3N2GB

Tubulin-nsc 613863: rb3 stathmin-like domain complex
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
427
structure length
419
Chain Sequence
b'REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Stathmin and interfacial microtubule inhibitors recognize a naturally curved conformation of tubulin dimers.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 114
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3n2gB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3n2gB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3n2gB01
5LA6A 3JAWA 4X1IA 4EB6B 4TUYB 5CB4A 5ITZA 2XKBA 4X1IB 5J2TB 5ITZB 5JCOA 3HKEA 1FFXA 5BMVA 5LP6A 3JARB 1W59A 4O4LA 5MN6A 2XKAA 4O4LB 3VPAA 5GONB 1TVKB 4TV8A 5IJ0A 3RYFA 3WGLA 5M7EA 3RYFB 5LXTB 4B46A 4U3JB 5CA1A 5JVDA 1TUBA 5CA1B 3RB8A 3N2GA 3JAKA 4X20B 3JAKB 2VAWA 3HKBB 3JASA 3WGNA 3CB2A 2RHLA 3JASB 4EB6A 4TUYA 3HKCB 4KWEA 5J2TA 5LYJA 5C8YA 5C8YB 5LYJB 5KX5B 5J2UB 2Q1YA 3JARA 2GVIA 4E6EA 2R751 4B45A 3V3TA 4I50B 4YJ3B 2Q1XA 5GONA 1TVKA 4EI7A 3VO8A 3WGJA 2BTOA 5JCOC 5LXTA 2BTQB 4ZHQA 3VOAA 1SA0B 4U3JA 4ZHQB 5LP6C 4LNUB 1Z5VA 4X20A 4TV9B 1W5AA 3JALA 1W5EA 3WGMA 3HKBA 5MN4A 3JALB 3ZBQA 3ZBPA 4X1YA 4EI8A 4WBNB 2RHHA 4YJ2B 4X1YB 3JATB 5EYPA 3E22A 3HKCA 4IHJB 5EYPB 5JQGA 3E22B 3VO9A 4ZOLB 2RHJA 5MN5A 5JQGB 4ZI7B 5FNVB 5LOVB 1JFFB 5KX5A 3RYCB 5J2UA 1FSZA 3RYHB 4EI9A 1W5BA 3HKDB 4FFBB 4O2AB 1RLUA 1W5FA 3WGKA 2VXYA 4I50A 4O4JA 4YJ3A 4O4HB 3UT5A 5JH7A 4O4JB 5JH7B 3UT5B 3C8LA 5IJ9B 1OFUA 2BTQA 1SA0A 3M89A 4LNUA 5IYZA 4X1KB 2VAPA 4I55A 5EIBC 4HNAB 4TV9A 3RYIB 5IYZB 4I55B 4F6RB 5CA0A 4WBNA 4YJ2A 5LA6B 3JAWB 3JATA 5EZYA 4DRXA 1Z5WA 5CA0B 5CB4B 4IHJA 4M8IA 5EZYB 4DRXB 2VAMA 4DXDA 3ZIDA 4ZOLA 3HKEB 5LOVA 1FFXB 5FNVA 4ZI7A 1JFFA 3RYCA 4O2BA 5BMVB 1W581 3RYHA 2R6R1 5LP6B 3VOBA 3HKDA 4O2BB 4FFBA 4O2AA 5EIBD 4I4TA 4I4TB 4O4HA 3R4VA 2RHOA 4U39A 5IJ9A 4O4IA 4TV8B 5IJ0B 4O4IB 3M8KA 5KMGA 3N2KA 5JVDB 3N2KB 1TUBB 5KMGB 4X1KA 4IIJA 3N2GB 4HNAA 3RYIA 4XCQA 4IIJB 4F6RA 1RQ7A 1RQ2A
chains in the Genus database with same CATH superfamily
1MORA 1M1YB 3U40A 1NBIA 1WMFA 3M6UA 5DU2A 5DCLA 1J1UA 1QX3A 3R20A 3JAKA 1UWVA 5AVMA 3DW3X 2OCKA 5G1NA 5KTPA 1AXGA 5CMLA 2YR0A 3RK1A 4F6LA 1TKRA 3ZLTA 1OA1A 4PLYA 1R0WA 3VSAA 4B71A 5LVAA 5EBLC 1ORQC 1EEXB 5A5FA 2F1HA 3U7EB 1XBLA 4OU4A 2BW0A 4LI0A 5EUQB 1E6EA 1MB3A 1XP5A 5FOVA 2PMCA 1TCAA 3B6NA 2XLCA 1SF9A 1C7FA 2ZS7A 4EHKA 2P1ZA 1IZ8A 1FXKC 4R9NA 2ODEA 1FOEB 5FAXA 1JDTA 1GUDA 1GFSA 4LDZA 2WSLA 1P7ZA 4K6FA 2A0LA 1S2NA 1UI9A 4ZEOA 3OW2U 1IXSB 1RRPA 2HOQA 5HNKA 1WPQA 3ES9A 1VQ4V 4A26A 2YJTD 4HNUA 1JOYA 1E9RA 2OCLA 4AJ9A 4Y67A 2REOA 3W5SA 4LNHA 1LX7A 3BMQB 1HLFA 2OHWA 2A14A 3N8DA 2KG7A 2CD9A 2NQ2C 4EENA 1JG7A 3PJFA 1RLJA 2Y1DA 4URUR 3IEMA 1CUUA 4J7AA 2FMXA 3KZVA 1IH8A 3TCKA 4G1FA 2PUGA 1WY7A 2XCTB 4MWEA 2JFOA 1OA0A 3EAFA 3JSLA 1EDDA 2QI2A 1GXSB 1A5BB 1YVUA 3ZUPA 5C7LO 4JIGA 2WFMA 4C08A 1XKTA 4DV5O 2FDXA 3OZWA 4B6JA 2PCLA 3GFGA 4X1KB 2NX2A 4TSFD 4KXLA 3TRIA 3T7AA 2RI6A 3HKEB 1MRNA 3NASA 6LDHA 5E1MA 4PBSA 2UUCB 3GWOA 1CJBA 3TPFA 5KTMA 1SB8A 5FX2A 4C7KA 1S9HA 1EFPB 4XDKA 2QX7A 2M9MA 1USGA 2HIGA 3OWHA 3FZYA 1PDVA 1VI5A 5A6SA 3ZHSA 4FS3A 3AM5A 5I5GA 1MMMA 5JVDA 3ZBTA 3LLMA 4W5TA 3A2LA 3JV7A 1NVKA 1CLIA 3GFTA 4D7AA 4E5MA 2JJMA 1R66A 1ZCBA 2CLMB 4X9QA 3ABQB 4QWMA 2CNNA 5BN1A 1YS4A 1YZBA 3M6VA 3TI9A 4KXFB 1RI3A 2BMJA 4BIIA 1XN1A 3NEPX 5LQDA 2WM2A 1URPA 2R1TB 2RI0A 1CR2A 3C8LA 1Z4NA 2GBFA 5TPWB 1NUQA 5EN4A 4WK6A 4BIMA 4R0MA 2B6NA 2WAAA 1R0SA 2OMEA 4BQPA 1ADGA 5GGXA 4ZDJA 3GR6A 3KJIA 1SNYA 4J0QA 1XSEA 1PDOA 4JI7B 5BSFA 3MWFA 3ZV4A 1LLQA 3GCXA 3ZCRA 4EHBA 3EQ7A 3QLUA 2JA1A 2IEZA 5DM0A 1CK2A 4A5SA 1OXXK 1NA5A 4KDFA 4G85A 2IHUA 5JH7F 2RE8A 1VSVA 3NHZA 2IDJA 3PPWA 2QM7A 3P2KA 4ZQEA 1GNLA 4CRWB 2DPXA 1W4CA 4YQZA 5IU6A 3CISA 3GPDG 4ITVA 2Q4TA 3JARA 1U5AA 1YZLA 3LCMA 1X80B 4CMJA 1Y7LA 1KD1W 3E53A 1EGVB 3DE6X 3MMNA 5K0NA 5DOZA 4X7MA 4LP8A 3KX2A 3OLZA 4WBNB 5KTKA 5BORA 3W04A 2Q4BA 3C14C 2O8DB 2OPBA 4RD3A 3PXBA 3B53X 3G0IA 1P91A 1QQ7A 3VR1A 2QMQA 2JD2A 4LC1A 4B43A 4JGBA 3CLRC 5CD9A 4HK4A 3GT7A 5K2MA 3UAGA 3M4NA 3M0EA 1I14A 3AHEA 5FLXN 1E7SA 4CS2A 2FETA 4FIDA 5F2NA 2QTSA 4ZI2A 4MQMA 4Y8VA 3MHHC 2HBQA 2HR3A 2W2KA 3C3WA 1MJGM 1GTRA 4G2NA 2AZTA 2BRUA 4FZVA 1Q84A 4H3VA 3UUEA 3CC7F 4Z53A 3QW2A 2OGUA 5CXXA 1YKFA 3ML1A 3KOYA 2JCBA 5K3CA 3R5KA 4I6EA 4QJ3A 1NBMA 2PTHA 3NUQA 4B6FA 1C9DB 1FYEA 1MAAA 1OASA 1BJTA 2G63A 2QE7D 4EGSA 1ZITA 1YBVA 4CLOB 5HKOA 4IGKA 4G97A 3UHOA 3UW3A 4F5DA 2VQFB 4KYTA 2PH3A 2FEOA 3ZWQA 2QN6A 4B79A 2HXYA 5BQPA 2IXFA 3CG4A 4RK4A 3EZXA 3PDIA 3QBTA 1T3LA 2IZ0A 5LMZA 5IWAO 4PAOA 2PUFA 5I7HA 3WGVA 2QBYB 2IE0A 4OXIA 3L46A 2X7JA 4L3VA 4G0OA 2PBZA 5BVGB 3PHCA 4D3YA 4MWDA 5DM4A 1S3IA 2NU7B 1V8PA 5K0FA 4K8OA 1MAWA 1VHLA 1VQLF 4MAFA 1A2QA 1IHUA 3M6WA 2OCCB 2W6MA 3VR4H 9LDTA 1MX3A 4MTXA 3HL4A 5AVKA 1CB0A 4MYSA 1I7QB 3D1VA 4HMQA 4KXWA 3DFKA 2FEXA 3E4DA 1X7DA 3RGBA 5HIJA 1WNTA 1R6BX 4L5BA 1ZRHA 1I30A 4MO2A 4XM2A 4HAUA 2K9PA 4OMFG 1TUIA 2ZYHA 1TTHA 2WQ7A 1O6GA 4JYAB 4DJ5X 5AR1A 4PNEA 3RR2A 2RK4A 1I3OA 1VJRA 1A7JA 5HX7A 2XMDA 5YASA 1RJFA 4CLRA 4H0LB 4HN2A 2XKJE 5DM6V 1U65A 3I6BA 2WJZB 2X4IA 2QN9A 3Q7QA 1EUZA 2H08A 2HW8A 5KJEA 4O29A 1XU7A 4RHFA 1IPFA 2O2JA 4CNQA 4O08A 2Q7DA 3K4PA 4IDEA 2IHNA 5EFZA 1LKZA 1QCEA 2ATEA 1NVAA 1OX5A 1VZ3A 4TUYF 5J2TF 1OKKD 2JRIA 2YXEA 1QPZA 5FUBA 1FC0A 3C39A 3IOBA 5HIAA 3NNNA 2CE2X 2RDCA 2BEVA 4M0PA 5A4JA 1CEXA 3KEOA 4NJOA 1OXUA 4B73A 1SVNA 4OBBA 4ES6A 3ZBHA 2IIQA 3D3NA 5ALDA 2VQEB 3D7MA 4CG2A 2PANA 1AKRA 4US2R 4YHHB 4J6FA 4TZKA 1DBRA 4D4IA 4WFIA 1VG1A 5JAIA 4WOBA 3HBFA 3L05A 2VLBA 2GAJA 4D9HA 3C87A 4YWJA 4KI7A 2WP8J 3JVDA 3FGOA 5ECGC 2ZRHA 4K9LA 4MUXA 4HWKA 1Z15A 2ZD9A 6YASA 5EK0A 4B1FA 3KSMA 4IWXA 2ZRDA 3GDFA 3WGHA 1ZDMA 3T5PA 4YAFA 4KW7A 1J0DA 5FOWA 3V48A 3ZU4A 2IHYA 5A4FS 1GPUA 1B0UA 5AJTA 5F98A 5I4IA 1J09A 1DXHA 4KO4S 4WNCA 3ITEA 3ELDA 2RGNA 1BRTA 2JS7A 1L6IA 4D9NA 3VDQA 2HPZA 3TVYA 4EG7A 3R8CA 2ZWMA 3DWFA 5FOSA 5LL6P 1DFHA 3HA7A 4EHAA 2G8LA 1LC3A 3L18A 2Q5FA 2QT0A 3HY4A 1GRVA 4CL0A 4TLMB 4ENPA 1NMUB 1GM7A 1V6CA 1BVRA 2HS4A 3EGCA 3F5TA 1EFKA 5DNVA 1Q86W 1FTQA 1M8KA 1CERA 3W7UA 1ZK2A 3FMPB 4HWGA 3ZN2A 2KTUA 3D2BA 1VEWA 1FFDA 4BFTA 3QVVA 4DV3O 2XIJA 1V6SA 2QUBA 3R6DA 3P0RA 5DN9A 1WHSB 3GAZA 1W0JD 5C8YB 3C3JA 5KX5B 3HL0A 4DV2O 1R6VA 3NDBB 3SQDA 3UMRA 1ISJA 1Q20A 3IAUA 3LUFA 4OQFA 3DYIA 1A97A 3U4MA 5K4AA 1HBJA 2UU9B 2CYBA 1E4EB 2WWIA 4KWCA 2UXCB 1C30A 4EY5A 1FRNA 2WWGA 1B1AA 3UGTA 5IFKA 3BXXA 3DT8A 3KWLA 1JIVA 1BN7A 1G3QA 3DMGA 4MUGA 5ITVA 5KSOA 3FXAA 4OL0A 3W5IA 4RDHA 2BEKA 1N3IA 4IDCA 1YZGA 1CK4A 5EBWC 3VBBA 3H42B 5DGHA 5F5NA 4CH5A 4KQMA 4EPTA 4F6RA 1L6RA 5JLJA 3NIGB 3MBOA 3GH1A 3EVKA 1VQ8F 5M3BA 1K88A 4ESVA 1KORA 4A27A 1HE4A 1TA0A 3E9QA 4FMCF 2H8GA 5L6MB 2TMKA 2CE7A 2CMFA 3OZGA 1L8LA 2GFIA 2CSLA 4DCTA 3E2IA 2CBZA 4XFDA 2IW1A 1XZNA 3FWYA 3Q3HA 9MHTA 1K8AW 5K9ZA 1B00A 2NZVG 2OILA 2R1VA 1GY8A 1E2JA 1NXQA 1N6KA 5EPEA 1XDGA 1K7CA 5EIWA 3S44A 5KYUB 1W0CA 4QHTA 1YI8A 1QP7A 1I01A 3ZK8A 1H1LB 3PUZA 4H7JA 4BB9A 1FLNA 4BVRA 1VRWA 5EQDA 2V7QG 1E9VA 1V9SA 3ESJA 2GPNA 5GINC 1ZJ6A 2II6A 2A9KA 2IAFA 2WKWA 3VH2A 3RT7A 3M6LA 3OZEA 5DTEA 2XHZA 2QD2A 3K1TA 2NNWB 5JMPA 4LXQA 3ZWYA 1FUKA 2GN8A 4BQIA 2GS9A 5JHGB 4NICA 5JPDA 3MCTA 5IT4A 5M7EA 1PDWA 3SQOA 3BSFA 4ETWA 1FXUA 1EX9A 1GHTA 5HQ3B 1LEHA 1RRFA 4GRIA 3FM9A 1P5RA 5FOXA 3PI6A 2GVIA 4TTQA 2FEAA 1JNXX 3AW9A 4G37A 5EPUA 4IGFA 2XWJI 1Q0ZA 2BCGY 3W5JA 3K6KA 4HZUB 5KJCA 1NW4A 3S03A 3R9XA 2CCKA 1R0LA 4MXDA 3IEVA 1DRVA 1PEAA 2HQ1A 3O73A 3TLMA 2BEWB 1MW9X 1T5BA 3EYWA 2X5XA 4N5IX 2C9ZA 1JQKA 4WXEA 3IAFA 2PIAA 1G2IA 1Z5WA 5DJ5A 4MVUA 3IOMA 4MKFA 1L5KA 2CVHA 3UG6A 1C3EA 3EPKA 1OCOC 3WMFA 1E9BA 3TBHA 3D8NA 2CHVA 2JEYA 5T8KC 1Y67A 2KQXA 5KVSA 4P5DA 3PVSA 4LV5B 1QO7A 3DO6A 3P9ZA 4YJ2F 3NC1C 3JYNA 3Q5DA 5FNVF 3IXQA 3U6BA 5JAOA 2IKQA 5HFAA 4I1RA 2PI5A 2DTXA 4P0QB 4H3HB 3KKOA 1UBTS 3LJKA 4D5EA 3ISTA 1YKGA 3EIWA 1BCSB 5FWDA 5H81A 2UYQA 2MSEB 4K9DA 1QE5A 3CZRA 1TNDA 4Q4DA 4EX6A 4FGSA 2ZANA 3ZJUA 3HEBA 4YUYA 2ZBGA 5ECYA 4DCUA 3U1VA 4AJ2A 4ZALA 4D7SA 3WISA 3RPEA 3NDJA 5HXAA 1XZPA 3UJ3X 4DADA 4PXSA 5DULA 1C0LA 2Z5VA 2YQZA 1G4HA 4TYYA 3ZD6A 1TLFA 1O94D 3N7TA 2ZCEA 2DYSB 2P4KA 1YMQA 4AB1A 4EB6B 1M1YA 2FSUA 2I87A 2A0UA 3KDAA 2YI9A 5LIRA 1L1FA 1EQUA 4BECA 2HXGA 5DYTA 5AM0A 1KY3A 4UBOA 1JDNA 5H9CA 4RV4A 4PLHA 4D4KA 4MDEA 4BNFA 3T3MB 1Q92A 3OZVA 3EF1A 2WHEA 3HAXD 1PD3A 1GKIA 4BNNA 4IHKA 3RRZA 1N2CB 1LTKA 1OAPA 1SZXA 1Z2DA 2C1XA 4PHFA 1KNXA 1RWVA 1VF5B 1HQYE 2Q28A 1FNDA 2AYZA 3GLIE 4C07A 1H2BA 1Y7HA 3C3TA 4W63A 3TCXB 3ICXA 3O74A 3RCBA 4BV9A 4N5NA 2XSZD 3LCCA 2VRZA 1EUYA 4G0XA 3PQ5A 5A3VA 2Y8EA 2XVXA 3QEBZ 4YWHA 2QROA 4OF4A 3QE4A 5DIFA 5IK2D 1IHPA 2ZAUA 3NGXA 3T3GA 5TMEA 2FOLA 3FNFA 2Z08A 2DOKA 4IM7A 3IAM6 5A9SB 2Q8PA 2QGNA 2X8WA 3M3DA 5IM4F 2AOVA 3LCUA 4ZGWA 2HTFA 4JELA 3RRFA 2W8BC 3JY6A 4HLUC 4P2GA 1ITZA 2XRZA 2PZJA 2QD3A 4GMGA 3FAKA 1F4VA 3M5CA 4B7CA 4ZOLB 1GXSA 4GOOD 2XQFA 4ZZ2A 3OJWA 5AVJA 2LGJA 4OH1A 1HMYA 4FZRA 1TQ8A 2GXSA 2IYFA 1SJ9A 4B6GA 3TQFA 2HQBA 2EZOA 1SHZA 3CCVF 1ZH6A 3FPIA 5HKAA 1PR2A 1ACJA 3GDGA 3IO3A 2CWWA 5DSXA 4O3MA 3GJ0A 2YOGA 5A5GA 5ARBA 5HCNA 1Z6AA 2NVWA 3BH0A 3U13A 2FAXA 2Z9DA 1EFPA 3R7SA 1G7TA 1KAMA 2IOYA 4MV9A 4PD4F 4WEQA 3GVCA 2V7WA 2ZU6A 3TQSA 4LF8B 4DRYA 2DVMA 5B66Z 3OZXA 4Q9IA 4IO0A 1E3LA 4GDFA 3R7FA 1CDOA 4CEHA 2IOFA 3ABOB 1QK5A 1PR1A 4RKEA 2QZJA 1WW3A 1WDMA 5K3SA 1T0PA 2QR3A 5I9LA 5JSKA 4NONA 4EY4A 5B3LA 5DHSA 4CGZA 1NDHA 1X2BA 2AHYA 1FA9A 2KLHA 2R1TA 2JVDA 3SF0A 1YB7A 3VKHA 1AJQA 2W11A 1LK7A 2OB2A 2DT4A 4EK9A 3VC2A 1UWLA 3M89A 2I62A 3LW7A 5JNLA 4AX4A 3OOSA 3L5KA 4JEHA 1RKXA 4WCFC 1E8MA 5LB4A 4LY3A 1E69A 1KPHA 3OKCA 3HCEA 3VR0A 3CX3A 4E2WA 3KDSE 3N28A 2L69A 4H7FA 1JFLA 1H48A 1XT6A 2VQSA 5H4HA 3FETA 2X8JA 3F7NA 3EVBA 4IUBS 3K0TA 1BG6A 4WFKA 3SPGA 1YCGA 2GVDC 3LOUA 2OA0A 4EG4A 3FNGA 4F04A 3HY6A 1X80A 4L0MA 3I9V1 4LGCA 3A9UA 4PVDA 3UWSA 3UMSA 4DV6O 3SLKA 4RTPA 3REFA 3YASA 4E15A 3TL2A 3BMNA 1ML3A 3DMNA 2K7ZA 1M2GA 2IYRA 4TYQA 1WSAA 4B4DA 3OY2A 4U2CA 1PQWA 5JALA 2FW7A 3KYDB 4U2BA 2VDJA 3RK0A 3VPBA 1O95C 3JWJA 3SCZA 2B9VA 1YVWA 3CLUC 4LXHA 1HYGA 1QB8A 3O1IC 3FKSD 1RNLA 3L7OA 1N4AA 2X3YA 621PA 1YJBA 5FBQB 4P54A 4P4NA 2EILB 4Z3OA 1GN9A 4PZEA 3WYFA 2R25B 2AJTA 4Z7OB 3LWOC 4F5EA 1ELOA 4RZ2A 3VJKA 3AIOA 5LMCA 3LM8A 3HACA 1KOGA 4TS4A 5TB5A 3DFIA 1ENOA 1KE1A 1TEZA 1NXXA 2BE7A 4UV9A 2HSEA 1GQRA 1XZ8A 3H0KA 4PANA 4WQMA 4CL8A 4MW7A 3KG2A 4C1BA 4IDFA 2ZREA 1RT9A 1YHQF 5IT9A 1CZHA 1E9AA 4CLOA 5SY6A 3I83A 3B3GA 2XMGA 4FEYA 1CJVC 1R6XA 3IB3A 4HXEB 1V43A 2DWOA 1T5HX 5C8VA 5EGNA 1T8UA 4IY1A 4L7VA 2XEXA 2PT7A 5F7OA 5IJZA 3WGZA 4LBZA 3QX9A 1LW6E 4DJDC 4YUXA 4X3OA 1V54C 1DP4A 4GU5A 4TL8A 3W8NA 3SE0A 1GCGA 1OHHG 3FCAA 3S8YA 3FPLA 1OIXA 2B3DA 2QBYA 2VK4A 1ONIA 1E63A 3H2KA 1MCZA 2OP0A 2RH8A 1GPJA 5JVDB 5B30A 3F8TA 5BVGA 4D5GA 3T3PB 4DDMA 5E6SB 3UMBA 4CDMA 5TE9A 3RWRD 5B6PA 4Q1DA 4NRDA 2V5UA 5B5EZ 4C0LA 3NBFA 3WK6A 4GOJA 3K0BA 4Z7JA 5SY4A 1I5YA 5J5CA 1KVUA 4GSYA 2JCXA 5TPZD 1OLUB 2ECOA 4LKRA 1XV2A 3KXIA 4DQVA 2EIJC 2HX1A 3M6IA 4RACA 1TZCA 3L04A 1UPGA 4DLWA 1FLDA 1MIOA 4A2WA 1UANA 3OU6A 5JDCC 5C4IA 4QVKA 2GBIA 4GMKA 3QTLA 3T4PA 4Q01A 5DW3A 4QUIA 4A6XA 5BV2P 1TFRA 2WWFA 2C5SA 4P32A 4CW7A 4MH0R 3BICA 2PJRA 1I6LA 4JJAA 2GKGA 3OM3B 3F49S 3KJXA 4JNCA 1VXOA 3EVFA 3SKVA 2EXXA 1E3MA 4YCSA 1H2ZA 2CVPA 2VT7A 3C3YA 4A6DA 1EZVH 5EEGA 2LFRA 3H9GA 4CUJA 4YV0A 3OEED 4FINA 1E3QA 2NGRA 3W6UA 3PZBA 1P7VA 4CEJA 1C7IA 4MS2A 3FPJA 4ND2A 5CLIA 2P27A 3RC1A 1DXYA 2XMBA 1AVTA 2V7QA 3IUYA 4FYWA 3JARB 4D8VA 5CBKA 2X0DA 5I9TA 2YDYA 1G8HA 2Y92A 5DCWA 3GB9A 3IXLA 3QEOA 5AXBA 4PA4A 1D9ZA 1QV7A 4JTAB 1YZUA 4L0QA 1YE5A 3HMKA 4WFJA 5J1TB 2ZTHA 2VUUA 3F4BA 1OIWA 2YI8A 2GBOA 3ZTWA 5IF3A 3FA2A 2FN7A 3W3AH 2GZ2A 2P5OA 1W0KD 4Q5IA 3EDQA 1T5IA 5AW9A 4IV0A 3PC8A 4MTFA 2W2KB 3KZOA 4DLSA 1N78A 4PZAA 2ZJZA 2P3OA 1BKSB 3HFSA 3ZGNA 4I1PA 1TEVA 1OZFA 3MAAC 3C1AA 3ZCSA 1U3VA 2OLJA 1AS3A 3NJ4A 4DG5A 1B8UA 1KYQA 1G59A 4ISBA 4N1AA 2F8SA 3A2KA 3KHNA 5K8CA 2XWQA 4DMHA 3ZGLA 1KIAA 3ETJA 4YUVA 4KMSA 3GLIA 3H1LH 1F2DA 3L4SO 1T2FA 2XOXA 4KIFA 5CVDA 4LQLA 3OF3A 1YB2A 3LZCA 1SU4A 4CCSA 3TSOA 2ZDIC 2QT9A 3FLBA 3T7IA 2R11A 5G41A 3WAGA 4DLNA 1CY4A 2G70A 3AM4A 3ROPA 2B7LA 4CF6A 3STZC 4QRHA 4FIZA 4YAJA 2VDWB 2OG2A 1C2YA 1C8KA 1E1KA 4O2BB 1NVTA 2FZWA 2BP7A 4L50A 1GDHA 4IEIA 1WF3A 1Z0JA 4US1R 1SBQA 5IT5A 4QO7A 4QGAA 1EVYA 1UBMS 4RD1A 1Y5RA 1XMIA 2G5GX 3M4JA 3Q5EA 3SX4A 3QPUA 2W98A 3G8CA 3ASNC 3TMAA 2XUDA 1GGFA 1SC1A 3PD7A 2OHFA 1PBTA 2QVBA 3LI2A 1HI9A 4LRUA 2FSGA 2JJ2D 1WHSA 3NHSA 4YI3A 3JQEA 4AN1A 2ZR2A 3A3NA 1VHJA 3WLPA 5C8YA 1E5DA 4I19A 3CEPB 2FMHA 2XVZA 4YMUA 5LMUB 2ZUCA 4B3RB 3KOUA 3ZU2A 1ZCZA 2QG4A 5A0TA 1Q21A 5P21A 3MTEA 5AOCA 1E4EA 3L0CA 3SNHA 2C8JA 2R00C 5JTTA 1AROP 4AY3A 2FRDC 3TBKA 5D5PA 3ITKA 1O8CA 4EMUA 4X92A 2Q3HA 3PU6A 5FT9A 5ANRB 3RSLA 4LRXA 5CHEA 3AF4A 2CCJA 3GRYA 2GJAA 4XCVA 1T2UA 2YHSA 3GEHA 4QXAA 4WZ6A 1FDIA 2J3DA 1V2GA 2XA1A 1VP7A 4CM7A 2YS6A 4CLRB 4EHJA 1NMQA 3C98A 5CH5A 2UYGA 5ITSA 4Z54A 2H9YA 4HEJA 4FE4A 4MW3A 3R3HA 1KUQA 1E77A 2YWDA 1EK0A 4JOSA 1R4ZA 1HL3A 1YHYA 3A26A 2CUKA 3UJDA 5EY5B 2WTBA 2XR1A 1H2GA 1MEEA 4V0QA 3IVCA 3FB1A 1H4QA 1VQ1A 3AMVA 3FBGA 4OI1A 4RIHA 2H7CA 2XOEA 3KO8A 4AWXA 1R3KC 4JTCB 3I6IA 5KYUA 5F4BA 2VZ9A 4TT8A 2BEVB 3Q10A 2WKRA 4L28A 2ZJ0A 1D0VA 3EIEA 3DUFA 2XCQA 1AR5A 3T0FA 3ICCA 1M1KH 5EXEA 3QTYA 1H1LA 4BRSA 4KE7A 2ZTMA 3BK7A 2WNHA 5TISZ 2VYND 4X88A 2YXNA 4XDLA 5MDHA 1FXSA 1Z4JA 2WHQA 3R6WA 1VKJA 1DGSA 3BMXA 4BO0A 2R87A 2ACVA 3FMOB 2EU8A 1BMQA 3GT0A 3VDMA 3SSAA 4X0EA 2AC4A 4MV6A 3F6EX 4IDBA 1PR4A 4IIYA 3KOXA 4B0PA 3QU5A 3IKJA 1YRQA 4RVFA 4EPRA 5KHIA 4N0MA 3CCLF 2CVFA 1KO7A 2VP5A 5HFMA 2ERYA 3WG7C 4IJWA 4JAAA 4A2CA 3OKPA 3PXAA 3A1WA 3DE5X 1Y6RA 5KYKA 3AEIA 2BSXA 1I4DD 1GZUA 4YUWA 4YMSA 2IG8A 2A94A 4BVFA 3W6NA 3U3XA 2QZ9A 1DRWA 1GWNA 1IHXA 4R4JA 2ZYUX 4P5EA 2AC2A 2O4UX 4HZUA 1YDEA 1S3FA 4D3DA 2OTJF 2IUFA 5A2QM 3FDZA 4D8TA 2IYNA 2B25A 4DHWA 1I5RA 1FDVA 4Y2VA 1XQVA 4MQFB 3OF5A 3PYMA 4LSZA 1NBMG 2WG0A 4NCIA 4FOLA 1NUSA 1N34O 3L9XA 1LDBA 3DBLA 2VNJA 1WWKA 3UMCA 4CV2A 3IT1A 2CGOA 4Y1GA 1RYHA 3W4JA 4FB5A 2OCGA 1CJSA 2AZMA 5CFZA 5NULA 3O26A 4BW0B 1NQ3A 3OWOA 3L07A 2D3WA 1XJWA 4H0NA 3ROXA 4OQEA 1KEEB 1R9GA 2DP4E 3DOIA 3FR7A 4QLOA 3AEYA 5LQNA 4YAEA 1BCSA 3ZW7A 1C30B 3T4ZA 1P4RA 1ZJZA 5AIBA 3TFOA 1FFCA 1GAWA 4PHTA 2BHTA 2QVCA 2J33A 4P4LA 1Y89A 2P0AA 2X1VA 3EWIA 1AQ6A 3LWZA 4GC9A 4R8VA 4EJ2A 1ZKMA 2WFZA 3K0CA 1Q3EA 3ZP7A 1BZYA 4MVJG 4OFWA 2VRWA 4L4XA 1NYRA 1IBCA 2IJHA 1G8PA 5CFNA 4F6RB 2J5QA 5FORA 3L6OO 4MUNA 2C92A 1AMOA 3V46A 2VRCD 4UXJA 2XAQA 2VF2A 5ARDA 3JPYA 1I5OA 2OHOA 2Z2JA 1G6UA 4ALLA 3KXDA 1E1CA 3O4VA 2V8OA 1P5FA 5F64A 2F67A 3T7SA 2C2BA 2X77A 3RTBA 1WTCA 3TW8B 1G8GA 3COYA 4HPXB 1WO8A 3AR6A 3H1HH 1WQ3A 2Q1SA 4M98A 1NKDA 3I45A 4B3SO 3BPSA 2A58A 3FYCA 4LF6B 5DECA 4GS5A 1N4DA 3SHTA 1RR6A 1QHEA 2VK1A 3H4MA 1W5EA 1RC0A 4OPMA 5JY1A 3AR9A 2D1TA 3KKPA 3HB0A 1Q6YA 4ZEMA 2H2HA 1U94A 4QJIA 4XWAA 3MFYA 1GITA 1K34A 3IT2A 4NAHA 2AG6A 1HEIA 1RVV1 1T1RA 4E1BA 3B51X 5EHZA 1X7ZB 1Y81A 4CKBB 3ZDQA 1U3UA 4ESHA 3BB1A 1B3RA 2VZ0A 2O05A 3PPVA 1NU6A 1XALA 1NZJA 1FMCA 3HCOA 4R6WA 4C2TA 1GG2A 3DWIA 1MOQA 3G5AA 3RC8A 4QFMA 4I8IA 2ZSUA 3OTQA 4E6PA 5F5LA 5FADA 3QIVA 1QHIA 5A9SA 3ASOB 4GOLD 3N0WA 4OMCA 1NQOA 2YYSA 3FX2A 4MVYA 1G0NA 4V0RA 2W0FC 1OCZC 2J9ZB 1UBEA 2FWBA 3A10A 1Z5VA 1LPNA 1MABA 3S99A 1KC1A 2WMYA 4X1YB 4Y2SA 3KDPA 4RDIA 4CM8B 3AVWA 3ICVA 3UXHA 2HMUA 3II6X 3PNVA 2FFJA 4R2XA 2EIXA 1L0NH 4RESA 3ENNA 3OBIA 3L8FA 1MJ5A 5HWEA 2KE5A 3AUUA 2AD5A 1SUDA 1KFCB 1USKA 3JCMM 2X4LA 3GT4A 4ADSG 5KB3A 1FRVA 9ATCA 1C1DA 5B8FA 3A9RA 2P2GA 3H04A 1WHTA 2R72A 3B9PA 3P9IA 5HILA 1DPFA 2ZIZA 1DAGA 4NSNA 3Q2KA 4MGEA 5HOQA 1XEAA 2WQZA 3SYTA 3OOEA 5MN6A 1KL7A 4NOJA 5FLXA 4B48A 5IJ0A 1ENZA 3H9QA 5K3BA 3O83A 4G5XA 2X3UA 4A4DA 1KSGA 4PPQA 5IAEA 3M4SA 1AB3A 2ZYAA 3AFIA 2IJJA 1S77D 2CEAA 3EG9B 1JU4A 1U1DA 1J07A 3I5YA 2E4ZA 5ILQA 2MSLA 5K4HA 3H65A 4JLPA 1X59A 2VNSA 3L74H 4B2LA 4UNRA 3COZA 1DXOA 3INRA 1WD5A 5C1OA 1JX6A 5EP1A 3F4KA 1YJXA 2M6YA 3V6LA 4WACA 1Q1GA 4FC6A 2XGMA 4QXQA 3T1YB 2P77A 3LHFA 4TKLA 2QV7A 2FPLA 4RVUA 4UDXX 4CF4A 3ILVA 2KB1A 3NDPA 3PICA 2YEVA 1P9WA 3SC3A 4P7GA 3JAWA 3EK2A 2C4VA 4JL5A 1PF7E 3CPSA 1M0SA 1DT5A 1I2BA 1PFQA 4ZKEA 2FWPA 3WDLA 4CV1A 4MX8A 1NXPA 3ETLA 1KI4A 3K5MA 1CUYA 1T0UA 1O1YA 5MF6A 1ZN8A 3V42A 2FC3A 3RBXA 1ZUNB 3M5PA 2QA5A 2BGGA 5DTJA 3L7NA 4ALNA 3MCVA 2CL0X 3HG7A 2XE8A 2Y9PB 3UQ8A 3A4TA 4RVNA 3RABA 1T0AA 4QBKA 5AW7A 2GXUA 3I61A 1T5LA 5T4FA 3OD5A 3KYDA 3L1UA 2A1IA 5C81A 3AB3A 4EVSA 1IRIA 5CLLA 3WDKA 1N0HA 5FYQA 1BHAA 4NBWA 2J45A 3T12A 3OETA 5L3RA 4ZT5A 3P1JA 4EKWA 1YDFA 4DR4O 5KINB 3UKMA 4ER0A 1KC8W 3VR5H 2YWGA 1E7MA 1TGVA 2JD0A 1EAMA 2FOXA 2WP0A 5CBGA 5D00A 4P8RA 1JFSA 5LBQA 2P5YA 3PL5A 1E6WA 3OMAB 1SM4A 2G71A 4LWQA 4XTRA 1SVMA 1E1QD 1Q77A 3L8CA 4JI4O 3RUDA 5HK9A 3NM6B 3TAUA 5I7VA 1A96A 4XDYA 4XLZA 5KSPA 4FWTA 1LLDA 3EVAA 1B6TA 4QBIA 3M4XA 4IOKA 1JTVA 4UBNA 1FS0G 2GZ1A 4R7ZA 3T61A 1ABEA 4J9ZB 1LPOA 1TGOA 1CF2O 2BGLA 3OH8A 1QKJA 5HJ2A 3NYWA 4GFDA 1LLFA 2VTBB 5JLAA 4R3WA 2GH1A 4YV2A 1WCXA 4BO4A 4HAZA 4S1VA 3V7UA 4QJFB 3WYEA 3H0CA 1YRWA 2ZE6A 4EUKA 4YEDA 2OFOA 4NMWA 3E0QA 1C0EA 4CEHB 5E6SA 3V4OA 2H52A 2RGXA 3N27A 4JC4A 4B17A 4BQNA 1TECE 3A06A 5IE9A 1H0KA 3NJRA 4DLZA 2O0LA 1XRNA 5GIPE 2HEGA 3DVRX 4LOHA 4G1MB 1NUUA 1OLUA 2I1LA 2E2WA 3FBTA 5B1AC 5HXUA 4QPJA 4CXMA 3NDIA 2H51A 2VDNB 4JR0A 5JCOC 5KNBA 4BFZA 4UXIA 4KZPA 2FF5A 2DXIA 3ZWDA 4B8ZA 1CUVA 1VKZA 2NN4A 4ENWA 1NURA 2I2CA 2QPLA 2YIBD 2VH2A 5TT1A 1NPYA 2DFDA 4L2IA 1IUOA 1RU3A 1OYYA 4H7EA 4EGAA 3NHLA 1R64A 2I9KA 4LZZA 4E5SA 3TD5A 3WSVA 3L6BA 4LQCA 2X13A 4ZEVA 3ERCA 4AZ0B 3ZGXA 3R5TA 2X8JB 3PGXA 4L87A 2AOUA 3NYIA 1XL4A 3DP9A 2IFTA 1GR1A 4S05A 2YXBA 1XTQA 1D09A 2HLPA 3RS0A 1YITF 4ZZIA 4ACAA 3KQTA 3CF4G 4OP1A 3BMNB 2GTSA 1KO4A 1R5BA 2PDAA 1P18A 3AWDA 2XVYA 2HCTA 1Y4ZA 2XBMA 4BT5A 2HBRA 3AF3A 5E4JA 2BZSA 4H1UA 4DK0A 1FMJA 4G41A 2QUHA 4XW2A 4AKHA 4RZ3A 4LJAA 1Z9BA 3QFFA 3DWGA 4I08A 1E4VA 4FEAA 2JLXA 1FL9A 3LH5A 3EORA 5HRCA 2GSDA 4TM7A 3VU1A 3W8EA 4XQ9A 4UOQA 3GGPA 2AJBA 1D5NA 1FVFA 3ZRXA 1Z07A 3AUFA 4BMCA 2I6TA 3U7JA 2X0FA 1KMIY 4AIIA 5ALJA 1S5JA 2H5IA 3V8RA 3FD6A 4J7XA 2HQRA 1AK9A 4DV0O 2A9QA 1F14A 4LDQA 5FBRB 5HK8A 1R0BA 4BLSA 3ME5A 3ZRVA 4X62O 3KAPA 4NIMA 3CCJF 3DBOB 3TFWA 2A0KA 2LQTA 3PHLA 2ZQ5A 2FWAA 1HA3A 2WABA 4IFBA 5EEHA 4G1VA 4P9NA 2EINC 1K27A 3K35A 1KP2A 3LXRA 1G5FA 1RKUA 3JSXA 4MMZB 1HE3A 1NF3A 2VDWA 4UDYX 4C0HA 3TNDA 3ZXIA 1XL6A 1SQGA 1UDCA 4O2BA 2AJDA 2HLHA 3QFTA 3IODA 2D7JA 5A7FA 2Z8ZA 3MFQA 4AJLA 1E0KA 1RYDA 4DZTA 4MVJA 5HM8A 2MU1A 1QIFA 1I7SB 2JD1A 4OXSA 3H4VA 2RIRA 1NATA 1RACA 1QXSA 1PLLA 3WAKA 4ARUA 2ZIVB 2FUG6 5JO0A 2RGWA 3UCEA 2VPZA 3HA3A 1MIOB 4BVSA 3NNDA 4PYRA 3UY4A 5FTKA 3VTZA 3HR4A 4YTEA 3ONFA 3R3WA 3C24A 3O93A 4I5SA 4EG5A 3QXSA 2G9QA 1QM5A 1AHNA 3JR7A 3BA9A 1V3TA 1VKRA 3FOAA 2OBNA 2XCLA 2IIPA 4QSHA 1UMCA 5M5BA 1SCAA 3NYRA 3T1TA 3VVLA 1XDUA 2PUHA 3V80A 4BN0A 1GH6A 4UCRA 2J4CA 2NO6A 2PZMA 4B81A 4Q4LA 5JYEA 1AUXA 3OQ1A 4CEJB 2YJZA 4CF7A 1N8RH 2YV2A 3IT0A 4JGSA 7MDHA 4LBVA 2VJCA 4G01B 3IVGA 4CPDA 5DGTA 4UUPA 2LIVA 1ULBA 4I0XB 3QKIA 1ZVQA 4QUKA 2RH5A 4X3MA 1QP4A 2FV8A 3AYXB 3SHVA 4BE4A 1JFRA 2C5BA 1JMKC 3U1BA 1AS2A 3DEHA 2FGKA 2BOVA 3UT6A 4JT9A 4LPSA 2X6RA 3W2HA 2EOAA 2C5EA 1RJDA 1WR8A 5LZ8A 2DPGA 2HYDA 1L4EA 4JB8A 4DN6A 3RFUA 1I94O 4GQIA 1EWKA 2VAWA 4H6VA 5G02A 4UQLA 1NASA 2HUNA 3H5RA 4C29A 4GOND 1VCMA 3BX1A 3HMQA 5ALGA 3ZRSA 3BQNB 3JW8A 3ZNQA 1N7JA 3SJCA 2EZPA 3DBHB 4D46A 1T29A 1V7QA 5CNJA 1CUGA 1JJOA 3G7SA 1WLYA 4F71A 5A5VA 3V00A 3UNXA 1XNJA 1MLDA 1EEHA 4Q7KA 1OFUA 5FTNA 1NU1H 1YAHA 4A5OA 1L7NA 2DWCA 1FP7A 3MRVA 1SH7A 5HIKA 3MK31 3BY6A 2VTVA 3FUCA 4X60A 4ND4A 2EDAA 1VBKA 3OECA 4AO6A 2VVTA 5AVVA 3E23A 4ZRDA 2AUTA 3CM0A 3GLIB 2Q2OA 3LUAA 4NEHB 4W7SA 2AJ8A 5AJUA 1QUFA 2JEXA 5FLXM 3DDZX 4UEWA 4GKJO 5GZ6A 2OGWA 4KYIB 1EI9A 1UQTA 2GJSA 4AJNA 1DVRA 1M33A 1UKYA 4FI3C 5A3QA 4Y2PA 3W7TA 1L8OA 2IV2X 3E82A 3I5DA 4FFMA 1H9BA 4RNCA 1QLHA 2XT0A 1IBKB 1AUQA 2O3SA 1E0DA 1W3EX 2GMWA 1K5SA 3DG9A 3QU7A 5JZSA 4KUMA 3OQJA 2NYVA 3Q5GA 2BP7B 4DLRA 4OMUA 3FUUA 1KRWA 4XIIA 2QQGA 4MQFA 5JRJA 2XUHA 3LPCA 5IFLA 1QYIA 4B9EA 3M6XA 4KV9A 4OJYA 1P2DA 3M9LA 4TQDA 1G8FA 4LQ4A 2ADPA 2CHUA 1TU4A 2V3CC 4MVJP 4HQ6A 4ZYVA 4B47A 1TE2A 2CE4A 2G4CA 2CDNA 1M75A 2RARA 4L5CA 3L1HA 4UU0A 1VKHA 2DHEA 1FU8A 3P2EA 1ZWKA 2DC1A 5ITZB 4IXWA 1V1JA 2O57A 4JV5O 1KEEA 4LHXA 1OFGA 3E81A 1KS2A 4GG1A 3UM9A 1ZU4A 1QVFU 3JVIA 3T1QA 3L0SA 3NHAA 3L1VA 1GNQA 3RVJA 3F8SA 3IQZA 5DEOA 1M83A 3R5HA 1D4FA 4FOTA 1YS2X 4BX9A 2CUNA 4DLKA 1Q7BA 1ZX3A 3ZV3A 3IP7A 3CCUV 5L3QA 2ASEA 5HQJA 3U61B 5JXWA 4DIFA 2ONYA 4LISA 5DWQA 5HJEA 2C7BA 2CHEA 1Z56C 3WLFA 3GTZA 4UUBA 2YZNA 3TPZA 1BMTA 2JAHA 1P2FA 3ZCXA 1A8QA 3D3EA 3F2VA 1DKMA 2JKYA 5F4ZA 1U0OC 2A35A 5C8XA 3F78A 4U63A 1UAAA 3S8EA 3GPIA 2R9RB 3M6MD 2HJ9A 2ZF8A 3P9RA 4WVFA 5HZMA 5KTSA 2HRZA 1PJCA 1WTAA 5LOVF 4TN5A 2Z6UA 4LH6A 3SJZA 2PZEA 2OXRA 1WB6A 3TW8A 3QLVC 4DBLE 1BXKA 2O7SA 1QPGA 1I1OA 1X70A 3L70H 1Z6ZA 1JG4A 1X7YA 3WY9A 4EJMA 4UHKA 4UVIA 1YU6A 1DCTA 2XMCA 3L8HA 5BQOA 3HO1A 1Z4KA 2H2GA 3DUFB 2AN3A 4RL6A 4DYHA 2R9VA 2JL1A 3FHLA 4Q9NA 5MFPA 1K0UA 3W5VA 3O21A 4GEKA 2N9UA 4KR7A 4FFSA 4AK9A 4EGCB 1T9CA 2XUIA 3JALB 3PUIA 4K35A 3GVPA 4TTIA 3SICE 1JDZA 3Q3VA 3LTNC 2V03A 3ICQB 2JDIG 1AA9A 3P9SA 1I0IA 4RADA 1JHVA 3G71F 2NTNA 4F72A 1TDJA 2C59A 3P2IA 3H2SA 3ZLJA 4YRKA 1CQPA 1X7ZA 2N1BA 3N0RA 2EEPA 4CKBA 2Y1EA 4JXKA 1S2OA 5C1BA 4ZHQF 5JW6A 3K79A 2D0OB 2JLVA 2QA4F 5JSHA 3KCQA 3TTXA 2H4HA 3RVMA 1P2BA 3AV0B 2DY1A 2RNBA 3OOYA 4NMLA 2GB4A 4LTNA 3COJA 2V97A 5IAGA 1DG1G 1UAYA 3Q4HA 4I4LA 4UVAA 2RDMA 2Z57A 4YQEA 2PO5A 4KMMA 3FDZB 3TLYA 4F4JA 1SC5B 3AUYA 4ON9A 5DW0A 1T0HB 3CCRF 4LCKA 1CNFA 3NWOA 4X1YA 2H11A 5EE1A 4CM8A 2ZYVX 2A92A 5BR7A 2Q4RA 2VYVD 3DBLB 2LR0A 1GTVA 1C1XB 1L4BA 3B5EA 1U4NA 1VBNA 2LTAA 3PX7A 2C0CA 2GCIA 2H4XA 1IZ3A 5T4BA 1QO0D 4L8GA 3RVLA 4JZKA 3FPSA 2FR1A 4M88A 3S0WA 2V9PA 2NSJA 2DKNA 3IQDB 1T4CB 1S3JA 1TM5E 2VPTA 4G2TA 2O3TA 3KLPX 2V1UA 1AR1B 1T25A 3R75A 4C87A 4YYEA 5EXTA 2A5LA 1EA7A 4IJ5A 2WHYA 3R9KA 4QASA 2EP7A 4AKGA 2QYTA 4NXMO 5EJ4A 2IHZA 3GJYA 2CDYA 4BO1A 3IP8A 4IGIA 1P7BA 3WL4A 4S1PA 2GZHA 3TMYA 1IEQA 5I47A 3O8QA 2BBSA 2B82A 5DH9A 3T2MA 3A3YA 3EG9A 3ZWMA 1QTNA 1C80A 2FZKA 1F3LA 4RQEA 1M8GA 3KR1A 3GRAA 1NHGA 2ID8A 3D7LA 4JQYA 4EW2A 3GEEA 3CF4A 4FSHA 5KUKA 1CUAA 4QUJA 4Q93A 4YGXB 1U0LA 2ZI9A 5AVRA 1P1HA 2QMHA 1E1CB 4LVNA 1PJSA 4K0RA 2DUUA 4JUBA 5C3UA 3ZIAD 4UVEA 4GZ3A 1FU7A 3ASYA 2GK7A 4O25A 1T9GS 4MJLA 1F17A 3KR9A 3RU9A 2PGJA 4X95A 1F7YA 1Q6HA 1ZNXA 1I1HA 4L15A 2A86A 2O8BA 3IEKA 4QJ5A 2GD1O 3LL7A 4ZIRA 1WDLA 3FHJA 4DWJA 3VXKA 3LK7A 1XL0A 3HDYA 3P8ZA 4E70A 5C2JB 2F4NA 4RPJA 3Q0IA 4N0PA 4ZAYA 4BT7A 1CEYA 2B3TA 1P2UA 5A5DA 1ZUNA 1ZQ9A 2ODMA 4N8DA 2ZKIA 2EP8A 1JRLA 1FJXA 1Z16A 1JMYA 1G8KA 3FPAA 2ZQYA 4PY2A 4NKGB 2P3QA 4NR0A 3HXOA 1WF6A 1I4TD 1NSFA 1RHQA 2C2MA 3S3XA 4FFKA 4JBXA 2IXBA 4F8YA 1CJCA 2GM9A 1M57C 1AKNA 2OZEA 2MMCA 1U31A 5JAQA 5LYJF 5I7WA 1FFTB 1F8FA 4YRBA 4BQEA 2UXBO 1SCDA 3AUSA 3N87A 3ZO8A 2LBTA 3SC2A 4R8SA 4D9EA 3ZHZA 2V0NA 4O2AF 3EEQA 1CRQA 2AMLA 2QTRA 1CRLA 3VYVA 3B2QA 2OGZA 4EUEA 2VPWA 2QMUA 4UTNA 5KVCA 4B7EA 1LVUA 5KS2A 1MABB 4JI8B 1W36D 2OHIA 4MP6A 1G17A 4LOKA 3AY3A 3PHJA 1PR6A 1Z12A 3D59A 3RE1A 1BJRE 4MMXB 3DWEX 3LSUA 3OFNG 4U5XA 3JQAA 3N74A 2GLZA 4WKPA 3CPHA 3T4DA 1Q5OA 5DMHA 3EUAA 4QOFA 1L5RA 4KX5A 1C1DB 1GU0A 3HADA 1WHTB 1E96A 4QVGA 2V55B 1VQOV 3B13B 3NIDB 4CT5A 2VTBA 4IX9A 3BWDD 2W83A 1AS0A 2JZOA 5IJ0B 3G85A 1O96A 5JS8A 2HF2A 5DVZA 4J1TC 4F7WA 4WI1A 3IJ4A 2ES4A 2UZ1B 3CMMA 1H2NA 2UV8A 1AJEA 9ABPA 2RHGB 4EKNB 2FUCA 2IPLA 2ZAYA 5BSVA 4D82A 5GIOC 3G6EF 3MS7A 3FNHA 1ODKA 3C70A 3TNJA 3OVMA 4ZARA 5FNZA 3FVQA 1MZPA 4OHBA 4UHDA 4JGIA 4BKOA 1XMOB 1M66A 1O77A 4RSRA 3FCYA 3SPCA 2VP0A 1CLUA 1VL0A 4C3ZA 3G4SF 1Y37A 1HDXA 2Z8XA 2YEVB 2LCFA 3FD8A 1XRJA 4DG8A 4JL8A 3B8HA 1GUBA 4PRZA 3D3KA 1NC1A 3S81A 3JAWB 5JJKA 2F9MA 3OA2A 3CWBH 5DCYA 2H0RA 4AZ0A 4J2HA 4NBNA 3U4QB 3CLRD 3CHXA 3C7KA 3PTAA 4F3KA 1CZUA 3AERA 4N47A 5CBFA 3GFQA 3RYIA 3VYSC 2AW9A 1LDNA 4FN5A 1UXOA 1R9MA 2NXEA 2QTGA 2MSKA 1JEDA 4M1OA 2EJRA 3NAGA 4N7BA 3ZE8A 1DWUA 1K5DA 1H9AA 4WLVA 4W5JA 4KQCA 2GM3A 2P6JA 4FWIB 3KCYA 1S7GA 3UJBA 3EZ7A 2KQUA 4Y3UA 2PGLA 3JD2A 1XD8A 5DEDA 4S04A 2O5RA 5D1NA 4R1LA 3U0BA 3O1LA 2ZTUA 1U2GA 2P3SA 1E62A 2QN1A 3EVGA 1H4TA 4UVBA 3MJEA 1DEAA 1PT9A 1YC2A 2Y6VA 4OQNA 3OEWA 3A6LA 1RZUA 4DCCA 2Q45A 3H11B 4FWBA 1W2WB 1JIIA 1TMOA 4I6JA 5CA0B 3TUJC 4HFNA 3EWAA 3WL3A 1HKHA 3KBOA 5C9ZA 1T5OA 2VQ6A 1KI6B 2VHZA 1N2BA 1LK0A 4M0LA 3CF0A 4BQSA 2BUBA 4DV1B 3IDAA 3SJBA 1M5IA 4PAMA 1IAQA 3ZG6A 4WY8A 1HEUA 1ULZA 3OZIA 3T3NA 1CC1S 3N0TA 1T9KA 2B36A 3EA4A 5IY5B 1U11A 4Y2UA 2FNAA 4RPGA 2J09A 5CBPB 4X6UA 4IFTA 2CW4A 4BQOA 4AUKA 3HO6A 3AGKA 2OFFA 1RXCA 4PLFA 1NTMH 2D3OW 4QM6A 5ALPA 1FYDA 4XB1A 3E7FA 1PZMA 3H75A 2KX7A 3TTYA 3ABZA 3FCEA 4JC0A 3C16C 1IDSA 3A0BZ 2A0XA 3AHDA 5ED0A 3NS7A 2CL5A 2G83A 4RJLA 4TKMA 2ID9A 3ELUA 1EM1A 1T2NA 4FDMA 1TI7A 2YYZA 1CTQA 5AHOA 4I3FA 5AVSA 5BSGA 3FFQA 3B8EA 2ZETA 3FCCA 4QGPA 3O9VA 5F1OA 1PR3A 1XYGA 3MM4A 2VH5R 2Y4TA 3V8NA 3RC7A 3HVRA 4WECA 1P8JA 3PFKA 4IFEA 5IJ9A 4J3JA 1MABG 1O9GA 1HW7A 1E2EA 4IWNA 1ZBDA 1X0XA 2VZ8A 3CRCA 4JVOA 2VNAA 221PA 2IYAA 2ECKA 2RH4A 4GZRB 4C82A 3CH6A 1LPAB 4MWTA 1QMGA 4BXOB 4TV8A 1U3LA 2I7XA 4NOMA 2YY6A 3IA7A 1M2OA 5G53C 1U40A 4EHHA 2ZUTA 3L7DA 4L2IB 3BIOA 3LUGA 4EJSA 1HPLA 2X4GA 3KSRA 4LQDA 4IZIA 3HCNA 1BXZA 1SKYE 5KNLA 2P22C 2C95A 2LW7A 2XE4A 1WLEA 4P3YA 4R0NA 2GETA 4CH3A 2GXQA 1YB1A 4K3UA 2SKCA 1R50A 3P30A 1QP0A 2AOUB 2OVBA 3KHTA 4ZJPA 3C3PA 2JIPA 4I0XA 2F1IA 3JTEA 2XRMA 5AK0A 1IBRA 5LMNB 2R47A 3NBUA 1JQAA 5LDHA 1RC8A 2I6DA 3U0OA 4Q37A 2JDIA 2R48A 2OO5A 3QE3A 4WLNA 3QNEA 4G0MA 1VMGA 1TYEB 2RC5A 4BGIA 5J47A 2PKXA 3LU1A 1G5HA 4DW8A 1R0XA 1UEXC 4QOGA 3S3WA 2WPNA 1PKXA 1CP3A 5EZYF 5JI2E 4P80A 1HR0B 5EIXA 2NLOA 3WKEA 3RRNA 3V34A 1JJBA 2ZJ2A 3NOQA 4B7UA 1DO0A 3HCCA 3DBHA 5KU1A 3Q7EA 4H6WA 1N0NA 5E9AA 1XZIA 5FWXB 3AK3A 5FUVA 2C5GA 2QRGA 5IKMA 2DPLA 2C2KA 1LBSA 2XF2A 4NAVA 4OGGA 1JB1A 3I9OA 4HDQB 5KBYA 2R7NA 3OESA 4M0FA 4AY6A 4FGJA 3BXHA 2GOYA 1H6AA 1QTRA 1GTL1 4KN6A 3PHGA 2Y0EA 5FUYA 1MQ8B 3QG5A 1JHUA 1PTJA 5EQFA 3KTOA 5A7HA 3ZPXA 3IDFA 3FPCA 3R7NA 2JH3A 2BE3A 1RQRA 1XMVA 5FV7A 4KLAA 4FCWA 3D3QA 5IABA 3IELA 2FN4A 2HK7A 4OHKA 3QXGA 4OPAA 4EELA 1R4AA 2DWPA 3WRYC 4PM4A 4HB4A 2E5LO 4C0WA 1IXMA 2FEWB 3QVTA 4PC3A 2WINI 4H60A 4OBXA 2RKBA 2HM7A 2PVPA 3WK7A 1L9XA 2JCGA 1CKEA 2NO0A 4EHLA 2PX0A 3DOFA 2BPOA 5LQRA 3ND6A 5GPBA 3BE6A 1LUAA 2EBWA 4HFJA 5L9AA 4ZK2A 1XZLA 1WSWA 2AA3A 1CUDA 3N6RA 3A1FA 1XDZA 2I80A 3G5MA 3SC6A 3PFGA 1TTQB 2JC3A 4XJTA 2CFRA 3S2SA 1W42A 2QS9A 2VG8A 3DR5A 4DIKA 1U97A 5ITZA 3X2QB 3R65A 3EIUA 2NVOA 2IHKA 1Q0RA 3ZY4A 4OTZA 2B99A 5ECWA 3VPAA 4CF3A 1SBNE 1N3BA 1Z7WA 1UMCB 4DCNA 4G0WA 2ENWA 4ZOBA 4RA6B 3KE8A 1VCHA 3N75A 2WLHA 3PQEA 3PFCA 3V32A 4G8BA 4IEEA 2O7VA 5A71A 3VR4A 2H2IA 3REOA 2QSJA 4BFUA 3NP7A 1MHPA 1UWCA 1JJ2U 3OJ0A 4QGHA 1IEWA 4YT2A 4YV7A 4GW3A 3X2FA 1HDJA 3IO5A 3AHGA 1OXSC 3RTDA 4I4NA 5KHLB 4OQPA 3NBAA 3OE5A 4J90A 1SZCA 3L7JA 2K1EA 4M7WA 4LEIA 2AXNA 5KO2A 4ITUA 4Q21A 4YXFA 2VTDA 3WLSA 1HQCA 3HVJA 4Q6BA 2H4ZA 1K33A 1USVA 1R27A 1X7WA 1T3ZA 2YMLA 1WAZA 2AK2A 1Q0QA 3RYHA 4GBJA 4DR2O 2ZUFA 2ARKA 5H9VA 2JGUA 3REQB 4MVMA 3P5BA 1R3DA 4H9GA 1SK9A 3NVAA 5K6AA 2JGNA 2ZRJA 1IZYA 1JKIA 2YXYA 1WV0A 4KUGA 2VXCA 3AL0C 4NKRA 1EE9A 1HFEL 4HD8A 4PSCA 1EFLA 2AI1A 2I55A 4IV5A 3F6MA 1FJ2A 5AVZA 3LWNA 1ANKA 1SIWA 4BHTA 4OJMX 1OH8A 1B0AA 3E7DA 1NJ1A 4CBCA 4W6ZA 3JALA 1YK0A 4RCYA 5D3QA 3K0HA 4RY9A 1A8IA 4BO8A 1Q6IA 3AKEA 3RUPA 1WP7A 3AWIA 4JR2A 5CEEA 3VAZA 4MGIR 3MRTA 1SXJC 2YHIB 3CGWA 4AG6A 4DV7B 4AJHA 3CNLA 3IEPA 2J4DA 1MHTA 3ZDXB 5T6MA 2MYNA 2FQWA 3OFNA 1LVGA 4IRMA 1SRYA 2A33A 5LZ7A 3RD5A 3RBZA 3GIWA 2FKAA 1RQPA 4ZZ3A 3I12A 5H3HA 2HT1A 3HCDA 2WTAA 1I0HA 3S55A 2IXTA 4GLOA 4GF5A 3BDIA 3IQWA 2CXSA 2JIOA 4B3GA 2BMWA 1BIFA 1P80A 1C41A 2IBZH 1DOZA 1U28C 1TUBA 3PUJA 1V5GA 2ZWOA 2XZPA 1ZWZA 4LF4O 3I3OA 4R9UC 5JWRA 1EXDA 3E8FA 4QPPA 1T13A 1HX7A 1GRRA 3W5DA 3RQIA 4W99A 2ZJ7A 3B85A 3AG4B 2WZCA 3QEKA 4CCAA 3LHKA 3ODPA 2VCEA 3E22B 5CIWA 3PXXA 2EC5A 2UUBO 2ODNA 3P10A 1C1XA 2VHXA 2C5FA 1MA3A 3VTIC 2PWPA 1XEXA 1XJQA 1E6KA 1A4UA 1OV4A 1U99A 2I2WA 1V8ZA 2E87A 1T4CA 4PG6A 4HBNA 4CH6A 1F5SA 2MJLA 4NU8X 5EXXA 3KLMX 2WT8A 1PEYA 2OFPA 3HUDA 1J7KA 3WGTA 1EWRA 1VLHA 3D3JA 4YS6A 2WAYA 3L4BC 5L3SB 1GRCA 5H68A 1BU5A 2ZJ5A 2BFAA 4L73A 4D8UA 2V1DA 1II8A 2G1JA 5L3QB 4PHZA 4BU1A 4AZVA 4X8LA 3TXSA 2EHDA 5DDIP 4EB3A 4I9HA 1COZA 1ZNZA 4N48A 4I5EA 2CLHB 1SKUA 4YPVA 5TF4A 4F4UA 2HK9A 1PKEA 1UBHS 1F2VA 1KMMA 1ZCFA 1DKPA 4D81A 1NFFA 3BT7A 5EJ5A 5F1KA 4DKJA 4UZEA 2I22A 4FYIA 4JUAA 4LJLA 4RAQA 5CA1F 4BJ6A 5FLEX 4OI2A 5F2VO 5IAOA 2SBTA 3BGSA 4ZOCA 4HB2A 5IM5A 2QG9A 2YRWA 3NHKA 3RIMA 8AT1A 1X7YB 3H13A 2P67A 2P6OA 3DGFC 4JYPA 1PJ3A 1P0IA 2W71A 1A8UA 1DIAA 4RJKA 5IT9M 3L43A 4TTTS 1L5MA 3BL6A 4Q7LA 4N76A 1QGYA 3Q3JB 3T5BA 2NYRA 1YVDA 3ZD9A 4DIEA 3FYDA 4MKRA 4JF3A 3RA6A 4HPWA 1PJRA 1DJLA 4CT0A 5JQGB 4G28B 2HA0A 1Y9AA 1DTSA 1JECA 2NYUA 3RN4A 1V5EA 3PXCX 4K6CA 3VNAA 4JASA 4NYKA 3MMZA 4Z9FA 1TJ4A 2F90A 3LRPA 4NQZA 2H29A 4UVDA 2J9GA 3T0GA 1UODA 4QPCA 3E3AA 3KVOA 1KQSU 2Y2UA 4AO8A 1Q7GA 2R8YA 1SVIA 5LGNA 1EFHA 2OCBA 1ZBQA 3KVYA 3Q4HB 1QWSA 1ZGHA 1MJHA 2AHZA 2NPOA 4CZ2A 1CY1A 1ZO8A 1CJKC 1ISHA 4EHDA 5HSGA 1Z5OA 1RE0A 3KEQA 3DDNA 3CPWU 4XJVA 3BFPA 3HJWC 3ZWXA 4EMBA 4E94A 3ZDYB 3ZZTA 4W1QA 5CVUA 4EKEA 3U9TA 2IH2A 2BLNA 3V7YA 2FPRA 4KXRA 1VE5A 1E9SA 3AB8A 1U6IA 2WYUA 4YCAA 1KDPA 3KLBA 1AK1A 2I54A 1SKAA 1QCDA 2R751 3IH5A 2Q68A 1Z83A 3OQNA 3DOUA 4YA6A 4DLTA 1ZTEA 3GG9A 2L26A 3UPUA 1SHLA 4XVCA 1T2EA 4GOKA 4LI3X 4ECEA 4G67A 1NM5A 1YL6A 5DX0A 1M76A 1LXCA 5C34B 3J7AU 2I67A 3TIXB 3MMSA 3NBKA 1NVEA 2D2EA 1D2AA 3TAHA 1MTZA 2IOFK 1RP7A 3FLEA 1BOOA 4TMFA 2Z9CA 2R6R1 1B41A 3VA7A 5LWHA 1YR9A 2HI0A 3QVGA 3NZEA 2WAMA 1U3TA 2GTHA 1Z7YA 1W6UA 3K2IA 1TYZA 3Q7RA 3I2HA 3O8QB 3USZA 4OGKA 2EKZA 3C7AA 3NIWA 1ID8A 1TO6A 4B3MO 2UZ1A 4DXWA 1SY7A 1ZD5A 4ZYLA 3KEFA 1BDJA 1UJBA 3W2TA 5IVPA 1QQTA 4HWOA 2OENG 3OAAG 2PG3A 2ODAA 1VBFA 2XUAA 1NXVA 1NRWA 2X6BA 2DF8A 4EABA 2A1TR 3S2FA 2PWYA 2ZVPX 3ESCA 1AD2A 5IEJA 4BRZA 1P9OA 3HI6A 4JKIA 4LOLA 4PIPA 4OHPA 3I01A 3OTOB 4BE9A 4DR7B 3BBPA 4ZYZA 4IRXA 1IAVA 3KT3A 5FCDA 3ZCUA 5FTLA 1KQGA 5IC6A 3WK5A 4B83A 2PEZA 3V9AA 2YIAA 4BMSA 1L5HB 4N0QA 4A6EA 2O8BB 4LG1A 5E6UB 3R8FA 4ZIRB 2B33A 5K5EA 1SESA 3IMPA 2ABWA 3ORQA 1O95D 4F5ZA 5IDYA 1VPWA 4RZXA 3MS2A 3U4QA 1ZUQA 3CLUD 1RKQA 3OJXA 4U2KA 1CZKA 4RAOA 1XB2A 5BMVA 5KQGA 2NSHA 1MRZA 5ALRA 4EH1A 3FHOA 4NCKA 3MJCA 2GAIA 3RYTC 4MR7A 4HS4A 1FXWA 5IULC 4M9ZA 2WUGA 3GZ4A 2RHBA 4XB6B 3AL3A 5DWVA 1LH0A 2I4IA 4II3A 3DONA 2CXOA 1KDRA 1TVEA 3KUKA 4BT6A 3WDSA 3V3TA 4J0KA 5JARA 1H8EG 4AMBA 3UKJA 3QXJA 2YUAA 2IYOA 2AN1A 2WSIA 4A0HA 1AI5A 4RORA 4E11A 1UJWB 4C2UA 2H8PC 1SERA 2YV3A 3NV7A 3EPHA 4K03A 2DBRA 1B8PA 2PV0A 3SC2B 1Q1EA 3W5AA 3EOZA 3H11A 2AWNA 2DPMA 3CVWA 2ZOSA 4DUGD 2YN0A 1OC2A 5CA0A 5J4LA 2DBZA 3AFOA 3UXEA 4RNDB 1R4MA 4UFPA 1KI6A 4FTWA 1SQXH 3KCNA 5FPYA 1W87A 3LNCA 1DB3A 2R4QA 5FYDA 2PHZA 3U44A 3KV1A 3OIDA 1SOVA 2HA5A 1QP8A 2HCRA 2QM8A 1ZESA 3RU3A 4BYGA 3JVVA 1RWPA 4JLAA 1KJ9A 3ND9A 3HNPA 3KBBA 4W4TA 5CBPA 3JQAB 2DY0A 1BN6A 4YP0A 4KN9S 3HCBA 1HT2E 4E3WA 3E84A 4LRQA 4QYWA 3DC2A 4W8HA 5TSDA 3PLAE 3ABKB 2G9ZA 2X8LA 3FNBA 2PUEA 5FPSA 3KUCA 3MUEA 1TZBA 4F2GA 2FPSA 5HF6A 4WFGA 3QYJA 2PHNA 3MT7A 1O96B 1VP9A 2FE1A 3I55F 5ETJA 4L85A 5L53A 2V7PA 2R84A 1GKUB 3LDGA 2QAGC 4DM7A 2O0JA 3TZKA 2A5JA 3B70A 2D59A 2QKYA 4V1CI 2ILTA 2J6BA 3FYUC 3DCJA 3EVDA 3GJ7A 1S76D 2R70A 5DBFA 4BXOA 2VKTA 3TR0A 3HR7A 2IGTA 1QIJA 2G9UA 5HF5A 3QEAZ 4MJXA 5ALXA 3BS4A 3NHWA 4BEJA 2XYVA 3TRDA 3VH1A 4WNAA 4EW3A 1OJHA 2WM3A 3SR3A 2R6DA 2JATA 1EINA 1P9LA 4MRPA 3X1ZA 1DL5A 3TSZA 2BCEA 2OB1A 2AN4A 2V6GA 1D4ZA 3RLIA 1AB6A 2WKSA 4I50A 3BABA 3INYA 5GVRA 4BMZA 3AERB 1J8VA 3BHIA 4JEIA 3QO5A 4EF6A 3RYIB 3K59A 1KFJB 5J4HA 1YCIA 5HIMA 1GN4A 1BZKA 3CKYA 4KV7A 5ENVA 4KAFA 4UXNA 4NDAA 2PBFA 2D7DA 4JIMA 4CE6A 3RGWS 1WU7A 3ZX4A 3S8MA 1NJIH 2AR7A 4FI3F 5CXQA 3GA7A 4EVQA 3V1MA 1YF3A 1C29B 4BC1A 2OBFA 1ZJJA 1MT3A 3OOWA 3LKDA 4I4TF 1ZI9A 4KQGA 1SD2A 1PSWA 2Q6KA 4LS3A 4MSWC 3EPJA 4F12A 3FB8C 4YY3B 4LYEA 4ZXFA 4CV0A 3N6VA 3DSQA 3ONNA 3DZJA 3NAQA 5FWXA 4IF6A 3ZWKA 3AG3B 1SK8A 3HC7A 2OAGA 3P2YA 2LIPA 3JPWA 3HRIA 4DCGA 2NO9A 1SG0A 4MV7A 1Z39A 2H1FA 3WHIA 3IHKA 1F0KA 4U7WA 2RK3A 4KPYA 1ORIA 2UYYA 5K8LA 4DJAA 4TZTA 2IIVA 4R8RA 4A0SA 5CEJA 3QUTA 3QEMA 4CQMB 4K6OA 3SEQA 3O9OA 1B0PA 2H63A 5KJ1A 2JFZA 1Y76A 1WKCA 2P9FA 3HJCA 2G9NA 1IVNA 5JJ5A 4LVOA 3CE9A 2ZOVA 3RVRA 2HLDD 3L82B 4YH1A 1ZY2A 1NV9A 4HX9A 4XEHA 1H2KA 5JROA 4Y98A 4Q1CA 3PNOA 2ZRKA 3B8NA 5KKAA 5CLFA 5AVTA 1XO1A 3CYOA 2F9FA 3U19A 4DB4A 4HEQA 1A4IA 3V97A 4HDKB 3DZFA 1DIHA 4URFA 3WU2Z 2GBGA 4NEGA 3AOEC 1AP5A 4P2ZA 1L7MA 5LQSA 2WFAA 3WFVA 1LY1A 3F3MA 5LKAA 4ER6A 5IJ9B 5JD5A 4YR7A 1JQLB 1ONNA 2XZLA 2I65A 1L4YA 3LSQA 5E4TA 1US6A 4KXUA 4U6QA 2PKCA 4DR3O 1RPJA 1F0YA 1NJ6A 3CJRA 1WVMA 1PUIA 3MAQA 2OV8A 1QZXA 1GARA 4QUDA 2VSQA 3PUXA 2ZJFA 4L4YA 2B6HA 4HZIA 4TV8B 4IIUA 2J87A 1GLVA 3TKAA 4IUCS 2IV7A 2VGNA 1IN4A 2YFYA 1M2OB 3TEFA 2HSDA 2QN8A 1FBTA 2XTMA 3SM3A 1NUPA 4EJSB 2B2NA 4S1WA 4CMKA 4RA6A 5FXMA 1WMEA 4UXHA 3HJAA 2AK3A 3ZHRA 1DIRA 4P36A 1K66A 1X1RA 3WZMA 1PNOA 1SZJG 1XQ8A 4M6WA 3WQSB 3DH0A 1JEAA 5G0VA 2QW1A 3C41J 1AQUA 2IUYA 5FIUA 1WABA 5LHIA 1RHJA 2QPTA 3H5IA 1RTTA 3WIVA 1X7XA 3VH4A 3EFFK 3CB4A 4K88A 1Y6GA 4UHHA 4Z1MG 3SOZA 4F96A 3BDVA 5TJHA 1GPBA 3LSYA 3H1PA 1ZD9A 1UL1X 3REQA 3DE0X 3E3MA 3OUUA 2JBAB 3GLUA 4AECA 3CRZA 2ZS9A 3CCQV 2CHSA 1UDRA 3UMJA 4BP8A 1WXEA 5T7BA 2CGNA 1Y1LA 4TSFG 3A6ZA 5FTWA 1RPZA 3DL0A 4EYOA 3OZCA 1R73A 5D1HA 1R6AA 3RVYA 4BLTA 4KRXA 1E2IA 1IX9A 4M0DA 1RRGA 1OCCC 1PI3A 3HUTA 4E1VA 2PUWA 3NFRA 4JC5A 5IKEA 4R3NA 3VAYA 2QRUA 5G4UC 3EGEA 2PGDA 3AYZB 3E18A 5HZGA 3O2QB 4G5OA 2A3NA 5IDXA 2FR8C 3W3AA 5DEIA 1YR7A 4O4LF 3NH9A 2PFSA 4MB2A 3DTTA 4GXQA 2YHIA 2AG5A 3EZLA 4MVWA 3IRUA 4Q4CA 2ZWIA 4ZDKA 2Z5FA 5C1DA 4KPEC 1QGDA 1LPPA 1CUXA 1ZHOA 4RYLA 2WMDA 1VIYA 1R74A 4KFCA 3LUBA 2YN4A 1RAHA 5FOTA 1IIRA 1FYFA 3BYQA 4LHWA 1VF6C 4NE7A 3K70C 2BTEA 1FFXA 2PQ0A 3TOZA 3HH8A 2IEDA 4ZTUB 5DGXA 3ILYA 5ICGA 1H2SB 4JI5B 3MB8A 4RTJA 2BV3A 3I58A 2XAHA 3DF7A 2R5FA 1N8NA 3BM5A 5T64A 4NDZA 4AF8A 5L4LA 3TEMA 5AJWA 2FSPA 1OUMA 3KKYA 2Q6TA 4KBYA 1I6WA 3PV0A 1Z4LA 3E22A 4JWKA 2WJ3A 3OAAA 1GEEA 3H2IA 3I01M 3Q8KA 1FMLA 2HADA 5LZ4A 4JEUA 3FZGA 2XQVA 2PWBA 3C6QA 1SUBA 1K5GA 2PS9A 1TPYA 1PLJA 3E9YA 1XZFA 2H4YA 4TVSA 3BWCA 1P0CA 1Z0UA 3LG2A 1H1DA 3N58A 2C4HA 3LNMB 1V7CA 4D8WA 4M89A 3TYXA 1QQ6A 4UM9B 5CCDA 1XHZA 2WLNA 3OTGA 5A62A 1KERA 3A1SA 5CURA 4IHJF 3OLVA 1CHNA 1N6PA 5F7JA 2R85A 4ALMA 5L3SA 1XRLA 3S0JA 4V03A 2XNDD 2PYJA 1VLQA 4INJA 3LQ4A 3VZQA 5K7SA 2W6JD 3NC4A 3NDRA 3KQQA 3LX8A 4B4WA 1V35A 2XVMA 4BX2A 4AIRA 1A98A 3Q9SA 2IYYA 1PJBA 3F1KA 2CWDA 3VYUB 4BZXA 1TQHA 4TLEA 3Q3GE 4C7UA 2NPIA 5H1YA 1Q82H 5IDVA 4FFVA 5GONA 1SBZA 1KI3A 4I1OA 4TT3D 4E88A 1H2MA 2DYKA 2E4AA 3WGMA 1X7WB 2K4MA 3RKRA 1JLKA 1MRSA 5J2UA 3RYHB 3O92A 1HNWO 5JE8A 5T3UA 3QHQA 3HXQA 1ZGBA 4YXWD 4QDUA 4P83A 1SXHA 1OXBB 2VO1A 2HPAA 4CIWA 3ZD7A 4QZVA 1H8EA 4G4SP 3IL2A 2WW8A 3E7PA 3SQXA 3STWA 3P4UA 3EEOA 2X6CA 3SIRA 5LGTA 4ABMA 2G0TA 3UWDA 3U81A 4FYPA 4LFAB 3UWPA 3LPNA 2Z9BA 3ZMZA 3WBFA 2YIDA 5K3AA 6AT1A 3IV7A 2XWBF 3S2YA 1V9PA 3KLNA 2M6SA 5DNAA 1PR9A 3P96A 1DF5A 1VDMA 1XTTA 1U5CA 2EQBA 4CKYA 4HDAA 3TLZA 5BY2A 5G0TA 1IV3A 3TG2A 2J0UA 4Y0AA 3DGEA 3ROMA 1A9SA 3ABLC 4A8HA 1DOAA 3QOXA 4M9SA 4PO3X 1GQSA 2VJLA 2V9YA 3WR5A 2D2IA 1Y1SA 3DBVO 3EUWA 4KC0A 3OBBA 1JFTA 2Y69B 5DN6D 3S27A 3HZZA 4AYXA 4Q1BA 2PXXA 5JQGA 3H1IH 4MTGA 3AJ8A 5B57C 5K0BA 1H6BA 1NXTA 3NWBA 1CZRA 3F5DA 2Y9MB 1F2TB 1W29A 3T4XA 3QV2A 3KOMA 5B12A 3SPIA 2W2TA 1JIJA 4R9RA 2LDBA 2COEA 2CNBA 3OICA 4ZI3A 3T3HA 3USES 1BFDA 1W55A 1T9BA 1NP3A 2FPXA 3JYQA 1L5WA 2GHTA 3FSGA 4L08A 2Z1NA 1D2GA 1TUBB 2EFHB 1YJAA 3R3YA 3UKDA 5K0LA 3I6ZA 3JQFA 5HXZA 2QSAA 3GV0A 2UVQA 2CY0A 4HC4A 4B6RA 3AR3A 1EXWA 3NW9A 1PW7A 1QKKA 1OGIA 1A95A 1G9TA 4AG5A 3OX3A 1DLBA 4RTMA 2C58A 4IJKA 5EE5B 5EZ5A 5FPKA 4C4YA 1L9KA 4I8XA 2LKDA 4FUQA 5HW0A 5JCJA 3LZDA 2GVZC 4LF7B 2BZGA 1XEXB 2AQIA 3L6RA 3OLQA 1OZ0A 4TQGA 4I9FA 4MQBA 4UU7A 3R24A 1RYEA 3P20A 5K3DA 1F2UB 4I6GA 1P2SA 4H15A 1DAKA 2C96A 3KZCA 2Z2XA 2ZRBA 4DUPA 2QXTA 3FRJA 4N3NA 4A0QA 4X85A 1H2EA 1P62B 3UCFA 4MGZR 4G9BA 4PONA 1CB7A 3RT3C 4F4CA 1OI3A 3OPXA 2GHQA 5TQJA 1T1EA 1MB2A 2VP3A 3ZYCA 4JLBA 4H1HA 5AJZA 4JVNA 4LJYA 1U8FO 1II8B 4NFSA 2C03A 1QOPB 2FYTA 2ODQA 2E6UX 4KXYA 4INOA 4BP1A 3N07A 1TD1A 1ZMTA 4O63O 4F9TA 3QX3A 3FTDA 4BT3A 4A73A 2B0JA 4MW8A 3BD8A 3O8CA 2EIKB 4X54A 5KCMA 2MW2B 1UZLA 2O2IA 4I1UA 1JA8A 4NMXB 5GOTA 1DKRA 1OJLA 1C50A 3AJAA 3B1JA 3FNRA 3BD6A 3D6VA 5FL7G 4IGGA 4K9MA 3ZI7A 1A88A 3PD1A 1SKYB 1DEKA 1YXMA 1RP1A 1L5HA 4U0KA 5E6UA 4BAUA 3AHIA 1JY8A 4HX2A 5LDGA 3ZJTA 2WB2A 2DFTA 3BQMB 1R2QA 3G6KA 3U31A 4ARBA 3N8NA 5D8DA 1HYHA 4HMPA 2ZM6O 2XNKA 1E7WA 3NONA 3E9MA 4G23A 3HJRA 3MTGA 1JVNA 4JQOA 4HXFB 2D1FA 1T91A 3RHFA 1S9DA 2O8EB 5A1TA 1E0SA 4Z49A 1MTOA 2XASA 1WLSA 5A03A 3EZ9A 5EFOA 1VIDA 5AUNB 3OURA 3UW1A 1N8RW 2EGUA 3SZLA 2LCIA 1K7SN 3LYBA 4RTLA 3K8YA 4JASB 2YICA 3OE7G 4PFSA 4LHEA 1U3FA 4B33A 3O3CA 2GFQA 3PQ6A 4R1UA 3P32A 2HGSA 3GUUA 4KREA 3JVUA 2WF7A 3H16A 4MVJM 2ODPA 5KWJA 1YDMA 4M55A 3H1EA 2VWHA 3Q11A 1A5AB 4YROA 2GARA 3CMAV 4WXYB 3D8TA 3TZQA 4YFYA 4PS1A 4UU8A 1KOLA 1Y7PA 1AKQA 3KT6A 3FYIB 4ZGGA 4BJHB 3F67A 1S72F 1U3DA 5K0JA 1H65A 4YECA 1K75A 3ZWAA 3MWLA 2CJPA 3OE4A 4G0YA 4K5QA 4QKQA 4WFFA 2E4XA 1IXYA 2G9VA 1FPQA 3EIQA 3QWBA 2QZZA 1FF9A 2WWRA 3B12A 4HLQB 4ZDIA 2Q0AA 1KYXA 1YKSA 4QNHB 3ZYZA 4XQGA 5T57A 3FB6C 1NW6A 2B8EA 1MAUA 3PC3A 4Q4HB 4MARA 1Z0SA 5B7GA 4Q34A 2OTLF 4OD0A 2FN8A 4ER5A 1GO0A 2B61A 3AIKA 4HH0A 2CLFB 3QVGB 1SOWA 3B1FA 1UK7A 3GLHE 2ECQA 1YZFA 1J5PA 1E3IA 1BD3A 4MVRA 1W4LA 5KQMA 1QIHA 2P8SA 5HP7A 1KAQA 3SEZA 3CCEV 1XEQA 3JWPA 5KQLA 1PG0A 5K0CA 1FUYB 2FFRA 4Z9XA 1PFYA 3ESDA 1LS6A 3RJ9A 2WJPA 4Y6LA 3B8MA 2A67A 3X43A 5DBIA 2F8TA 2OXEA 1JDSA 2LZ0A 4Z1MA 5PGMA 2Q7OE 5FI5A 3HB7A 1IONA 3EN0A 3T54A 5KVVA 1J24A 3QNMA 4DQLA 1B2LA 4FUTA 3E3OA 4MV0A 3IQHX 1NJ2A 3F4LA 4W6QA 4DW1A 4HV4A 1G5QA 1VJGA 1J8QA 1L5OA 4FSXA 3VPCA 2VF7A 4C89A 4TSFA 4EA8A 1E2QA 5C18A 4X1OA 4BDTA 4PWYA 4RXMA 3MD9A 2J59A 4IZHA 3IAHA 2OYCA 3VZRA 3MUNA 1XCLA 2NV2B 1YMUA 1ADJA 1RVDA 2VDRB 3KR0A 4WOCA 3TX6A 1PPJH 5BMVB 3K9QO 1XIVA 5E1OA 2YW2A 3FB7C 1P2GA 1YF2A 4LE0A 4LECA 4MR7B 3AG2B 3SI7A 1SUFA 3V4LA 4CT4B 4TV9F 3RWMB 1BAPA 1MPTA 4C9BA 3RV3A 3RM3A 1ZC3A 4ZVNA 3JCUZ 1M2KA 4JLNA 4GRDA 4QEKA 1Z6GA 1A9XA 4EB8A 3R0PA 5KU7A 4HH4A 1UFYA 5B55A 2MHCA 1ZIXA 4TQAA 3ZWBA 2FUEA 2VEDA 4MRRA 3B9BA 3OIUA 3PPXA 3URMA 4ZP1A 4XARA 1E1NA 3WLHA 2HXSA 1FNCA 3HA5A 1UCFA 4C4WC 1JIXA 3M1XA 4L76A 4BNHA 1U2PA 5ADVA 3BH6A 2FWNA 3MGGA 3CX8A 5HP4A 2QTHA 2ZBVA 3T9CA 2W6ZA 4HYEA 1BS1A 3VJLA 1R4MB 4RK0A 3ROKA 4A7PA 1V5WA 3LCVB 5JNRA 1Y6JA 4LNUA 821PA 3PIIA 3U44B 3DVAA 1SBYA 3ABSB 3BCUA 1GGMA 5CFQA 4Z2WA 1UT8A 2G25A 4GWLA 3NGMA 4CQMA 1TM1E 1S4MA 5ALZA 1LRKA 3EYAA 2NXWA 3GLFE 5KQRA 4W5NA 3VR5A 2BGNA 2DJ5A 4UVGA 1V5IA 2ZJ4A 4RQOA 5CB4A 4EW6A 1WSDA 2JJ8A 2Y99A 3OPNA 2IXAA 3LUPA 4FB4A 3LNTA 2ZE7A 4OLFA 4HVTA 3LC7O 4YT8A 4OX9Y 4KK4A 1PQ4A 4HDKA 4ASUD 4Y30A 1U7WA 1PZXA 2ILVA 2G7MC 1A9RA 4H4CA 1B6RA 3CLTC 1IOVA 2OT5A 4RK5A 1CCWA 2QR4A 3W4IA 3DOJA 3EGIA 3EF3A 4UCFA 4Z86A 1YE3A 4R51A 4PZZA 5I7RA 3MSXA 2B78A 1RPAA 2Y1FA 2EP5A 2WTNA 2V7TA 2GRUA 4HZ3A 3IBSA 2CVQA 3A4YA 4JB2A 4PQRA 4GMFA 1BTOA 5F7XA 1FYJA 4IXMA 3ASVA 4H13B 1T9AA 2IYEA 5L8VA 1Z45A 2YZ2A 1Q7TA 1A9TA 1K98A 3AF0A 4BLWA 3CXRA 4WXMA 3AP3A 2LE0A 4WNAB 5I9SA 1O6FA 1OLOA 3SYOA 1BYUA 3FUTA 1KY4A 1E6CA 3S1SA 2WE8A 4OHFA 3HXKA 3N2ZB 4GI7A 4MZXA 4X7BA 1I0LA 1IU9A 2HU5A 2A57A 4FGWA 4I50B 5H3LA 2A9OA 2FSHA 3CYFA 4HG2A 4OAPA 3UK2A 4FK8A 2DHRA 4BNMA 2WVAA 3EXFB 4RV5A 4OXKA 4QNMA 4MTCA 4LA4A 1LI7A 2Z1EA 1IPAA 1QG6A 2CLOB 2VC2B 3D5TA 2EFJA 3TXXA 2OCXA 4I0WB 1K63A 1ZUIA 1XRPA 2ZB4A 3TWOA 1DK1A 5HY1A 5E4FA 3P0JA 2XA2A 4NJEB 1R3JC 1UFIA 1MFPA 3CC4V 2ADMA 2G0AA 3GRZA 3T7TA 4P0PB 4C4OA 1K8ZB 2OZPA 3LW8A 5KOYA 3FWPA 4H17A 5IKXA 3DFFA 4U02A 1R8YA 2JBAA 5BP7A 5CDTA 2YJ5A 3WQRA 1XX6A 1E8DA 4URYR 4ZZ0A 4K81B 3AFGA 3MD0A 1OU4A 5I7OA 2VNIA 4YRGA 2FLVA 2J6HA 3FWKA 3RF6A 4DLPA 1UOPA 1S3GA 3CCSV 3ZWCA 3FE2A 2L2QA 4D26A 2H5EA 3W78A 1PZFA 2HF9A 1W25A 1GCIA 4Y9SA 1SCNE 1XLVA 1ZR4A 1UM8A 3WJQA 4Y2YA 1FFHA 2BGTA 3KOWA 3MC1A 5MN4A 3HKBA 4TWKA 2B1QA 1MJFA 2XAFA 4X8AA 3STYA 2DG2A 3BFKA 3WGKA 3HP1A 3QEMB 2O4CA 3DF9A 1W49A 2XUQA 5DM2A 1Y76B 2OK8A 4TKUA 1GNRA 1QC5A