YRCA 3L82B 5F3RA 3ZWVA 2QD1A 4MUXA 1Q20A 3H1FA 3Q5GA 5F1PA 2YINC 5HBGA 1OBHA 4BWGA 5I7EA 4A8JB 5AVWA 2E1PA 4ND8B 1TKRA 3BXZA 1ORVA 3EEBA 3IAFA 4L0MA 1G6OA 4MCJA 1PJSA 4WCFC 5JCXA 1J95A 4FGZA 3WJAA 1LI5A 2EXXA 2QXYA 3IDOA 3N1UA 2B6NA 3ZX6A 2XA9A 3DM9B 1J9EA 4EMUA 1SCKA 1MMMA 3RKSA 2PCJA 2Q1SA 4G0YA 4NMMA 5B7QA 2QSZA 3ZEDA 3KZIZ 1I1OA 1NMSA 2A5GA 1H7MA 3LYHA 3AM5A 1WM1A 4L9WA 4ND2A 4UAGA 1TAGA 4TV9F 1CNEA 5K0BA 1E5DA 3T7EA 3WAGA 3FY4A 2ZWMA 1QXSA 1QGYA 1LK7A 3TNFA 1CP3A 5LQSA 4BBAA 1F4MA 1SCUA 2A5JA 4Z54A 4LSWA 2YI8A 3QGMA 4WKPA 4YDHB 4FK8A 3BK1A 1TAUA 2ODPA 1JF8A 2FZCA 1W5EA 4CJXA 3QUSA 4PBTA 2HK6A 4HOYA 4FPPA 1QVGF 4LBVA 4R40A 1EIZA 3TB6A 3VU8A 4DV4B 3SR4A 1D03A 1DG1G 4IJMA 3X1JA 4JT9A 2EX1A 3OZRA 4F4IA 3F7NA 3OKFA 2I7DA 2G8NA 1E2HA 2P2NA 3MWDA 1MJGA 3E7DA 2I87A 4CR7A 2A84A 4AQYO 1GHTA 4LC9A 2ZZKA 2X5KO 4EZIA 4JOSA 1XG5A 8ATCA 2VXBA 4HX5A 3LSYA 5BNIA 1R64A 3VNQA 3EXG1 3LGAA 4NTZA 3SXUA 3CRRA 2V7VA 4G8JA 3BVOA 3VNAA 1ZSNA 4PRLA 2OZVA 5DGHA 4DDWA 4UOZA 4XDHA 4ITUA 4ZOLB 3EK2A 1HFEL 3SPJA 1AQLA 1O6BA 2XEDA 3SQXA 4PN7A 4IKPA 3K6RA 5HF8A 2CZCA 2ZDGA 4HEA6 4PLZA 2PJDA 2ZTVA 1MQ8B 3STWA 3ZDQA 4ZCPA 4DLZA 1RCTE 1YKSA 3S8EA 3J81A 1V9LA 5ECYA 3HL0A 3Q7RA 1JA8A 2R9IA 3G6EV 1MOFA 3QEMA 4I4CA 1Y3CE 1YFZA 3Q88A 2ZR8A 4PHTA 4MZDA 1UBJS 4YJKA 3GX1A 4HNHA 3K9NA 3DBIA 4GXTA 2JGLA 1KPHA 4RHXA 4G9GA 1JILA 3D31A 3AEKB 4R2XA 2Q8VA 3HXKA 1Q22A 3H0KA 4J9YB 3IEKA 3C3PA 2GZMA 2AMJA 1GD1O 3E9QA 3ONNA 3D8HA 1K6MA 4RXTA 3H9JA 4H4EA 2EIJC 2V9PA 3MSCA 1IWPB 1NTOA 1X77A 1UBSB 3E4CA 4Z7NB 1DT5A 5K8UA 2Q5CA 5ADWA 1EK1A 5HM8A 2OUIA 4BGVA 5JEDA 4UM9B 2FLWA 3PXAA 4AJ2A 4C4XA 3M0EA 3T9FA 2EQBA 2KBFA 2NU7A 3CNQS 3IJPA 3TR5A 1FUYB 1TU0A 5ARBA 5KJFA 3NH6A 4KXYA 1H9AA 1U3WA 2AKAB 1V6AA 3DD1A 3SZMA 5EJ8A 3UCFA 3RRNA 3W4KA 1XZDA 1L4UA 1UKYA 3REQA 5CA0A 1UADA 1W48A 1WKVA 1WV0A 2XE8A 5ALYA 5EBWC 1JN0A 2BHLA 4JI1B 4AWXA 4BMPB 3AVVA 5KOHA 4IHJB 3SEFA 4JAUA 2LGWA 1L6RA 4AIRA 3DP7A 4PSAA 3SJQC 4BAYA 2BM0A 3TDKA 4YRMA 3GFGA 2O2YA 1X1RA 2B1QA 1XD2B 3GEMA 4WY5A 4WW0A 3BCCH 2XRZA 4LJYA 4X6YA 2J7KA 1SCUB 3OR6C 2IV7A 3OY7A 3RD5A 4CEJA 4YALA 3VHLB 1WB8A 5I4BA 2GFIA 4AZSA 1F2VA 4LRXA 1CETA 3NBFA 3TQHA 4CI9A 1N5RA 1XALA 2GKGA 3MK31 4GSKA 5IMBA 2W83A 3UK7A 1SQSA 4GS5A 1L5FA 1NE7A 4NBWA 1NKVA 4FC7A 5KYYA 1R3IC 2VZLA 4GE0A 2EX0A 3H3FA 4V0SA 1W85B 1LC0A 4P9OA 1QIKA 5KZMB 1O6CA 2ESRA 2X6BA 3ENKA 3MS2A 3QTYA 5L3SB 4YBZA 1RQXA 1P73A 4HJXA 3GCXA 4CH4A 4GP7A 3I01M 3A6DA 1NVAA 3RYIA 2AN9A 5AVMA 2FGKA 3GRKA 3NIBA 4KXNA 5CR9A 2VXYA 1SVUA 1DRKA 1O8CA 3ACCA 3FAKA 4WKCA 3F7TA 4LVOA 5AHOA 1M8KA 2PSFA 3ORHA 5DP1A 1NAIA 4FWTA 2H1OA 1O58A 4N6NA 5IFLA 2O2DA 4C3UA 1IL0A 3NFYA 4NV1A 5HQJA 5K3CA 4W5OA 1DO2A 3WL6A 1Y1TA 5DEOA 1P7ZA 5BW8A 1L7VC 2BFPA 3IAM1 3K1JA 4D0NA 3OQNA 5LJLA 2HJ9A 1CUIA 1CJCA 1JYFA 3VQWA 5YASA 3TNYA 1FYFA 3C85A 3KQYA 4GX5A 4YASA 1G5IA 1UMCA 4YXWA 3Q5DA 1BJKA 4C5BA 3FBGA 3WGOA 5LOVF 1TXGA 2GTHA 3NYIA 3S8MA 3TE7A 2PUFA 3JQAA 4UAUA 4B2LA 2ZZNA 2AEJA 3OWXA 3V8VA 4CKWB 4G1FA 2FK7A 2PUHA 3O9ZA 1NASA 4AUNA 2JW5A 3OCWA 4BFVA 1QH1B 1ZH6A 4II3A 1X7ZB 4E5UA 4IZ6A 5EQJB 3AHEA 1QG4A 3TVTA 4RH1A 4MR9A 2VNJA 1U7HA 3RYFB 3U56A 1DKUA 2YXLA 2OAQ1 1BHSA 3WMGA 2ZS8A 3KQSA 3KSDO 4LSZA 1XRRA 5C53B 4UU7A 3WIOA 4BVBA 3WICA 3EHEA 2NUTA 4JI1O 2QTLA 4DIMA 5CFMA 4C6HA 1KECA 3PRJA 4OBEA 4PCLA 4B8WA 2WF7A 4IMJB 5JNLA 1W36B 3ZWMA 3L1IA 4GX0A 4EO7A 1N4DA 3N8KA 3U4QA 3KJGA 1FTQA 4WLVA 2W8BC 1RWOA 3A6EA 3GCGA 5K0ZA 2YZKA 3HB0A 3H1BA 4IVNA 3BSFA 1T9DA 1A69A 3L8HA 5FYDA 5I45A 1TRHA 3WA7A 4LOLA 4B83A 4IFTA 3S99A 1Q2UA 2F48A 1X7OA 1EFUA 1SZPA 2WV9A 2Z9BA 5JFGA 4QO7A 2WYVA 3C6ZA 3A4VA 3I9JA 3V3KA 1GMGA 3FYHA 3M3DA 4KVFA 2BEVA 2WLIB 3MG9A 4I46A 3B6IA 3DEZA 3M1IA 3ENQA 4B7EA 1MQSA 4HZUA 3RC7A 4EYQA 1XU4A 5L3DA 1I7FA 1DHTA 1FY2A 1LDNA 2EJTA 2QYTA 4Y6PA 4R1QA 1CDOA 3LF2A 1YR9A 2PH5A 5ALFA 2ICAA 2W42A 1XDSA 3IOCA 1E99A 4IO0A 3RI3A 5CA0F 4D0SA 1BQEA 1DIGA 1CY2A 1B6SA 2EOAA 1U7ZA 3KOXA 2MSLA 2LCQA 2B30A 1XD8A 3EJ6A 1W47A 1CZOA 5E2IA 1WCWA 1LDYA 1KA9H 4OQYA 4PZEA 4BTLA 5AUOB 3LWNA 4HDQB 1HY3A 1L5GB 4DCJA 5L53A 1G17A 1WAMA 5EIEA 5E8RA 2NADA 5BQ3A 3H42B 1VQKV 1KHHA 3KB2A 3S55A 3TM4A 1EVZA 2HIAA 2PCLA 4DJAA 1NRXA 1VQ4F 3SYMA 1C3EA 1O54A 2QX4A 2B0JA 1EM1A 3C1UA 2BMEA 1LSSA 1IJFA 2SKDA 3EVBA 4G37A 2NVWA 3RWBA 3TSZA 3BHPA 3D3WB 2HJDA 2Y66A 3E1GA 2QZJA 2HIGA 3PK0A 2QGFA 2QTCA 1N7JA 1SKVA 1EVLA 5BXYA 4H7HA 2JIDA 4D25A 5A0TA 5CPFA 1VIVA 2YZMA 3BGDA 3RIHA 4FONA 3D43A 2PZLA 2BCEA 2CLFB 1SCNE 4DW1A 4Y2VA 2FSVC 2I6FA 4A27A 3AEIA 2Q3MA 2VTEA 1A76A 1CD5A 1OF1A 2IG8A 4MJ7A 3UHFA 4J3FA 2Q5FA 4B44A 3FAVA 3PIDA 4GLFA 4TMTA 3GLGB 4KDFA 2MR6A 4GZLA 4WASA 4PQFA 4J3NA 1AKQA 3LDTA 2V55B 1RC1A 5A3VA 4ND3A 1DC4A 3O1HB 5DTRA 1E94E 3O47A 1WPXA 1HT0A 3BABA 2W6ZA 1CQIA 3G59A 3VI6A 3IVCA 3PFWO 3ABUA 1DT9A 4WOPA 1ZUIA 4KL8S 5CCDA 2OCXA 3K9FC 1BHO1 3IPLA 2X23A 3OQIA 1H2MA 1LKZA 2DTDA 1S1CA 5JY6A 5CDHA 4AAYA 4F8JA 1K2WA 3UK1A 3KEQA 1L1FA 4UUAA 4RC9A 1Y9JA 3HDYA 4KV7A 4LMBA 1PUXA 1W93A 2VFAA 4KGVA 5ECDA 3PWZA 2VQSA 1ZK1A 5JCOA 3HR0A 4ENQA 4DB4A 3FUVA 1U2EA 2VQFB 1P0CA 1WMAA 2AX4A 1PKEA 1EMDA 2VS1A 3BQ9A 4R5MA 5A2QA 2MMCA 1NQ5A 4FFOA 3VR4D 5DYIA 1SERA 3USES 4C0SA 5HPYB 4ABTA 3VTIC 3TDMA 3AH8A 4FWIB 2F2TA 2FHSA 4H7DA 1I9CA 3LOQA 3GK3A 1EWRA 3QE3A 3QMVA 3OURA 1JKJB 4Y1RA 1Y5IA 3GDFA 2ZWAA 1DQPA 3DLTA 4TTAA 3Q7EA 3ZK8A 4FM0A 1J9ZA 2G70A 2VHTA 2J7PA 3ZDRA 1X15A 3G2JA 3NBZC 4IM7A 3H1TA 4XVRA 3WR5A 1Z6AA 1QYRA 4HKTA 1ZXLA 4QBFA 4CDRA 3J81M 4F97A 3RV4A 1YE8A 1YF3A 4EG3A 1ONBA 1NDHA 1N2ZA 1I6LA 3CCJV 1H9CA 3D00A 2BFBB 2VA9A 4Q20A 2AFHB 2CCKA 3HB4X 3ISJA 5D5PA 4LW8A 3P71T 3FYCA 3H2HA 1R10A 4I08A 5AM3A 1B8NA 1HNXB 5BOSA 1G20B 4LWPA 3CCRV 2Y0BA 2GVIA 5UKDA 4ED9A 1CUAA 3HDTA 4Y2TA 1B6TA 3HCBA 2CT8A 3D3KA 2VXCA 2XNJA 1H8EA 1KEPA 2ZTLA 5EQTA 3R9KA 1W5BA 4EI8A 1MEJA 3GJXC 4JODA 5AKKA 3MJTA 1SQQH 2G82A 3KE9A 2P2DA 3SR0A 3ZIDA 1S4QA 4IGAA 2MIIA 3I58A 1PR3A 4R71A 4FOTA 4XCQA 4C4YA 4JOQA 5DW3A 1FFCA 3VTAA 1AUOA 2HWKA 4BL5A 3E8SA 2CJYA 1VG0B 3OO1A 1Z4LA 1KAOA 2HTFA 3QU2A 1S0VA 1MQ9A 3BMNB 4PPGA 3B3GA 4O2BA 3IESA 1DAEA 1C4KA 4N5IX 4QA9A 4OJNA 4TTQA 2VPXA 4AX4A 5EJ6A 5KSOA 1JHPA 4ZOLA 1M56C 1FNNA 1P0PA 3F8TA 4EK9A 4I55F 2J08A 2ORED 3ITKA 4FFMA 4Y1GA 2CNLA 1YRQA 4BNKA 1JLSA 1USGA 1D4AA 2M7WA 3CU5A 1FFHA 2IC5A 1NULA 2DPLA 3SPIA 1PD1A 2CHGA 1JFRA 2GRAA 2XDAA 4YRFA 1F8FA 1KDTA 3JASA 1I3NA 2Q27A 4UUPA 4DC1A 3GFPA 2NSHA 1V1JA 2BJHA 1YCDA 2WG2A 4Q4HA 3FCYA 4NPCA 2EINB 4QYXA 4B6JA 3EGCA 2QXUA 2VDOB 5H4HA 3IAS6 2X2PA 3DFMA 4O5OA 5TE9A 2ZIGA 4WBXC 5C81A 3SX2A 3VX4A 1PVOA 2GLZA 4OSEA 3AR7A 4ARVA 3H1IH 3DAYA 3F4BA 4I1UA 1QYXA 2J6CA 3LQFA 4OK5A 4PAMA 2XF2A 5JE8A 3M8KA 4MIYA 4ZI2A 5JOQA 1MG0A 4S05A 1UXIA 2AK2A 1GN8A 4AJHA 1RP3B 4FFWA 5P8WA 3WMXA 3DV0A 5JJCA 2OC9A 1H48A 1GITA 3N2ZB 3QBJA 4KE6A 2G3YA 3TZBA 4GR5A 2NWQA 4OFXA 3UT6A 1W96A 2IEZA 3R5SA 4K9LA 4F4LA 4TRMA 5DWQA 4ZYYA 5KNBA 1GNSA 1M2OA 1VL6A 2CMKA 1Q82W 1RQ7A 3SEAA 3FYUC 1E1QA 2IYUA 2JJ2A 3JTEA 1KIFA 3ON1A 1YZKA 4HV4A 1S8OA 1XV5A 4GWGA 1M1UA 3LXUX 3PKJA 4X90A 1QQ5A 2VZ8A 1XL4A 1DTWA 1AUQA 1V45E 2FZKA 1FFGA 4OI2A 3O4FA 1YQ9A 4YYZA 5JS1A 2X9VA 4MKFA 1Z4MA 2WPDG 1H2YA 1RBZA 3RTEA 5LMNB 5T5QA 3W8FA 3BGIA 5KA6A 5AYVA 2DTEA 2JGFA 2IEYA 1DCFA 2L17A 3KZCA 1BE3H 1Z68A 1TUGA 1UJMA 2QY6A 3LYLA 1KQSU 2FRDA 2GD0A 3RABA 4I9QA 5IKMA 5LWQA 1YVPA 1FXKA 4EI7A 4ZT3A 4JZGA 4CTOA 4EHFA 3QWHA 2PZMA 2X1MA 1QNLA 5MDHA 2A67A 3GFVA 2Z83A 4NCHA 4QTXA 3WG7C 4XAQA 5TQJA 1JQDA 4H0CA 5JR3A 4AP6A 1WL8A 1EDDA 2VRWA 2PKQO 5IX8A 1Z2AA 2VPQA 4JUBA 4PX3A 4QGFA 5DNEA 3BKWA 1SD2A 1Y9AA 4HLQB 2ZVJA 3EPKA 4IUBS 2V8OA 3A3PA 3C39A 3H1HH 5FBLB 1YQXA 2LZ0A 3B9PA 3TLYA 5K0GA 4OOEA 3E81A 4KWCA 3TIFA 1QAOA 5B7NA 1THTA 4RFLA 5DB4A 1Z12A 1NXOA 5ERGB 1U0EA 1SC3A 2AC4A 4NBNA 3G71F 2QLFA 4ALJA 3NPMA 1JHZA 1D04A 4FBMA 3FB1A 4URZR 2H7XA 2ZJBA 3ULKA 1RDFA 2QT0A 5DFAA 2ILTA 1TD1A 4MVJM 3JSNA 3ETHA 2AXTZ 5KSWB 3U6BA 3CVJA 2OAGA 4GM1A 3HEMA 1I0ZA 4MR7A 3RROA 1U8FO 4MQEB 1WY5A 1RWNA 1H69A 2GDSA 3W34A 1H2RS 2TRSB 3URMA 1HNXO 1KNJA 4OHPA 2IY8A 5AT1A 1H2NA 4NS1A 5GONB 3W5BA 1IXYA 4WX2B 2ZT8A 1U3LA 4AXXA 1H5QA 2H7VA 3NUQA 1P7YA 3MWYW 3LNCA 1V54B 1JFLA 1DK1A 2R6HA 3JD2A 4KUHA 2BKXA 4S1VA 4E4TA 5K8CA 3U44B 1JIVA 2BP7A 1M74A 3ESRA 3NNNA 1T36B 1U9ZA 3PQ5A 5REQB 4IDHA 3AG1B 2P9ZA 4YCLA 2ECQA 2E76B 4C0KA 5I47A 3DW3X 4FD3A 5HBRA 2J0UA 3BL5A 1IZ9A 2V7QD 2CTWA 3NRCA 3RK4A 3DSQA 1Y7IA 2FWRA 4V3CA 3FVRA 3EFBA 1ORIA 5AJYA 3DHVA 1THZA 3FI9A 4IIEA 3PXEA 3WVNA 5IT9A 1OHHD 1QHYA 1D4ZA 3NFRA 1XWWA 4NCIA 3SC6A 1Q2XA 2X13A 3SM3A 3U49A 3LH5A 3QVKA 1C9YA 4RXUA 4Z0PA 1QLHA 1YR7A 2OMKA 1M1XB 2NZWA 1YIJF 4YRTA 1VFNA 2A1UB 2GO7A 2GK7A 1HR0B 2QQFA 1JTVA 3HWSA 3L84A 3ZCPA 4WZ6A 2RHMA 1T3HA 1XDZA 2CNKA 4EPWA 3SF8A 1A4IA 1EGAA 2X76A 4I5SA 2CXSA 3GUVA 4RFSB 4AICA 1XZPA 5CTJA 5FBKA 1YIAA 2XUAA 2P77A 1ZMBA 4EJSC 2FWNA 2VBIA 4XYLA 2I2XB 3K53A 4NZ9A 1E58A 2H29A 2QN8A 4NFHA 1D2NA 2H2DA 2Q6KA 1UZUA 3PLAC 2EKLA 2FWIA 3OVMA 2G7ZA 4KDEA 4LTNA 4ZV9A 1E5XA 1NUSA 1Z5GA 1QB7A 5IAJA 4ABYA 2Q1YA 1Z5OA 3D8RA 2OV4A 1YNSA 5DEDA 3DV0B 1HL3A 5FA5A 5B4UA 2R8PA 3NI2A 3WIBA 3TD2A 1MHPA 5FQNA 4HGOA 2YTZA 4WK4B 1T13A 2GHQA 3O7WA 5KAMA 2DUMA 2QD3A 1K08A 3PFHA 3VR3A 4YAKA 4JLWA 4JF3A 3K8OE 4ALKA 1PYDA 3OZWA 4Q3CA 3HGMA 2DR0A 3WV4A 2VWGA 2CE7A 3KZXA 1OT5A 4F5YA 3B48A 2BFEB 4MUFA 2J0EA 3ML0A 5BR4A 2WF5A 4TL9A 1IUPA 2RGDA 4URFA 4OG2A 2QR3A 3TPFA 1YZFA 3TW4A 2YW9A 1LVGA 3M7MX 2OCCB 2XUMA 3H83A 4FS3A 3BE8A 5AW0A 1KARA 3TG8A 1UEJA 2W93A 4I4TB 1LU9A 1V95A 3V8RA 4D4KA 2J6HA 4HTFA 2ZSHA 1EHCA 1XMIA 4BVSA 3E83A 1NN0A 3CWBH 1GPLA 2BEJA 3MHHC 5K7SA 1YOBA 3R24A 1EA5A 5JZSA 4H2DA 2IYSA 2OXFA 1OIVA 1TQ6A 4ZYUA 3U3ZA 1W4RA 5F51A 2QF7A 5C34B 5FT9A 2GPWA 4XLZA 3OECA 2Y92A 4RENA 3KKKA 3AF6A 4XQCA 1PBNA 3MVEA 3CD6V 3TLJA 2R7NA 2RI0A 4F6LA 1ECPA 1JLHA 1NBME 2CK3D 2OHJA 2JLSA 4D8TA 4K8ZA 3FSEA 4UB6Z 3DE3X 1E60A 1XELA 1GQYA 2D5BA 3RSGA 5DIFA 4ZI7B 2ZD9A 2XYVA 3MHSC 1O87A 4LV8B 3CJHA 4C7KA 2ZBDA 1XZKA 3E3AA 4P3PA 4CM4A 2W6QA 3MHPA 4G5GA 3DS8A 3N2GA 1YK0A 3H16A 1CRQA 3VGPA 3ZBUA 4YMWA 4MS4B 4U6NA 1KRWA 4FZ5A 3KJZA 5C2JB 4IIGA 3LP6A 4WESA 2EDAA 4CEIB 1GX1A 3NASA 4WINA 1Z2NX 2XBMA 3GEIA 1SUWA 1ZNQO 2CVZA 4FHDA 3IEIA 1E1LA 1K88A 1Z74A 2PDAA 1P9NA 2AV6A 3DFIA 3MUOA 4Q47A 2C5EA 2C3PA 2QVGA 3ONFA 2CVLA 1M7HA 5KYNA 4D9KA 1H93A 4GOMD 1EVKA 4BEJA 3U3MA 5GJWC 5HY1A 3T94A 3L7OA 3R8CA 1P7GA 1YMUA 4NG4A 4B3SO 2X7RB 4ZIBA 4RJKA 4Y2RA 3A4NA 3WYFA 1U7DA 2Q3CA 2YXDA 1AKEA 3FUWA 4YCNA 1TC2A 4Y1FA 3LPNA 5ERXA 1U3TA 2D5AA 3HMKA 2REXB 2RH5A 2X8BA 1CQPA 5B1NA 4XKJA 3TSWA 1B14A 5M7EA 4WOBA 1GPAA 1RAEA 3MEQA 4ZC8A 3VR0A 5ICEA 3BEHA 3A1VA 4U7TB 3LDHA 4PANA 1QRSA 3DNPA 5JG7A 1K4CC 4MWEA 4TQUS 5FRDA 1NJIH 2FWAA 2UXCO 1UZMA 2R25B 1YXBA 3KKLA 4X6LA 5BSWA 3HUTA 3BJRA 3ZR4B 1KU0A 3F0FA 1COWG 3I7TA 2BGIA 3PPYA 1JWBB 4P31A 5KAIZ 4FUQA 4GHWA 4YB8A 5FR2A 3H1PA 1F38A 1EM8A 3LWVC 1UJNA 3CR3C 2ZEJA 4Q0MA 3KFXA 3T9BA 1SBNE 1KU6A 4YP6A 3Q3GE 2I66A 1VQ6F 3A0RB 1IN7A 4CL2A 5BV0A 2WINI 3KUDA 3QKUA 2N75A 3CUYA 4OB7A 3STTA 5G0TA 1F51E 3A1UA 5K3BA 1U2DC 1LFAA 2JS5A 4CRWB 3L4KA 1FJ2A 2J0VA 2RGWA 3MC1A 5IHPA 2MR5A 3GJRA 5C1OA 4CEHB 1PWHA 2EW1A 2AYZA 2Z2YA 2ZQZA 4UZFA 4WA8A 5E8JA 2RN9A 1WMBA 3U5TA 3RTBA 4EAQA 3JATA 1TGVA 3OX1A 1M1NB 3ZJUA 1T5TA 2EULA 4C8EA 1LBQA 2EV9A 3ENZA 3VR1A 1EZVH 2YJ6A 4QUIA 3TTYA 3A3NA 4KRYA 3AETA 5U4QA 1EBUA 2QUZA 3GFFA 5KWJA 5ED4A 3F0EA 2XTJA 5HRAA 5GJCA 1FFXA 3QBVA 2L26A 3K32A 1XMXA 2QEQA 4LA4A 2RI6A 1V7QA 5EZ6B 1DX4A 3WWPA 3WGVA 4DR5O 4FB5A 2EJVA 2A57A 3BJEA 3GWGA 4CKZA 3EIHA 3X43A 2F43A 3KJIA 2BKVA 4I5FA 1NDQA 4D8VA 5JYDA 1T3SA 3UMMA 4WFFA 3KPWA 5CBKA 3PQ7A 2I4MA 1A5BB 4HGZA 2G36A 4KAFA 3KJNA 4F3TA 2VWKA 2FJ0A 1ZL8A 1EX7A 3HADA 2O5CA 3MTBA 3BXOA 4HFNA 1MEEA 1LBEA 2ZUBA 5JBNA 3E8HA 2HJWA 1WVMA 2GOYA 1YL7A 3KHSA 3QYFA 4A0SA 2BEVB 4INAA 5T41A 2XUZA 1VFPA 1RHUA 3DZGA 3QFHA 2Z5UA 3QF4B 4M9ZA 4GLXA 2LIVA 5HQTA 4ESHA 1CUHA 2YQ5A 1Z4QA 2O8EA 5J40A 3OTOO 1CY4A 1VE9A 3HP4A 1UFYA 3CC2F 3BFJA 3WOVA 3ZKWA 1K8ZB 4AJOA 1XVVA 4UD2A 2VDQB 2GN9A 3CRZA 1WLEA 3KR1A 2NMVA 3DKKA 1F7UA 2XUDA 2XR1A 2YN2A 1D5CA 4X8AA 2EFJA 4MVJH 3ZMUA 1HDIA 1ZN7A 3RVZA 2H2WA 3L6DA 4KU4A 4NXMO 3B70A 1Z5PA 1AKRA 1FDUA 2QRZA 3M49A 4G8CA 2UYYA 1D1PA 2OKGA 5C8XA 4BKOA 4OLBA 1UBMS 2HMYB 1M6HA 3IIKA 5E9WA 2LE0A 1QP8A 1Z6TA 2WTXA 2XUHA 2F3QA 1DXHA 1XAGA 2NUPA 1VL0A 1NW4A 2DQ3A 3VBBA 2OTCA 2VSOA 5DVZA 2EFDB 4A8TA 4J43A 1PK7A 1T9CA 1YZUA 4N3NA 1DFIA 3PEEA 3EG9B 1Y6QA 1SA0B 3L9DA 1T6BY 1V8OA 2PKCA 2QRVA 3UMCA 3VYWA 2P3LA 2FYTA 1QVGU 1VQMF 4ER5A 3AG1C 4LE0A 3FCXA 1E9FA 1ODTC 2BFOA 4JIMA 4MWCA 5J58A 5JSUA 1HT2E 3D2AA 1MO6A 2CF5A 3I92A 3IP3A 4MV4A 3DDCA 2C99A 3AM1A 1D9ZA 1XTIA 1ST2A 3A06A 3HCAA 1GRCA 1UL1X 4HB4A 4XH9B 3UB4A 1FJGB 1JFSA 3RVNA 5B66Z 3GLUA 4DIKA 3B5IA 2DKOA 2P4KA 3SYCA 2ZUDA 2JZNA 2PHZA 1BE8A 3N7UA 3NDPA 4RNCA 1Z3CA 5AMXA 3TPZA 2JK0A 4KTVE 3VPBA 3E6AA 3FKQA 5GVSA 3N74A 2KLHA 1PT5A 1Z88A 3T7IA 2YJ4A 4WK2B 3EFHA 3P30A 1K75A 2VJCA 3R3SA 1EK5A 4LZNA 2CVQA 1ULZA 3LUBA 2CZGA 5JC1A 4Y6GB 4EFEA 1P19A 4Q3LA 2QROA 1ZD2P 3BAAA 2V6MA 2IEDA 1UK6A 3S06A 2B69A 2GARA 3QITA 4RW0A 1T5DX 3F4KA 3EMVA 5JTTA 1C30A 4EW2A 4G0VA 4DV4O 1HYGA 2OO5C 1Y76B 3JQFC 1Q21A 2I99A 2MSEB 3NM6B 3DPSA 1AF4A 2OO7A 4LFAB 2CYCA 2ZRDA 1OLXA 4Y0AA 5CA3A 1SZXA 1DRJA 2YBDA 3NW9A 1XNJA 1I0HA 3S5JA 4U00A 3D36A 1SXJC 3IIEA 1QOQB 1G5QA 3DG9A 4MKZA 2V54A 3ZIAA 1CUCA 1DXYA 1YHZA 3KTAA 2C82A 1HETA 3SJBA 1G3IA 2B2NA 5BT9A 4DBZA 2QRNA 2HA5A 1F3LA 1UPTA 5LOVB 2ERXA 3T1QA 1GKKA 5I01A 3AG3C 5HF9A 3ZZMA 3MMZA 3V2UA 4Y2XA 1KYVA 2JH3A 5A03A 5BP7A 1JE0A 5JATA 3HI4A 1EFAA 3BIOA 4M36A 5CW1A 1AZLA 1SUEA 3HKBA 1E8DA 5LXTF 5L3VA 1J8VA 4C87A 5K8VA 2DBVO 2FW8A 2JLRA 1CY1A 3LLVA 2AMYA 5FUBA 5KOHB 3EPRA 5JXWA 2DECA 3ASZA 1D0VA 5DU2A 3X3HA 3MT8A 3OKAA 3QJGA 2HJFC 4WLEA 1L4MA 1V1MA 1RMQA 2RI1A 3SHTA 1BMFD 1EDBA 1VCIA 3WWOA 4EGFA 3W2IA 1NIPA 2OFWA 1X7WA 4UZEA 1XMSA 3TNJA 4RHUA 4F45A 4KL1A 1H2ZA 2HU7A 2NZUG 2ZXFA 1YI2V 2O19A 2E5FA 4BFUA 4FFPA 4LZJA 4PO9A 2VZEA 1V9SA 4LHZA 3H6GA 4JNKA 1UDAA 2FC3A 3P9CA 4RHCA 5B1OA 3EFOA 2YNMC 2JGEA 3IMFA 4RBNA 4WL0A 3C9SA 4F5EA 1REQA 2RGRA 3PQ4A 5DHTA 3S2SA 4P3KA 5EIHA 3RS8A 1OROA 1KAMA 1NVVR 1RHRA 1YDGA 5CPBA 1KZGB 4A3SA 4HZGA 4B3JA 2VC2B 4X1YA 3N4YA 2GCOA 4RK5A 3V48A 4AG5A 5F33A 4F1KA 3ELBA 4RAOA 3MD9A 2XA2A 3QEMB 4XARA 5BUZA 3I56V 1ZMXA 1ZGBA 3KPUA 4LECA 2JFGA 2I2AA 3HYRA 4W8OA 2KTVA 2ZDIA 1GUZA 1I51A 3EVEA 4FZ3A 3KTAB 4PZ0A 2OCHA 2R8BA 4F86A 2BZ1A 1ZJYA 3F3SA 4FHFA 4J7AA 2RD2A 1V41E 1FTNA 1CQXA 4NBKA 3VTKA 4ZGBA 5IBCA 5JU6A 5TV2A 1XZLA 3JQ8A 2ZM6O 2PSEA 3ZS8A 3LDUA 3A0HZ 1U6KA 4HDMB 2Z6UA 3QPDA 3KZVA 2G40A 5AVOA 2JFYA 4J29A 4YT8A 3UG7A 1ODIA 4HWRA 3RYHB 1HQCA 1XTQA 1ZC3A 3GHYA 1Q5OA 2J59A 3MN1A 4IV5A 4NKRA 4XOUA 4C1BA 1A2BA 5FL7G 1DO0A 3ZDCA 2ZM5A 2IXBA 1XQXA 3CNNA 1RHQA 4ZMRA 4G4GA 3EF0A 4BLWA 3MGCA 5D8DA 1TMKA 4HMPA 3LZCA 3JQGA 4IOLA 2IV2X 1YDFA 1TJ4A 2RKBA 3REGA 1NPDA 2PXXA 1I4TD 3CLUD 3BPZA 4WZBB 5DLQC 3K0BA 2A0UA 1A9TA 2Q0OC 1U02A 1E20A 4M0FA 1F4NA 3OOEA 4RCYA 2ECOA 4FXPA 2ZBQA 1MB4A 4HAUA 1JG1A 1R6XA 3GBVA 4MHSA 2R1ZA 1U4OA 3IAYA 3IDQA 4IL5A 1BHJA 3AK1A 1J8YF 1XWIA 2C5BA 5EJ5A 3EVCA 3IE1A 2V9CA 3O2NA 1ZNYA 2FFRA 3TFWA 3F3YA 2BE7A 5IHXA 4L6IA 4DABA 3WLIA 1X4TA 2YZNA 4FCCA 2RGUA 4IX1A 1O97C 2IYRA 4EFDA 2PD4A 1VECA 4M21A 4D45A 4DA7A 1U3VA 4UE6A 3FG9A 2B4RO 3H2SA 2AZXA 4UJ3A 1BFUA 1AS3A 2P5TB 3O3MB 3PR2B 4XJTA 1MX3A 4BC0A 1G7TA 5G40A 3QMPA 4P5DA 2A7QA 3VO8A 3TDNA 1OBFO 4DMMA 4P7FA 3HPLC 1U2ZA 2ZWPA 2JJ1A 4JC0A 3FYUA 4P2ZA 1OAAA 5JZVA 3AHHA 2VUTA 4BVRA 1BVUA 1FRNA 1P31A 4GW3A 2PLNA 4NOKA 3VQYA 4LXGA 2Y1LA 1JDJA 3IQFA 2Z6AA 4B7ZA 5TXGA 1VYUA 3M5CA 2GT1A 2IUUA 4LI3X 3SJ7A 4JP5A 1ID8A 3U1TA 4WLUA 2AT1A 3G89A 4OMFG 3EPJA 1UM8A 1CKEA 4PZLA 1I94B 3A8TA 4AB1A 8ADHA 5HZKA 1NXXA 2WJZB 4FZRA 5LCXA 1JBEA 4ERXA 5LGNA 2AUMA 3KIPA 2C2ZA 2O14A 1KY5A 3WNCA 3ZTWA 2AHYA 4RS3A 4AD8A 1WJGA 2HMVA 1QV6A 4PNHA 3L7LA 3ON5A 2IVFA 1CSEE 2RHBA 2ZYIA 1ZVKA 5DHPA 5DBGA 3M5DA 1E92A 2H85A 1DJNA 1ZBQA 3IJRA 4GQIA 3VYVA 1S77D 1ZBDA 3ZUPA 1PJTA 4UARA 1HFKA 1TEZA 1IY2A 3D4OA 1JDNA 4AM8A 2YNMD 4HDMA 5BV7A 1PZGA 4X1IB 3KWMA 4DQUA 3GRUA 3DAOA 4OU5A 3UAYA 3E86A 3OZFA 3PXXA 4JFRA 2YY7A 3DA8A 4V3BA 4BX8A 3MTDA 1FFXB 4ZIRA 1ULSA 3DLBA 4O4HA 2C61A 2IFTA 2BLNA 2GPTA 3CLKA 3R2JA 4G97A 3VZBA 4Z3OA 3O90A 2QAGC 1PSZA 1ZD8A 3ESYA 4Y98A 3M84A 2UYKA 1DFHA 1W87A 3ORQA 3J7AC 4LZZA 1E9DA 1U7XA 1T2FA 3P9YA 3TZKA 4CE6A 3ZWCA 4P6VF 2P5OA 1NXVA 3EXEB 3E22A 3X1XA 1YI8A 3HO1A 3LC2O 4I0XB 3NHYA 2ZJ4A 2DUJA 5E3HA 5U1PA 3NHLA 1XVAA 1NX6A 1M54A 1CS0A 4KGXA 4DT1A 5CBPB 1ZJWA 4CF7A 3CC2V 1F20A 4PQRA 3EXIA 4TVBA 4QM7A 2WTNA 3ET4A 4QE3A 2Z6QA 5I9MA 2C5GA 3AB7A 1GRNA 5JAIA 1TRKA 2DX7A 7ADHA 3AGQA 4XJSA 1ZR2A 1NJGA 1C9EA 5M5BA 3AM3A 2YVQA 5IYZB 1KMNA 3HB9A 4QPDA 5TRTA 4MJLA 1DBRA 3ITEA 2ZR3A 1C3VA 4RUKA 2MSKA 5BN5B 3NOXA 2LPMA 4AJPA 3GLFB 3QG5A 1OFUA 4URHA 1HE4A 5JXGA 2BCJQ 4KOAA 1QFXA 1W57A 3JAMM 2CTQA 1QIJA 1W8DA 1I08A 4ESEA 2APJA 2ENWA 4DR3O 1TW3A 2PL1A 4V2IA 1ZQ9A 2HCJB 2OXRA 3BIXA 3OE7D 4QFBA 3VHXB 3JWPA 2C5LA 1RIIA 2OGTA 2Y68A 3K9CA 3ZV4A 1TYBE 4E11A 3HNOA 1NM5A 3CCMF 4EAAA 1LQ2A 3HDQA 1IC6A 1IBRA 5C3UA 3GQBA 1YJBA 1SOVA 2I2CA 2AW5A 4KE7A 4GG1A 1CUJA 1XQ1A 5B1EA 3F97A 2REOA 5I51A 1PYOA 3AY3A 3IUEA 4HMQA 4HQ6A 4KB5A 5DHFA 3T0GA 4RTMA 3RT1A 4DN6A 2WTAA 3R6GA 2LUOA 2BI8A 3HCWA 3AKYA 3KKPA 4GDMA 4GZ6A 1E6MA 1L4KA 3CHYA 4YJGA 3SDBA 5K5EA 5BV2P 1AC5A 2WJWA 2ZUFA 2I78A 1LVUA 2Z1DA 3N28A 2O1SA 2QRHA 4D0RA 4D9NA 3GLIA 2JGDA 2N0SA 1JA1A 1DIOB 3MAAC 2ZBFA 1PD3A 1XBIA 1XZFA 4EHDA 3B51X 4BO0A 1NLYA 2WSBA 5BNWA 4RELA 2FHPA 3WHIA 4NDAA 4AP5A 3B40A 4G5OA 4IUYA 3EA4A 5LC1A 2X7XA 2E0IA 2RCNA 3QLJA 3JY6A 4UU0A 3WLQA 4CM8B 1JS1X 1FQKA 4ZQGA 4WZAB 4AJLA 1NJ1A 2BTQA 4F1JA 5E6UA 4OBBA 1RM0A 3OLCX 3ZGZA 1J6UA 4JLOA 5KKCA 3T5PA 5JZBA 5I5GA 2G38A 2C96A 3GO4A 3PGLA 2QN6A 2C2BA 2ZNIA 1TA0A 2WJ4A 1FU7A 3LP5A 2RBEA 1ZD5A 1G5TA 1NSYA 4QOHA 3ZHVA 2A86A 1V6SA 3D0RA 1KEEA 3IBCA 3OE5A 3PVSA 3TAUA 1DAIA 5CFOA 2UXDB 4Q1VA 2EX4A 4X5OA 2C4VA 2D1YA 2JLVA 1N7IA 3IUSA 3UA4A 5KHKA 1BXGA 1COWD 3ICPA 1ILWA 3OJ0A 4GWLA 3M9LA 3K0CA 5DI3A 3MUFA 4ZVTA 1KF0A 4F93B 3N53A 3NWOA 4G1MB 3UAOA 4LQLA 2VNSA 4NBSA 1BCRA 2J30A 1QYWA 3PN1A 1ZHHA 2ENUA 3K72B 3C5WP 2WJYA 5CVCA 4AJKA 1LPAB 4W9MC 4PX5A 1E4VA 3H4TA 4NB5A 2VRCD 1QCEA 3HN6A 3ZE9A 2E18A 2ZT9B 2D0IA 3OJOA 3LX5A 2WTBA 1DAGA 4ZVQA 1YMQA 3JS5A 4WZBE 5E1MA 4CIXA 1XMJA 4KNWA 3UMRA 3R7DA 3H1AA 1JJVA 1KSHA 4DYVA 1XMOB 4J1TA 4EA6A 2FPWA 2JEYA 1GFZA 1T8RA 3KAJA 2PZKA 4HATA 5FOTA 2FOLA 1SOWA 4PAOA 1QVZA 4G0MA 4FZ1A 3GT3A 1DG3A 3E8BA 3ZD8A 4AL4A 2P6RA 3HA2A 2GZSA 4TT3A 4UQPA 2CVOA 2VA8A 3D7RA 4EL5A 1YTUA 2H9YA 3FSRA 5AI5A 3TTXA 1XNRO 1YT5A 4MB2A 4HS9A 1EXDA 1KJJA 3T34A 1IK4A 5LYYA 3PC6A 2QS9A 2C58A 2X1VA 2BR5A 3K5WA 4TWIA 5ALHA 1E0DA 4RDXA 1LBSA 1MB2A 2WUGA 5DO9A 5L4LA 1GNPA 1OCRB 1CUVA 1DBIA 2XMRA 3RK1A 2HP3A 2A7WA 3AF0A 3AERA 1C9JA 1KP3A 1AKVA 1NQOA 1W1IA 1PX2A 3VVMA 1UFVA 2ZR2A 4NYJR 3HA5A 2AL7A 2OZBA 3BAFA 3SR2C 1R0YA 2JKYA 4X1KA 1U6IA 3DYIA 3CLHA 3G8BA 1MBZA 3AZPA 3ANNA 4D92A 1UBOS 5IXJA 2IDZA 4HJRA 3CCLF 4Z5XA 4P4SB 1IWBB 4RVGA 5ALIA 5L7TA 3U31A 3IH5A 3FXAA 3PQ3A 4MQUA 3BZWA 4P36A 5K8TA 4RJIA 1QVWA 3F90A 3RIMA 3LZDA 3HWRA 1NTZH 2V4MA 1VSTA 3QP9A 2MWMA 3DE5X 1PV0A 3BTOA 1UXKA 3A9CA 4FFLA 4GEGA 2P9FA 3HU1A 5AOCA 1WLSA 3UJ7A 4BNLA 2D2FA 1MB0A 4XTCS 1IQRA 3ZYCA 1OX6A 2P2GA 4J4BA 3QE0A 3QFSA 1NQTA 2YXHA 2GM5A 2Q7OE 5G0WA 3RVPA 5EMMA 1JR2A 4RWEA 2YIMA 2QU8A 3KBBA 2JVIA 4MEAA 1ZTEA 3ZRWB 4AVYA 2IGTA 5CJPA 1KO4A 5AVZA 1WMFA 2H0AA 4CMJA 3NEYA 5LZ2A 1EK6A 2H7CA 4EKWA 1T5HX 1PHRA 3U3RA 5LHIA 1RKBA 2CMFA 4LBEC 1T5OA 3MF4A 3ZE7A 5AIBA 5KREA 1CQWA 2XI4A 4DMGA 3QEKA 2ZVZA 1CHNA 3MUEA 3NYRA 2X8JB 4FK5C 2FH5B 3B9BA 5KX5B 1S5JA 1KMQA 1SC4A 4U9HS 3PVCA 3WGZA 2EZOA 5D1NA 4YCJA 2J67A 4GSLA 4CEHA 1GRRA 3CEAA 4B80A 1F6BA 2YWJA 4I55B 4JYBA 3LT2A 5L3QA 1UOQA 5EESA 4I8XA 1NVGA 2PJUA 4QPZA 2IHKA 5HXZA 2QLTA 3BFXA 3N70A 1UWLA 4F4FA 3H13A 5D85A 1VKHA 1XJQA 4JP1A 2VRCA 4D3XA 5LA6A 1NW6A 2EWMA 3CNOA 4FVTA 4R01A 4A5SA 3GGCA 3KKOA 4FCWA 4NNJA 3RFVA 2WJAA 4XRRA 4YK7A 4BW0B 3U9TA 1PD0A 5M3BA 1R7RA 2Z2JA 4HPWA 4LCKA 4HFJA 5EWLA 1N33O 3G9TA 2L6LA 2O3JA 3W5JA 5BURA 1IXKA 1QK3A 1ZKDA 2QLJA 1NF3A 1E59A 3IB6A 3OFNG 1ZI8A 4TQ9A 1E3WB 2LRHA 2H57A 4KFTA 2Q9BA 5LDGA 1F8YA 2NZYA 3G5AA 1MORA 1H4TA 1SCJA 3N07A 4GUDA 4KLZA 3P0IA 4ZCRA 2UXCB 3BEOA 2R66A 4B08A 1BW9A 3TLXA 4ZN6A 5C3MA 5HQ3B 2R8OA 2CDNA 3OJWA 3T15A 1E32A 2QL7A 2EEZA 1QBKC 1GM9A 3ZXXA 4DDHA 2QRVB 1N6IA 3V1MA 1NMXA 3THXB 4CV3A 1TKCA 2C77A 3VX3A 1H1LB 4EARA 2G1AA 2P62A 4OPMA 3F6BX 4AS1A 3RA5A 3RVQA 2ZUCA 2ZM6B 3W8DA 3RSQA 2I03A 4CQMB 2XOKG 4MDEA 3OQPA 3TQTA 3L7QA 5IRCD 4O2AF 2D7CA 1UKEA 3BXEA 5TY0A 3VH4A 3EAFA 3ER6A 2ZI5A 3E70C 3AP3A 5CEFA 1YQUA 5FAKA 2EW2A 4U8GA 4WLNA 4NECA 5KNCA 1HSOA 4F7DA 1QQAA 2O0KA 4FFDA 2GN1A 2WKQA 3SS9X 4RTQA 3K4HA 4LJ4A 5J23A 3AIKA 3FPLA 3H9BA 3IP9A 1HORA 1F4VA 4DMFA 5BVHA 3WTCA 1E1CB 2VWHA 3VXKA 2ZAYA 3Q72A 4DDMA 5KS2A 2NAPA 2QM7A 4Z99A 4RHTA 2UYCA 2BHRA 3GELA 3OI7A 3UFXB 3WNDA 4EYKA 1CLUA 4MKGA 2F1KA 2OENG 1DXQA 1OMOA 1UXJA 3EHDA 3QENA 2E87A 2ZPTX 1DZIA 1ECFA 2BGMA 3JQBA 2HL6A 3LUKA 4GPEA 4TKUB 3V4OA 3UWMA 1PQPA 4RADA 4BB6A 1RWPA 3JD0A 1QVFU 4NYIR 3PQ8A 4R7CA 4HF7A 4R9NA 5B1YA 4CL0A 1G8HA 3VV3A 5TMDA 3D4NA 4GICA 3EYWA 4RY2A 1PXWA 3MTQA 2BEWB 4EG4A 1DTEA 4UNIA 2VKTA 5TS2A 3SIXA 4I9WA 3FMPB 1N2EA 3IB3A 3VQXA 1GKLA 2HA2A 3LF1A 4HXEB 4W1PA 1I36A 2OT3B 3TECE 2P2CA 4G2KA 3R0QA 2IYZA 2LJ2A 1QD9A 2LKCA 5HIMA 1LUWA 1VH8A 3JQ8B 1OQAA 1MB3A 5FPHA 5LR6A 1SHTX 2CLEB 2DM6A 5AO9A 3U7QB 4EMTA 3KQTA 4L4ZA 3LQQA 8LDHA 2YMPA 4MS1B 1MAWA 3H9GA 3ZE1B 2Q5QA 4EGJA 5A7HA 2DERA 1CN7A 2NV0A 4QUKA 4EHLA 1C29B 3ZJVA 4C8IA 3GUCA 1N77A 1B42A 1M1NA 3W3AH 1KFBB 4UTNA 3I6BA 1ZEJA 3H2JA 5K0CA 1FAFA 3E1SA 4L6CA 5GGYA 2I6SA 1KL7A 4IIYA 2ADQB 4X41A 2W58A 4O4LB 1DS6A 1TIBA 2BBWA 3ZVMA 1J2JA 1GNLA 4F3KA 5FUQA 3S1SA 4DUZB 4CU2A 3PHGA 4W1SA 3T3GA 3ZP4A 4MUYA 1AOXA 2PFSA 3DEYX 2ZB8A 1UK8A 3QVTA 1YCHA 4RHFA 3WXMA 2OFXA 2QV7A 3TKYA 4Z1MD 4ZKDA 3KQUA 1QCDA 3A0RA 2NU8B 5AJWA 3E4DA 1YB7A 1Z6PA 2QW0X 3PX3A 1CEEA 4II2A 2R1UA 1YQGA 2PBFA 1H1LA 4WD3A 2C54A 1GZHB 4HDRB 3FDJA 2Q5HA 4OTZA 5JCPA 3NHRA 3N8NA 4GZ3A 3CZQA 4F4CA 1UFIA 2C1XA 5IAEA 3UJAA 2V1DA 1LV8A 1MIOB 3OP4A 3OQOA 3WGMA 4AT1A 1T4BA 4EF4A 2ZDQA 4ZGGA 4CM1A 1QDUA 2AWOA 2Q29A 3NTLA 2O2JA 2Y9MB 3L7KA 2JJQA 1BWPA 4XYMA 1DWUA 3TMYA 5CH3A 3UJNA 3CRMA 3PYMA 2B9ZA 3IJEB 3TMKA 4UHEA 1GZ4A 5BUCA 3H7AA 5EWMA 5CDFE 1GSAA 1NOIA 1GR1A 1EBFA 3FUXA 3RU2A 1C7EA 3DF7A 3SNHA 1OE0A 1DG9A 3UJ9A 2A33A 4KQFA 2HLDD 2BMAA 3LHIA 2VRZA 3NDRA 4MULA 4XQ9A 4ZYXA 1WXXA 5TQ2A 4RTRA 2CL7X 2XKBA 4EKDA 4RUEA 2P27A 2PX2A 2JDIG 3CMEV 2A3QA 2VP6A 4D0LB 1YHNA 3C74A 3LQYA 4UBNA 4CTJA 5KTYA 4IH9A 1CK4A 1N2HA 4G5YA 2ODQA 2HA7A 5I9LA 3W7SA 4A6DA 1CCWA 3L18A 1MZVA 3ZCUA 1UT5A 5CAEB 1RYMA 1I7DA 4JUFA 5C1BA 2DPYA 3M7IA 2XECA 2X42A 4EB3A 4BIZA 3FAVB 1IBMO 4M9CA 3K5NA 4ZMBA 1GLVA 1I2MA 3HEAA 1WPRA 1CY6A 1USVA 4H7KA 4JYCA 2YWEA 1I3OA 3TBKA 2OTMA 1W4LA 3LXXA 1UAGA 5F35A 3WLRA 4AUMA 4HG2A 4RMGA 2FWPA 5T7BA 2W9XA 3CKMA 4Q6WA 2H17A 1K89A 5EBMC 2GYVA 4FNOA 2AVDA 4TZZA 2ASVA 1K5HA 2FKAA 2FPPB 3V42A 4EYGA 5C18A 5GIPE 1QRUA 2O1XA 2W0FC 3VDMA 3IR5A 1B1AA 1JHRA 4J3JA 1KI9A 1KSFX 2IZ6A 4IVPA 2YCLA 1F2UB 3KSAC 4DV6B 4L7QA 3LMEA 1FZQA 1C3XA 2CLKB 2WM8A 4K6MA 2VYFA 3VZQA 3ZHOA 3B3JA 1GYRA 7REQA 5C80A 4GC5A 3C9TA 1R6UA 1FP6A 3MCZA 3FOBA 6NULA 3JAMN 2GF9A 2BE3A 3OU7A 3EXFB 4PCUA 2WJJA 1V25A 3IRUA 4EQ6B 3MOIA 4B47A 4X84A 3AOGA 4Z1MA 3TTVA 2ZT7A 4F5WA 4KXRA 3SYQA 3G0DA 3WB2A 1MV5A 4UNQA 5F73A 1SA0A 2DFPA 4KR3A 3T1HB 3B6JA 5LJIA 1HNNA 1AVTA 1C2YA 3O95A 4U2DA 3RF7A 5F3WB 3R7WA 4JAVA 1W49A 1EP9A 2VP2A 5CHEA 1MLDA 4C1NA 1JQEA 5KAFZ 4YACA 4W7HA 3ZE0B 3I62A 2J31A 1P3DA 1ZICA 2A9JA 1R6KA 3QLVC 1RU3A 2R87A 2BGLA 2QUHA 1MX1A 2R6FA 2X3FA 2XCOA 2Y0DA 2ZRBA 3N2EA 4PNPA 4RA6A 5B6JA 3ADCA 3IKFA 1TAQA 2O2HA 2C7QA 4KAXA 1P29A 1SQXH 3KP1A 3UTDA 4EGSA 1EUDA 2C7VA 2HQRA 1NXSA 3ND9A 4OFWA 5HKKA 4WDQA 1JKXA 2J5RA 1V11B 1WU7A 2CFOA 3KQPA 1NVTA 1B43A 3EZ7A 2J5XA 3LYBA 1PNVA 2QV0A 2H4JA 1GU1A 1SZDA 3KAPA 3MRVA 3AVTA 1GYQA 3VYTB 1DBPA 4X71A 4DQ0A 3IT3A 1Q83A 4ALMA 5IH7A 3NMUF 2AOXA 1LSOA 2C2GA 4NJMA 1WJZA 3LT0A 4PG4A 5EN4A 5JAHA 1G6KA 2ZK7A 4A6XA 2C83A 3WYAA 4EFKA 2C4KA 1OWNA 2OQ2A 3D7KA 2BC9A 4DJEC 3C8LA 3CSXA 1ARZA 1WB4A 1U1CA 4MV1A 3PPVA 2C9ZA 4OUKX 4QQ8A 4ZAWA 3TRKA 3WO0A 5KC9A 4UTVA 1R3UA 5J4LA 1Z9BA 4BFCA 4BQRA 3UJ3X 2P6YA 1E98A 1PJZA 1NQ3A 2VOEA 1J0BA 3CEJA 4GGMX 2FI1A 2O5VA 5EWRA 1TIKA 2JGUA 2WJ3A 1XRPA 3OTHA 4L8FA 4PHGA 3VH3A 2WTEA 1XZGA 3W3AA 2JNWA 2QW1A 5U4XA 5KPDA 2O8CB 3QLVA 5JEEA 3T4PA 3TBFA 3MJRA 4N3AA 2Q4TA 1NTMH 1GGFA 3O0DA 2QX7A 4K6HA 4MGKR 1PKXA 1WUJS 1VL1A 3HCDA 1M5IA 4Q4DA 4EUKA 5REQA 2ES4A 4DOMA 1TMOA 3DLCA 3AJAA 5M2QA 1U40A 2F93B 1C7QA 1QG6A 1PRYA 4YIPA 3HABA 3NRBA 5CT9A 2CMDA 4Y0VA 1GLNA 3VJMA 1MA3A 3W7AA 1N2IA 3VR4H 5IZCA 4G0ZA 4CLDA 4F06A 4Z4CA 5KHOC 1JMYA 1D8TA 1Y5NA 1YZBA 3MQ4A 4G0OA 5FPPA 5HM6A 1SAYA 2IQ5A 1V26A 2UZAA 1Y6JA 3JZDA 4D4MA 4ES6A 4DL9A 4HYTA 4EQZA 2W2LA 1R3LC 4YP1A 2GJ8A 4MR7B 4L16A 1NSFA 3WWCA 4KRXA 5JS2A 5F23A 2AQHA 1QYIA 4DB2A 4MINA 3WJ7A 1JIKA 1SJ9A 2HX0A 1IHXA 1DBVO 1JJAA 3NALA 2PGJA 4MW9A 1D7AA 4CM9D 1CEQA 5IXYA 1E5VA 1OXMA 5CLLA 4OK3A 4Q9HA 3R7BA 3IYLW 5LVAA 4D96A 1ZH4A 2O06A 1DAMA 2PWZA 5EXPA 5EXSA 5AW1A 2ZSDA 4AZ0B 4ZO7A 3HYSA 4BDTA 3IV6A 1SBZA 1QG2A 5T3YA 3H2GA 4FGJA 4BO6A 1OOEA 3CPJB 3PHBE 3QTLA 1L4YA 1J1ZA 3MJCA 3I5MA 4OKIA 1YGPA 1XTPA 3PNQA 1W2GA 1IIBA 2MDTA 3O1IC 4C2BA 3PFKA 4B62A 4IDDA 4X66O 1LPMA 1NBMG 2C57A 1E3IA 5F76A 5IM5A 4DLYA 3ZXSA 2OHWA 3FRJA 3AGPA 2Q7EA 4JI7B 3NBXX 5A04A 2W6MA 5IYZA 2AIZP 1LPOA 3WX0A 2BVNA 3D1JA 3DZHA 1AJQA 2JH9A 3OLQA 4C7MA 1Z0AA 4D7AA 1KDPA 4NMLA 4XD7A 5D3KA 5HJ7A 1JXOA 2HCRA 3IOYA 1VIDA 1UWKA 2CBXA 3GCZA 3KU4A 2ZNJA 1P9LA 1SG0A 4B9AA 2Q9LA 2V7QA 4WY8A 4C22A 2FETA 2JFHA 2G06A 1Y6XA 1W2WB 2E4XA 1NTRA 2NAFA 2PIDA 1EFLA 2W48A 3SIWA 2OD9A 5BY2A 1MHTA 3K70C 1AY0A 1DEAA 4PDRA 3SE7A 4JCOA 4K0KB 3P94A 4JSYA 4K87A 3LK7A 4MQFA 1RLTA 5HMLA 3WQHA 5KNDA 2PMKA 3G4SF 1N5IA 4S0ZA 4FYWA 3SU8A 1H0HA 2O5EA 2AOUB 4JH0A 4AKEA 4MTLA 4K3UA 4LNUB 4FDUA 3WAJA 1ZVVA 2HK7A 1KSJA 4D8YA 1SPBS 3GH1A 1RQGA 1QIMA 3JQEA 1EB9A 4HB3A 4NWIA 2N46A 2QDOA 5HFAA 2RB5A 3OY2A 4ESVA 3ZVNA 2HGZA 3VC7A 3SQMA 2P7TC 1O5OA 2R84A 4OA5A 1NE2A 4X1YB 3WYBA 1Y3FE 1V7PC 5JMTA 1I6MA 2UZ4A 3SZLA 4D6PA 4EW3A 1XEWX 4KZKA 4N48A 3W4JA 4MW0A 2ZJFA 1IBLO 1NBWB 2RONA 3CH4B 4XVUA 4Z2AA 1OX4A 4KWHA 2IHUA 1XTKA 4R8KA 3Q2IA 1F0NA 1RM1C 3KFLA 3PEVA 4M7RA 4S1OA 1EZ4A 1ZWLA 3C6QA 2E2WA 2EP8A 2A9HA 3BD9A 3ITDA 3HVUA 4M0DA 4RZXA 1B04A 3GTZA 3V00A 2ZB4A 5K4AA 5TJHA 4L0DA 1AO0A 3PJDA 3JD1A 1QFYA 1RJDA 2XRYA 3KTDA 5IS2A 3RHZA 3ZZUA 2YIDA 1MPXA 5EA2A 4BV2A 1L7MA 3CJTA 4J0GA 1FFBA 1AV6A 1ZVQA 3AJDA 3ZO8A 3BUSA 3RUCA 1PX0A 3VYRB 5BSHA 5TT1A 3HJWC 1VHQA 2DQZA 4BB9A 4K6CA 3UO3A 4BBJA 2XD9A 4UV9A 1N9GB 1Q44A 2H9AA 2EILB 5JWHA 1QK4A 5EQDA 3TAHA 4JI4O 1RXCA 4P0QB 1KOGA 3KM0A 1EQ2A 1Y7HA 4K0RA 2QJ1A 2Z3ZA 1SVOA 3ONVA 3ICQB 5DCLA 4Q15A 4AIIA 3AWDA 4Y9UA 4OLAA 2X4GA 3QWIA 1WXFA 1NFFA 2EDCA 4MUBA 3IBSA 5CJJA 5HFNA 3RDPA 4ACAA 3NKVA 1JPXA 1Z0DA 3F6YA 4DSNA 5BWBA 1KQGA 1PN3A 1E3DA 1FXKC 1KH1A 2PD6A 3G0GA 3LFUA 3OF2A 3MT0A 4MWBA 2GEUA 4YH1A 4DQLA 5JYCA 5I7FA 3CF4G 2BFNA 1PLKA 2AX3A 1G3UA 2HT1A 2CK3G 4MKXA 1ODCA 1MV8A 2PA3A 3IP8A 5AJVB 2GEKA 4JJ7A 3EGWA 4JBGA 3G5TA 3AKCA 4U2GA 4D42A 1C30B 1OKKA 3C8MA 2YFKA 1ISMA 2IVZA 4QXRA 1M0EA 4XM2A 2Y48A 3UWDA 3TIVA 5CNKA 2P67A 3WB9A 3DQPA 3WRVA 2ZCEA 1PR4A 4GL4A 1DEKA 2PV0A 5LZ4A 1DV1A 4PS1A 3AX6A 1LLDA 4J16A 1XSEA 2A3RA 3HY4A 4MPDA 4PJ0Z 3UF0A 3AYXB 3UYLA 2BSKB 4RQFA 4TT8A 2ZJ7A 4MYTA 1A0OA 3RPEA 2FN3A 5KHGA 1RS0A 2TMKA 3FGPA 1HT3A 2LD4A 5AXDA 3REOA 3LUDA 1YJQA 2VDKB 3ELWA 3PQEA 2PRJA 4IJWA 4ZJZA 4NHOA 1O96B 5BMOA 3VPGA 1CUGA 3PTZA 5JJBA 1OH6A 3OFSA 1KGDA 4RJJA 3NAMA 1U2DA 4KO1S 1JSXA 2H1RA 3ZBPA 4BNDB 4N41A 1IPFA 1KYWA 1R6VA 2WHPA 2WLSA 4HH0A 3I1YA 4RIHA 5DNAA 3RS5A 4XFJA 1Q43A 1FEZA 3G85A 4KK3A 4RH0A 3GYQA 5EAZA 3IAXA 2AYXA 4BUZA 4DYHA 3S0HA 5C35A 2G4VA 3ZWKA 3IQXA 1K66A 1J09A 3Q4GA 3DBRA 3SE0A 2QYOA 2Z3VA 2A8YA 3ETQA 3OOWA 4L3WA 5IC6A 1JPJA 3LQ4A 3W6NA 4V02A 3W5HA 5EHXA 3IL2A 4NCXA 1RWVA 1ZM9A 2NUPB 2YJZA 5B3LA 4LRWA 1PTJC 1GZSA 3E05A 3OZVA 3T9EA 1G2IA 3NIFB 2AUNA 3OEYA 1MNAA 2QX9A 3PWSA 1WMDA 3BFVA 3A58B 2A35A 3UT0A 1QHHA 2BGUA 4UBJA 1JLRA 5GVRA 2GBGA 2ODBA 3KVYA 4DR4B 4NBLA 4RA9A 2WLLB 2AB0A 5IVPA 5KTPA 4HB0A 3GLTA 1KP9A 3HJHA 4IDQA 3C3DA 1HE3A 1JHAA 2DEUA 1QLEB 2QRJA 4TQGA 4IJKA 1JIIA 2VVTA 3QUTA 2H1SA 3N6VA 4Q82A 3UXYA 2EFEB 1XTSA 3IAUA 1BX0A 4BFSA 3G5LA 4ND7A 4JUIA 3H9CA 1BVRA 1R8YA 1Y33E 3IXQA 3EG5A 4FNMA 4HH3C 4DV2O 4DCUA 2JGAA 2V59A 1A7UA 2EZUA 3ZTYA 4IHJA 1SG6A 2C4HA 3K0FB 5CVJA 2IS2A 5EKXA 5KNBH 2AJ8A 3A9UA 2QWNB 2B4TO 4GI5A 2XJ9A 1G19A 4DRZA 2OIGA 3G80A 1Y1LA 1EEXB 5KQRA 5CMLA 2A3NA 4QBGB 1TE2A 4GOKA 2PT5A 3K5OA 5ALRA 4JGSA 1D2RA 2C5HA 3GA5A 4CIDA 1M8FA 2I7XA 4F2HA 3HU5A 1SKMA 1LJLA 2NUBA 3LO8A 4X9QA 5C4GB 3OGCC 4RV5A 3RUIA 1P2TA 4I1IA 3ZWOA