3N2GB

Tubulin-nsc 613863: rb3 stathmin-like domain complex
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stathmin and interfacial microtubule inhibitors recognize a naturally curved conformation of tubulin dimers.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
total genus 114
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3n2gB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3n2gB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3n2gB01
3JASB 1SA0B 5J2UA 1Z5WA 2GVIA 2VAWA 5FNVA 3RYHB 4EI7A 5LOVA 2RHLA 3RYHA 2VXYA 4X1KA 3JAKB 3RYFA 5IJ9B 4O4IA 1JFFB 4FFBA 3HKCB 5IYZA 4EI9A 3VOBA 5CB4A 3HKBB 3HKDB 2BTOA 5LA6B 1RQ2A 1W5FA 5KX5A 3HKEA 4X1YB 5JCOC 4O2BA 2R751 2Q1YA 5BMVB 5C8YA 3R4VA 1JFFA 1W5BA 4O4IB 5IJ9A 3C8LA 2XKBA 3JAKA 4X1KB 3RYFB 4EB6B 4ZHQA 4TV9A 4TV8B 5LOVB 4I4TA 5LXTA 3RYCA 5JH7A 5FNVB 5LYJB 1SA0A 3JASA 5J2UB 3JARB 4F6RB 5MN4A 2BTQB 3VO9A 3JALB 5CA0B 5LP6A 3N2KB 4O2AA 5JCOA 3WGKA 4I55A 4X20B 5EIBD 4DRXB 1TUBA 4O4LA 4TUYA 3UT5B 4I50A 1W59A 3VOAA 2RHOA 5MN6A 4B45A 5KMGA 1OFUA 4IHJA 4YJ2A 2Q1XA 3JATB 4ZI7B 4O4JB 5M7EA 5JVDB 5ITZA 4WBNB 5IJ0A 4IIJA 5J2TB 3WGMA 5EIBC 3E22A 2VAMA 1FFXB 5GONB 3JAWA 5LP6C 2VAPA 5MN5A 3V3TA 4U3JB 3VPAA 3RYIA 1FSZA 4LNUA 3JAWB 5GONA 4YJ3B 3E22B 1Z5VA 4X1IB 4ZOLA 5J2TA 4O4HA 5IJ0B 4WBNA 3N2GA 4HNAA 4ZI7A 3JATA 5EYPB 1TVKA 5CA1B 5JQGB 1RQ7A 4M8IA 5EZYA 5EZYB 4I50B 3UT5A 5JQGA 5CA1A 3M89A 4DXDA 1TVKB 3CB2A 1TUBB 4O4LB 5EYPA 4DRXA 3N2GB 4HNAB 4U39A 4B46A 4XCQA 4I55B 4X20A 3ZIDA 4O4HB 4X1IA 4ZOLB 4YJ3A 4O2AB 4LNUB 5LP6B 3RYIB 3JALA 5CA0A 3ZBQA 2RHHA 4U3JA 2BTQA 2XKAA 3JARA 3ZBPA 1FFXA 1W581 5LYJA 3RB8A 5JH7B 3RYCB 4IIJB 1W5AA 4I4TB 5LXTB 5ITZB 4E6EA 5JVDA 4TV8A 4O4JA 4TV9B 4ZHQB 4EB6A 4IHJB 4YJ2B 5KMGB 4KWEA 5C8YB 5BMVA 2R6R1 4TUYB 3VO8A 4EI8A 3M8KA 4O2BB 1W5EA 4X1YA 3HKEB 2RHJA 5KX5B 1RLUA 3HKDA 3HKBA 5LA6A 3WGJA 5CB4B 3WGNA 3N2KA 3HKCA 4FFBB 5IYZB 3WGLA 4F6RA
chains in the Genus database with same CATH superfamily
1ZISA 5E7JA 4B74A 2J7KA 3QBTA 2V1DA 3H3JA 4KB5A 5AM0A 2XNHA 1JEJA 2ZYVX 5G0SA 3K9FC 1AS3A 4AN0A 2B92A 2AMYA 1GZVA 1GG2A 1PJ2A 2Q9AA 3D8BA 2RD2A 1IMJA 2QQ0A 2AR7A 2WIJA 2RGUA 4DDVA 4JX8A 1FNKA 5JQWA 1B74A 3KE9A 4AJIA 4YIPA 4ABTA 2X1MA 3DTNA 3A0BZ 2HI0A 3KOXA 2DP4E 3GH1A 1BKYA 3N2IA 2NAPA 2EXXA 5IDWA 2GUZB 5DB4A 1N6PA 4J0DA 5L53A 1PJZA 2E85A 1HC7A 5K0BA 2G70A 3RSZA 1N2BA 2IZ1A 3CKKA 1N34B 3QOWA 2AIFA 3MINB 1THMA 4LQCA 5AFSA 3UAZA 1R5OA 3UANA 1KD1W 2JEOA 5DOZA 5FOSA 5KPJA 1J0DA 1A96A 4WY2A 2C9YA 3DVAA 3IRVA 3JWEA 4DLRA 1PF5A 3K58A 5EPOA 1RKBA 4QARA 1DC6A 1CUAA 1U1CA 1HM5A 2EZ4A 3OOYA 1OXVA 3QFRA 4JC5A 5AOCA 5EC8A 5F7JA 1HDXA 2ARKA 1Y4UA 4P7KA 3RWRD 2IX9A 2R7KA 5IDJA 2BWJA 4LW8A 1JHRA 2VHUA 1NX9A 8GPBA 4X20B 5HZHA 4QPJA 2PWAA 2X9LA 4PY2A 3G8YA 4PPNA 2OFFA 2XCQA 4PX9A 3TXAA 4AROA 1ZP6A 4GYYA 5F64A 3UT5B 1U8TA 4PC3A 4GE0A 4DLYA 2BGGA 3FVVA 4RSHA 1FS5A 2QSYA 3KHNA 5HIJA 2BI4A 2OXFA 1W55A 4QUGA 4GO1A 2EL7A 1QOPB 2PKQO 4V3BA 5K8UA 4BO8A 1JSCA 3H9JA 1INLA 4LZPA 1AD2A 2G07A 2E6KA 4XEHA 5J2TB 1RACA 4G4ZA 1LPMA 3V3TA 5D8DA 3RUFA 4TTJA 3W4JA 1JXQA 4OHKA 2GCOB 4L85A 1UJNA 4C7KA 2BRUC 3AIIA 4AUMA 4BJ3A 1FSZA 1VEWA 1DHRA 4R31A 2EKPA 2VNAA 3BM5A 4QUEA 4UC0A 1K86A 2CDBA 3VR5D 4LJ6A 1AQIA 2AC7A 3HCBA 5JJEB 3PYMA 4PZEA 5CFOA 4FSHA 4QU0A 3WHIA 2PPVA 3S2FA 3UUFA 2VQFO 1GTJ1 1X2BA 4ZJZA 3ZRXA 2UXDO 4KUHA 1C9DB 1U2EA 2JLBA 1O77A 1CYDA 2IYZA 2VATA 2ZJ7A 3OZAA 4ZEXA 4HH3C 1MDBA 4LFCB 3HDGA 4KI7A 4YAIA 3BB4A 1KU9A 2Y48A 1V39A 2BMAA 3LC1O 2N75A 4KW7A 5EIFA 1NIPA 4BT5A 2OWOA 1YK0A 5CEFA 2X76A 3WQRA 4QIWF 4BBJA 4LX0A 3VAAA 3LOUA 5JFGA 4H7IA 3VDQA 1M90W 3OZCA 4RY0A 2IZOA 3RV3A 4GOKA 5FDFA 1OYYA 3KR9A 1A77A 1YQ9A 1PHPA 2XBMA 2OCPA 4OF4A 2AFRA 3VZDA 4OQMA 3REFA 2ZVYA 1OBHA 5B2FA 4H27A 2ZJ3A 1OYOA 3GEHA 3SJ7A 1ZOLA 1O8BA 5J1TB 2H0QA 2BH9A 5DW3A 4LZNA 4JAAA 4C9BA 2FH5B 4MITA 2AEJA 1ISJA 1I30A 1ZUD1 2XNDD 2E3JA 4JUFA 3NS7A 2BC9A 4PNZA 1R4MB 1ZRNA 3OU2A 3SKYA 3SU8A 2H7XA 5SYAA 1CERA 3NHPA 4KRGA 2GYWA 2VZ8A 3O82A 5JJIA 1ENPA 1R0WA 4HDNA 4F9EA 3UY4A 5D84A 4IUCS 2DTXA 4YR7A 5HVNA 4F60A 2A9HA 2XA2A 4XIJA 5FWAA 1HSOA 4CV2A 2ZRAA 2LQTA 3ZO8A 3L7JA 4Y2PA 4NZ9A 3HUDA 2C2YA 3AZPA 4FCTA 1QKIA 1H5NA 1WMDA 1OR8A 2XDQB 4KAFA 1OI7A 1KRWA 4QT0A 4JASB 4R3NA 1XP5A 2HIHA 2WM9B 3W5SA 1T1JA 1EFCA 3GVHA 4IDQA 1F6WA 2WJPA 2QTVA 4P83A 4CC5A 1ZOSA 2AOTB 1SVNA 3CNEA 3DYBA 4RVFA 4U6NA 3IDFA 4A16A 2CNWA 1V43A 3MHHC 1KYWA 3KVRA 1VQPF 4KAXA 5B1YA 1T25A 2QJTA 1X25A 1UMBB 3I0MA 2F3UA 2V7GA 1RLMA 4HOYA 1GTZA 1YZLA 3L1HA 3EODA 3OM1A 5K1ZA 2X0EA 1T4MA 4CZ2A 1ENVA 3FX2A 1QCYA 4N3BA 2GWHA 1UODA 3VNAA 4BBAA 2IOFA 2FFBA 1P49A 2FMIA 4FIDA 3L4JA 1IURA 2IGTA 1DOAA 1H3NA 1NVTA 3O8QB 2F64A 1U0LA 3D8SA 1OLXA 1Z29A 1FFHA 2JVJA 3LP8A 5ENDA 1P8AA 5FHQA 4C07A 4RK1A 2C2OA 2UXBB 4N7MA 4MI1A 2CMHA 1AQ6A 3STLC 1QSGA 2V5VA 4NONA 5I9IA 2BSQA 4LC1A 3OTWA 1H65A 2C9DA 2XUIA 1QZUA 4XWAA 5CLQA 5AVWA 2JGNA 1Z56C 1OT5A 2CHVA 3NX4A 4V0QA 3U4GA 3UFXB 2C3YA 3H99A 4BNWA 1LRJA 5ALIA 4Q4HA 2QTGA 4FZ0A 3MJTA 3CW8X 2E7ZA 2O14A 2VEDA 3QEJA 4K26A 2ZS8A 2HY7A 3PE3A 3WB0A 2ZROA 3C3EA 1ZD5A 2JFPA 2RMKA 1DKOA 3CONA 4TGLA 3L4SO 5FL7G 4CR8A 5I01A 3N6VA 4EGFA 2GN4A 2ONZA 5GGXA 3S0JA 1CLUA 3KR2A 4G56A 1CQPA 2I33A 1Y76A 5LHIA 3PC3A 1RQRA 3D6AA 2I7VA 3C74A 1KL7A 1K7YA 4RK4A 4UVDA 4D43A 1TKAA 1JFVA 2JAQA 3I5UA 2ZAOA 1XZHA 3BF8A 5IX8A 2AQHA 1H48A 2Y92A 4C5AA 3OZDA 4QBTA 3HXOA 3UF0A 3MIZA 1HR0O 4OGQB 3TLAA 4HVLA 4M8IA 5PGMA 1KNKA 4KQEA 4HUQB 5LLDA 3K0EA 1OI3A 4QE7A 1S8NA 1M7BA 1JHPA 1KYTA 2AB0A 3R7WA 4BT3A 3SYTA 1EFRG 1Z5GA 1KSHA 3PXUA 1SCNE 1K0FA 5KJFA 1J2JA 1NVMB 1GFIA 1BXRB 5HFJA 3NDBB 1ZNQO 4OCZA 3L8EA 4YS6A 1N9KA 2X9VA 4B82A 1DADA 3G9ZA 1YF2A 3GLIE 2X5JO 1TFUA 1MBZA 4P93A 4NTXA 5GAPK 1FXWF 1MRSA 1U5BA 1W4RA 1UFQA 4FFDA 3OE7A 1YHZA 1M2OB 1PS9A 4WNCA 2A92A 3VNQA 4EGJA 1H3FA 5DVZA 1PJ4A 1H8EG 4MV6A 1CG6A 2C3UA 1YITV 3SX4A 3DHYA 3TXYA 1I33A 1ODLA 5JNLA 1S6YA 5AJWA 3P96A 1GQOA 2ZNJA 1P7PA 5TXGA 4IJVA 4N18A 1HYQA 4EFNA 5GTIZ 3GRRA 4XCXA 3TLGB 2Q8NA 3UTCA 1IL0A 4YRKA 1ADBA 2V7VA 3MVEA 1QU2A 2QN7A 1FZQA 3GTZA 2XADA 2XQGA 3M0EA 4DA8A 5BW5A 5COBA 2OQRA 3NATA 1JH9A 3NDRA 1HQKA 2Z3WA 1EUZA 2V7PA 5JMOA 5CIWA 5CNIA 2I0FA 4C89A 4REQB 3QKRA 1ZD1A 3O4FA 4QDTA 1ZWLA 3M4YA 1UBCA 4ZAFA 2IHTA 2AZ2A 3VR6H 1XALA 1KJZA 1HDCA 3ZJ5A 3CMCO 1OBOA 3K0AA 4AMGA 3AI2A 4BMYA 4XOIA 1BH2A 3RAPR 2B78A 3ILXA 5JWRA 5A4IS 3KSDO 1MNAA 2WZCA 1E2GA 3FFMA 2YWHA 3MFQA 4JJGA 3TVTA 5DLPA 3EWNA 5FPRA 3LKZA 4JYAO 2Q0HA 1WDTA 3QFHA 1LRKA 4WGGA 3SFTA 4X3OA 4O4IB 4JB8A 3L70H 4EB6B 4B40A 1VL1A 4PFJA 2H18A 4ESEA 5DBGA 1UOPA 2ERYA 3WLEA 2QRGA 3CWBH 3ONVA 2IPMA 4CQMA 1NLFA 1Q7RA 3PXEA 4BN5A 3ORFA 2Q7EA 5A9SA 3AINA 3H01A 1NP6A 4MKHA 2FR8C 1PV1A 2QWRB 3CJHA 2RKOA 1MO3A 2C1XA 2XJ9A 3M9XA 5CXQA 1IXRC 2PXAA 2FUNB 4R54A 1G4AE 1ZOPA 2X58A 1QAMA 1AXEA 4HZIA 3VTZA 4KIFA 3PD7A 3JCMM 4C29A 5I7FA 5K8JB 3R8CA 5BQ5A 1CUHA 1PD0A 2G0AA 3SMQA 3UM7A 5LD2C 1B8PA 4NOMA 3RUCA 4AS2A 5GTDA 2OD2A 1I80A 1XRGA 1COZA 2IH5A 1JP7A 4KL8S 2AVNA 1NM5A 3KCQA 4F84A 1E20A 1Y3AA 3MCWA 2JGEA 3G7NA 3NALA 4FT4A 4H7JA 4N54A 3GWOA 2W2PA 5FFFA 4UCSA 5KHKA 4QFDA 1G8GA 3AMVA 3VVBA 1MB0A 1QFYA 5JJKA 3GARA 4C8IA 3R0VA 4NJOA 1NXQA 4YIHA 2Y69B 3W5AA 4AZTA 4IIUA 1F7VA 1WUYA 4BS9A 1QX4A 3QHAA 2PBZA 3DXFA 4KFUA 5FPQA 3RAJA 1SU4A 3B1KA 1GNSA 3TQIA 4F9FA 3P3PA 1MB2A 2PSJA 1BWQA 4FOSA 4BGUA 3ACCA 3QE3A 3AY7A 2FZWA 4UHFA 2AQIA 3IBSA 4B3FX 2C9OA 4DUGD 3OKCA 4R2JA 2NO0A 4HQOA 4IH4A 4PHFA 4BO4A 2FPIA 2IDJA 2FMFA 2FV8A 1Z6AA 4EIWA 1TM1E 2V59A 3H1BA 3S2YA 3DQQA 2RG1A 1GU0A 1GKUB 4BMZA 3EVKA 1I36A 1TK2A 3FPSA 3IC5A 3DWGA 3K9BA 4WXHA 1UDWA 1XNRO 1D3AA 2XNDA 3JARA 3H18A 4NU8X 1WTAA 1JEEA 4B7KA 3BK7A 2WLIB 4EVIA 4KE7A 5FI0B 3AQIA 2K7ZA 1R2QA 1E0JA 1ZH6A 3D0RA 1LCIA 1ZXBA 5EUBA 4C3VA 4Z0TA 5BV2P 1NVFA 3GMIA 4CCYA 3F3YA 2WWTA 2MYNA 1Y8AA 4JLPA 1RIIA 1GLNA 3DAYA 3LPLA 3PFBA 3M49A 4UREA 1X1DA 4ZVPA 2H1SA 3ZWYA 1BQ3A 3IC9A 1DMSA 1N6KA 1T9CA 1Y8QB 4GPD1 3ZTTA 3L7LA 4D5EA 3AW9A 1K6MA 3L40A 4RLHA 1CWUA 1SHZA 1ZD8A 2L42A 3LC0A 3TD6A 1ZITA 2ZBEA 2EL9A 5ERXA 3PFHA 5IBRA 4E4YA 1A4XA 5DM70 2NOAA 2DYRC 5HS6A 1P84F 2FQXA 1XTJA 3BMXA 1Z2CA 3LUKA 4I1SA 1JWLA 2X6BA 1CD5A 3B12A 3T0FA 1PT9A 3TPFA 4IW3B 3EUWA 5D51S 3PFKA 2GJ4A 5REQB 2RHLA 1G98A 3N4YA 2HX0A 4F5WA 1YI1A 3G4SV 4KEAA 5ECYA 5EIAA 3HVHA 1M1KH 4LEIA 2D1QA 3WMRA 4RD0A 2X19A 3G0DA 2CUGA 1V1JA 4TRNA 3L5OA 2FEPA 4OIFA 3Q8MA 1QIJA 1X70A 4K05A 1ESDA 4DWOA 3L18A 2AI1A 2X0IA 2UVPA 5K7SA 3NONA 5I9BA 5BSVA 2JNWA 1SUAA 3ORSA 4FYYA 4BZXA 2B7LA 2H9AA 2QRHA 1M6EX 3FW1A 3LYUA 5AJTA 4EG3A 3RC9A 4HNVA 1LLFA 1Z26A 2ZT5A 3MXOA 4QTXA 2ZI9A 3K73O 4ENVA 3GQVA 4KQ2A 3COZA 3OE5A 1QFJA 1EB8A 1SXJB 2R44A 5CFNA 3GDFA 4XGKA 5CAEA 4K8OA 3SVLA 4NDZA 3F8TA 3LW7A 3INGA 1JU9A 4X6LA 5JU6A 4R3UC 3OZUA 5DSXA 5DBFA 3U13A 2EBOA 1XLUA 2XKJE 1J09A 3DXRA 3IP6A 1NVWQ 2V74B 4N7JA 4QWMA 3UO8B 3IEXA 1G9TA 4Z4EA 2YQ5A 5FPTA 5CYOA 5JWOA 1CJBA 3GB7C 1QTIA 5JD3A 5HUJA 5THQA 2WU1A 4I50A 1M57B 4NC9A 2H2HA 2X0FA 3W1WA 5JZMA 4HAMA 5JI2E 1QFZA 4M46A 4YX9A 4BLWA 4KLZA 2QQEA 3DC5A 3OHPA 4J16A 1HRDA 4GT1A 1KUQA 1JYSA 4RAQA 2C7PA 3STHA 2UV8A 4PZDA 2JFQA 3DHEA 2KLHA 1ZM2A 2YIDA 1OCOB 4YAWA 2DJ5A 1IBKB 1UZLA 2PUBA 4FFMA 5JXJA 2FSSA 1YS4A 3GGGA 2IJIA 4MQFB 1FYFA 4DE5A 2H59A 3LGSA 1CR2A 2HBYA 4N1AA 5IHXA 1SQ5A 3DOOA 1MIHA 3H9UA 5E2BA 1BSVA 1TK9A 4AHCA 2ZB8A 2QQFA 3AR8A 4BNMA 3FKSG 4HNHA 3UHFA 3OUTA 3P3NA 1QHNA 3TD5A 1EGMB 1Z2AA 1U65A 2H16A 2VO1A 2Z3VA 3IBYA 2JC3A 3EXHC 3N3BC 4OGFA 1V2HE 4Z3KA 2A84A 2HMWA 4URVR 1HYEA 5BRJA 1OSNA 2HN9A 1LX6A 1X1RA 1US8B 2REOA 1M2FA 3S70A 3FGNA 2VK2A 3SGLA 1UKBA 3VH2A 5AW1A 3J81N 2QX4A 4YJ3A 1JEQA 3A10A 4LRUA 3CCLF 1EFHA 3PITA 4KQCA 1ZRSA 3K92A 3L79A 1MT3A 1JVNA 3PQ4A 4L7QA 1PEKE 1SK9A 5TS2A 1RZRD 2YFHA 1FFXA 3B36A 4GMHA 1I4WA 1Z4KA 4B09A 2HS0A 3CPWF 4XQ0A 4NMXB 5HQJA 2PX4A 3IAS6 4O4JA 1KZYC 1RTKA 1ZG3A 2UDPA 2UUOA 3SQWA 1QNMA 2QPTA 1T26A 3BEHA 1S3JA 1ZM9A 1RRVA 2IEBA 3DE7X 2LPMA 3IRUA 3QX8A 1AX9A 2UYJA 1KH3A 1H4SA 5JCXA 2BKEA 3O31A 4B4DA 1VJGA 1FNDA 2ATIA 2RCVA 4I9NA 4M1QA 1M6HA 1MVOA 3UFXA 4BIMA 2Q3CA 5I4IA 1X7YA 4GCZA 4U9IS 3P2JA 4ZGWA 1XEQA 2V5AA 2ZVZA 1E1QD 1NULA 1CUUA 1RA4A 4I4CA 1E7SA 3A0RB 4JBGA 1NT2B 4D1YA 3HYSA 3IBFA 4GRIA 3TM5A 3K6KA 2QE6A 2LCIA 3PENA 4H0NA 4X44A 4RTKA 1KYZA 4QFBA 4U6SA 3OCWA 1BX1A 4Y9SA 5FBRB 2HLDA 4JHXA 1HUQA 1VKRA 4Y6GB 4IIYA 1EXNA 1AGNA 1MXHA 1OJLA 1T4CB 5EERA 1MTOA 4B44A 3L4KA 2PUAA 2E9SA 4G0VA 1SQFA 1L8LA 1AKWA 1K6IA 1Y4AE 1YOVA 3W2FA 1VHTA 3PBKA 2B1QA 4LDZA 4P2GA 1E6UA 1UMBA 5IT9M 1V11A 2ZF8A 2XB9A 5H9WA 2AT1A 1ZONA 1ZM3A 4YBZA 4C04A 3TS1A 1NXWA 4ZEMA 1RYZA 4HDSB 4D4HA 3LECA 3CKMA 4HFNA 3RYTC 1EDEA 1WP7A 3QHDA 1JQDA 1PJ8A 1Y67A 1ISIA 2PLRA 1SQPH 4C82A 2X2PA 2ZBFA 2YY5A 4FS8A 4UCUA 3FDJA 1JR6A 3SS7X 1N8KA 2JPDA 4IX9A 1U0SY 4UNRA 1WEKA 2ECOA 5T64A 3ZHUA 4F6RB 2PA3A 4NDAA 2RGEA 5AHKA 2I3AA 2X8LA 5HTOA 1PL0A 3LLUA 4NBVA 4NBKA 4B73A 5DNWA 4KODA 3ZBHA 4EATA 3P9NA 4J75A 5BN3A 4QPNA 4OGWA 3C1UA 4KXUA 2AJ8A 3BS4A 3FNFA 5IHPA 1CS0B 1VG8A 1A88A 2GN2A 3QEBZ 3U0ZA 5L6LB 1D5AA 3CX5F 1GUYA 5F3DA 3ASYA 1E1YA 4ZALA 8AT1A 4DGQA 4EA9A 1K3TA 1XMIA 2PBLA 2ZTVA 3LDUA 3AFOA 3M1LA 4MUGA 3QIAA 3GQBB 5JCJA 1FJ2A 4D81A 4F3RA 5KAMA 3JRNA 1QHSA 5ITZA 3T7DA 1CXZB 4CF6A 4LYDA 2YXDA 2ODBA 1JX6A 4XVQA 1SVUA 4BRUA 2CVOA 1H38A 1NXVA 4FLFA 2F4VO 3WTCA 1Y7TA 3ENWA 1E1CA 4Y2XA 2F3QA 1NJ6A 1YAHA 4QYIB 5HF5A 1XZKA 2P1ZA 2CSUA 2XNDG 1QMPA 2MWMA 3H13A 4G0NA 4AD8A 3I3FA 3KCXA 4MYSA 3BSSA 4J3JA 4DVJA 1SY7A 2OXEA 2VWHA 5AJHA 3TNFA 4EUKA 4YC7A 2EVWX 3IAUA 4FB4A 2G67A 3MYRA 2MK3A 1QS0A 3FFBA 4UBNA 4V24A 3DNFA 4C0BA 3QW4B 3SSAA 3E7DA 4LE2A 1ZH8A 4YHBA 2EQBA 1LK5A 3F49S 4YP7A 1SCJA 2HF8A 1O94D 3VR3A 3KSRA 1FMTA 4GVPA 1Q7CA 1WCYA 1K06A 3MWEB 2VWPA 2CW5A 4DC0A 4DABA 1GL3A 3H6HA 3WV4A 4R0MA 2LUOA 2NSLA 2VGMA 2Y0BA 2ZREA 4WPGA 1QH9A 3BXEA 4NZOA 5K0FA 1W42A 4D9NA 3S29A 2C5LA 4RMIA 1WG8A 4M1TA 3FYUA 3OONA 2C78A 4RFSB 5BWBA 5E2IA 3AB3A 1NOJA 1ONPA 2VNHA 3NDPA 3WL7A 3WYBA 4IDOA 4BMPB 4HNTA 3C3MA 3WLFA 1U7HA 5A4MS 4JVLA 1XZQA 4UB6Z 4RC9A 4Z9FA 4UQLA 4YDQA 4W4KA 4QNNA 4MUNA 1AJEA 3JVUA 1XPRA 2Q0XA 1IN7A 2PT5A 3NM4A 1P62B 4BNHA 2JLZA 2OCHA 1U3FA 4G4YA 3ROFA 3GNQA 2JW5A 4HQRA 1FA9A 1N7GA 4HCJA 1N36O 1S5HC 3SIXA 4EG4A 1WPXA 4ZI3A 4KL1A 1BQEA 4N0EA 3AJ8A 3UWKA 4TKLA 2NZXA 1ZI9A 2B98A 2J7PD 2X7HA 5EO3A 3EYAA 3L7CA 1HT0A 1XAGA 4QUIA 4FOLA 3WO1A 4BKUA 4X00A 2MR6A 3W8FA 1T1GA 1XU7A 5DM60 1L7XA 2J5QA 1WD5A 4PQGA 3GVMA 3OW2U 4JTDB 1FTQA 5LA6B 2CUZA 4BDTA 2JIDA 3LQ4A 4ZOAA 2J3JA 2FPRA 5EWMA 3MT8A 5JJ5A 1D6JA 4DO2A 5KOHB 5CLIA 1HNZB 1WCXA 4LX8A 3WYCA 5MFPA 2Z8XA 3D8HA 2HPAA 1XHOA 3MERA 3VI3B 5HKKA 3LMKA 5KTKA 2Z2KA 3MCZA 4P4SB 3X2QC 1AM4D 5GONF 2BCEA 4JLDA 1ABBA 2GPJA 1RLTA 1GRRA 1LI4A 2M1ZA 4MAMA 4GFDA 4HDRB 3TYXA 4W7SA 5CB4F 4MS2A 5KHGA 4P3OA 3E2IA 3DOJA 4WECA 3JVDA 2FYTA 5F33A 1JQ5A 4R2MA 5J5CA 1K33A 2ASEA 3T1NA 1IWPB 1GZ3A 1K7EB 2CKMA 2JFBA 1A4UA 1I4DD 5HJ2A 4OHZA 5KZMB 3UMSA 4EHIA 4KXVA 4CMGA 1DFHA 1UM9A 2HUNA 5BOSB 1SBYA 2GK4A 2VUUA 4RTQA 2JEYA 3K59A 4K9QA 2XTAA 4R3WA 4TSFG 3I52A 1U0NA 3LWBA 2LNDA 4WJZA 2EBWA 1X87A 2GEBA 3QELA 3BMNA 3KUKA 3IPRA 3LFOA 5I4KA 1H2GA 1R64A 5AM4A 2PKRA 3USZA 3OT7A 3NPAA 1FDTA 1F3OA 4YJ2A 1J5EB 2ZBPA 3AUYA 2A5JA 3N1UA 1X4TA 3NWPA 1Y6FA 1R6KA 3FTDA 3NBXX 2F9MA 3KQOA 1E0DA 3KB6A 1FFXB 4MVMA 4IXMA 4E5NA 2Q69A 3IHLA 1XLTC 2EP8A 3H87A 3K72B 4G0YA 3WYGA 1DGQA 3D6FA 1VQNF 4ZT4A 1ANKA 1H6DA 1XTBA 2WD8A 2Z09A 4G01B 5JY1A 1NMQA 2HRUA 1UDBA 4ZI7A 4G63A 1R0CA 2GTIA 4Q7KA 1ORRA 1PEYA 2BGMA 2PKXA 3K30A 3RVQA 2P4HX 3V8BA 1BHQ1 4AY3A 3WJ1A 1RZRA 2ZIZA 3KSUA 1LLDA 2NU6B 3D6TB 3PR2B 4URUR 2PX2A 3EFOA 3VPSA 2P06A 1QZTA 2IP1A 2JHPA 4NZZA 4MAAA 4WTOA 5DISB 3ZY2A 4DARA 4CKZA 4GW3A 5BSKA 2ZM5A 2FPPB 3SIWA 3ZLTA 1UK8A 2JI8A 1XHXA 3KHSA 5GJVC 2FY8A 3TAUA 1K8YB 3PVZA 2EAUA 3EIEA 3KQTA 1WSWA 3ZI7A 4PI0A 2B4AA 2ATEA 4XWTA 3TDKA 3HQ4O 4RQAA 5HCNA 4B3JA 3T15A 2PJUA 1E3TA 5LMCA 4DM4A 3LCVB 5CJPA 4OI4A 4H16A 4RZIA 1JUDA 4W9NA 4PWYA 1L5YA 2Y6VA 4DQ0A 4TV9B 1IK6A 1SXGA 5CDFA 1S4QA 2IYYA 2TSYB 4JXJA 1E3IA 1LC0A 2OBBA 1HEIA 3PHCA 4KDFA 4M1OA 4MIOA 5HIMA 4ALKA 2YZ7A 3U10A 2BHLA 2PWYA 5KJEA 1KIFA 5A06A 5K0JA 1DCTA 1E9BA 1DBIA 3AKZA 1VLHA 2WC1A 5LQCA 1JLLA 4NESA 2MINB 4UD2A 4NR1A 3ITDA 3IAM6 1I94B 3PGKA 1L4BA 4OXXA 5C8DA 2GWRA 1NF3A 2RHBA 4BNGA 1UDCA 2ZTMA 4GLLA 4J4HA 2IS2A 4C4OA 3BABA 3LCMA 2YYEA 2OKGA 1EVIA 4WK6A 4A4DA 2K1EA 2XT9A 4BVRA 4GIBA 4KLRA 4O0LA 3FSRA 2K2WA 1U2TA 1QPGA 3V2IA 4OQZA 3SQNA 4LJ8A 1A97A 1J5EO 1AB5A 2R25B 1ICEA 3VQXA 2YTZA 2QBYB 3FHOA 4DW0A 1TQ4A 4KK3A 5H0IA 1F48A 3ZJZA 1M7GA 1NN3A 3VR4H 4EHDA 5BWMA 2YKGA 3L7OA 4KREA 2H8GA 2YASA 2LGQA 2V7EA 4LYHA 2OWEA 1N2JA 3HDHA 3OLVA 4UCQA 2C96A 3FXAA 4NMMA 2JLXA 1KDPA 1KGSA 5LWHA 3AF3A 4BGIA 5LQAA 4KQGA 4O25A 2DKFA 3FAVB 2Q9CA 2G40A 4J90A 4NEGA 4ALMA 3M9LA 5IZCC 4RKYA 2UXDB 4H18A 5J2UB 4ZOQI 1BL8A 4DYHA 4IZOA 3I2FA 2TMYA 3C98A 4QNMA 1N0JA 3GLHA 5J40A 1UJWB 4AF7A 5L40A 1I51A 4L8VA 2I34A 3IEPA 2OCBA 4DBLE 1SM4A 3M1XA 4U1RA 2ZWIA 3ISJA 1H0SA 3CSUA 3H75A 2PRKA 4H17A 5E6UB 4DILA 2HPHA 4Q1AA 3RU7A 1KOGA 5KKNB 4DYLA 1TTHA 1Y3CE 1C3LA 2J85A 1QK3A 2C94A 2CMDA 1M0SA 2O2DA 1H2ZA 4GWGA 3J81A 1PFVA 4CGYA 3MT7A 2WNSA 3ZLBA 3EZ7A 1WB4A 2QVBA 4KU4A 4LAFA 4BKQA 1GXSB 3DHVA 5JSQA 2VJKA 3U56A 2IU4A 3PC4A 1FNSA 4BW5A 1CZLA 5GV8A 2O2YA 2GHTA 5K5EA 1MEOA 4YY3B 2OORC 4MWDA 3CC7V 3STYA 4PO1A 1T6ZA 5EESA 1IY2A 4UDOA 4GZ6A 4RPKA 2JFFA 1OV6A 3CNNA 4FNAA 4DK0A 1P81A 2AHRA 2PUHA 3PE4A 1OCCB 4A0FA 1QG6A 4PLCA 2N47A 4EBFA 4MKXA 3A05A 1KNQA 4WCFA 3W06A 1UMDA 2R66A 2G5TA 2XUHA 4GLFA 5G02A 3ZU5A 5A4FS 1LV8A 5IM4F 1NV8A 1T2CA 2PL3A 1VSTA 4DS3A 4XQEA 5ED4A 1W0JA 2P79A 2DZDA 4E2ZA 3E1KA 4D9BA 4MVUA 1U8FO 3RAFC 2C2ZA 5C51B 1XNRB 3C7CB 3WOHA 4ESHA 4KSCA 2D5CA 3PUIA 3DC7A 4RDIA 5AXBA 3WKAA 4D5GA 1C29B 4IL6Z 2D4HA 1YU6A 3OH8A 4DRXA 2H4XA 3WLAA 4EH1A 5ICGA 4CI9A 3PJSK 1U94A 4YJ2F 5AOBA 1UMCA 4L5JA 5DI3A 1AXRA 1G5RA 1NW7A 3KJEA 3G49A 5EXEA 2IHNA 3ZDZB 2P4VA 2XITA 4JLMA 1JA0A 3KQHA 3HH8A 5JD4A 4C4XA 5LMNB 5JAOA 1GEEA 4KXLA 1T2FA 3CKYA 3E8MA 4S2EA 5DLYA 3WNDA 3ZOZA 2QRVA 5KOJB 1ITZA 4U2KA 1V6CA 4PVDA 5IWAB 3RTDA 4TLBA 3GNSA 3L93A 1J20A 3G68A 2I91A 3VFDA 3DJYA 1K73W 3A9VA 4QYSA 1U0RA 3TSOA 4D9IA 1VYUA 1XMPA 3BA9A 4G1MB 4L74A 1LBQA 4XR4A 2VDQB 4RHEA 1GKIA 2NP6A 1BS2A 2XMSA 2BFWA 3CCUV 3A36A 2L2QA 3O3MB 3VYUB 3SK0A 4LOLA 2I6TA 2Z58A 2FZKA 4OHBA 3T3IA 5BUCA 2XECA 3O47A 4ND4A 1SIOA 3I6ZA 2V0CA 4WL0A 1UFIA 1W7AA 4QDUA 1MC5A 4BZQA 3L1JA 2GS9A 3H5AA 1HZZA 1Z8HA 4ZCRA 2J6BA 2E75B 3CZPA 3JVVA 1KQFA 1PJTA 3V7NA 4ZRMA 2CT8A 2XE8A 4GE3A 2BGTA 2BEUA 2A57A 4DIFA 2NU9A 1OU0A 4ZEWA 1RBQA 1S96A 2RBGA 1KE1A 3U7EB 3R44A 5KYTA 2BR5A 3BIFA 3LUHA 4IGKA 3P32A 4IJWA 2OPHA 4PNEA 2ENWA 2OA0A 5LUAA 3CS5A 4S12A 4D6TH 3KEFA 3CINA 3QNWA 2H00A 4PV7A 1JIKA 3WIBA 5KJ6A 2V0GA 3K53A 3C7TA 1I5RA 3CSSA 1NQVA 3DMYA 3KUXA 1ACLA 4LGCA 4RZ3A 4Y6QA 3N76A 4U9HS 4XB1A 2XHBA 1OGIA 3SNHA 5B3LA 1X1SA 3G8BA 1W88B 2EWMA 1YDFA 2AIZP 1CN7A 9ATCA 5LQDA 3QSYA 3P5SA 3W9SA 5LQKA 3MUEA 1HY3A 3OPYB 1KR5A 1EEXB 1VIVA 1CZUA 4KLNA 4WDRA 3PA6A 3PGMA 3PNKA 4RH3A 3ZOKA 4AJPA 3WSTA 5C4IA 3WFZA 5FUQA 4FJ0A 4XDLA 3OIVA 4IYJA 5D3KA 3VU1A 5IDYA 3PZRA 3F7YC 1Q0UA 2H11A 1Z28A 3WRVA 3BCUA 2AFIE 2MINA 3S0YA 2IA5A 4G97A 4JSYA 4M6WB 1J8QA 1X38A 3AR5A 3KHUA 1YFKA 3QOFA 4DEXA 1FNCA 2PUVA 3JD4A 3O4VA 4WMLA 1YS7A 2AFIB 1PYGA 3NHZA 2CK3G 4FC6A 2J9YB 3B09A 3OTOO 3DO8A 3E7WA 2BFFB 3HJAA 3B7WA 3MN1A 2C5BA 2UVQA 4RESA 6REQA 3H2GA 1T3LA 2EW2A 2VHEA 3P9KA 1GL6A 5D5PA 3CCSV 1YRQA 4KN9S 4EZEA 5LL6P 4IT5A 1FDVA 3O95A 4FHCA 1JNYA 1P0IA 1J39A 1Y9AA 2CN1A 3AYZB 4XD7D 5HCIA 4EYEA 4EG0A 1XNQO 1WAMA 2CDCA 3ITNA 1UAGA 2V96A 3CR3C 4TKVA 1UWVA 2JCGA 3CMEV 2Q7HA 3IEWA 1JDSA 1MG0A 1T4DA 1HDRA 1W46A 2C5GA 3OIDA 4IDDA 4P5EA 1MB9A 2H52A 4KO2S 4O8ZA 1W4AA 3M5WA 2VI5A 2O6HA 4PBRA 4J03A 2V6IA 4QVIA 2G1AA 1HYHA 5FULA 1ULZA 3OEEG 1E1QG 4JP5A 3IDAA 2YI8A 1NNUA 4U7DA 4EL0A 3G5TA 3G82C 4TQGA 1UWCA 4DLNA 2DBQA 4V39A 5A0TA 4X20A 3SR2C 1U3WA 1XRLA 3F5TA 2VJPA 4JUAA 3ZGYA 4B3MB 1QGOA 3QEKA 4MUJA 3ZBQA 3B60A 2XRYA 4ZDJA 4FFVA 3WIEA 1UDAA 4PLHA 3T0GA 4N3CA 4BX0A 3ADCA 3IE1A 3HV2A 4GLBA 1GGKA 2HPZA 3H2BA 1PJQA 3LBHA 4O4HF 3DL7A 3THYA 1MZPA 5DM6V 2KBEA 3DBIA 4E5YA 5LZ4A 5BMVA 1D5NA 4HB2A 2F8SA 1K73H 3M4NA 5ALSA 5ILQA 1N6LA 3GWZA 2ZODA 3L6UA 2J8ZA 4J9YB 1HFWA 2OM6A 2VHQA 3L8GA 3NBFA 2E89A 1SKBA 3C3YA 1D9ZA 5CT8A 1RYFA 1R15A 1X59A 4Z53A 2PJZA 1T3GA 3W7SA 1DCMA 2DPHA 4N5IX 4CCSA 4IDPA 5ESRA 2BHRA 1FU8A 4DRYA 2J3DA 3IKMB 5KOIA 3UK6A 2FTKA 5IVHA 3JXEA 4J7KA 4FOPA 1QCEA 1J25A 2J09A 4LSZA 2E74B 3OESA 3DBRB 3KJZA 4FEYA 3KR1A 4EABA 1M0EA 1SUWA 2OQVA 3GFPA 3SG0A 5I5EA 1UCFA 2IYXA 4QXRA 3QO5A 4X61A 3VOBA 3VHQA 1P7BA 2GDSA 5FLEX 3VVLA 3CVUA 5JS1A 1MG5A 3K05A 3A2FA 3QG1A 3A7DA 3EASA 5C32A 4GXNA 3HCAA 4DR5O 2BGWA 1P2UA 1BGYH 2FK8A 1V54B 1PGOA 2ID8A 4OPMA 3DWFA 4MR7A 4ZXFA 5A9RA 4WT7A 2A9QA 2QP9X 3Q3HA 4P08A 1NU6A 4YT5A 4NVPA 1TUIA 2ALEA 2A1UB 2GHIA 3HSKA 1SS3A 3L2OB 3N58A 4EDFA 5JRJA 1S7CA 3OPNA 1TX4B 4HB3A 3UK7A 3HCCA 3ZCTA 1JRLA 4CMBA 2BR4A 4Q4HB 4EEZA 3AONB 3JYOA 4KQWA 5C7YA 3Q7EA 4L76A 4KWCA 3A2LA 3TPZA 1VJDA 2Y3IA 4DTCA 1SA0A 1NBEA 4XJVA 3W1EA 4XUCA 4EQZA 2VZLA 4W9MC 1Q1NA 2F1KA 2JBAB 4G2TA 3EBOA 4F11A 2JDIG 4OXRA 4WV3A 2YFYA 1QV9A 1XZCA 1J0XO 4NMLA 2QK4A 1UUFA 1HE4A 1Q7TA 3ZX4A 2O7NA 5CCXA 5B1BB 4LFBO 1TYEB 3ZIAA 1N25A 2JJMA 2QP3A 4I81A 2I9KA 3OLQA 4XQGA 4BWYA 2JI6A 3SX2A 1A8HA 1WSAA 1Q2UA 3VX4A 1W41A 1QRRA 1V3UA 1VCNA 4X92A 3KB1A 3E8BA 2D0IA 3LK6A 4F7WA 4F8EA 3FPKA 1NTRA 4OL9A 4L95C 2C5EA 3WL4A 3NT2A 4IIDA 2X5NA 2D1YA 4YRJA 2AJDA 1A3CA 1WKVA 5I7HA 2VG8A 4MA4A 2XCUA 1CUVA 3ZZ0A 3O93A 1DAMA 3IX7A 2UXCO 1SQSA 3DOHA 2AN1A 3NHFA 5E6SA 3KZOA 4LE1A 1M1NB 1XWIA 3CNOA 3H4MA 1OLSB 2VDVE 4J3NA 4TV8F 5FCDA 1PFYA 5DWQA 4GKBA 1Y74B 4J11A 4FINA 4IGIA 4DKXA 4DMFA 1EUYA 4PSVA 1BXGA 4EVRA 1AT1A 1OV9A 4J91A 4DQUA 3ZS9A 1NW8A 4EITA 5FR1A 2VDPB 3OX1A 3QRWA 2WIBA 4IINA 3TUZC 3P19A 1EZJA 4NU5A 3WK8A 4ALLA 3L6EA 2AN4A 4BECA 2LXNA 1F4LA 3IAEA 4KSYA 2ZIFA 4N49A 2E1RA 1A76A 2IXTA 2AYYA 2QRMA 3LBAA 4BTLA 4ERNA 4HNAB 3OBYA 2VUSA 5B1HA 3SDBA 3R0PA 5E9WA 4YRIA 4ZZIA 4JI2B 4JI7B 3TTYA 4X7RA 4HTFA 3CYQA 1GTL1 3JQDA 1W75A 3A6KA 3UWSA 4QDOA 4AX4A 5BORA 5IXYA 4D9GA 1KQPA 1PX0A 2WZDA 4FOTA 3THSA 3D2LA 4RHUA 3WJ7A 4BU0A 3PUWA 2ZIUB 3I92A 1H4TA 4HYQA 3ON5A 2OESA 2JJ8A 5CB0A 2BGIA 4UTRA 2Q1SA 1NUUA 1YZKA 2X77A 4Q66C 3SZRA 2CFIA 3QPBA 3N70A 1E2DA 2Q5QA 3TLCA 4KWEA 4DY6A 2ATXA 2KSQA 2N04A 5C37A 2WAOA 2BHNA 3H6KA 3HM2A 1SRYA 3MAJA 5A9TA 1PXWA 1MNQA 3KXDA 2YIJA 3WIOA 3WBFA 1KKCA 1OTYA 2GJAA 2VF7A 2D7CA 1LW7A 2I03A 2PMBA 4G6ZA 3R74A 4P4TA 3FZQA 3WBKA 4UEJA 3RIMA 3D3WB 1XR3A 2VOEA 1BKSB 2E6UX 3OJ0A 3W3AA 4C4ZA 4EKDA 5JAZA 5I9LA 5AW0A 1Y9DA 2CH7B 2F95B 4Z9BA 1COWG 1CF2O 4L15A 2GLZA 1CDZA 2JGMA 4NKGB 2QR3A 5EJ2A 3FDZB 4FC7A 3U1TA 5FEMA 2LWIA 2QOEA 3KLPX 3D1LA 3H8VA 4JLUA 4ZIRA 2X3YA 3ZC3A 1YVDA 3K09A 1Z7GA 2WVJA 5L3SB 2P6RA 4QNHB 3E7FA 3L41A 4PHCA 2DYKA 5IYZA 1H6BA 4DSAA 4YMUA 2RB5A 4KVFA 2OV1A 4M1SA 1TAUA 2VPYA 4ADSG 4B5KA 3OFND 5EMKA 3K2XA 1VHLA 3PQEA 4UNIA 4ARVA 3P30A 3O38A 1P2VA 4B81A 3HCNA 1L7NA 1KFJB 5JNWA 5CTJA 2JIMA 2R9VA 4F93B 2D8AA 2G6TA 3IKJA 3VNRA 1ZIXA 3L73H 2G5GX 3I4FA 1BNCA 4WCVA 4JV5B 3EA5A 2XE7A 1OTHA 4G5XA 1EX7A 4C0LA 3HK2A 3NJ8A 4PIMA 2J67A 3C90A 5I7WA 5JALA 5LOVB 1N6IA 2H2GA 3EXG2 1G4YB 3GROA 1DDGA 3IP5A 4FTWA 4J49A 4U7TB 4LJAA 4ZK2A 3FOWA 2NT3A 4QJFB 1XXHA 3LPMA 1BSMA 2CYBA 1PUXA 1QB7A 3RLFA 3TI7A 1KZ7B 2XUFA 4JFAA 4OOFA 4L8JA 1ULUA 3DLCA 2W6ID 4L51A 4CJXA 3N27A 4KMOA 2G06A 1ZL2A 3SEFA 4MYHA 4F4JA 1MW8X 1VQ4F 4DRXB 1NN0A 3CCBA 3D0QA 3MJSA 4IBOA 4J0CA 1PZHA 4P98A 4B17A 1L7BA 2ADFA 1F60A 1R3KC 4B80A 3A3OA 3CV3A 4M83A 1XD2A 1LQUA 3EARA 1Z2NX 2X6CA 2D13A 1NFQA 2JFVA 2OSBA 3WJ2A 4EKEA 4ZP1A 4ND8A 4DCVA 4RNDB 3GAFA 3CUYA 1R8QA 1C5KA 4XASA 4HQNA 3GZNA 3CIFA 4HO1X 4EP1A 1MRZA 4QICA 3ZXSA 1JDPA 3LQQA 4BQSA 2D7DA 1XEWY 2H08A 4JU8A 4UCFA 3U7QB 1T3ZA 1KQNA 1NZJA 1Z0AA 3GU3A 2JASA 4Y2JA 5CM8B 3CPWU 3VVCA 5JSZB 3I45A 3HRIA 2FUCA 1EE9A 3EVZA 4EM6A 3BL5A 2NU8A 5BT8A 2ZRLA 3D6NB 1I94O 2WD7A 1A2BA 2YS7A 3LCCA 3JSNA 1BGWA 4NAVA 3DGFC 3S4YA 4OJTA 2OGSA 4DV5B 2P3LA 2ZDGA 4ERXA 3HDVA 5BQ3A 3PJDA 4KNWA 5J4HA 5AVSA 5A05A 5B5SA 2C7RA 3KKLA 1K66A 2VP3A 2XTNA 5CN0A 5IVDA 3V4RA 2XUDA 3ERCA 4F3NA 5EFOA 2DSTA 5HQ3B 1KKDA 1QB8A 1R9NA 3A1WA 1VM6A 3OU7A 4M2LA 4NAHA 3EQ8A 4PGAA 3G5MA 4P2BA 4HBNA 4Y6LA 1WO8A 2OHIA 4DZZA 1DAHA 1UL1X 5K2MA 3BDIA 3G0BA 1TNDA 3U3DA 2XVXA 2FMKA 1U0HC 4PSDA 4MKRA 4MQ5A 5EP2A 2Q7OE 3ZWCA 2CYCA 5LFAA 3GD5A 2HBQA 2M1XA 3I1JA 3IUQA 3FHCB 1OCZB 2XH8A 3LKDA 1DFIA 1ZH0A 1XNQB 1RCUA 1LZLA 2IPXA 2H1FA 2VYVD 1PG2A 1R0SA 4B4UA 1SQGA 4HRVA 2QSAA 1YJ9F 1EFRA 3L46A 3N8HA 4I3FA 4Y6PA 5LP1A 4JCCA 4DDWA 1QVGF 1RLUA 4MINA 1BGXT 1DCFA 4ALIA 3ZE1B 2LJ2A 4PZ9A 1VJRA 5I47A 4H7PA 2OYRA 4M8LA 3UXEA 4JODA 3OZBA 1ONBA 2Q29A 3JASB 4CH4A 4GKKO 1NTOA 3OWXA 4BVJA 2JH9A 1T1EA 1QQ6A 5HF6A 3RK0A 5BWNA 4AKHA 2V4DA 1UFOA 5K0CA 1FJGB 2DM6A 2ZCUA 3ANNA 5HNKA 2QAGA 1NMYA 5HY0A 1P44A 4R84A 5IY5C 3EF1A 4YRGA 5GZ1A 3MIIA 4QRHA 1RI4A 3WTBA 3LBFA 3L7BA 4B87A 1MV5A 2WMDA 3UMVA 2R9RB 3FROA 2EX4A 3BH0A 3WMFA 2P41A 1X8JA 3AI1A 1PP9H 1MFZA 1IQ0A 2CEAA 3I5MA 4Z8XA 2C0QA 1XRSB 1XFDA 3H0CA 3VVMA 4A8PA 2Q46A 4NHOA 2AKYA 2DFLA 5FTLA 4UE2A 4C6HA 5KYXA 1TKBA 4HMQA 1VMKA 1QLWA 3UCFA 2ZEJA 4MQUA 4CQLA 2ACWA 4JI1B 5BSEA 2W71A 2Q6TA 4K3VA 2RGWA 1E5LA 2D1TA 1KJWA 2VPTA 4Z6KA 3I5YA 3SSNA 4XVCA 1HDEA 3QVKA 5JNUA 1Z33A 4FMDF 1N2EA 3UIEA 3ZIAD 4XXHA 4AWAA 1WNTA 3SM9A 3V4DA 3EA0A 3L6OO 4KFSA 2O0HA 4ZOLF 5M04A 2QUIA 2QKYA 1A71A 2AEMA 4BQEA 4IUBS 3SXJA 1MIOA 4CNBA 4N3AA 2A5LA 1L1QA 4FPXA 1XTKA 2ZR9A 4AQDA 5E1AC 5JMWA 2HQSA 3CLSD 1ESEA 4HDKA 2IYWA 1GDTA 1J5PA 3D6MA 1E0AA 5DASA 5EQDA 4CIBA 3D5TA 1TZCA 1U6KA 1W36D 1S2OA 2N74A 1SHKA 4JLSA 2FZ5A 5JNSA 1HDYA 1RLOA 1UZAA 1JIUA 2QL9A 2WYIA 3PFGA 4QYTA 4X91A 3THWA 4FYJA 5K03A 3ECCA 2VRBA 5JNTA 1R0RE 2F43B 4KIWA 1Q84A 5FUWA 3TUJC 2VPQA 1U80A 3DHWC 3M2PA 3I2GA 5BNZA 1FEZA 1HORA 1DQRA 4UBKA 4WX2B 1QIFA 4AKEA 4KR3A 1YI2V 1PFUA 4QX6A 4JLJA 4R68A 1PEAA 4TYMA 5DYGA 2VKTA 3UBMA 4TYYA 4O4HA 4BP3A 1MABG 3LUJA 4FDTA 5B3JC 3HBJA 1RRMA 2ADOA 1MOPA 2ZFUA 1IRIA 4G8JA 4MMZB 4F86A 2XUZA 2A5FA 2ECPA 2Z57A 2DFKB 4FFNA 4RY2A 2PL1A 2Y69C 3RANA 4A92A 4F6CA 4B3SB 4UJ3A 1U8EA 3QSGA 2FMXA 4XH9B 1J24A 3IGAC 1USKA 2IDZA 3BHJA 1JHYA 2KW5A 4BPBA 4G4GA 5M5BA 1FPQA 3G67A 1UMDB 1IUKA 2QMZA 2Z1DA 3E53A 3MS7A 2VTKA 4KFTA 3ROKA 3U7RA 3HR4A 5D3MA 3S2IA 3FBAA 5T4HA 2WWGA 4BE9A 1Z0FA 3SYCA 3F9CA 2OHFA 3P2EA 1XDGA 3FGOA 2IV3A 3LX6A 5HZMA 1VKJA 1TM4E 4HGZA 3O2SB 4PZCA 5TISZ 4BO9A 1UBRS 2B1IA 1XQ1A 1UKVY 4XR9A 4E4RA 1V8FA 2Z2YA 1J42A 4F21A 3HB1A 1SERA 2XYRA 1NTKH 3V8MA 1K2VN 4ID3A 2C9CA 4TKMA 5LYJF 2YWRA 3BD8A 5KOHA 4KAAA 4X1YA 1NA5A 4LFCO 1V55B 1FYEA 4NENB 5EE0A 5I9NA 3SY8A 4B8YA 1SZTA 4GL2A 4B3DA 2UZ0A 2XWPA 4NL4H 1L4NA 1H8HA 4DLKA 4WXYB 1R6NA 4S1TA 3D4IA 3TR5A 1SVSA 3WY9A 3HJFA 2YVAA 4Q4JA 4BT6A 3CLTC 3MOSA 2VNIA 2HFJA 1B00A 1KYVA 2C4HA 1ORQC 3H1HH 2W6JD 3MG9A 4I9UA 4D56A 1L0LH 3BY6A 2SBTA 1YNSA 2ZT8A 3G0GA 3AOEA 4D0RA 2NU7A 2HWXA 4S24A 1FJGO 1KVQA 1Q19A 4B6SA 2GDJA 3IJEB 2QT1A 3LPAA 5EE5B 3UJBA 4LR3A 1QVFF 3ADBA 4LPKA 1AB3A 1DARA 4DCNA 3E1GA 3B7PA 4OHXA 1I08A 4AWXA 2HDOA 5AW8A 1TJPB 3QLTA 4HXFB 4B2PA 3ZJVA 2L19A 3HRHA 4PX3A 5K9ZA 1SVMA 5C8YF 2H63A 1NBHA 4RQTA 1CJTC 1EVEA 2HAEA 2FGYA 2J87A 4PRLA 3ZPXA 1MH9A 4NG4A 4UOZA 4NFSA 1LS6A 4MW3A 1JFTA 3C70A 2O5CA 2AA3A 5CVCA 1SU8A 4XWWA 1BH6A 4LK3A 4M37A 2HYIC 4DCCA 5DCUA 3JASA 1ISSA 3RM3A 5FJ4C 2I1VB 1I5YA 2IKSA 3QVNA 2WFMA 4MKGA 4E30A 2IU3A 1C0KA 3H97A 3ORQA 4J7UA 4KPFC 6NULA 4MUFA 2VWKA 4D8WA 3K5OA 3OEED 4HDMB 3EHEA 2LIVA 3HY3A 4EENA 4F85A 1U0TA 2XLBA 2XNCA 2XZDA 4QJBA 1GO1A 1RXSA 4LVCA 4UHDA 3M83A 2JFXA 4W6ZA 3RJ9A 3SWWA 4WESA 4RWUA 3N2ZB 1KZHA 3FWHA 3K94A 1K63A 1N78A 4OBXA 2LTAA 3JWJA 4Z1OA 1G7TA 1WULS 1QO9A 2FXVA 3PQCA 4RXUA 3OG9A 4HJRA 4C01A 4FLXA 2IKQA 1YF3A 2XIJA 2B9VA 1GQ2A 3O73A 4BJ5A 5JJNB 5ESXA 3AB7A 5HYVA 1OLSA 1GPMA 5DHFA 4Y8VA 1T8UA 2O05A 1K08A 3NCHA 4D3SA 1T0UA 1M3SA 1PWHA 2D59A 3NIFB 3TX6A 1Q74A 1CP9A 1G3RA 3IUJA 4CG1A 4N39A 4AKIA 1TT5B 1JDNA 4XRRA 5DMXA 4ZRNA 3C16C 2VZ0A 3RG8A 1E6CA 5DEDA 3DW1X 3F7OA 2VH2A 4I9FA 4NHEA 3R7WB 4DR2B 3T3DA 1EUQA 3TI9A 4XGQA 5KNCA 1EQUA 3GRZA 3BICA 2XQFA 1PQPA 4MTOA 1BE6A 2YNMC 2UKDA 4WEQA 2OAQ1 1JB9A 3AG6A 4QFMA 5DGDA 2Q3EA 2WHEA 1J9EA 3C3KA 1W40A 4PHHA 1Z35A 3KOMA 1PEDA 4IHJF 1XO1A 1NJGA 4Q9DA 4CKBA 1NC3A 4IQ0A 4MW0A 2VFAA 1P1BA 4JZGA 1I3KA 2Q4TA 1XWWA 3AH8A 1YUMA 4XD2A 4OSPA 3RU9A 4FMCF 1MGOA 4OP1A 1F1BA 4R6WA 2P5TB 4KN5A 4RKWA 3L05A 4CPDA 4R7GA 4IIJB 5I9TA 3VI4B 2HXSA 1PLLA 2WLLB 1QRSA 3H7AA 2O5VA 3KBOA 3TL6A 3UWDA 1X1TA 3O7WA 2CNBA 2BJHA 3EXIB 1QZ3A 4NU6A 3USCS 3VPGA 2NVUB 1AZSC 4AYXA 1Y89A 4AJHA 1GTSA 1XD2B 3GW8A 1CUJA 3UJPA 1JYEA 3VUFA 2R8BA 2CGOA 4F4LA 2E82A 2YVKA 2R6CA 2IEAA 4TXJA 5DGHA 4KXYA 5I8ZA 2FP3A 1G4UR 1TJ3A 1CR6A 1V11B 2JVKA 2QLJA 2YJZA 4FE3A 5JS2A 3ZK9A 2CLLB 3HEMA 1NWHA 3EQZA 4D26A 2A9VA 3I83A 4EHFA 1SOVA 1O57A 1PV4A 2B4TO 2NNWB 2O2IA 4KP7A 5GJCA 2AEEA 3GLFA 2P22C 1H69A 2W4IA 4WH0A 3BX1A 2C84A 3IMCA 3PHGA 1OW3B 5JAUA 3ZU3A 5LQNA 5CFPA 5IT9A 3BIWA 1B8OA 2JB9A 2GTAA 1Y9ZA 1Q6HA 1FRVA 3RFRA 2GSWA 5B6PA 1EBFA 4UVBA 1THGA 1P19A 4B6RA 3BE4A 1M1UA 3CC2F 2FSVC 2WU3A 3LKVA 2NMVA 3LCUA 2NPFA 1JMVA 4O3FA 2X9QA 3BOSA 3PX3A 3QVWA 1HG1A 4HN2A 4MYCA 4RMGA 1UP6A 2VWGA 4OHWA 5B1OA 5AKEA 1BHO1 3PPIA 4EG6A 3I9LA 4JXXA 1GGFA 1ZJ4A 1L5FA 2N3ZA 3ME5A 3UQYS 4RV9A 4PI2A 3WL8A 1HNXB 1HTTA 4J43A 2FMUA 2CLDX 2I2XB 4X7MA 2VT3A 2PMEA 4FGZA 4R8RA 1F06A 2Q21A 3NT4A 3ST7A 4J9UE 2PMWB 1SOWA 3DWEX 5JH7A 3C2QA 2CXPA 1ZPDA 3I6MA 2A3NA 2XX3A 2A0KA 3AJDA 3FE2A 1Z0UA 1FNJA 1RXYA 2CXXA 3D4OA 5CDHA 3LZDA 1NVKA 3M1IA 3SOPA 5D7NA 1C7JA 2C2MA 3ZI0A 1ODEA 2JGLA 2QHXA 5D5QA 4ERHA 1VQOF 2M6RA 2WR8A 4NMHA 4RV5A 5BN4B 4BO7A 3ABIA 1JQJC 4DV1O 1F5NA 1D2DA 4H6VA 2BONA 3KELA 2B6HA 2MR5A 5EE3A 1UBNA 4PPYA 2Y66A 1RP7A 3LU1A 4XYEA 1A9PA 1O95A 4XWKA 3ZCPA 5GIOE 5J59A 4JAVC 1R8XA 2X1VA 2ZXFA 3PTZA 4B8WA 1T0AA 2FYUH 3L0PA 4F06A 4WJLA 4TYWA 2O3SA 1B93A 1LBEA 1I3NA 4P35A 4Q3LA 1KB9F 1JDJA 4K9PA 4XAQA 5KNDA 2H1LA 5C46F 1U1IA 2XUPA 1QZXA 1JH8A 1B6GA 2OLKA 1V4BA 3N8KA 1JJ7A 4IF4A 4Q3DA 1UPUA 1JFRA 4IJ5A 4QLAA 4XX0A 3ELYA 2NW6A 1C1XB 3KX2A 1P2SA 2PUSA 1LZKA 3EIFA 2M32A 1X7OA 1EUCB 1NE7A 3E8GA 1YE5A 2R00C 3PP8A 2EILC 3R0ZA 3A4VA 3HWX1 3C5EA 2JEXA 4RPJA 1YS9A 4Z51A 2D54A 1JEDA 4OMCA 1H4VB 5C1PA 5EB0A 1GNLA 1Y8RA 4URHA 3QVOA 3L9XA 2ZUVA 4DCSA 4MCJA 1LI7A 2I6XA 2QTPA 2XEDA 1RHUA 3TNLA 3A6ZA 3SYRA 1XCLA 1MMFB 4XCQA 3BD9A 1JHQA 1ZLZA 3BIJA 4MQ6A 3NKFA 5DP1A 5LJIA 1AUPA 2CUKA 1NY5A 4H0LB 4CLEA 1OVMA 1SXJD 2MIIA 2RKBA 4AJNA 1QGZA 4MGZR 1ADCA 1ZL8B 4G1CA 2O06A 2Z1NA 4PSCA 2DYSC 3Q5EA 3RYCB 1DQZA 1TCAA 2MYUA 4E13A 2VRZA 2VRCA 3EVTA 1T0JB 3FMOB 5CAEB 3S5UA 5DSTA 2PJDA 1GH6A 1R18A 2C82A 3O85A 1X42A 2F66C 1Q50A 2QQ5A 2FEMA 2R6ZA 2JGDA 3FUWA 2GZDA 3RJZA 4C14A 4DBLC 3P4UA 2D0PB 3B8NA 1EE1A 1Q17A 3RIGA 1GGVA 1QTRA 5DWDA 4TRRA 4G0XA 2AMJA 3SFVA 2A06H 5DOVA 3ML1A 3NETA 1QR9A 3MSCA 4JI8B 3X1KA 4C0AC 4B3SO 1SUBA 2H5LA 3II6X 1Q90D 1OCOC 3RE3A 1PWZA 2DVMA 2KSDA 2XTZA 3TIVA 3I2YX 1KZ9A 4FYXA 2DLDA 3T7CA 821PA 1VPVA 2EYQA 3OLZA 1EU1A 2C2KA 1DG3A 3KXPA 1P9LA 1FVXA 4WFQA 1OCRB 2ZIEA 1KHTA 4ZODA 3S06A 3IE0A 4H08A 4RH0A 2NUAA 1PJSA 1AP6A 1ZSYA 2BM8A 2PG3A 3C4VA 1G2PA 2P9BA 3LOPA 4QO7A 2BM1A 2QZPA 3LSYA 5IBPA 2KX7A 2A35A 2JKZA 2IYTA 3QENA 5C9ZA 2P75A 1KEUA 1XQ9A 4R9RA 4WAUA 2F93B 1DEXA 1TYBE 3KJHA 2OD9A 2DFPA 3F6RA 4YGXB 5T7BA 4M1KA 4ZYUA 4PG8A 1TLTA 2EZ9A 2XUMA 2QDXA 2WJ3A 5GTHZ 3EWSA 3L6CA 4FVTA 4J1TA 3U7HB 1V3VA 1Z18A 3E4CA 4HBGA 1KZGB 4BWAA 1FY2A 4Q4CA 4QJ3A 1IFXA 1YR7A 3EMVA 4N0PA 5DTIA 1NVUQ 3CLSC 4MMYB 4H59A 1KPIA 3OT4A 1DSSG 1HBJA 2PBRA 4DIOA 3KPUA 3UV7A 1GPH1 3V7UA 3GLFB 1V48A 2JGJA 3RDPA 1K68A 3ZEAA 1EE2A 3LWPC 1Q1GA 1XAIA 5E0OA 5FUXA 2IITA 3OPMA 2JIOA 2VXCA 4JT4A 1M1ZA 4PHGA 3UICA 4IIHA 4K6GA 4UAVA 1POXA 4D8YA 4B3MO 4EJFA 1F12A 1O6ZA 3PG5A 4X7PA 3STUA 5TS3A 3TCNA 3TTTA 1B43A 3QYJA 1LJLA 2IH2A 1DIHA 1NLYA 1T36B 3HDJA 1JYFA 5L3VA 4J94A 1TRKA 2BFPA 3ITEA 1PFWA 1ZHHA 5K01A 5ITWA 5MHTA 2PGGA 3K1YA 4OMDA 1T5TA 1CZNA 1QHHB 3T2MA 3W77A 3CVWA 3AFMA 4LF4B 3VZPA 1WUHS 3BGIA 1N4AA 3B1VA 1RKXA 1XRMA 5LP6C 2WMNB 3OU6A 5GOZA 4L75A 4YTEA 2XE6A 4RHFA 5DWVA 1DVRA 2DTEA 3ZCSA 1FLDA 2JJ2A 4NATA 1VRVA 1MOZA 1DRJA 2V3WA 2Q4DA 3B6JA 1L8OA 1T5HX 4I99A 3T7IA 3R66A 2UUCB 1GQRA 3Q1LA 5HM6A 4H7EA 4UCRA 4GKKB 5HBRA 5DX1A 4L3VA 4XB2A 2Q2QA 4QTYA 3RVYA 1JFSA 1BX3A 1T43A 3AFNA 1U31A 1VYVA 2C29D 3VA7A 2HM7A 2D5AA 3VZQA 3VR6A 5A4AA 5JQGA 1YR6A 3TOVA 3Q8LA 5EIWA 1BXZA 2JDIA 1JZSA 2DYSB 3E8FA 4G9GA 4DT1A 1Z36A 1A2QA 2VBFA 5IUNC 2RFLA 4U5QA 5FPSA 3VAZA 2EV9A 1UC5B 3HMQA 4UUJC 3LLCA 3Q72A 3ZH9B 3TKLA 3DDHA 2QWXA 2EKLA 3RYIB 2ZRGA 4ENPA 5EJ5A 3R0XA 1QH8A 2NACA 3KKEA 3AETA 1I7NA 1RZUA 2BSKA 2FPUA 3HBLA 1JAHA 5AW3A 1FD9A 1GPYA 1P0MA 4RDXA 4N40A 5CD1A 3BGSA 4C3UA 3FWKA 2YIVX 4BZPA 3U3MA 4RQFA 3MTEA 3U3KA 1RHQA 3GP8A 1N2CB 3PXCX 4IR7A 3AK3A 4QGSA 4U8GA 4DV7B 4POAA 1JR3D 1IHDA 2C95A 2AFHA 4JU9A 4L02A 4DANA 1OCCC 3FJYA 4TZ6A 2L26A 3CZRA 3E58A 2FZCA 3B6KA 1F0KA 3W2HA 2F3PA 2RG7A 3N0TA 3P9ZA 1NMSA 5ELMA 4A03A 1J99A 4KFMA 5KSYA 2RJOA 3RSFA 1VI5A 4CKCB 2EZUA 3TLEA 3I23A 3K1TA 5K4AA 2OGUA 5JOQA 3UOAB 4JJ6A 1PVOA 2O0MA 2ZQYA 2XYPA 5CT6A 2Y0IA 1TI7A 3AKYA 3C6QA 2HKOA 3CZ5A 1DV2A 3UKMA 3I6YA 5HA5A 4AECA 4EWLA 4OXSA 1VQ1A 2C4WA 1NJIW 2VP4A 1LTKA 4UFNA 4H7DA 4YLGA 4CDMA 2RSLA 1XZNA 3CW2A 4AU1A 1A8UA 1XE3A 1G3UA 1GARA 1B8VA 4IIFA 3K9HA 2R7NA 4UXIA 5JZBA 2W42A 2FN8A 3MXTA 2ZKOA 4OLJA 3U6BA 4NK4A 3VBBA 2X4IA 2G9RA 3COJA 4J0QA 1GAXA 2AK3A 1SD2A 4MV1A 4CL2A 2WFAA 3A14A 3CCEF 1CQJB 2HF9A 2J0VA 5BW6B 1O0CA 1J9ZA 1GUZA 1DP4A 1PWXA 4H7FA 4RKRA 3EDQA 1L5GB 3ILSA 1KPHA 4V0LA 2FQWA 3GI1A 5KTYA 2DXIA 1QK5A 1DTWA 1JDVA 2QRLA 1WCV1 1LDEA 2JAUA 3N9IA 4OYYA 5LDGA 3ZKAA 5LKRA 2YR0A 3UW1A 5EJEA 4OAQA 1QTQA 4H0FA 5HQ3A 3CZQA 3G2NA 2WTEA 3O03A 2B6NA 1EM8A 5CFMA 5ARCA 4KN8A 1Y1KE 2IC5A 4DHWA 4H44B 5DNEA 3W7BA 4B3GA 3ZE2B 1EWVA 1H9AA 5IM4A 3FG9A 2HS3A 4QU9A 4F72A 3JCUZ 1Y8QA 4KI0A 1I2DA 4EJ0A 4OHFA 3AHCA 5LGUA 3CNLA 1FUEA 2QUHA 3ELBA 2ZR3A 3PHHA 2FPSA 2QJFA 5KUMA 3FNEA 3ZG6A 2G71A 4BR6A 5L9AA 4MV5A 3D5QA 3VOUA 5KTTA 4MLPA 3ELDA 3M5CA 4QU8A 4BKRA 5GIPC 2EIKB 2ZT9B 3HL0A 4EY6A 3RR2A 3NWEA 1QF9A 4WOPA 2FSIA 5EVCA 1F8XA 1DCKA 3SKXA 4TVBA 2E1PA 3PNVA 1Q91A 3ZOPA 4ZQGA 5A1JA 1DZIA 3KD3A 3EW9A 4DV4B 2C61A 3U3JA 4P3YA 2ZDIC 3KT6A 4S2UA 2HSWA 4TT3A 1DBPA 2Q3JA 2P4SA 4D02A 3P9YA 1H5UA 3HB7A 4HPJB 1N6OA 4V0RA 5L3DA 1DRVA 1JAYA 4ZJPA 3CJTA 3CLUC 2CV2A 1PJ3A 1Q1QA 1ZMTA 3GCDA 2VSFA 3HXTA 3H0KA 1RYYA 2W2LA 1WS6A 1B3RA 4KYVA 4BNYA 5AVJA 3QK7A 1J2EA 3K0FA 4UFOA 3A25A 3DYVA 1WHTB 1THTA 3KNZA 5HIIA 4CQJA 5CA0A 4GC5A 4K35A 3F2IA 4B4VA 4IQFA 2C42A 1CEYA 1CR4A 1VKZA 5F35A 1TU0A 3R65A 4EVQA 2NSJA 3HJTA 1UJMA 3LIIA 3U4QB 4ZHQB 4L4ZA 2H7YA 1G8MA 1CEZA 3KJKA 3MUFA 2VZEA 1NN1A 1O5OA 3QE0A 5DULA 5JC1A 3VNSA 1QBGA 4YXWG 3D54A 1E2FA 5KWIA 1IDOA 3AL2A 1QUEA 2A94A 2EBHX 3VPXA 5BNIA 2RARA 1KSJA 3IQDB 1FDRA 4MV4A 4C4TA 3RG2A 1VHDA 4EYSA 4OK6A 2PR7A 2X2EA 2WA4A 2NYUA 3A9UA 3G2KA 4Q4AA 3TOXA 2ZB7A 4R1MA 4TYNA 1NSTA 3DUWA 3ZZTA 1FUIA 4TOIA 4PYQA 2W7TA 3N8NA 5BUZA 3CE6A 5HP4A 5A0FA 1UBMS 3P2MA 2P5UA 4DDHA 2IGBA 3GH3A 3WP1B 1ZI8A 3ILHA 4IJ6A 2VWJA 1G6UA 4P4LA 1FXHA 3VSBA 4F12A 2AR0A 3P9CA 3AF5A 2I7DA 3KTFA 2OV3A 1YDHA 2VPXA 4JZ2A 1M83A 2AFVA 2EFCB 2V8OA 1DBQA 4R41A 3D6HA 5EGSA 5K6AA 3BRSA 2CD7A 2XCSB 1ONIA 2WJWA 3E9MA 3MTIA 4F6EA 3HLYA 4NCIA 4BNNA 1AI5A 2BKVA 4C0XA 3CEAA 5KO2A 2AZ4A 1Y1SA 3UO2A 3K32A 4S0XA 3ZW7A 5JUWA 2HT1A 1TT7A 5C8YA 1G3QA 4UCWA 5TARA 3C8LA 1NDHA 3VR3D 5BUQA 1N2IA 4GYWA 4H1TA 4ZYVA 2W83A 3H8JA 1AK1A 4JAVA 2WF9A 3ORRA 3CH6A 3PC2A 1BKDR 2WVHA 4TN1A 2C3MA 3TD2A 3BA6A 1A69A 2A33A 1FBNA 2A0WA 1VMGA 3M6XA 5IKOA 1NTZH 1Q14A 4CF7A 1XEWX 3JALB 3E8XA 4I0XB 4PWTA 2WPDA 3V8RA 1D9XA 3DE4X 3PQ8A 1QV6A 4PA6A 2FW8A 3SYMA 2CFCA 3A1TA 1Y1LA 2QDKA 1EWTA 3JQ8B 4UCTA 3SP1A 4QPPA 1VOTA 3HA7A 3QE4A 4G1BA 3O3CA 4QUHA 3SCZA 2WLMA 1GRCA 2W6NA 2WTXA 2YQZA 4AYTA 2P40A 1P0QA 3BHPA 1TO6A 3UUEA 4C05A 4U8HA 2GESA 1XU9A 5L3QA 2OMEA 4DA6A 1Z47A 5AVQA 1DT3A 2WWFA 3UN1A 4NYMQ 1I2MA 1Y74A 1DJOA 1KVTA 4PW0A 2R86A 1TD9A 1LX7A 2MMCA 4HNGA 2HYDA 5EMMA 7MDHA 1N5MA 2J9XB 5FTJA 3ZQ6A 4IMJB 2G1PA 3RYIA 3G2QA 3UWPA 5IAGA 3NRJA 5IEBA 5CU7A 1CR0A 1JBKA 4ZCPA 3LWRC 4BVSA 1CXZA 1BC5A 3FETA 3GAZA 4DXHA 1MW9X 4R1LA 3T1HO 3LYAA 4Q1CA 4X0EA 4DW1A 2VUIB 5IK2A 3V6MA 5HQTA 4B43A 2PVPA 3OZRA 1A04A 1YA4A 2IOFK 4EKNB 3BRWA 2NU6A 4GLOA 2CTQA 1N5IA 1Z8NA 3R24A 1WV0A 2F6RA 2XR1A 3I42A 1RFYA 4WNYA 1YR9A 4ZMRA 2UAGA 4OJYA 5AH0A 1U2DC 2VYNA 3TIIA 2IUYA 3GFRA 4B83A 1PSZA 1DUIA 2MHCA 4ZQBA 4V2UA 1D7AA 4F3CA 1W8DA 2XUAA 3UPUA 2ZCVA 4RACA 2GD0A 3DTUB 4CM8B 1GMGA 1R0KA 3UNXA 3UGJA 1KORA 1O1YA 3W5HA 3IVAA 5K99A 5LYJA 2WV7A 4G5FA 5FD8A 3OPXA 1PNKA 1YDXA 1FQWA 1ZUHA 4V38A 3DPIA 1EM6A 1VJTA 1NUHA 4JSTA 4Y67A 4I1OA 1QYXA 4FLEA 4IV8A 1DF4A 3CG0A 1ILEA 2RMKB 1D8TA 1Q1ZA 2W6JG 3BK1A 1HDGO 3KAJA 4MO2A 2DHDA 4D7SA 1E59A 1LFDB 4MWSA 4W8HA 5CITA 3IT3A 2R87A 1L5WA 3ZY3A 2C2AA 1RT9A 1HF3A 2OO7A 1PTJC 1GX1A 4HAIA 3K9NA 4B2IA 2O20A 3B77A 1OASA 3MWFA 3AR6A 3UO3A 5E6RA 1P7ZA 3ER6A 4KKXB 4E32A 3N2KA 1ODCA 2WTAA 3K0TA 1NBMG 1PZFA 1UPFA 2G1UA 5AJVB 1QVAA 3U5TA 2AOUB 1IK4A 1QYDA 2OBMA 3OCYA 4JUDX 1DL5A 1NQAO 1VP9A 2GXSA 2XMRA 1NNSA 1QE0A 3CEJA 3BMQA 2VJYA 1QH0A 1JDBB 1O5IA 1UXOA 1TVMA 4K5QA 5L95A 4ARIA 3DOCA 3EIOA 4IGEA 3M82A 2BMJA 4TMTA 3T1TA 2O23A 2ZSAA 5LNK1 5E1OA 5FTKA 3R7SA 3I72A 1DFGA 5IC5A 2DGDA 2UUBB 4BV3A 1HLGA 2M6SA 4QHTA 4D4MA 2O59A 3HKBB 3A9RA 2WG2A 1HR0B 1RHJA 5CBPA 4A0SA 2C4NA 2AF4C 4H3SA 2GO7A 4QJ5A 3ECAA 4IJUA 5DNUA 1A27A 3OGIB 5FL3A 1NR1A 3RBXA 3S3TA 4GVLA 4HDCA 2AHOA 4Q9AA 3EPJA 1CJSA 2GZ2A 2FWAA 2VC2B 4CLXA 5KC8A 1F2UA 3LDGA 1P2TA 3CPHA 2HHHB 4UM9B 1Z6YA 5SZJA 4JI6B 3PHIA 4MPRA 2YQ4A 3EN0A 1JLRA 5FNVB 5KHJA 1NRIA 2O3RA 3Q40A 3R3WA 5HFAA 4NE9A 4IEFB 4M0UA 1REQB 1XI2A 1HLDA 2GNPA 3ICXA 2FPXA 2H2IA 2ZULA 3ENZA 1VE6A 2DKNA 3FTPA 3LUAA 3PKZA 4ZAXA 5HWEA 3KZMA 5CLLA 5G4KB 4EYKA 1H93A 4RVCA 5TT0A 1E2BA 1QYWA 4OXNA 3OURA 1IV4A 3AZOA 3VPDA 2FJUA 1H23A 3B3QA 3V1TC 1YONA 5JQGF 2Z4SA 5JE8A 3UXYA 3NYIA 4KUGA 4OY3A 3TRDA 5IFKA 3T4UA 3T8YA 4YMVA 1VGVA 2ZQ5A 1V7ZA 2HB6A 2Z08A 4MVJM 1KEVA 2QM8A 2OXIA 2Z2JA 1KZ1A 4C4AA 4DADA 3CH4B 2BGLA 4LYFA 2FWIA 1T2EA 1RVDA 3K70D 1FKAO 2GA8A 3KQPA 4EA6A 4LHVA 1ZBQA 1B3QA 1ORWA 4MZXA 3FJ1A 4Q9NA 3BRQA 3AOGA 1UBGA 3DZCA 4IYIA 2WHXA 3C4QA 3C8UA 3H11A 4ZAGA 4YUWA 5BMVF 1GZSA 3QLVC 4TTPA 2CAZC 2EOAA 2BFFA 4H15A 1XJCA 4WINA 4ZAYA 3ZV3A 1HRKA 2COUA 3I1IA 4QODA 2IHBA 3E61A 5CHYA 5L7TA 2H1OA 1E32A 1V5IA 2QYSA 3B9RA 1YC5A 3JYPA 3IKEA 3MYYA 3OX3A 4GEKA 2CHSA 4OB8A 4AN4A 1PYDA 1PZMA 2P6MA 4FSXA 5FP0A 5H3LA 3RFUA 1XZPA 2QS9A 3IILA 2PH1A 1EKXA 1UBOS 3ESRA 1SUCA 4AZ3A 4KQ9A 1L5MA 5FO0A 4EJ2A 4ESVA 5ALMA 5L51A 3D8CA 1XHZA 3AIMA 1OYWA 4II7A 1YRBA 3QXGA 4YXFA 2MSCB 4QOIA 1R5BA 4IILA 3NM6B 4KE8A 3UJDA 4DSNA 2FOXA 2ARHA 1Z2GA 3Q10A 4IQGA 3OJCA 2Y4OA 4I1PA 2EZTA 4DV2O 3L4BA 5KYVA 1SCUB 3WK9A 3SYQA 1PYOA 3DEFA 5AQEA 2G72A 2ZI6A 1BOOA 3A2KA 3TQFA 4AUNA 1CS0A 3IBGA 2B1JA 4G5SA 3I8OA 5F4ZA 3VKGA 1Y3IA 3GEPA 1U2PA 3GFOA 4F2PA 4DCJA 4MCAA 1I32A 3ZY5A 4EMUA 4DMHA 4Q7LA 4NNJA 5T6MA 3G4SF 4J1NA 4K9SA 3U09A 4DJJA 2FF7A 4F6RA 1Z83A 2AIRA 3B5IA 3F3SA 1YTFB 3W9YA 4BNZA 1VQVA 1VF6C 1N2GA 2O2XA 3KJJA 2J0SA 4CH5A 5CBHA 1K7CA 1K8QA 3GOQA 2P7IA 4H6XA 3B6NA 3EZLA 3SHVA 1XA0A 3JU3A 2NXCA 4EMTA 1NFRA 4Q3CA 2Y6UA 3CBQA 1P5ZB 2CB9A 4R1NA 5ALOA 3QWBA 1NXTA 1PZGA 5FORA 3ZTWA 4MR7B 2XZLA 2XCLA 2I2CA 4G8BA 3W5JA 4HF7A 2FOLA 4KV7A 1GVNB 3CX6A 5IBQA 4IKOA 5BVGB 1HGXA 2IPOA 2G5PA 5DHAA 2QLMA 1RC1A 2FU5C 1T2NA 5C7OO 1KU0A 1UF9A 3ODGA 4KV9A 2QMQA 5H3CA 3VGJA 3JAKA 1RM3A 2L82A 1B26A 4UATA 4ZVNA 4DPKA 2W6ZA 3AK4A 4CIAA 4B7XA 3ZQUA 5KHLB 1ZX1A 2QW0X 4PAOA 1W48A 3I56F 4CKYA 1COWD 1NRJB 4OSEA 2GCEA 4NCKA 5IKXA 1VLZA 2V3CC 3I8SA 1G9SA 3LSQA 1AJPA 1LDMA 1VYHA 2H54A 2Y05A 1Q12A 3A1CA 2QN9A 3CLRD 3FVTA 1D6MA 3SC2B 3VR2A 1L0BA 4C2AA 3TPCA 2ZIOA 1GNQA 1WX1A 4HDQB 1UAAA 2CDRA 1NWCA 3EH1A 4Z1MG 3QBDA 1PRYA 3O3OB 1EXMA 3ZD8A 4C6TA 3ZDQA 5DW0A 1Q43A 3DLAA 4CG0A 1HDJA 2XODA 2FI1A 4IJKA 4B0PA 3D4NA 3NEAA 2PUCA 4ICGA 4B9EA 1GPJA 4CEIB 4LJSA 2C4TA 1M57C 1OJ7A 1RXUA 1P3DA 5HRAA 1X8XA 3CH5A 3PU6A 3JZDA 1JPJA 2QORA 3NW9A 3PGA1 5DHRA 5HRUA 3AEIA 2Q99A 3JYLA 1W8IA 4JUBA 1PVVA 1PL7A 4PR0A 3ZE7A 4R71A 1E66A 2A8YA 3I1FA 1JF8A 5HUQA 2R70A 2VAXA 4L8GA 2VJCA 1ZJJA 2ECQA 1X7ZB 3R7BA 4FFWA 3NOVA 3GT3A 4W7IA 4QVGA 5DTRA 1DXYA 2ID9A 2O2SA 3RK1A 4QT4A 3RKRA 3UV6A 4YT8A 5IEJA 4FB5A 1G21E 4CKXA 2XKKA 1GXSA 1WNFA 2CY0A 2D06A 1RPAA 1YQNA 1SBIA 1X6VA 3FMVA 3FNHA 3N05A 3KETA 1RXCA 3IV6A 5IP5A 1JKJB 5BYAA 3RJTA 3UM9A 1ZNWA 3PLAC 1W5TA 1N9ZA 4EPVA 3RRJA 1SN7A 3ZQJA 2JIPA 2WLNA 4GMDA 5AW7A 4XSVA 1QQBA 1HMYA 2DEUA 2AK2A 1KF0A 3QVXA 4OQDA 1E2PA 3OKPA 1ZNXA 1C4WA 1UBSB 2ZJFA 3P27A 4RK6A 4OLHA 1F20A 2HRQA 3L82B 4N8EA 1HLFA 1CB0A 1QYRA 2GJKA 5CVDA 3CSXA 4CQMB 2EKZA 2IW3A 5JZVA 3O2NA 3RVDA 3T5PA 3TF5A 1HEUA 1XRJA 1GN3A 5JVDA 3QUBA 2VYVA 4MZDA 2QAIA 2G83A 5AP9A 1CQJA 1QD9A 1O03A 1OB2A 4E5DA 3R7LA 4AJJA 3UGKA 4R40B 2H4YA 1AZLA 3F8SA 5AVMA 4MARA 3G7UA 1Z38A 3HRKA 5HK8A 2UUAO 3MWJA 3PC8A 4Q3OA 2ATCA 2ISCA 1YZQA 1WWKA 2Z95A 3BE5A 4RM3A 5HE8A 2RK4A 2IZ6A 3C24A 4XBFA 4Z99A 2XD4A 3KPWA 1KAEA 1RMYA 4PC6A 4B08A 1OFUX 3DXRB 1JHOA 4N5DA 3R0QA 4P7FA 4BLRA 2R8EA 2GLUA 1UP4A 1ZCZA 3EQ9A 4FFKA 2X0JA 4QQNA 1IN4A 4WEOA 2IDKA 1J7JA 3IEQA 2OCLA 3L8CA 1CRLA 4I6JA 3KBBA 3PUHA 3ZW8A 4BFWA 1XJWA 4BJ6A 4E46A 1ICIA 1FUYB 2KM1A 2W58A 3OO1A 1N92A 4HGNA 1H2NA 1DKNA 3TXXA 4G26A 5T3YA 1LBTA 3FYIB 2JAPA 1W52X 1BTOA 4XW2A 1YQUA 2E18A 1DV1A 3QVVA 4XIFA 4GZLA 1KZ6A 3QU7A 4M1EA 1Y3BE 2QD1A 3BWBA 2DSNA 2C5FA 1JG1A 3PGLA 5EWLA 1NG9A 3BAAA 2PLFA 3IR6A 3PXAA 2QMYA 4R16A 1GG8A 2P2CA 3C9SA 2HHJA 3DBHA 4WASA 2P2NA 3KOZA 4WKPA 2R1VB 5PNTA 3ZWQA 3KCNA 5GAJA 4KRXA 1E94E 4BMVA 4BTEA 4TV9A 1NQ5A 1PKEA 1RRPA 4TV8B 1YB5A 3AWIA 3TW8A 1JEAA 1FF9A 1ONNA 1NKTA 1G8JA 1UINA 1ZSVA 4PLFA 3ZW9A 5JPCA 1G3MA 2FKXA 4RO2A 2JFOA 1UFKA 2QSZA 4J07A 3PNSA 1OPRA 1YI2F 2B69A 2OUKA 2Y2UA 2Z43A 3AHFA 3BH7A 2HA7A 3D4LA 1E9SA 3Q0TA 4WOCA 4YK7A 1TZBA 2BFCB 3ZVMA 1V55C 4PO3X 3BSFA 5AJZA 1I4OA 2ZBVA 3NOQA 3TTWA 3R20A 2HCBA 4P3PA 1CY4A 1SVKA 4DCMA 3NV7A 5LM3A 2PRSA 1T8YA 2YOHA 1WF3A 5FPYA 1GTVA 4BFXA 1WLSA 2V97A 2BKUA 2IQQA 2HFEC 5BY1A 3A11A 4NCJA 5EWJA 5JAPA 3U9SA 5TGZA 1EBUA 2AXQA 2NP7A 3MGGA 4B45A 2Q7GA 4W8GA 5HG0A 2QKCA 1KFKB 2GTPA 3SOZA 4AY2A 1J97A 5C1IA 3H1KH 4M36A 4LWOA 3NTRA 4BVKA 1IPFA 3BWMA 3QOYA 2H7VA 1D8AA 4WY5A 1SBQA 3FPJA 3ZWWA 1M2KA 5EIBC 4CFSA 1J2TA