3N2GB

Tubulin-nsc 613863: rb3 stathmin-like domain complex
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
427
structure length
419
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Stathmin and interfacial microtubule inhibitors recognize a naturally curved conformation of tubulin dimers.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 114
structure length 419
sequence length 427
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3n2gB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3n2gB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3n2gB01
3JATB 5C8YB 3E22A 4X20A 2BTOA 3V3TA 3VO8A 5KMGB 3RB8A 4O4JA 3WGNA 5EIBD 3N2GA 4I50B 4O2BA 4F6RA 5IYZA 5MN5A 5JVDA 3JASB 5LP6C 1W5EA 2RHLA 3CB2A 5EIBC 5IJ9A 1W5AA 4TUYA 5JQGB 5MN4A 4U39A 5LOVB 5J2UA 3JALB 4IHJB 4ZI7B 4X20B 3WGJA 4DRXA 4O2AB 4X1YA 5EYPA 5LXTA 2R6R1 4O4HB 5KX5B 3RYIB 3VPAA 4ZHQB 3N2GB 5JCOC 3JAWA 5FNVA 4FFBB 1TVKB 4U3JA 5EZYB 4YJ3B 4LNUA 4B45A 3RYHA 3JARB 4I55A 1FSZA 3HKEA 2GVIA 4M8IA 3N2KA 5CB4B 3VOAA 5CA1A 4TV8A 3C8LA 4X1YB 2RHHA 1Z5VA 4HNAA 4XCQA 5FNVB 1TUBA 4I4TB 4EB6A 4U3JB 3ZIDA 1RQ2A 3JAKB 4X1KA 4TV9B 2BTQA 1RLUA 1W581 3RYCA 3RYHB 3R4VA 4YJ2A 3RYFA 3HKBB 1RQ7A 5LA6B 5IJ0A 1W5BA 4B46A 3E22B 3N2KB 5CA0A 4TV8B 5LYJA 4O4JB 3VO9A 3UT5A 4O2BB 4F6RB 4O4LA 5IYZB 5JVDB 4EI9A 3M89A 4X1IA 4X1KB 4E6EA 2VAWA 4IIJA 3HKDA 1JFFA 5IJ9B 4TUYB 4YJ2B 3WGKA 3WGMA 1SA0A 5J2UB 4EI7A 5BMVA 4DRXB 4DXDA 5EYPB 5LXTB 1Z5WA 3ZBQA 1FFXA 3JAWB 4X1IB 4LNUB 1JFFB 4I55B 3HKEB 1W59A 4I50A 4ZOLA 3HKCA 5BMVB 5CA1B 3JASA 4HNAB 5LP6A 5GONA 5J2TA 5JQGA 2RHJA 4WBNA 1TUBB 5LOVA 2Q1YA 4EB6B 3JALA 4IHJA 4ZI7A 3ZBPA 1W5FA 2BTQB 4O2AA 3RYCB 2RHOA 5MN6A 4O4HA 3RYFB 5KX5A 3RYIA 4ZHQA 5IJ0B 5JH7A 4ZOLB 2Q1XA 3HKCB 5CA0B 5JCOA 4FFBA 1TVKA 5EZYA 4O4IA 4YJ3A 5ITZA 2VAPA 5LP6B 5LYJB 3JARA 5GONB 3UT5B 5J2TB 4O4LB 4WBNB 3JATA 3M8KA 5C8YA 5CB4A 2VXYA 4EI8A 4IIJB 3HKDB 2XKAA 2VAMA 2XKBA 4KWEA 5KMGA 2R751 5JH7B 1SA0B 4I4TA 3VOBA 3JAKA 4O4IB 4TV9A 5ITZB 3WGLA 1FFXB 3HKBA 1OFUA 5LA6A 5M7EA
chains in the Genus database with same CATH superfamily
3F7NA 3RIYA 1R1BA 4DQVA 3ZJUA 5EIAA 2A9OA 3REQA 4ZYXA 1E3DA 3ZHQA 1RQLA 1GTRA 3BTSA 4YHBA 2WM3A 4DHWA 3VV3A 2ZRLA 4UU8A 2FR8A 3ZN2A 2NU7B 1WUKS 3BHPA 1ZUIA 1H1TA 4QUBA 4PA9A 1TCCA 3HEBA 1MHPA 3GUHA 1OYOA 2BH2A 2XUOA 1GHTA 5A4AA 3IV7A 3GLQA 3OQ6A 1SWVA 2RDMA 2PLAA 4JFRA 4LXYA 1J6UA 3FTEA 3KOMA 3LKDA 1E7WA 2P0EA 2OG2A 2H31A 5A3RA 3STUA 1ZUD1 1F23A 2QUZA 5CBPA 4JLBA 2UYGA 3W5UA 5CVJA 3EDOA 1U8UA 1TE2A 3IILA 5G02A 2BGLA 4C4OA 1Z4MA 2XZPA 3I4LA 4GP9A 3V7WA 4GC9A 3KJKA 5FAKA 4NVPA 4CUJA 4Q20A 3CUTA 1WPGA 4A8JB 3L2OB 2O7QA 4RGBA 4PTZA 5KTTA 1GQFA 2IXEA 4KQIA 4DAEA 1GFWA 1JYEA 1CRPA 4XCXA 2D3WA 1EFLA 3RRXA 3MTIA 4I7EA 3TB6A 3X1ZA 2VNJA 4YJ2A 4J29A 4B40A 1N7JA 2C5GA 4X1IA 3AG7A 4PY2A 4CKXA 2A79B 2BF4A 3S1LA 1L7DA 1RLOA 1KO4A 4MUGA 4NE9A 1ZNQO 4EG6A 2QL6A 1BWQA 3HXOA 4BJ3A 2ENWA 1T35A 4HWTA 2CTRA 3AVTA 1DEKA 1CUCA 4GP6A 3A28A 4LXHA 1CKEA 2EP8A 3RTAA 3A3OA 2QTFA 3B2EA 3B09A 1QLWA 4GGOA 2PGAA 4OQYA 2Q0SA 4QOGA 1G5FA 1ZL2A 4QBKA 2X0FA 1YA6A 2PXAA 4FEEA 1ZONA 5H80A 1YZLA 3NM6B 1O54A 4D3FA 3DDZX 2FYTA 2UVQA 2OHXA 4MUEA 3RV4A 3CX3A 3EH2A 3A1CA 1GCIA 1Q22A 1SZTA 3LDTA 1SBCA 3FSGA 4DQUA 1QRRA 4PRKA 4KLZA 3IQIX 3BQ9A 3NRJA 1HNXO 1PT6A 4OAPA 1OXSC 3AEUB 1O4WA 2IIQA 2VWKA 1RCFA 1KUQA 4LQ4A 4MUXA 1K7YA 4OMCA 1BQ3A 4L22A 3KHTA 3UQ8A 1W29A 5FL3A 1WU8A 3K6SB 5DN6D 4CQJA 4TKLA 5CT4A 2HNAA 4V0ME 1GNPA 2QLTA 3S0YA 1DC5A 1SPXA 1IWBB 1ZX1A 5EQFA 3ABRB 4IDEA 1QF6A 3VPXA 4D46A 4P54A 3Q3VA 3CE9A 1TADA 1YR2A 1F14A 1ZD5A 2QTMA 3EUFA 5JATA 1EDEA 2C9OA 3OFKA 1E58A 3G59A 3VZQA 5FL7G 5ENVA 3I7TA 4JQCA 1FYFA 4OBWA 4MVJP 1LV7A 2DQ4A 3Q8LA 4IV8A 4S3MA 4PC1A 4TSRA 2GN0A 4L6CA 4KUEA 3CLTC 3CX4A 1WUJS 3VJRA 5IDJA 2FPWA 2YUTA 1BE8A 2OGWA 4YCCA 3OLYA 3GVCA 3A05A 4WVLA 4Z5XA 2ZFUA 1X39A 5CFPA 1IDSA 5K8VA 2CF6A 4KIFA 1QQAA 2G3YA 4IDCA 1U3DA 4XIIA 1G6Q1 2TMDA 4DIFA 3CO5A 1EQUA 1NU6A 1M2VB 3NIGB 4BBJA 5IC4A 5HILA 3NIBA 4DIOA 4HUTA 3NXKA 4BLTA 3FPSA 3MLBA 4YC7A 3LSYA 3F47A 4B3SB 1DMRA 4WIAA 4AG3A 3NVKE 2VQ3A 2SECE 2R44A 5BW8A 1IQPA 4QHYA 1SAYA 5IYZA 1AV6A 1Q44A 1JKJB 2GZMA 1G9XA 3NM4A 1X1QA 4L6AA 2RAPA 4TQGA 4IHJB 2IXTA 3IPRA 4Q39A 3RFRA 1RXIA 1QPBA 4RA9A 3DFZA 1J90A 5AKHA 1LVHA 5I3ZA 1RR6A 4QIWF 2VP4A 1G8KA 4C7KA 1I14A 2QNRA 2QKYA 1G59A 4ED9A 3DGEC 4CS4A 4LWSA 1JWBB 5DM6V 2ZCJA 3BRCA 3EIXA 4IVQA 1Z68A 2VAWA 4KP4A 3LC2O 4QDOA 4OVKA 3ZO8A 1JL3A 1C3VA 1JIUA 4MV8A 4DDWA 4HF7A 1ZIPA 3NH9A 1HXHA 3Q9SA 7GPBA 2VRCA 2PXXA 1QF9A 3HG7A 1VHTA 2CWJA 3FJ1A 4RZ2A 2XIQA 1IJBA 3K05A 4QOEA 4TSFA 3ZE6A 1XC7A 3JWPA 1KKDA 2F59A 2IUFA 3CWBH 1AXRA 1THGA 2Y27A 2QRNA 1USVA 4G5OA 1WZUA 3IMFA 5CITA 1BXGB 2XZTA 2VSXA 4BX8A 3U6BA 1CETA 5C1IA 1BAPA 1UBFA 1P6QA 5IM5A 2IH5A 3F5SA 5CIWA 5U4XA 4RH3A 4ENPA 4GMXA 5EWJA 1S8AA 4G81A 2I1QA 2G67A 2D7JA 3ZPXA 2VPQA 5E2AA 3H2KA 5KSWB 1J8YF 1DLBA 1C14A 3CNNA 1W36B 2D0PB 5LL6Y 4DR7B 4OMUA 3TZLA 1IPAA 1CZOA 4PJ0Z 3QEJA 1LDBA 4UM7A 2XYGA 2DJ5A 1K7EB 2WTNA 1LNQA 3ZHRA 1GL6A 1G21E 2B33A 1JPVA 1DRVA 2YJ5A 4UCSA 3QU9A 4M98A 2HY7A 1EQAA 3C8HA 2Y2VA 4YI3A 1P2FA 3WQQA 1VQPV 3W06A 1GYRA 4XDYA 1NLFA 3R6TA 2R8RA 3SXJA 4ON9A 3R3SA 1IY0A 2ERCA 4TS4A 2CW5A 1N1EA 3ESDA 1IDOA 1U8ZA 3LC7O 1BVRA 1FX0A 3UXMA 1IOVA 3ENKA 3LP8A 1A27A 4KN8A 4W8HA 3ASZA 4B48A 3KXLA 2OR3A 1S4MA 2ON6A 1ULHA 1AI7A 4MKHA 2AN5A 3LFTA 1YRAA 4YAWA 5JCOC 4QSMA 5C18A 1A9SA 1IQUA 4ESOA 2UUCO 2OUKA 2XUIA 2FPRA 5K3FA 2CNWA 4RMIA 1OCOB 5K0EA 3I28A 2F9ZC 1ECCA 4WL0A 1UMCB 2NYRA 1Q2UA 4FMTA 4M49A 3W4KA 2MSWA 2D2EA 2XYHA 3FPFA 1ZZEA 1FC0A 1ZKDA 3USCS 3LUFA 4ZO4A 4Z0PA 1I1OA 4X8AA 4ZCMA 4AKIA 1UBKS 3AZOA 1X87A 2GOYA 3U80A 4N3AA 4CMHA 2XWQA 3D1VA 2WAYA 3ZD6A 2W4IA 4UHKA 4AZTA 1YHYA 2EKPA 3B1JA 1NOJA 1I5RA 4L76A 2ZIUB 5NLLA 3OKAA 3A4IA 2WP0A 3N7AA 2FMUA 3ROQA 4NMHA 4IJKA 4P9OA 3VOBA 4DPMA 2E76B 4IRMA 3C8UA 2A7QA 4Z2WA 4KXUA 3OQIA 3PNLA 5E6SA 2H92A 5CB6A 3R0JA 4CDMA 2J0VA 4YY3O 1MNGA 1YB6A 3AM5A 3M6WA 1BS1A 4FFOA 3VPGA 3D7MA 2VRBA 4CDGA 3A1TA 4GG1A 1XTKA 4G0NA 5SICE 4JUFA 1ENPA 2PIAA 3CEJA 4FUQA 5CBHA 4XI9A 5HF6A 3KQHA 5JZOA 3JD3A 1Q86W 4OBBA 1W35A 3KPYA 2W9XA 5KX5F 2A9VA 1QLNA 1UPXA 3E5HA 1U2GC 3EASA 4IYHA 5COBA 4ABYA 2W6IA 4WECA 2ECQA 4HWRA 3K92A 3QKUA 3S06A 2A57A 4BNXA 1RBZA 5HK9A 4J03A 2NMUA 4E09A 1F5NA 5FL7D 5C7IO 2ZWPA 4HAUA 4ALJA 1EWQA 3H9JA 2TRSB 2IYQA 1LLDA 2VYNA 3A10A 2CXOA 4JZYA 4ENQA 4J6EA 1M1ZA 4B0PA 1E89A 4C5AA 5EHZA 3GO4A 4X45A 1X77A 4K0RA 2AEJA 2IUEA 2QUHA 5B66Z 2F1IA 3IAXA 3LHKA 4ZANA 3O8CA 4HLUA 4FGJA 4X7PA 4EUNA 3NBUA 3FPKA 1BX3A 4D4IA 5FI0B 2Q0QA 2KPOA 2AW9A 4D4MA 3N2ZB 2LKDA 3F71A 1BX0A 2C9CA 4RXMA 4URFA 5I9LA 3OTQA 5JO9A 4LNUB 2D3TA 1PZEA 2KHZA 3U7QB 4B4VA 1JFTA 3TRKA 4HX2A 1TD9A 3WGOA 4RSMA 3FFQA 3ZVMA 2NTYC 1H8EA 1KAMA 4NESA 3FXAA 2YFHA 4XR4A 1ZBQA 1IULA 3RUHA 5KYTA 4RULA 1T9GS 4NR0A 121PA 4OFBA 2O8BA 1J25A 4MWSA 3LO5A 2H7YA 2B21A 2VTEA 3C3JA 1CR2A 5TNXA 5C2JB 1GO3F 3WGHA 3OLCX 1NTZH 1YF2A 4C29A 1PSDA 2P62A 1BS9A 1Y6FA 4L9WA 5FV7A 5IDXA 3CXCU 4JLUA 1YBMA 2XH8A 3TX2A 5ELXA 2P9BA 2JFHA 2ZR0A 3AY0A 3O21A 3N27A 2PVCA 1A5SB 2I8LA 2HJGA 3VNAA 4LI0A 3D3NA 3OVMA 5AW7A 1VKJA 4RL6A 2YSUB 4IFEA 4E2XA 1X7ZA 1Z4NA 1XPUA 1E1MA 1QCYA 1RABA 1UKAA 2E55A 1P5FA 2AFIE 4R0VA 3LP6A 1KR2A 3QLJA 2GEFA 5AKYA 1ZD9A 3AGQA 2BPOA 4Q3OA 3TQOA 4ZKEA 5KC8A 3WRYA 3DWFA 3ITNA 1GH6A 4HDNB 3I0ZA 3GFBA 3GGJA 3I73A 1JEDA 3V3TA 4DR4B 3CEHA 4TLBA 4WMLA 1J39A 3K2IA 4P86A 2OGTA 1JOYA 1A9TA 1Y1PA 3RVLA 5EWRA 4FGUA 1R16A 1ES9A 2Y0EA 2B83A 3G6KA 1FLDA 2IITA 4UNNA 3SYLA 3H9UA 1XMQB 1EDDA 3EB9A 2VHZA 3L73H 2V7GA 2NZVG 2XE4A 2QAGA 5AKKA 1HKUA 2AKEA 4P3KA 4EX7A 3R4VA 1REQA 4U4AA 1CIJA 2EVWX 2AXNA 3HC7A 3LGXA 4F6RB 1ZI9A 4NABA 4AKSA 2IJKA 1OH6A 1VHJA 1H2MA 1G3MA 1RE0A 5YASA 3H7IA 5EAIA 2F4NA 2WMNB 4TOIA 4C3VA 3G2LA 2YCLA 2YKGA 5K0NA 1E2FA 5K20A 3CNEA 3NWJA 4RHXA 3KQSA 1UKYA 1ILWA 1NJGA 4CTJA 1O2DA 4WCFC 3IIIA 4B8ZA 2VHVA 3IMKA 1Q20A 2GYVA 3WGLA 5G40A 1VK3A 1FXUA 3NVKI 1H8HD 1KE2A 3V4FA 2OD2A 3QF4A 2R1VB 3IEWA 1ZK2A 3I6QA 5IJ9A 2DGDA 4G2KA 4P36A 1E60A 1U8AA 1P7GA 1VIYA 4TKVA 1PWZA 4CKEA 3ZHYA 1EESA 4MW0A 1ISIA 4BBPA 4G1UC 1V9CA 4BQEA 3VU8A 1AKMA 1YNOA 2EJCA 2YRFA 3LWDA 1CNEA 1UBUS 4DWWA 3TOSA 2V6GA 1C1YA 2QYTA 3RT1A 4NJEA 4DV7B 5B1BC 4NOJA 5SY4A 4RVFA 2ZJ3A 3MXTA 2GPTA 3KU1A 1EM6A 1N75A 1NJ6A 4L16A 1P91A 1YH3A 1KEVA 3FSRA 5IBQA 2HHLA 1U9CA 2BMVA 2HU8A 1LK5A 3EFHA 5K0SA 5L4LA 3ZHCA 4ZC1A 2QTAA 3EGXA 4I0XB 2WV9A 4OHBA 2HA5A 1N1MA 2MIIA 5C4MA 3AERB 5EJ5A 4UD6A 4PG6A 3G3EA 1OGJA 3GOQA 1WQ1R 4IJWA 4BFCA 1E1RA 3OPVA 3U37A 1E0AA 2Z9CA 3OUSA 4DLRA 5DX1A 2HCJB 4ZDIA 3H5IA 4WDRA 3AGKA 4Y9DA 3GRFA 2RMKA 1R50A 5H3HA 1VP3A 2ACWA 4I50B 5I9SA 4G0VA 1L5WA 4ALIA 1GGNA 4HNRA 4PG4A 1JHXA 2K7ZA 4AZVA 2IZ1A 1U28A 2WIAA 2P6OA 1Z7YA 3K1AA 2AG1A 2PEYA 2PFGA 1C9MA 4NXMB 1E1NA 1KZGB 2ZULA 3PGJA 4NB5A 3G5UA 2QIPA 1EG2A 3ZOPA 1KYYA 1MFZA 4N49A 4E1AA 1J0DA 4X64O 3VYSB 2C1EA 3CRVA 5HJEA 2PANA 2ZJ7A 4L57A 3O3MB 3HKCA 3SYCA 5J59A 2YVQA 1ZCJA 1O95D 1Z7BA 1DEOA 2Y8EA 4PX9A 2CLFB 5HY1A 2VJAA 1QVFF 2XMCA 5TDHA 1NQUA 2QTTA 3NS7A 2FN4A 5JAOA 3G13A 1ANKA 2AB0A 5EJFA 5CVVA 5CVDA 1KY5A 2C4NA 2PKYX 4K03A 3H13A 4WUVA 2OZBA 5IN4A 4R40B 2W48A 3B51X 3T1YO 1TZMA 4Z4EA 4Q3KA 3UUGA 2Q45A 1AS0A 1E8DA 1YQUA 4A8TA 5K51A 4IH4A 3PNKA 2ZUUA 4ZOEA 3RG2A 3S1AA 5AI5A 2RI6A 3WGVA 3PRJA 2RCNA 5BN3B 5CG2A 4KEAA 4UFOA 1T3ZA 1ATIA 1EFPA 4NJMA 1NP3A 5JCXA 3JYHA 3LSSA 1I1QB 1XZFA 4MGEA 4GMFA 1RDFA 2OXTA 4YFYA 2WPDA 1AKVA 5EYPB 4PLCA 3K2BA 1U43A 4W5WA 3BTOA 1G9TA 1R5BA 1S2DA 3UC5A 4L4SA 4J7CA 3DV2A 1OJ7A 3FLEA 3I53A 5C80A 1G291 2R9AA 2E3JA 2Y1LA 1F4MA 1P6XA 4YRZA 1TF5A 3ZV6A 2J0UB 5LZ5A 3BBLA 2WWIA 1XEXB 5H5NA 4CKWB 1YC2A 3AJ8A 1QB8A 4IYJA 4FMDF 3IH5A 2ZPTX 1CUJA 2HWUA 5LD2C 3AUAA 2PR7A 2QM7A 1YIDA 4KE7A 5DRYA 3ZWWA 3WHKA 1Z4IA 2OTLV 4JUBA 5K03A 3N53A 4FQ7A 1Z74A 4MRVA 5D7NA 1L0LH 3I6BA 2CCGA 3C3MA 1ZUNB 4N48A 2GDJA 3C39A 1JR2A 4RUKA 1L8LA 2YJNA 2P91A 4XD2A 1ZM2A 1BD3A 3ITDA 3MFQA 1TJ3A 1UIMA 1TUGA 2AT1A 5A4KA 3WYGA 4AQ7A 1PQWA 1VHDA 1OA1A 5JCZA 4DBLC 2VHTA 4Y1EA 2IW1A 4BJ1A 4XAQA 4BGIA 2HV8A 2ECFA 4HH4A 1HYBA 4GXTA 5C34B 4DOMA 4W9RA 5E7MA 3H0KA 4UUAA 3S2IA 4A10A 5KNDH 3QVJA 2A30A 4G28B 3N39C 1OQAA 2Z2ZA 3SSMA 4OQLA 2WU1A 3MCUA 4EECA 4GOXA 2CUNA 1UBMS 4D9KA 2GRJA 4GGMX 3QUQA 2NVUB 3KQLA 2FG6C 4EF4A 1Y89A 3FIJA 3V32A 1YK1A 1N57A 3QYFA 4COOA 2ZRFA 3ENQA 2I34A 5DI3B 3KXIA 3R2JA 2G9QA 2CSLA 2VUHB 4P4UA 2I22A 4A0HA 4Z7QB 2G82A 2PS0A 3O94A 2ZODA 5HK8A 1H65A 5T3YA 1J23A 3WYCA 4YA6A 4YK7A 1TK2A 2BKLA 2IEZA 5HXAA 1G7RA 1KERA 5TARA 2WUVA 2BBOA 3K3PA 3AO0B 2WHXA 5KAIZ 3RVYA 4A03A 3JASA 4Q34A 3ADPA 3WYAA 1Y98A 4XTCS 1V3UA 1ZA1A 2PKCA 3ASYA 4A0GA 4YR7A 3AJRA 2HO4A 2IOFA 1UQUA 1TB4A 4C4YA 4O1HA 2HTEA 1A2QA 5ICCA 3ED5A 3K1TA 4FQ5A 4N3GA 2JFGA 2NO9A 5B1AB 1XVIA 3VOTA 1JEYA 3OZXA 2FPGB 1Q8RA 3PNVA 2WJHA 1EFRA 5A5DA 2VNKA 1JLSA 3Q3JB 2BFBA 3UENA 3AZPA 3KKPA 1WW3A 4PHFA 2WWGA 2WF9A 4RDIA 2FPLA 1WQ4A 4PHHA 1F8GA 1LPNA 1SWWA 4BP9A 4CMEC 2XGSA 4O4IF 1DBSA 4EW6A 3UA3A 1ZMTA 4I0WB 1XXLA 4UDXX 4ND2A 1H47A 1GGVA 2HCFA 3IT3A 1IL0A 1BW9B 4MKZA 2NO4A 1QQ6A 4O5AA 3WGYA 3CZPA 4OM8A 4CEJB 3RS5A 1SCIA 5HJ2A 1M72A 2F8MA 2JGDB 4DR5O 3UKJA 2GLUA 2YBDA 2BSQA 221PA 5G1OA 3T1CA 4WFQA 3UVEA 3FSGD 5EVCA 3RKRA 3AETA 1G9SA 3H3XA 4X44A 1NM5A 3OE4A 3SFZA 4DLAA 3LYHA 3EGCA 1TAEA 5LJLA 4R68A 2JKYA 4JUDX 5G0VA 1G8SA 2FW8A 3OKCA 3U4QA 5D6NA 5KHOC 4Q7QA 5I7OA 4PZDA 3AB7A 2IIBA 5IRCD 2IEBA 3WK6A 1NX9A 3S0JA 1XHEA 4ZKDA 3FROA 3FF1A 5FJIA 1W76A 1ZXLA 4F46A 5LKAA 2W6IG 3CIOA 2Z09A 2H8EA 1GDDA 5B3JC 3TLXA 3E7XA 2XWPA 3WS7A 2QV7A 3EAQA 4JEUA 4PLHA 4CMBA 1KI4A 1MB4A 3FPCA 1FFGA 1II0A 2Q4RA 1JJBA 3O26A 3TL3A 4MRNA 1LPPA 1UFRA 1EWYA 5CA1B 5COQA 4YAUA 3H5WA 1Y0BA 1RXYA 3IDFA 3ZVKA 1JR3A 4OUDA 3MAJA 2CL6X 3IRVA 5BN5B 5IAJA 3L43A 1K6MA 1VSVA 4CEHB 1XTJA 4F06A 4FS8A 2X0NA 3PZRA 1C80A 2JCGA 4M83A 1DARA 2NSDA 4NOLA 4L4ZA 3M83A 2O8DA 1FFWA 2Z6UA 4QWMA 4JX8A 4WZBB 2WG2A 2YW2A 3AJDA 3NOVA 4II3A 3JV7A 1QLEB 4HYTA 4D81A 1YDFA 2F00A 2H08A 4AD8A 4LDNA 4DWVA 4FJCC 1DKPA 3WWOA 1VJ0A 3O03A 3DAFA 1TK3A 3N2EA 3OC6A 4O02B 3TXQA 4BFSA 1XCMA 1VIAA 2E21A 2Z2JA 2R8ZA 5G53C 2CHGA 4BB0A 3RBZA 2MQEA 1R9GA 2JI7A 2YXEA 4MQFB 3ZRSA 3ZTWA 3GLGA 3CCMV 1XL6A 3X1DA 4LHWA 2Q5ZA 1H8EG 1RAHA 4Y6PA 2WMYA 2F1RA 1C8BA 1ZY2A 3ZLBA 4RDCA 5CYGA 4HDAA 2DR2A 4PNZA 5JNLA 3MTAA 2E5LB 3RTDA 5IYZF 2RH8A 1G19A 5FWDA 2JI8A 4UXJA 5E1MA 4RHTA 4MGHA 1D9ZA 3AP1A 2ONJA 4P4SA 3LVRE 4H7JA 2ERXA 2R8PA 7REQB 2SCUA 5EQDA 2IC5A 3NPMA 4FR2A 3GRKA 4A73A 1W41A 3QFTA 2ZBDA 1XA4A 1J8DA 5MDHA 4IVRA 2IX9A 3NBMA 5HP7A 4L6IA 4U39A 4BDTA 3CE6A 4KWHA 3HO1A 3REOA 3NOOA 1PV4A 1DI0A 2VRCD 5LIRA 1WABA 3PGKA 1R4AA 2Q46A 2W90A 3FTQA 2B4KA 1J99A 4CMIB 4CMAA 1DNPA 2OWDA 1N25A 4TSFD 5FLKA 5KSZA 3LMEA 4LP8A 2H3HA 1IXMA 3DTUB 4X0EA 1SXJA 1IAQA 4NU6A 1CUIA 3L8GA 2JRLA 3S8YA 2WFLA 1GITA 2FEAA 5DHAA 1RRGA 4ENSA 5EMMA 4JBLA 5AVZA 4FKMA 4X6LA 4IOLA 3PNOA 2PV7A 3LRXA 4KSBA 4KR6A 4JN6B 5E1DA 4MLPA 1JTEA 4CF3A 2HP0B 4PU0A 3W4IA 1WM1A 1TA8A 1NYRA 2E2WA 2QYSA 1RKVA 1MUUA 5BMVF 3V4PB 1JDUA 2VHUA 1QZ3A 3WI7A 4ZFNA 9LDBA 3CISA 3OO0A 1W42A 3E4DA 1U3VA 1XCLA 5LQUA 3VZSA 3X1JA 5KNBA 2EG9A 5D51S 2IHZA 5TEWA 3PGLA 4ESEA 5EMHA 1QE5A 1NAIA 1QSGA 1EH5A 4N5DA 4C0KA 1D4AA 4GPZA 1UK8A 1N5IA 1A4IA 4HTFA 2OCCB 1W8DA 1KQOA 4CM4A 4Q37A 1Y76B 1CC1S 5KOJA 1NKTA 3H2SA 4K8ZA 3H2ZA 1I08A 2LW1A 2O8FB 1D2MA 5DGHA 1J4AA 4AWAA 1Y66A 3FMIA 3EIFA 1ELOA 2IH3C 3O38A 1W94A 4E14A 4OHCA 2P1RA 5D3KA 1IV3A 2CNWD 1AZWA 4R2IA 2X4DA 5B1AC 2H2FA 4TWIA 2RGNA 4BFUA 1P84F 1AKUA 4L5BA 4CCAA 1IUPA 4MHTA 2RIRA 1QFJA 3QNEA 1E18A 3Q9UA 4JPRA 2F8TA 2FJUA 4U1RA 3SNKA 4ZN6A 3T1QA 3FD6A 4F5WA 4RMJA 3C85A 2JFZA 1WHTB 4H17A 1QTNA 1M1NB 4DCSA 3INNA 2ZBVA 4N76A 1WDKA 5CA0A 3GUCA 3QVSA 1GRNA 4KV7A 4RORA 3SIVA 2HMUA 2JNWA 5FUVA 1TTHA 1ESEA 1QHEA 5G41A 2WWFA 3WL6A 1E1RG 4B0OA 1OH8A 5KHGA 3WMGA 1OFTA 3TVTA 5BQXA 4WCDA 5C8XA 4ZREA 1FJGO 1WNSA 2CYCA 1KOLA 4CEIB 1S1MA 2C04A 1ZC3A 3TQTA 4DXHA 1TVKA 4CIDA 5FTLA 1K8YB 4G09A 5HE8A 3R0PA 3LVFO 3QHDA 4NWOB 4L3WA 4H6VA 4PD4F 1IY2A 3WIEA 4NYIR 4FYMA 1W9MA 2HKIA 3V8QA 4CG3A 3C4QA 1DC8A 1BXRA 1E2JA 1MH1A 1MBZA 4ZHVA 1QGAA 5DM2A 1AN0A 4JBNA 5GIOC 1ZN9A 3ZEAA 1Y48E 1CERA 3HNRA 5CN0A 2MINB 2MSLA 2W6ID 4ZI2A 2ZJFA 5GVSA 2R7KA 4HGRA 3EZXA 1UFYA 1CEZA 2WLSA 3ONNA 2AZ2A 1QOQB 4LQDA 3RTBA 3HP4A 1S8NA 3JQGA 2NUTA 2B98A 5JTTA 3M3DA 5JRDS 3A4VA 1U2QA 2ZRKA 5FUXA 4D8VA 4FD3A 421PA 3VPHA 2VYND 3IGAC 1YO6A 1L7RA 5JJIA 1YTFB 3DL7A 1M6EX 4PZYA 2YFQA 5I51A 4TZKA 5FLXA 1A32A 2EBOA 1L4KA 3I4CA 5GINC 2AHOA 4EEZA 3AR5A 1ECLA 2H3EA 1EXNA 4AUMA 2OXIA 5HXUA 1P60A 4D4KA 1VCOA 2H52A 1JU3A 4QUIA 5IT9N 2XTMA 4INPA 1RHQA 3H1FA 4FP9A 4H59A 1Y82A 4L3VA 1AKEA 3R7BA 1ORTA 1RHJA 1PAUA 2WPDG 3M9WA 1VPVA 4S1TA 2H0QA 1V9SA 4G25A 2C8LA 2F1KA 4QYTA 2P9ZA 3A4NA 3P5SA 4KQEA 4HDRB 1A0OA 3CBGA 1R4ZA 1SKQA 1H8ED 2XASA 2PYIA 4KG7A 2X3FA 2H17A 1LF5A 4UNQA 3OIYA 4FD2A 2WIBA 4RWUA 1G1XB 3ZH2A 1ECBA 4ZOQI 1BD4A 1ZM9A 2QMOA 4Z9AA 4D26A 4WESB 3K0KA 2WZBA 2YNMC 3FTPA 2A84A 5EI5A 5IJWA 2XDYA 1DLJA 4IX1A 3V8NA 1TO2E 4FLTA 3SJUA 2AXTZ 1MB9A 2DT5A 1AZSC 1QO9A 1EUCA 4I1YA 5CVUA 3IP6A 1M73E 1SEVA 3GCZA 2ZDIA 2EIKC 1X7WB 1LRLA 1XBIA 3L4BC 2QL5A 1EXDA 2YV3A 2D0OB 1UKEA 2ZRNA 1YASA 1IXBA 2E4ZA 4C4AA 5T57A 3FOZA 2VWQA 3SOZA 2PZSA 2GK7A 2JW5A 3NTRA 1M5IA 4GDFA 3BHJA 2ZE5A 4WKPA 5K0FA 2HJRA 2VL7A 1S7CA 3A37A 3HUDA 4TLDA 5BO5A 1C9JA 2VH2A 3P4XA 4IUBS 5A7HA 4H2DA 1BA3A 5BSMA 3LW8A 3L0BA 2WWXA 3RVOA 1SC1A 4DLLA 1V8PA 5BVGB 4XYGA 3DUFB 5F2EA 2Z3WA 4ZAYA 3BIJA 2ZT6A 2I7TA 3KQYA 4MS1A 4FBLA 3T9CA 1RPJA 2QQ0A 4ENRA 3CCEV 1OHHA 2NGRA 5FA5A 1VPEA 3Q3EA 3FF4A 4F4UA 4XQEA 1QYVA 5IYDO 4QC2A 2SKCA 3FAZA 1SZDA 3BWCA 1Z36A 2WLIB 1Z0IA 3DUWA 3ICEA 5D3QA 2FCRA 1FA9A 4W4TA 4Q05A 2GCEA 2QQFA 1GGFA 3FYUA 4Q9IA 3PDIB 5H4GA 3JAKB 2XE6A 4XKJA 3GZNB 2JIZA 5K6AA 1PL8A 1QC5B 4RTPA 4OL9A 2FRVA 4JVOA 2OFPA 2OCCC 1P7VA 4ETWA 3RUCA 2WJ3A 4QJ3A 4QTTB 1VQVA 3IOBA 3BB3A 1GAQA 3MT8A 1NY5A 1EFRG 4ND8B 3QIAA 2VWGA 4QWWA 6LDHA 1SGWA 4LVUA 3D6VA 4YPFA 3NHRA 4XOUA 5BUQA 4DY6A 4UVAA 5IWAO 4IAOA 4JJ7A 1XPJA 2B2CA 2R8XA 3IAFA 3CCQF 3SZOA 3QELA 4RUEA 5B57C 3SC2A 3TD3A 1RWMA 5JYCA 1K5HA 1FXKA 5IAAA 1DKUA 4RADA 4H7HA 4MW5A 3STWA 1GZVA 3D6NB 2IW5A 4R9SA 1RQXA 3T5MA 4XD7A 1XCJA 3P4YA 3M6IA 2HMTA 4QAQA 1LEHA 1E1RD 2PUDA 3E8BA 1KAHA 4E6EA 5LKRA 1T3TA 2O7VA 1RAIA 1I4EB 4QGSA 3E20B 3GFFA 3CH5A 2I9KA 3GZJA 1ZD1A 5CW1A 3NT4A 4FW9A 2GESA 3LU1A 2BY4A 1HBJA 2RKOA 3P10A 2CH7A 1AF4A 1X25A 1T5OA 5D2CA 3V7NA 5GJCA 1NH2D 4QM6A 2QW1A 4FYXA 5C5IA 2WC1A 4M76B 1OCZC 3RAGA 2Y92A 1M5TA 1KOJA 4IDFA 2BKEA 2R2GA 4FOPA 3NALA 4P33A 1GAXA 3RFTA 3BC1A 4AZ3A 3JQ9C 3TJZA 1VQKF 2ZI7A 1QU7A 3TG2A 3B7GA 3N7TA 5DOZA 1UKCA 3RS4A 2PLNA 2ZT8A 3AUYA 2QTOA 5SYMA 1P4JA 4QYIB 4U9IS 2QVBA 5H4HA 4EFDA 5JS2A 4RTNA 2BFCA 1C4XA 2P4KA 1XZIA 3V55A 3AVWA 4Q21A 2C98A 3Q8XB 3F6MA 2PTGA 3EGVA 1ZEJA 2M6LA 3GJ8A 3GZTB 4PPGA 5IC5A 3SSAA 2VBGA 4J7KA 2QDKA 2NZ2A 5AVYA 1Y9DA 1SU6A 3GPDG 2HHAA 2OA0A 1V48A 2AMJA 4GKJO 4RD1A 2ZPUA 2NT4A 1DUSA 3F2IA 2W4MA 4BU0A 4PC7A 4RACA 5KJCA 2PGOA 1AK9A 3VSAA 4ZDJA 1J0XO 1FP6A 2C2MA 1TNDA 1V11B 3FYCA 2REQB 2WPDD 1Z83A 1YACA 3D4IA 4Q7KA 1DWQA 3VRHA 2KG7B 1RWWA 4B09A 4ZMRA 3B60A 3FB1A 4YJHB 3VAZA 2NXJA 1C4OA 3NZEA 4YMLA 1DTOA 4LR3A 1NMXA 4BTEA 4PZCA 2LV8A 2PL5A 3ROZA 3WNQA 3QVLA 2PMDA 4WV3A 4F91B 3EISA 1K73W 2DFNA 3F1LA 1E62A 1GT91 5ITSA 4UVDA 4UUBA 4YPVA 3FCOA 5HF5A 4PRLA 4AJOA 5FKJA 4FCWA 4G8BA 4HH0A 1AUVA 3OE7A 2NM0A 2I1VB 1UFIA 4UCUA 4EEQA 1V8DA 4A6EA 3WXMB 5AVSA 1B26A 5TVKA 2BFOA 3AIIA 4OYRA 1WJZA 1GSIA 3L6EA 2RGRA 3HFRA 4E0BA 5C9ZA 3MJCA 4G9GA 4TPKA 1JY8A 2P8SA 4Y0AA 2O07A 1ZJJA 2W6ZA 4ZQCB 3MWKA 1R8SA 2HRBA 4LOKA 3V2IA 3KYDA 4RTQA 2QZ9A 5B3LA 1PGJA 3HU5A 4J16A 1DVRA 2FB9A 4OI1A 1M8JA 4Q9AA 3FZEA 5BT8A 1HK7A 4GUDA 2QTSA 4XSVA 2IS2A 1JQKA 4ZHYB 1LY1A 5TPZA 1MC1A 3WB0A 2ASEA 4DBZA 1YHZA 1P33A 3GIDA 1T5HX 3BXPA 2QS9A 4PSCA 4P81A 2DOKA 2GNOA 1NURA 4PPQA 1G8HA 4H33A 1PRYA 2QTLA 2GCNA 3I52A 3KPVA 1XG5A 3OD1A 3P9KA 3NCTA 3W8NA 1X1AA 3IKJA 3ZDXB 5DCYA 2P30A 3WZMA 1J56A 3BAZA 2ZM6O 5THQA 1OXXK 4U6NA 1WZCA 5ARDA 2B2XA 5B4TA 2UZIR 1Q91A 4IHAA 1JEQA 4P98A 1FFAA 1NJ1A 2C58A 3VA7A 3V97A 2BLNA 2WJWA 4Q7JB 3RVSA 3FM9A 3IC9A 1K89A 4ZCIA 2CL0X 2JFFA 5KYXA 4K87A 2HEIA 3WMFA 2XGJA 3SXUB 2I2DA 9GPBA 2BFFB 1ZR2A 2X13A 4V2IA 5DW0A 2HL6A 1PBNA 4BQOA 3DPUA 2NO7A 3VTIC 4L51A 2HLPA 4Y8VA 3H2JA 5HGJA 1DIHA 4OMDA 1EFRD 3W3ZB 2EQ5A 3OQMA 3JQCA 1Q3EA 1SK9A 3CXHF 3ZZTA 2EV9A 4MYUA 2H0RA 1J8MF 1WPRA 4FZ1A 1BHQ1 2PM8A 2WV7A 1ZVKA 4DHEA 3CC7V 1RC0A 1Z0FA 3BREA 2X19A 1PZFA 2CL7X 4PYRA 1KC3A 5I9IA 1D6JA 2E48A 2BHRA 4N8DA 3MTBA 3WHIA 1DXQA 4DMFA 2XBMA 2W0MA 1GUFA 3EIWA 4ID3A 2FF5A 5AT1A 2HBYA 5LCXA 3T15A 4UUOA 2F95B 3VDNB 3TOZA 4B3FX 2AXPA 4EYOA 2IYVA 3A3NA 4Z1MA 5B7GA 3OTOO 1L5MA 2WF7A 5B4UA 3AF1A 1J21A 1PEDA 5G0SA 2BJWA 1JHOA 3U3KA 1XTPA 1FTYA 1MZEA 1DUVG 2IYXA 4Q3CA 4NMLA 1NATA 5BNFA 4KYIB 4G3XA 1R6KA 4DVGA 1XLUA 3V4VB 3PKIA 1SXQA 4ZVRA 5KJFA 4OK6A 3DMYA 2FGYA 1ZU5A 5FWAA 4BASA 4Y9TA 3LTEA 4B7XA 1A9XA 1OE0A 2IBTA 5F1OA 4BY9E 2HREA 3JAMM 3M4ZA 1P4SA 3BH6A 1H2BA 1BH2A 2VP9A 2GVNA 3O47A 3PJRA 1AC5A 3CF2A 1C7RA 5CYFA 3D3QA 3IP9A 3N3BC 1D03A 1SELA 1B06A 1EXMA 5H9VA 5AXBA 4Q03A 4IGGA 3IAM1 1EVLA 3FW1A 3NANA 3H8SA 1LF0A 1VLZA 4HVAA 4CKCB 1QMGA 3ND6A 1Z8FA 4WHMA 1FW8A 1TTQB 4MUHA 4MB6A 4GO1A 1FSZA 4MJXA 3C74A 3TLGB 1OXMA 2EIMC 4CTNA 2H48A 3CVWA 4NYKA 5KCMA 1JR3D 3TW4A 3INYA 4FEGA 2I3AA 2V1XA 2M1XA 1H4SA 1EZ1A 2PUEA 4O3FA 3BICA 5CDSA 4WCFB 3HWSA 4ARUA 4BIIA 2YVAA 4B82A 1G63A 5JFOA 4J0EA 1YZNA 4ZI5A 2XQIA 3W77A 4TXLA 1G8FA 1YOVB 1PEAA 3EFOA 3HO6A 1ZK1A 1QR6A 4A15A 5DBEX 4TXNA 1H8HG 1R3LC 3LUJA 5FHRA 4JLNA 4BNKA 3U0VA 4L87A 3CUVA 2D54A 2ZTVA 4BQQA 2BUCA 4MVMA 3EXIB 2OBBA 1FD9A 4ZEWA 3USES 5K1XA 1FLNA 4C1NA 4IIXA 2PMPA 1IN6A 4R1PA 2BMJA 2HIAA 3QU4A 5AHOA 5AHXA 1M34E 5B1BB 4WNIA 3HA5A 1XD2A 5F9FA 3WGZA 1XMOB 4FIZA 1OIWA 2WYIA 4MYCA 1FE8A 4G1MB 1MOPA 3N0WA 1K63A 4L2IB 2PX5A 1VQ8V 4C8IA 3KYCA 4PSKA 5LHGA 3SYOA 3QVNA 1YGYA 2ZE7A 1AGXA 4MAAA 4UHJA 1TLFA 2AZXA 4EG7A 2QXYA 4CCSA 2RJ3A 3ZJ4A 2BEWB 3AUKA 2IHYA 4N9QA 3JQ8A 3ZLTA 1Q3HA 4CKBB 3UMMA 1BRTA 5CJPA 1SO8A 5DFAA 2FTKA 2H4WA 5LGNA 2ZQZA 1IHUA 2YJ4A 3WNDA 2D1QA 1QGUB 2LBWA 4XGRA 3EC1A 4BNTA 1U81A 3Q3HA 3LSUA 3CH4B 1J20A 4DW0A 4EHLA 1SXJD 2IG8A 2ORED 2IKQA 4NZ9A 4Q1VA 1HDIA 3HXLA 4IRUB 4D0LB 4ROSA 1RYYA 3DQZA 2IDJA 2X9GA 1ENOA 5J43A 1E1CA 4EB3A 4CH3A 2FEXA 1K98A 1V16B 4H7EA 5CNIA 3GWKC 3NHLA 1SZQA 1ODCA 1TCAA 1BFUA 3BK7A 1TVCA 3QENA 3FMFA 3UMYA 4X6XA 3B38A 2YASA 3B9PA 4F4CA 1OHHG 1VXOA 5HZKA 5KNBD 5FADA 3A8TA 3A7EA 2CW4A 1HFWA 3QI7A 4JBHA 4TV9A 3CNHA 4KCGA 4AP9A 2P9JA 3T7CA 5A2QN 5HS6A 4X61A 5CH5A 2WYHA 2PXHA 1XKQA 3C6MA 3P20A 1EGHA 3OR7C 4CFZA 4KGXA 3TE7A 4MSUA 3HCPA 3KCYA 2JIZG 4HC4A 1QZXA 3OMAB 2HH9A 1YEWA 2QU8A 3NB0A 3AVYA 4BKOA 1XREA 1NLZA 5HJ5A 4BFWA 3ZDZB 4ZKIA 1OBVA 4PO8A 4BYGA 1RHMA 2Z4SA 1KDOA 3AI2A 3INTA 5F35A 2VHYA 4WZAA 1T0PA 1RAFA 3HCAA 4B3SO 3HWX1 2WEKA 4IIVA 2XPCA 4F60A 1E1KA 3E82A 1KP2A 1QYXA 2DJVA 4FFKA 2ZRQA 5DNCA 2GXUA 5JC1A 2V3VA 1YR6A 4S1PA 2HWWA 4ZRNA 2IU6A 2JLCA 5LZ8A 3ZZMA 4KWTA 4BLRA 1UIRA 4BO7A 4YMSA 5LD2B 1PR3A 3ZXUB 1BA2A 4W4LA 1LPSA 3HA3A 1EVEA 4X8LA 1IUOA 1DC3A 4HI0E 3KZIZ 2F3RA 3PTAA 1QTRA 1FPMA 2Q9LA 2B1RA 3EXHC 2DERA 3KLBA 3I9V6 5DHUA 5C1BA 4EQ6A 4NTWA 1WKBA 4BFZA 5CA0F 1VLJA 3JALB 1E8MA 2ZRHA 4BNLA 1E61A 2DE0X 4WGFA 3KO8A 2IQQA 4ZGWA 1GADO 4FU0A 4R1OA 3RC7A 3SPGA 1ONOA 3SNHA 3N7UA 2FWAA 4MLDA 2V0CA 1NNUA 1S8FA 4RPLA 4CNBA 2ZK7A 1G2QA 3CJHB 5LZ4A 5K1ZA 4JYMA 4FHCA 1XL1A 3VU3A 1JGTA 4XX1A 1G8PA 3E58A 4NEGA 3ANYB 2QVZX 2N1MA 4ZYWA 3KU4A 3QM1A 1YTUA 4QVIA 2ZB3A 4MVSA 1UM9B 3Q0TA 2YOFA 3Q85A 2BDUA 4JLPA 1LC3A 3KAPA 3OUZA 5LN1A 5BZBA 1CULC 3H1HH 4DR7O 5ALZA 1ZIOA 3GGOA 4L0MA 4MV0A 5KSPA 2X5JO 3D8HA 4P3YA 3S2FA 4H6XA 1T4CB 2W2VA 2YWGA 3UXEA 4M6WA 4OAQA 1ZXXA 4RM2A 3G9ZA 1ROPA 5KOHB 1XDWA 4LNAA 4XEUA 1FRNA 2AKYA 4RYDA 3MD0A 2YXBA 3RSCA 1SR8A 3HJCA 4K9NA 4OXRA 3LT2A 1DC4A 5JNVA 2FRDC 1KDRA 5IAEA 2OEPA 4Y7CA 3F4KA 4BTVA 4WY8A 4O0MA 1U97A 5KTYA 3GQVA 3VTZA 2C7BA 3ROFA 4HOYA 3T0FA 4EIWA 2OSBA 2Q1XA 1U4SA 4G86A 3I61A 1YQGA 3LA6A 5COAA 2PS9A 3GY0A 2CFIA 3L7JA 2VZ8A 2QUJA 4KP7A 2QK4A 3VX4A 2P8JA 3S28A 4A36A 5CW2A 3NONA 1SG0A 1V5FA 3DD1A 3GGGA 3K9QO 4DV4B 1TIPA 3KYJB 4DSZA 5ALHA 1NBHA 4RQBA 1NN1A 4LJRA 3W1VA 1P1BA 1U7PA 4BO5A 4C8GA 3O85A 3MQ2A 1KI6A 2AJTA 3CX8A 5CP8A 4HO1X 2J08A 1P2DA 1AT1A 1YI1A 3MMPA 2EX1A 3WKEA 2L18A 2JGEA 4PINA 1W8IA 3HXPA 5ESDA 3UJPA 1RIFA 3THXA 1OXKB 4YMUA 2JVJA 4QBHA 3AHHA 3GA5A 5FOVA 4PN7A 4BVJA 3X2EA 1SCUB 3EEFA 4BCCA 3MBOA 1V45E 1XN4A 1K4YA 4DM7A 3K96A 5IM4A 2OYRA 5BV1A 4CPDA 5FUBA 2G9RA 4HTAA 1HTWA 3SLRA 4ZEMA 3BGIA 4TMTA 2YC0A 2DULA 4ZDWA 3L6UA 3M2PA 4FFSA 1U1CA 2G1PA 3NBYC 1SQQH 2X2EA 3QY9A 3MLAA 1FXWA 4WNAB 1WF6A 3COJA 5J2UA 2NLOA 3G17A 1M66A 3COSA 2IP1A 1X38A 1OASA 1PYGA 1I01A 3ZI7A 5CEJA 5IZCC 1DTSA 1KH3A 2CUKA 1TZBA 4FM1A 3ELUA 1A8UA 1J07A 3Q12A 4TTSA 2Z1TA 4EI9A 3TR6A 2Q4BA 1QB7A 3T0IA 3K3WA 1OHHD 3C5HA 5BNWA 5FOWA 1AN9A 3B36A 1G18A 4RZUA 1VCNA 1W59A 2QJTA 5HSGA 4FINA 3SYMA 4WZZA 3ZBUA 4R01A 3MF4A 1RI4A 1GSOA 2V3CC 4Y6OA 4WFHA 1D4OA 4UEWA 4I7ZB 1M8FA 3E61A 5HEKA 1EGVB 2H7CA 3UYKA 1N6PA 3NFYA 1SOMA 2O2CA 5EQJB 2BGRA 3HDGA 2JIZD 5JTUA 1LDMA 3QOWA 4K2HA 4G5SA 5AYVA 721PA 2GEKA 3LHDA 3ND9A 3C98A 2WAAA 1T9CA 2YEVB 1PX2A 4HWGA 2VQEB 3ID6C 5D5PA 4NPAA 4XJTA 2PWAA 5CNKA 1R6AA 2E18A 5ERGB 4N18A 3P3PA 1APBA 5FB3A 1ADFA 2PU5A 3AUSA 3KDAA 1XV2A 1U2DC 3A1NA 3C1TA 4DJJA 3M2TA 3MJVA 1B3RA 5C8ZA 2ZAMA 1WB6A 3AG6A 3WIBA 1F0PA 5LL6P 3T7DA 4B3IA 3H4VA 1RS0A 2CHQA 3QVVA 4DRYA 5FR2A 2ECOA 3M4NA 2XAGA 4I81A 4WSOA 4P92A 1ZL8B 2ZYRA 5EIFA 1JN1A 3K59A 1L5LA 5KB3A 3ORHA 1R0WA 4XD7D 1NRJB 3NHKA 2IAFA 3LL7A 3OP4A 4Z1MG 4D9JA 1QIDA 1BVYF 4IZOA 3MCQA 1K92A 2GPAA 4YIHA 2G36A 5B2ZA 2JF0A 4F9GA 3A1UA 5ISMA 1OAKA 1OXTA 1PNVA 3CY6A 2OHVA 2ADFA 4CLDA 3TAXA 4YJ3B 1X94A 4D7SA 4TSFG 3AH8A 4XVQA 2X4LA 1XMSA 4K3AA 3CLRD 1ZJWA 2X0KA 3VKGA 3OJXA 4J3FA 4YRCA 1RD4A 4AY4A 1Z5GA 1DMSA 1CP9A 5TF4A 3B85A 4YBZA 3EG9B 1QDEA 4DV1B 1NQOA 4WFGA 1ZM3A 3LLSA 2QW8A 4LHEA 4S2UA 1J42A 3DXXA 4KRYA 1Y67A 4DR4O 1UP6A 1RC8A 3LCCA 3QY0A 3F9IA 1HRKA 4OX9Y 3MQFA 3BHMA 4DC9A 4JI8B 3U44B 1XMQO 5TC4A 4QGHA 3UXHA 4PXYA 2HJVA 4MR9A 3DOCA 3I39X 1BSVA 4QUJA 2WM8A 1RADA 3VYWA 1SG6A 4IINA 2C57A 4J1TC 3PE3A 4MVJE 2DUWA 3FDIA 5HUQA 3H6GA 1XILA 1PFUA 2ZT9B 1WTAA 3RODA 2Z0AA 1IMOA 2HQSA 3ZD7A 2J9FA 3WX0A 4E5UA 4N8EA 4ZMBA 3NHBA 4ZOAA 3LX8A 3DO5A 2HPHA 1M2KA 2A3RA 1MB2A 3T34A 4HDSB 4A4DA 1QVWA 1ESZA 3TSOA 4QNRA 1GGEA 5BV8A 2EC5A 3OD4A 4HAXA 3U3RA 1TVMA 4EDHA 5LLSA 3X2SA 4DLVA 4R54A 4WPGA 5F4BA 3K08A 2VSFA 1ORHA 2C00A 4NCBA 1VMEA 3ICPA 4OH7A 3NX4A 1PTKA 3BD6A 1PV2A 3T3IA 2CXUA 3A2LA 2ZAIA 2BISA 2B7BA 2X5OA 4YJ2F 4MV4A 2EJRA 3ABSB 3D8TA 3ND5A 1NI3A 1M6VA 3KJGA 3DW1X 4G23A 4XB6B 1EBOA 2EFDB 4JD5A 2VHCA 3H11A 1MIHA 3QPCA 2GI4A 3CPJB 1R4MA 4RFVA 1L4LA 3U3OA 3U4GA 3M0EA 4DV7O 1TAHA 3B3JA 3WNCA 2ZAOA 1XQWA 4C0QC 2VDMB 1K66A 3N2KA 5K9ZA 4HB3A 3ROTA 2DWQA 2ZRIA 3OE7D 1CXZA 5LB4A 4EFBA 1X7OA 1Z2EA 3WNZA 4MQEB 1P72A 4UAGA 4QBTA 3F49S 2VP2A 3IKEA 4YREA 4NG4A 1AI6A 3WGMA 4KUGA 1FUYB 3DTYA 1G17A 3OM1A 1BMQA 1EPUA 4NI5A 1FYXA 3BQMB 4AZ0A 1DTWB 1EK1A 4CR8A 1WBBA 1ODKA 1MEEA 1Z8DA 4URYR 3QQ5A 4WOCA 4U2DA 1WVGA 4GX0A 3T12A 2XE7A 1LCIA 1MAAA 4B5CA 2PPVA 1GXSA 3A1WA 3L77A 4IJUA 2NV6A 1DCTA 5KQLA 4Z54A 2BGMA 4NXMO 3IQEA 4YAGA 5TPZD 2XBLA 1GO0A 4ENUA 4JITA 4BUZA 4DYHA 2DRIA 2Q7EA 5KUKA 1ZS9A 1R66A 2R6CA 3WPWA 1I94B 3PXCX 1N6LA 5KYKA 2IV3A 4EUEA 3PL5A 1QUEA 1S2GA 7ADHA 4JB3A 1DQZA 4PBRA 1T6BY 3DW3X 5IC6A 3OT7A 3ADOA 1VFNA 2EHJA 5HXZA 2AOUB 3ADCA 3AG5A 4CTOA 4ZBMA 2R6GA 4EMBA 1F9EA 2BZ0A 4P80A 3ETCA 5CMUA 4D41A 3MPOA 2IZOA 2M6KA 4LDQA 1NV8A 1GQSA 4EY4A 2F7SA 4QZVA 1FDWA 1MOQA 1N0VC 2BMAA 1E6CA 1LGYA 1HOTA 3ZU3A 1XX6A 5HHTA 5JSYA 2JAXA 2NUPA 3H1BA 4ZWNA 1DDOA 1XLTC 1NBWB 4R9VA 3MWEB 2ZXEA 2JS5A 1IHDA 5C53B 1B8VA 2Z8YA 1WEKA 4BMVA 4GR4A 4R1QA 2AI1A 2R00A 2FPIA 2CN1A 1R9NA 1FYEA 4UV9A 3TTTA 4H35A 5IP5A 3LSTA 2I7XA 2QDXA 5FNVA 3IDQA 3LD9A 3VH4A 4H31A 3F74A 3F5WC 1PFVA 2KQUA 3KAQA 4BQSA 4RCZA 1E69A 1L3IA 1WPQA 1T6ZA 3QYJA 2HJFC 3ICCA 2R7LA 1I8TA 1QS0B 2P75A 2J3MA 3PDCA 4QEDA 1UBOS 2HEGA 1Z4OA 2HPVA 1NT2A 2WIDA 1RFGE 2OV1A 2GF0A 4H7DA 2HRCA 1TZCA 4I55B 3ZNPA 3A32A 1B2LA 4BNUA 2AGAA 2IF0A 4RH0A 4FDTA 1P9RA 4CE6A 3FTCA 4MV7A 1I2CA 1SQFA 4R8VA 4Z1MD 1JQJC 3UAVA 2OB1A 5B3KA 3VC2A 4D4LA 2Q4TA 3R5KA 2EIKB 3O73A 1OAPA 5ALKA 5KJ1A 3LDGA 1O97D 1FTGA 2A4MA 1BDHA 2PT5A 4CI9A 2ZIFA 2X6AA 3FMPB 1NRIA 2E1PA 2J3KA 2C4HA 2N1BA 5TRTA 4BT3A 1Q81H 3V33A 1OCCB 3OFSA 3ENZA 1XZQA 3ZU6A 3DFKA 1OPXA 1DO8A 2Q3FA 4HWKA 1SF9A 1XL0A 4B46A 1KJ8A 4FK5C 4RQAA 1RA4A 1JFVA 3CN9A 1Z73A 1I0ZA 4LYFA 1VQ9F 2YI8A 2CD7A 1TUIA 3D2AA 3KL2A 1ZH0A 3F46A 2YZ7A 1DQPA 4J0CA 3AF3A 1XRGA 1QK4A 5THXA 3DCIA 1IQ0A 3DSQA 4KH0A 4FFBA 1O6ZA 3C6BA 1UC4B 3TBFA 1KZ4A 1IJEA 4I5IA 4XVHA 1UADA 1Z5ZA 3I72A 1UBGA 2CVFA 4FYJA 1YIJV 3I32A 4A91A 2FN7A 4BBAA 5DHPA 5JS1A 5IUNC 2LPMA 4B32A 1OLXB 4K6OA 3VQWA 3SEQA 3ZWAA 1VLLA 4MVUA 1U7XA 3TEJA 2JKVA 1Z0KA 4I9FA 1RRKA 3A2FA 4BXOA 1U5AA 3TMKA 1SB8A 2QLLA 1ETHA 1HMPA 4E33A 4LRQA 3CX5F 4PWZA 3SOPA 1EU1A 3TZBA 4I5GA 4M22A 3RE1A 1PJZA 3ST7A 2ZCUA 3GFPA 3GW8A 5DOVA 1XZLA 1T2DA 1JFFA 2IUUA 1F6BA 1XMIA 2A9JA 4UKDA 1K9SA 5D84A 5E2BA 4GF5A 3QUTA 1HLDA 1F3LA 3OIFA 5EJEA 3EVCA 1E77A 2OBMA 5EUCA 2OHOA 2GBPA 4IEFB 4EM6A 3WIDA 4C20A 5H8WA 1FNDA 3H5LA 3WLHA 3I8XA 2FOLA 1MSDA 3DF7A 1SD2A 1YIOA 2IH2A 1X74A 2W58A 2RBEA 4LYDA 2WWWA 2BMEA 1KVSA 2CXNA 4QU0A 4WLVA 1LU9A 4N0EA 5EP1A 2HVKC 1HE8B 3L7LA 2WA3A 4RL4A 2C2BA 2PBRA 5CJ2A 2C2YA 4E7PA 4BLVA 3HFSA 3KT3A 1P2GA 2VNHA 2IHBA 4LSMA 2PMBA 4JSRA 1TJPB 3EOBI 2I4RA 4WFAV 1RP1A 1QBGA 2CMFA 3GGSA 1K5QA 1LLUA 1HOXA 3UJ8A 1JEJA 5BPHA 1OCZB 3T80A 3EODA 3T5AA 2JLVA 2EW2A 3ZCVA 3AK4A 3PQFA 3KQMA 3KFVA 4HSGA 2O5RA 1TRHA 3N4ZA 2XVZA 3NHMA 1I2AA 3SQLA 2J7KA 4E7OA 4MW2A 2YX1A 4H0NA 5KMGA 3KJFA 3KIPA 1A4XA 3CZ5A 4L15A 2BEUA 1ZM4A 1LWNA 1V95A 4MJLA 3W9UA 4DB4A 3GJRA 5IXYA 2CNLA 4UNPA 3IQHX 3G80A 1P4AA 1I94O 5K1PA 1A2BA 4ZYLA 1Y37A 5CPFA 1GZ4A 4MVRA 4MVJI 5EJGA 4TVSA 2VP6A 2NVWA 1LX7A 2N9UA 3GRVA 4K40A 4DSAA 2R65A 3VTKA 1O7JA 1YRBA 2PMKA 2RJZA 2CJXA 1I6LA 4QHTA 1JBKA 1NVGA 2P40A 2RAUA 3S3TA 2H1RA 1LC0A 3X3HA 3NU1A 1BZKA 2P9EA 5AXCA 1R2QA 4RC9A 4DM4A 1V1MA 1ISJA 4PPYA 5JCJA 3IUMA 1WY7A 2OZPA 5EINA 3FPLA 1G3QA 2IDMA 2GN9A 4TV9F 1UI9A 4OHFA 4QYSA 2PBLA 3EHEA 1P0CA 4MR7B 5J23A 3FHJA 2DFVA 2OKGA 3SPCA 2O8CA 1C50A 4J0FA 3KJZA 4JUCA 1QVVA 3OHPA 3H8JA 4CCWA 5K8TA 2XD4A 2FDXA 2JBAA 3EUAA 4RZSA 4BVSA 1V47A 3NKFA 5ARCA 3SDSA 4ZZ1A 1LJ8A 3PYXA 1G6HA 2PUCA 4CODB 2OD7A 4TUYA 5HW0A 4KHPB 1BQ4A 1OX6A 1DELA 3NNNA 1WE2A 2HQBA 3UH1A 3OEYA 1Q11A 1N0NA 1U0RA 4JSTA 3KQTA 2Z1FA 4Q3DA 1Q7YH 2GCPA 3GRUA 4D8WA 3DWIA 3PC2A 1N5KA 1N2ZA 1O3YA 1J7KA 4KE6A 2E5LO 4JI5B 3DVSX 3FA2A 2ZIGA 3BCSA 2GSDA 5CXSA 1P5RA 3ILHA 1LDEA 5EPEA 2OOKA 3A1SA 2BTUA 2JEZA 3QOXA 1YOBA 1MOFA 2BZ1A 3BMCA 4P9PA 3E8GA 4B5LA 4MUNA 3FDXA 4GBED 5K7SA 2PD4A 5IABA 4QPPA 2GZAA 1L5RA 5BV0A 5KZMB 4ENTA 1PZXA 5LB2A 4RQOA 1U0OC 3FYTA 4M9XA 1OT3A 3EPRA 3HY4A 1FPQA 4JKIA 3LQ4A 1WA8A 5ALMA 2DW4A 3PQCA 3V5NA 3K7EA 6ADHA 3OF2A 5EE0A 4QG3A 3RJ5A 4CI0B 2CCKA 5EPUA 3AKCA 3BDIA 3ABIA 1ZICA 1KEEA 1OCCC 4M8IA 1U98A 3SJ7A 2BSKA 1WNFA 4X5OA 4K7JA 3MIIA 4JDUA 1ADCA 2VP0A 1U3CA 2QF7A 4KI7A 3LAWA 4RGYA 1GPYA 1G21B 5A03A 1K3EA 2VJOA 3GT0A 2IYRA 4FWIB 2V1DA 1XTBA 2HQRA 4X7MA 3TMAA 2NXEA 3BXGA 4UNRA 5GONA 2CLIB 1CY2A 1U3GA 4IIGA 1NQAO 4NQ3A 4MXDA 1DX6A 3B7WA 2LTAA 3C5VA 1VBKA 2ZYWX 1IVNA 1GPMA 3WK5A 2DMXA 3V9AA 2PGIA 1DQSA 4C5CA 3ASUA 4ER5A 3G2NA 2VPWA 1JB1A 1U31A 4JOSA 4Y2GA 1CWUA 2QTWB 3E86A 4MULA 3S1SA 2WLMA 2PGJA 4NBUA 2CVPA 5JAZA 2BR3A 5AM4A 1RJ9A 4GXRA 1CY8A 1N7HA 4C7BA 1HG0A 1Y1TA 1EQ2A 1ABBA 4ZV9A 3RYHB 4GQBA 4L74A 2A4KA 3LPMA 5BRNA 1M1XB 1YZVA 2WTBA 1VGVA 3MINA 1D04A 1U6JA 1NVBA 1TJNA 3HR7A 1UBEA 1M34B 5FPQA 3KALA 1YCFA 1XELA 1FSFA 3WBJA 3MN1A 5AI8A 4KGZA 4P3XA 2Y6VA 4DB2A 2DTDA 5K4GA 1JR9A 4EZEA 4RLSA 3PCXA 4R83A 4CXMA 3KV1A 1Q15A 5EGNA 2ORWA 2A0KA 3THWA 4TMZA 4QNMA 3FE2A 5T64A 3GCXA 1UEXC 2D7CA 2WLLA 1UP7A 3VBCA 5KIAA 3VHXA 3JQEA 1Y1LA 3HBAA 1J0AA 1QP8A 1T5BA 2P35A 3OD5A 3T3DA 4IUCS 3HPRA 2PD6A 3QXSA 4B6SA 1U9JA 2AFHA 2Y77A 1RLJA 2W00A 1WD5A 4GYWA 3HR8A 1D5WA 1TEZA 2YXNA 3G2KA 2LFRA 3LT1A 3EEQA 4R81A 1ESDA 4GSKA 5FBZA 5K0LA 3AP2A 1DJPA 2CBGA 4HEQA 4PO1A 3U61B 4GI2A 5L3FA 6REQB 2C42A 3CCSV 3B5IA 4YRSA 1EFTA 4WX2B 5FOUA 4JI4B 1Z2AA 3TL6A 3GLFA 3JD1A 1JJ7A 2HDWA 4EY7A 1FXWF 1G2IA 4JQYA 4ZQEA 3FFMA 1C1XB 5L7YA 5J2UF 1GNSA 5AI6A 5GW7A 4B73A 1XGKA 4HVLA 1MCZA 4ILKA 4B6OA 1PZNA 4YNBA 2C54A 1JFSA 1BCRA 2XRFA 2EIMB 3A25A 3L74H 2IM9A 3BMNA 1XOIA 4CVNA 1QLJA 4R8MA 2PUHA 3TYXA 3VU9B 2ZJBA 4CQNA 4R8RA 1P0QA 1K68A 3H04A 1AQ6A 1D4FA 3CRZA 3K79A 4LRSB 3DBRA 2J41A 1JLKA 4NBVA 4Q3NA 3TKYA 2DG2A 3R6WA 1J22A 2KS6A 4NBKA 4R1TA 1PQPA 2NR5A 2V0GA 1L7MA 2DT4A 4X88A 1E4EA 2DPXA 3L7IA 4M1EA 3DEZA 5I9NA 4EKWA 1NUHA 4LBVA 2JAOA 3M70A 1RP7A 4L75A 5JSZB 2BGGA 4IIJB 4N0DA 4E4EA 4C43A 4OHUA 3J81M 4RE6A 1K8XB 1Y4MA 1B8PA 1IZ3A 4D56A 2R3SA 3QE2A 4YP9A 3L0OA 3BIFA 4LZOA 3Q9NA 3E3AA 9LDTA 4ZC8A 2ZSBA 3JRXA 5FRDA 2JZCA 4CQLA 5CDYA 2YBEA 5E6RA 1FP4B 4DTCA 5HIMA 1YMQA 4IGEA 4E12A 4WKOA 3CKYA 5AJYA 3DVRX 1G4UR 5BURA 3FVWA 3A0UA 1AZLA 1DBVO 1GLVA 4GVXA 3LQKA 3I2FA 2P6UA 3ENVA 1Q1EA 4HATA 2QVYX 3KFLA 2AFIB 2GBOA 3HUTA 4F93B 3BSFA 4O4HA 2VK2A 3RC2A 3V3KA 3EZNA 3GRPA 3TGUH 4LY0A 2AZMA 4RGQA 4OJTA 3CUSA 4ND7A 5TMEA 5ITZB 3Q0EA 2XR1A 2PZJA 2O8EB 1YE5A 3CONA 3BCCH 1XZAA 2C2WA 3JQAB 1XZJA 1E0JA 5IKEA 4F2WA 2RHLA 2BCEA 1VDZA 1IXYA 4KPGA 1D2NA 4BV3A 4OYLA 5ALWA 3WISA 3GBPA 1FKAO 2XOEA 1S01A 4KBFA 1YIAA 1T2CA 1FP7A 2BI4A 3FCAA 1ZL0A 4EUSA 1N5LA 3R7SA 2Q49A 4I8DA 1T29A 5FBVB 3BJEA 3IIJA 1CRQA 4QGFA 5KTPA 3VX3A 3WC4A 3AR6A 1GEEA 5DCLA 5H5JA 5IUKC 5I7WA 3S70A 1KSGA 4B75A 3TZKA 1DV2A 4IUDS 2PUJA 2B35A 2P2YA 3R3VA 1Z2CA 4KV9A 3C43A 4I2VA 3DC6A 2Q6LA 3KQUA 5H02A 1XHOA 4H7FA 1NI5A 4HJXA 1FFHA 4IJVA 1EVJA 4OI0A 3UANA 5CR9A 3IEIA 3CR8A 1SG9A 1L5VA 3O7MA 2I33A 4GUAA 5G0WA 1SZPA 2ZD9A 3NQ41 1Q7GA 1QH8B 3Q4HB 2J0EA 3RRNA 1N6RA 4DXWA 4LDZA 1RJEA 4OKIA 2XCSB 2EGHA 1A5TA 2YJ3A 4KODA 5BNTA 3HBNA 2V6MA 2O6HA 4BKMA 3HMQA 5FLXN 3O4JA 2E75B 2O0JA 4LTDA 1A9RA 2WTXA 2L26A 4IJMA 2I3GA 1CVRA 2QT1A 3CCLV 1A69A 4HRAA 1M2NA 5AKIA 4UBOA 3EXHB 5MN6A 2QMZA 3OWHA 2CJWA 5EKUA 5L3QA 3LPLA 1LS6A 5LYJB 1GG8A 3EBLA 1Q83A 2QBYA 1NVMB 1RHUA 1GGHA 1UC9A 1VMGA 1Q50A 2Q41A 4MVJM 2YXPX 3ANMA 2JLRA 2FWMX 2GZHA 3T61A 1MW8X 2F6RA 3KEMA 4DADA 2A59A 4YAEA 1VL0A 2L82A 2GSMB 1NI4B 4H7KA 5K45A 2D5IA 1U3TA 4GPD1 3HMKA 2Z58A 1DL5A 2BP7B 4OLAA 4DL9A 3Q8WA 4GI5A 1HWYA 4KL1A 4D9FA 2A6PA 1W2BU 1EYZA 5IH3A 5JDIA 5FOTA 2FK7A 4PGHA 3KV3O 1GARA 1XRQA 2CLEB 1JU4A 1SVMA 4AC9A 5DRTA 1TKAA 5ELMA 4NKGB 1RYZA 4PONA 4LBZA 3T6KA 4LBWA 3D6AA 2XQFA 1G4HA 4Q93A 5IFLA 1K86A 1XIVA 4BMYA 1KL7A 1JFRA 4FUTA 1Z9BA 1T5IA 4QRDA 2DC1A 1YMUA 5AOCA 1ZTEA 3S7TA 3IERA 4OHOA 4XFKA 1WOYA 1WZ2A 4GZLA 4ZO8A 3X2QC 5DK6A 3DLIA 1H2AS 5E9JA 1DAHA 2IBZH 3PWKA 4MW6A 1CY4A 2G80A 4NHEA 1DTEA 3CNOA 4TWAA 3GXOA 3HZRA 3L7AA 2V8BA 3NJ4A 5JD4A 3W8FA 4BECA 3HEMA 1VM6A 1AA9A 4FQ8A 3BT7A 4MS4A 3CO0S 1Z5OA 4J43A 5JPDA 3JQQA 3K1JA 5TPWB 3EA0A 3JSNA 4J3NA 2W0SA 3RI3A 3I2IA 4AP5A 4L5AA 2FX2A 1PTJA 3W1WA 1NTKH 5LMNB 1KYTA 1EWTA 2F1HA 1RWKA 3T9BA 3P4EA 4MIEA 2DPLA 1PM9A 5CLGA 3DEKA 4Z6KA 4JXKA 4G4IA 2N42A 1SVWA 2H9AA 2ZI4A 2XMRA 2YXHA 2WF8A 3JVDA 3OOHA 4M9ZA 3ZWQA 7MHTA 5C32A 3BXEA 3ZHXA 3O31A 3E2EA 3L46A 4FEYA 2F43A 3FX2A 3FNRA 4FILA 4LCEA 5B3SC 4PZAA 5JZMA 4IL6Z 3J80A 1S76D 2JLYA 3I5AA 3C5CA 1EAYA 4RTKA 1IG0A 3DAGA 4U8GA 2UUPA 3MFYA 3LF1A 2H9IA 4Y0VA 2F67A 4B62A 4IMPA 1UPCA 3CMEF 4WXRA 5MN4A 4LMBA 3A3KA 4RD2A 1FQOA 3TZCA 4OQ4A 3QKSA 4BVBA 4UVGA 1JAIA 1PZMA 2B7LA 3KWLA 3FB6C 3RYCA 1EP3B 2E4AA 1OFHA 4MQ6A 2C0QA 3EYWA 3VSBA 5A06A 3QEOA 3NMUC 3N1UA 4ZVLA 3G7SA 3T5BA 1BMFA 4HXGA 5BWCA 2Q1SA 2ZVZA 4F3RA 3IR5A 3K8ZA 4A5SA 1FL9A 2EF1A 3FPHA 2ISSD 4Q4HA 4AKEA 4U0KA 2LP7A 3SG0A 5AI4A 1IN7A 4KBYA 4PGFA 3UFBA 3U16A 2X0EA 2RN9A 2AIFA 5DHTA 1F7YA 4LAFA 3IUYA 3HYRA 2Z6QA 1H22A 2FUG6 4OD0A 2AEEA 4BIMA 4TS3A 2DWUA 3PP8A 3RQIA 2MYPA 3L41A 4DYLA 4P31A 2B3DA 5CDFA 1KR5A 2V5AA 3P2YA 4N5LA 4H3SA 3JZIA 4AJNA 1GY8A 2X58A 5DHRA 4F56A 1XSEA 1GKFA 2XXAA 4EK9A 2GKGA 1HR0B 2J30A 3V6MA 3MWJA 1TA9A 1JAXA 1IZZA 2J6BA 5BSTA 5A4FS 3EMKA 3MJ4A 4AO6A 3NO4A 4NU0A 4BX0A 3DP7A 5F64A 3LLMA 4V0LA 3CLVA 2GD1O 1U0HC 1XJWA 2BTQB 3K09C 4IR7A 3ROEA 1UOPA 2JC3A 2WHPA 3RVZA 2XKAA 4Z7JA 2ONYA 2OOSA 4K3VA 4GKVA 1C3OA 3DXZA 5JYDA 2K4MA 4A6PA 3ZHVA 2VDWA 5FOQA 1L7NA 3L1KA 3N2GB 1OZGA 5FPPA 5FEUA 1C7QA 2IL1A 4RVOA 3R9KA 2H07A 3KSDO 3QUSA 4QXQA 1VIMA 2GPYA 3VO2A 1KA9H 5EPOA 4JC5A 4JXJA 5FF9A 3LQ2A 4KPUA 5EA2A 1LI5A 5JNRA 4XSGA 4WVFA 3B6JA 3R3ZA 4QXMA 2VJMA 3O8OB 5EMNA 4YXFA 3VCZA 3AJ9A 1NUTA 4P38A 5E4JA 4EZIA 5TQ0B 2DYRB 5IARA 2O2XA 5DTRA 4KAFA 3CC2F 2H1OA 3NHSA 1F4LA 3DLPX 1E9BA 1PHRA 3KPJA 4O63O 2DX7A 5FWYA 4YRQA 3KFXA 2EWWA 3VO1A 5ETJA 4LJKA 3RRYA 2FPPA 4B2PA 4CM9A 5E8RA 4J2HA 4LF5B 1M90W 3DBLB 1EHCA 13PKA 4K9DA 5EXTA 5GJBA 1TC1A 5TEVA 4LJ8A 3L7KA 2XWJI 2YWEA 5ULLA 2BEJA 2FZCA 3M33A 2B1GA 2AN9A 1QYWA 1O9GA 5I7VA 3UUFA 1AF7A 4FZJA 2G0TA 1YITV 3QZUA 1HL7A 2G76A 3UK0A 4BLOA 2ET6A 1TPZA 4M1WA 3UAWA 2IHJA 3GPIA 4Q15A 1JYFA 1Q1AA 1VIDA 4H7PA 5I7HA 4IV5A 2A5LA 2HA0A 3QNMA 2ZR7A 4IIUA 2IY9A 2H18A 4BVRA 3WRXC 2C1XA 2NW6A 1Y6JA 2HB6A 2YJGA 5EIEA 5EKXA 4RVHA 4R1LA 1R9JA 1NJ2A 1NKSA 3SQOA 2XA9A 2J4DA 1VJDA 1TU4A 1BHO1 2WSIA 3C48A 3OOEA 5LQNA 4JHLA 4BL5A 3RVPA 4AM8A 4F5EA 3ZS8C 3L0DA 5JCJD 3B48A 2WKRA 3PXEA 2X0DA 1M75A 2P1DA 3FCSB 1P1RA 2Q3LA 5EP3A 4AS3A 4FR5A 1CUSA 1OLOA 3O8DA 3BD7A 2I4TA 3ETGA 1M10A 5FAXA 3OIVA 5EFZA 4G89A 1C9DB 4WBXC 4WQMA 3FB4A 4U2EA 1W4AA 1KJIA 3HJAA 1SA0A 3E18A 3TR5A 3SDZA 2GHRA 5IDYA 4ENWA 1NTOA 2A78A 2HS3A 2YINC 2CL5A 3FB7C 3UJCA 5DM0A 1WB7A 3CCFA 4M8NE 4TUYF 3WWZA 1GU0A 1YUBA 3DVQX 2WU0A 3WNVA 3JARA 3T52A 2RB5A 4XSHA 3JATA 3IBFA 2H54A 1BS2A 4MRAA 4EGQA 1ZXBA 1XMOO 5A9SB 2H29A 4C06A 5DNYB 1OX4A 4BEBA 1LQUA 3IVXA 4WN9B 1D2HA 4ER0A 2UXDB 3MILA 1NLYA 1PSZA 3GQBA 3WDLA 3IE1A 3D8NA 3J81k 5EJMA 4WK0B 1JHDA 2ZB8A 1HDRA 3VBBA 3PF8A 4BFYA 1VA4A 3JSAA 2ZWOA 3OE7G 1RI5A 4R5MA 5L3GA 3ADBA 3GK3A 3L0PA 1NW4A 5JDCA 1VMKA 3DZBA 4RF2A 4TKZA 1U9IA 1U65A 2YOHA 4PZ0A 1EM8A 3GZ4A 3H7AA 4GM1A 2PUAA 3TM4A 4LZAA 4B3CA 4TQAA 3K0HA 3STXA 4H3KB 2Q9CA 2BELA 2A1UB 1AUPA 4F0JA 3GFSA 2G4VA 3C5EA 3CRW1 2G88A 4RTMA 3CC4V 1YRWA 2G4LA 4BAZA 3O4HA 1NVDA 3LNNA 1YZHA 3N8DA 4BJHB 3D4PA 2X6TA 2FSUA 1HRDA 3AZQA 5H2FZ 4QXOA 1QQTA 1Q6IA 4BGVA 3CEPB 1DF5A 4YRLA 5K5EA 3ZU5A 4MDYA 4O4LB 4C2UA 4TZ0A 3QVOA 2ACEA 2JGFA 4OGQB 3EGOA 4Z4HA 3L5OA 3LBIA 3N8HA 3FB8C 2ENUA 4OPHA 1W19A 1ZITA 1SBZA 2DWEC 3M6XA 1DV1A 1LXCA 1V6AA 1W85A 1PVVA 1Y80A 2C99A 5L95A 3TTWA 3EVDA 2NOAA 3LF2A 1RPOA 3AHEA 4ZU3A 5DU2A 3TF5A 2P79A 2EBFX 1JPNA 2P6JA 4RSGA 3SYAA 3GT3A 1SZXA 4MUJA 4ZAZA 4HMQA 4U63A 5J4YA 5E4FA 1NWCA 4D8TA 2GVZC 4ZT5A 2H85A 4GI7A 6Q21A 3QU7A 2OYCA 4QOJA 2CLSA 1M2EA 1ULSA 3VNSA 1W4BA 4CC5A 1NQWA 3VMFA 3UMJA 1WZNA 2WIFA 3FLMA 3IFXA 2VTBA 4DJTA 2QMEA 3ZDEA 3TQRA 4AU1A 2N48A 4UTXA 1TT5A 1B0PA 1QNLA 4LV8B 4KQ2A 3JYQA 1C30A 1FFEA 1E3WB 5JJKA 1U7UA 2KSDA 5TY0A 5LQJA 3A3YA 3KD3A 2DBYA 1C8VB 3EG5A 3Q41A 3C4JA 4X9QA 4LC0A 5IKOA 1ZDMA 4Y6GB 3WRWA 3DTVA 3FVVA 3L7QA 3D6UA 4Q9DA 3AB3A 1CJCA 1IOZA 4C0SA 2H2HA 2JI4A 1KPGA 4AJEA 3VPSA 1VOTA 5A71A 2UYNA 2YN0A 1G7TA 1Z15A 2BCJQ 5K3OA 2W2TA 2PLFA 2YMPA 5CXXA 2AWOA 1F20A 2J5RA 2I4MA 3DOUA 1OLSB 4D9NA 1B23P 1RXCA 1W1WA 1HV8A 3RGWS 3IDAA 4BMOB 3ZCRA 1FVHA 2DYRC 1BWSA 1XRRA 4BEVA 2NSJA 2E3CA 2IYTA 3DHWC 3LQFA 3C6YA 1DAMA 1IQRA 2JIBA 2DSTA 2C77A 2X0IA 4QJ4A 3H86A 2OQ2A 1NBMA 3TVDA 4WXYB 4JGIA 5IAGA 1MQ8B 3I55F 1OJHA 1TTPB 1SHJA 1UZNA 2O20A 2EW8A 4ZYZA 3QE0A 1WG8A 4KR7A 3OE1A 1TM5E 2WT4A 3B6IA 4UHEA 2OV6A 5JXWA 3TEFA 3TOCA 2MT9A 1YCIA 4XVRA 4QNNA 2J5KA 2O0KA 5ILQA 5HPYB 1E6LA 4DIBA 1FMFA 1SQXH 4WFEA 1EZ4A 4IOJA 5ITWA 5TX7A 3OLQA 1TPYA 2WYUA 4PQYA 4Y6LA 2Y1WA 3ISTA 4N54A 2IYEA 1OIXA 5KAFZ 4ZAXA 1TDJA 2P6PA 3MXOA 4NOMA 4YRKA 2QJ1A 4TWBA 5L9AA 3TKLA 4HAWA 3U26A 3V7QA 4C4SA 5JJ5A 5M5BA 4G07A 4PS1A 3DE5X 3IJ5A 4Q4LA 5KYUB 4BGDA 4Z4CA 4XQ9A 3CM0A 4GOKA 16PKA 3WL5A 1KTVA 1Z37A 3KOOA 3IUSA 2QJFA 2QTVB 1DADA 4OQEA 3DYBA 3VYVA 3RBXA 1NF2A 3QXJA 5U4QA 1MD9A 3CCJV 4JB0A 4WASA 5F73A 2B6HA 4GE0A 3EXEB 5LXTA 2HV9A 4AO7A 2VYFA 2IY7A 4J0GA 3H5NA 3Q40A 3W9YA 1M7HA 2KMLA 4DARA 4ZOCA 4PSAA 4LQCA 4FZ0A 3QPVA 3NATA 4KU4A 2DKOA 2FPOA 2AZ0A 4JWTA 2Y68A 1M54A 2A3QA 3M1LA 3PFGA 4EJSA 1U6IA 1X8JA 5BXYA 1FMTA 4NTZA 2F43G 2PYZA 2JLBA 4G4JA 4YUWA 4C4RA 4DV4O 2EOAA 5EMKA 2NVOA 1V39A 1L5KA 5ALSA 3NVAA 2G9IA 2ZIXB 4DUZB 4YV2A 5K8CA 1QX3A 1P45A 2UXDO 4KQ9A 1NFRA 4FCTA 1FFBA 1PDVA 4U2GA 1XBTA 1ZRMA 1NW5A 2G07A 4L8JA 2DLNA 5DV9A 3PEYA 1GYQA 1T2AA 3O8QB 2FZVA 1FK8A 2KM1A 4B7ZA 3D31A 3OJOA 2WJ6A 3OHMA 4NENB 4B8WA 1O08A 4ITVA 4F4JA 3IVGA 2SICE 3BL5A 4HDKA 5SV2A 1BMFG 4WJLA 3NP7A 1O0BA 5EIOA 5DNAA 1N2CA 5TIIA 4MRRA 2QT9A 4EPTA 4M86A 3I0NA 3M5WA 4O4HF 4FXPA 2I71A 1JPUA 1U4NA 3KB2A 2ZT5A 2IYNA 1O94C 3KJJA 3F2VA 3ET4A 2QW0X 3TH5A 1P19A 3CTMA 1G55A 5KTKA 3SBXA 3RFCA 4NK5A 4F2DA 3E5RA 4TKUB 5TS2A 4Z2AA 2VS0A 1JHRA 2GTHA 5BSRA 4BB5A 1MVOA 3KZOA 1T0AA 1TF2A 3OW2U 2QA4F 2UYYA 5IVDA 4UFPA 1G2OA 1NVPB 4LF9B 2ZRCA 1CY7A 4G4XA 2BJHA 2BGKA 3VC7A 1B1AA 3EW9A 3HZHA 3PQDA 1S72F 3SKVA 4GPEA 1MF7A 4GYCB 3MS2A 3LCMA 4J41A 5ALDA 3U1TA 3FYIB 1PFKA 1VQNV 3BF7A 1RAEA 3X44A 4UBIA 2XT0A 3I12A 1I6KA 1MOZA 1F2TA 2ZUSA 3ZWYA 5DM1A 1PR9A 3AEKB 1TQ2A 3M4YA 1Q21A 2EGGA 1HETA 1IOLA 2ZVJA 4AMUA 2EEZA 4OYYA 4E31A 2FX5A 3LX4A 2CUGA 3HHPA 3UPDA 5J58A 3S29A 1E3IA 2Y0IA 4GXQA 5GTDA 2VQEO 1ONPA 4WBNB 1Q82H 1EDZA 4HWPA 4OREX 1M8GA 2J9YB 3IHTA 4QYXA 5HKKA 2OC9A 3M9LA 4N3BA 4ZIRB 2QM3A 5B1OA 3R6GA 5L3RA 4BAUA 2PAAA 3CNLA 3R75A 2UAGA 3TUIC 1IV4A 4JAAA 2GH1A 3K9CA 2Y4TA 2OY0A 2EFJA 2AOTB 2WIGA 5FYDA 1GA4A 4RZHA 5HWEA 1N0WA 4INZA 2XAHA 1STOA 2DBQA 1D2CA 4RBNA 2D1RA 2CCJA 5DWDA 3GJ0A 3OECA 2F64A 4MV1A 4MUYA 1LW6E 2OB2A 3LCRA 3PSAA 1AX9A 4IGAA 5BORA 4XZ3A 4TMKA 2FJ0A 4ZMSA 2COUA 5K2MA 3SY8A 4WA7A 4Z8XA 1YZQA 2V4UA 3GFGA 4FKBA 4KDRA 2HQOA 4IWXA 1R6VA 4GMGA 4U7DA 4YQEA 4C0WA 2N75A 2V98A 4BZQA 1R18A 1ZVJA 3D6FA 4PLTA 5A0FA 4MTOA 1YULA 2FUKA 2D59A 1PJRA 3HM2A 1P7YA 3CN7A 3BXOA 4JJ8A 4NBLA 2H1VA 4BB9A 3VR4A 1E99A 4YCBA 5DCWA 1GQYA 1LSOA 3DR3A 1KO1A 4C01A 4DV1O 2CB9A 1ZEMA 4ETNA 2YHIB 2A7XA 3SYKA 1V3VA 3AI7A 1GAWA 4JQZA 4GI3A 2QPTA 4F86A 1IIRA 1AIPA 4AL4A 4AYXA 1I0HA 4BN0A 4JI8O 4CIXA 2H5JA 1CQPA 3LTNC 3FGOA 3VR3A 2RC6A 4E08A 1LDGA 3TTSA 2PKQO 3BMQB 1XZNA 1MG0A 3K31A 1PW7A 3CXCF 2NLJC 1R3UA 3PYLA 5AW5A 4MT8A 1RXVA 5FPYA 3LH5A 2VNAA 4KXQA 3RS9A 1AILA