3N2JA

Azurin h117g, oxidized form
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGGSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Probing the reactivity of different forms of azurin by flavin photoreduction.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3n2jA00
4AKQA 3SBRA 3DIVA 3L45A 3JT2A 1AS8A 1JVOA 2YXVA 3V9EA 2FT6A 1GW0A 3S3CB 4PCYA 1JZJA 3NSYA 3QPKA 4DPCX 4BWUA 1SNRA 2J56A 3NJKA 1PZAA 3AG1B 3OQRA 1KYAA 4HALA 2GBAA 3PLYA 3PAZA 3WIAA 1AR1B 2X87A 3ABLB 1PCSA 2HRGA 2TSBA 3AZUA 3H4HA 4G72B 3TBCA 3TBBA 1R1CA 1UATA 1L9TA 3D12B 1NPNA 3GYRA 3X1NA 2YAOA 4DPAX 2WO3B 1JZIA 1TEGA 5I26A 5B7FA 2XYBA 1GS7A 3PXLA 2UX6A 1W6WA 2XVBA 2BP8B 2GC7C 3SBPA 1TKWA 1GY1A 1L9QA 2IH8A 4Q89A 2X88A 1ET5A 1EHKB 1HAUA 4DP9X 2QDVA 2BWDA 1AZNA 2PPFA 3DTUB 2AZAA 4M4RB 1TEFA 2EILB 4YSOA 3S8FB 1OE1A 1ZIAA 4K9JA 1YLBB 3CVDA 3MX0B 2XV0A 2I85A 4DP4X 1WA1X 2E86A 4W1TA 1KBVA 4HHWA 5I6NA 1NZRA 2HXAA 4EF3A 3QJRB 1T5KA 2GC4C 1BXVA 2EIMB 2DV6A 2VW6A 3FYIB 1AZBA 4DPBX 4E9YA 2UXFA 1KCWA 5E9NA 1CUOA 2FTAA 3BVDB 4GP4B 5EHFA 1A4BA 1X9RA 2R7EB 2W8CA 1A3ZA 3EH5B 3C75A 1FWXA 4A67A 4E9SA 3CVBA 1ZDSA 4E9QA 1V54B 4A2GA 5A7EA 1AQ8A 2XV2A 3KW8A 1RKRA 2BZCA 4YVUA 1L9OA 3OMIB 4F7KA 2WSDA 3ZBMA 2AVFA 4KNTA 1M56B 2MTAA 3T71A 1J9RA 2AFNA 1ET7A 3X1FA 1JZHA 1F56A 2QPEB 2CCWA 3FSVA 1NWOA 2H47C 3FSWA 2DWTA 4PAZA 4E9XA 1RZPA 2GI0A 1KDJA 2JKWA 2AZUA 1AACA 2FJSA 2CBPA 3AW5A 4BXSV 2P80D 2XWZA 4P5RA 4NAJA 2FNWA 2H5UA 2IDFA 3S8GB 3FU9A 3WKQA 2IWKA 2N0MA 1OCRB 4HCGA 2PCYA 2ZOOA 5B1JA 1JERA 1TU2A 3EH3B 1QHQA 3EF4A 2DY2A 2XXFA 3T6VA 1CYWA 1ID2A 4E9TA 5ANHA 3FT0A 3ABGA 4A68A 2DWSA 3T6XA 4YSEA 1BQRA 3T9WA 3AG4B 1EZLA 1L9SA 3GDCA 1PLCA 1SF3A 2UXGA 2GHZA 3GXUB 3FS9A 4GXFA 2YAEA 1M57B 1NIFA 3FQ1A 1DZ0A 3NJNA 4YSSA 4G7QB 2DYSB 2PPDA 4A2HA 3UAAA 4YVNA 4DP8X 1BQ5A 5B3SB 1BAWA 3N2JA 2J5WA 4AZUA 4W9ZA 2XX0A 4JHUA 5B1JC 5D4IA 4Q8BA 2PP8A 3TASA 4BDVB 1GR7A 3KW7A 4BWTA 4YSQA 1SHXA 3IN0A 3WI9A 4G7SB 1KGYE 4JHVA 1NWPA 2W88A 1GS8A 3FYEB 2VM3A 1NIAA 2GIMA 3ABMB 1GYCA 1I53A 4A2FA 5B7EA 4KOCA 6PAZA 1NIEA 3CDZA 3RYMA 5B1BB 1CURA 3X1BA 3ZDWA 5PAZA 2PCFA 3CVCA 3NSFA 3ZX1A 1CYXA 1PZBA 3QQXA 2FT7A 2CJ3A 4YSDA 3EH4B 4HCFA 1FA4A 1AZRA 5I5JA 3IBOA 1MG2C 1MG3C 4HCIA 8PAZA 4HIPA 3SBQA 1URIA 5D4HA 4HZ1A 3BQVA 3QJTB 3WNJA 2IWFA 3V9CA 4KNUA 3FQYA 1XB6A 1BXUA 2NRDA 1NINA 5B1KA 2XV3A 1OF0A 4X4KA 2FT8A 3QJSB 3EHBB 5D4JA 2FQGA 2JXMA 1HAWA 1SJMA 3FPXA 4DP7X 2VM4A 1ETJA 1MDAA 1M9WA 3FU7A 1ILUA 1XB8A 2PLTA 4MFHA 1ASPA 1BYOA 4F2EA 2YQBA 2IWEA 1AG0A 1IUZA 1ZIBA 2IDTA 4QLWA 5AFAA 4KO7A 2DYRB 5I28A 4KO9A 4ZK8A 3HEIB 2IDUA 4TXVB 5PCYA 1ASQA 4G71B 1J9SA 1SF5A 2HX8A 4ENZA 3NJFA 1OV8A 3OD3A 1JXFA 3FSZA 4BWWA 1WA0X 1BQKA 3QJUB 3UAEA 4UANA 2FWLB 5I6LA 2BWIA 5I6KA 4E9RA 1E5ZA 3T6WA 4GY4A 1SDDB 2BO0A 2BP0A 2J55A 1B3IA 2QDWA 3UADA 1JVLA 1PMYA 2ZXWB 1VLXA 3H4FA 2EINB 3NSCA 3NJLA 3TA4D 1BYPA 1WS8A 4NB7A 1AOZA 2PP9A 1FFTB 4YSPA 1OOWA 3NP3A 1PAZA 3T6ZA 3U25A 4G7RB 1AZCA 1AAJA 2PPCA 3IN2A 4YL4A 1E65A 1J5CA 1W8EA 1NDTA 1BXAA 2IAAC 2A3TA 3CG8A 5F7BA 5FC9A 4AKOA 3DKHA 1ADWA 3QJVB 3IE9A 2VMJA 4A2DA 2B3IA 1WAEA 4KO6A 2AANA 1PNCA 2OV0A 1V55B 1PF3A 2FQEA 4E9WA 4HAKA 1PZCA 2I7OA 1GS6X 2IDSA 1XMEB 4YSUA 1KDIA 7PCYA 1L9RA 1ASOA 2HX9A 4NERA 3HB3B 4N8UA 2CUAA 6PCYA 4AI7A 2QT6A 1JZFA 2BHFA 2JFCA 2PPEA 4KOBA 1KBWA 1NIBA 1OCZB 4G70B 2RACA 2VW4A 1BEXA 4AKPA 2XLLA 4JKNA 3PCYA 4GP8B 1L9PA 4M3HA 1GSKA 1IC0A 4CSZA 2BW5A 1AS7A 1OCOB 2YAPA 2I7SA 1NTDA 4DP1X 3OM3B 9PCYA 3SQRA 3X2QB 2OCCB 1RCYA 5LDUA 2YAMA 5I6OA 5I5IA 1SHWA 4BXVA 3NJIA 4GYBA 2VSMB 3H56A 3NJJA 2MRYA 1AG6A 1IKOP 1N68A 1ILSA 3ABKB 2XU9A 2HRHA 2FQFA 1AS6A 2BZ7A 2EIKB 2P80A 3AG3B 1GY2A 3NSDA 3UACA 5B7MA 4A66A 1AZUA 2HX7A 4DP0X 4DP2X 2XX1A 2BP8A 4DP5X 1JZEA 2UXTA 4L0PB 4FA7B 5AKRA 4P5SA 1SFDA 1AIZA 3CDZB 2FQDA 3ASNB 4UAHA 1WA2X 2Y69B 4WKXA 1A65A 2GSMB 2UX7A 4YSTA 1JOIA 2YAFA 4WTQA 3AG2B 3FSAA 4QKTA 1IBZA 1J5DA 2BW4A 1PNDA 3X1EA 1MZYA 3UABA 4YSAA 3WNIA 7PAZA 3MBWB 5TK2A 1CC3A 1X9UA 4GP5B 2Y1AA 2OJ1A 1A4CA 2B08A 2HZHA 2VN3A 3UGEA 1E67A 4E9VA 1RZQA 2YAHA 1KV7A 3IEAA 3PAUA 2R7EA 4HHGA 5AZUA 3WKPA 3QJQB 1QNIA 2VW7A 4KO5A 1JXGA 3NT0A 3FU8A 1PLAA 5B1AB 1IBYA 4KNSA 2YARA 1MZZA 2GB2A 3FU7B 3CZUB 1E30A 2QPDB 1ZPUA 3PPSA 4AX3A 3NJHA 1HFUA 3X1GA 5I5MA 2LLNA 4YSRA 2Q9OA 2CALA 4YSCA 3ERXA 5I6MA 1ZV2A 1V10A 3ASOB 2PP7A 5IY5B 1AANA 1A4AA 1SDDA 2PPAA 3NJMA 1ET8A 2ZONA 1WS7A 2H3XC 3PAVA 4BK5C 3JTBA 3FPYA 1W6LA 2EIJB 3FQ2A 1E5YA 3AY2A 2WO2B 2XUWA 2XXGA 1OE2A 1NICA 4DP6X 3N55A 4F2FA 3NYKA 1J9TA 3NJGA 2TSAA 3OMNB 2BP0B 1PLBA 3NP4A 3TU6A 1A8ZA 2IDQA 1NPJA 2VSKB 1OE3A 2J57A 4RH4A 3S3DB 2IH9A 2YXWA 2CAKA 4N4YB 5TK4A 5F7AA 1NIDA 1JZGA 1JXDA 1OCCB 1KCBA 1PY0A 3WG7B 1QLEB 2UXVA 1ZDQA 3G5WA 1J9QA 1XB3A 2ZWNA 3OMAB 3S3BB 4UF7C 2YAQA 1DYZA 1SFHA 5I6PA 4BDVA 1N70A 4FAAB 2HLEB 4CSPA 2Q5BA 4A2EA 3ZIYA
chains in the Genus database with same CATH superfamily
1NCAH 4P5MB 4PRDB 4O02H 4E2OA 3B9KB 1BPVA 5CSGA 5A2CA 4AXWA 3L4TA 1WBYA 4QRBA 1T5XB 4HS6A 4ABUA 3ZMNA 1EMTH 4NFDA 2FSEB 1CDIA 1KJ2H 4R7LA 1KYAA 4R7NB 2Q2LA 3Q2VA 1M7DA 1L9NA 3PLYA 4Z7WA 2BOCA 1N5YL 5D1QB 2XPZA 1X5MA 4BE6A 4YHZH 1RZJL 5KG9B 2CNZA 1UOWA 3RVVD 3ABLB 3V4PH 3TFBA 3VFSB 3D05A 3QXDA 3P73B 4PBXA 3FQWA 1KBBA 4Z1PA 5GJSL 5C0JA 1KMGA 1R5IA 3S35H 4FG6C 5LNEA 1XF3A 5M95B 1FVCA 1T3FA 1K4CA 4W9LC 3VD2A 1P4BH 3SGDH 1XCWA 1AOHA 1Z7JA 3GMMB 3BDYL 1ESOA 2GUOA 5CD5D 3CX2A 4TSBL 1QSFB 1IKFL 1U8JB 1MVYA 1TYJA 2BSRA 1GS7A 4WTZA 3X13A 5CCJA 4HT1H 1LO0H 1AGFB 4JFDB 4JKPL 4QDGA 3GMQB 3QIUC 4MA8L 4HAFA 4R7XA 1IM3B 1NGXA 3RIKA 4ODHL 4PRAA 1G7LA 4IDLA 1BFVH 2Y06L 5TQ0L 1NKOA 4XN1A 2AGJH 4R84A 1DVSA 3IETA 2YIHA 2FL5A 5B8CC 1TEFA 1MRDH 4UNUA 4PVLA 4ALAH 4PG2C 1BWMA 4EI5A 5FUOH 1U8LB 2FVNA 1HC1A 1WZLA 1M7IA 3G6DH 4WQOA 4UOW1 1GGIH 2DWDB 4WI4A 4XPBH 4JRXB 1NMCB 3F7RA 4QCIB 2YGOA 3W9DB 2Q6WA 4H44C 5B1CA 1D5XB 2UXFA 4N1HB 2XHNA 1BFSA 2AV7B 4E41E 3TPKA 3UYPA 5IJVA 1J48A 1YEKH 4LB8A 5IW3A 3O2DH 4Y7MA 4B96A 2QQNH 1YQVL 4ONFL 1WCQA 4OIBA 4XXDB 1A3ZA 5DQJB 4XPGH 4GRWH 3CXDH 5AD0A 2CDFA 4TTDC 4L4JA 1M3IA 2E7LA 5CU9A 3Q2LA 3VYNA 1VSCA 5GHWH 1I8LC 2ZXGA 3MRGA 1L9OA 2V5YA 4JJOA 4XPFL 2HVJA 2LU3A 3PPEA 1IQDB 1WPCA 1X6LA 2VLKE 2Y7LA 1HEJC 5I1AB 1KIPB 3BAJA 4DCQB 2DQEH 4H0GA 2AJZA 5CLYA 3RNQA 4UU9B 1F4YH 3VFVB 5HI4C 5DZVA 1ZSDA 1MWAA 2Q76A 4Z0BL 1BGXH 3W11D 1NBYA 1U8HB 4ZO7A 2P80D 5ES4B 3TEZA 5ISZE 1E28A 1P9MA 4FKEA 4X6DA 5T1LA 1A4JA 4YHKH 2F1AA 3QUGA 1YN7A 4LSTL 1W15A 3QUMA 1ZA6B 2FWOB 1E27A 3F3HA 1H6TA 1OGTB 5EWIL 2Y3AA 1TU2A 5HHVL 2YBRB 5DLML 5HGHB 2X7LA 4X4MA 4N5EC 4CN1A 3CPLA 4GUPB 4EUPB 3AC0A 5EO1A 1N8OE 4ELDA 1U8NA 4PS7A 4DW2H 1FL3B 4FLSA 4FD0A 3WTWA 3KYKH 1HH6B 3VXNA 2LW3A 2VNCA 1NUNB 2L3BA 5I1JL 1HSAA 4HIJA 5CEZL 2F7IA 3WOVA 5DCCA 4AQ1B 3RURA 1SBSL 5EULV 4JO4H 1M57B 3HW7A 3QQ3A 3D1MC 2DI8A 5LGYA 5T1MB 2DBJA 2R69H 3EH2A 1XGPA 3HMXL 2PPDA 2G0LA 4GIOA 4L29A 4M93C 5I6XB 2EDYA 3LKRB 3ARGC 5D7JB 4YO0A 4GEJA 3VFNB 5HYFA 1NEPA 4K3EH 3VMPA 5C0GB 3GI8H 1DO6A 1JGLH 4ZUSB 1OM3L 2NCEA 3SJVA 2OBGA 3KD4A 3BVXA 3EYFB 2R2HA 1ZS8A 3RL1B 4Y4KD 5HGBB 3P30H 4ESKA 5C0FA 2PR4L 5CLXA 3T0AA 4OD3L 1CLZH 3HJEA 3QNYB 5LAPA 1A5FH 1WBZA 4U1HA 4LSQH 5FHAH 2HFGH 5B7EA 2W92A 3MLZL 3Q6FA 3VQ1C 5B1BB 2G2PA 3MA7A 4GAJH 1MF2L 2BNQA 3CIAA 3D0LA 4UM9D 5AWNH 1KTLA 4TNWK 2DKUA 1UOLA 1FA4A 1MIEL 3GRWA 5DUPL 5G5DA 4QTIH 1MCRA 2Q8BH 2RH0A 3MBWA 4EDWH 1UASA 3ZDZF 3MV01 4CSSA 1ZVYA 4K8RD 1WZ1L 1URLA 4Y1AB 3FQYA 4GKOA 4NWUH 2BIMA 4LKXA 3LXUX 4NQCB 4NZRH 5C0CE 1UXWB 3FCSB 3WMQA 3KYMB 1QEWA 3DUUB 3QJSB 5DC9B 3ZN6A 3ECVA 3EJYD 3FSOA 3CVIH 4JRLA 1KLUB 3T0DA 4LPTA 2V5SA 4AGPA 2VQTA 3DURB 3WAKA 3VXUE 4K94H 2P1YA 3C87A 3X11B 4YX2H 4TRPL 2IMMA 3K6SB 4CSTA 3V2AR 1CVRA 4XGZB 5I5RA 2YD8A 1OF2A 1NDMB 1K5NB 3ZT7A 4OTXL 5C0EA 5C8JB 2IWEA 2VRQA 1NBZA 5TH2B 1GIGH 3PIQA 3VXOA 3L3DA 4PLJC 2H0EA 1SUJA 2PYFA 4NRYA 4QLWA 5M94B 1SYSA 1M4KA 3DGCR 4OCYH 4TVSa 5FECB 4KK6D 1C1EH 2V9RA 4QTFA 1FFNA 2GTWA 3P2TA 4FCHA 4OZGB 5F0LB 2NTSP 1LNUA 4TXVB 2B5IC 3WV0A 4UILL 1KB5H 1IEAA 1T7VA 5L2KD 5BUAA 4XNUL 2NY6D 3TS8A 1BF5A 2FWLB 5I6LA 4LNRA 3EGXA 4E5XB 3KYOA 3OZ9L 4GY4A 1Q0YH 1IZJA 2NW3B 4NN6C 5E8NB 1T04A 4M6MH 4N2GA 5A6LA 4KZDH 5D9SA 1UJTA 3ARWA 2H32A 4K2UH 4NO0B 3TN0B 3DVFA 2NX5D 5J57B 1E42A 1MHEB 4X5RA 3BH9B 4XBEL 4DUWA 3IJYA 2PPCA 5ADOL 5FCUL 4U0RC 1SDAB 3WSQH 2KBGA 4FQHA 2EUVA 2X0UA 2MSPA 1DUYB 5FKPA 2QLVB 4M9PA 4ODUB 4NYLA 3MVSA 3C5XA 5EN2A 2CDGB 2VUYA 2X4NA 4JGJA 3BD3A 2GIXA 3JWDC 4FULA 3GXDA 3TC9A 2GSIB 5CJ5A 1XTLA 3TONA 4OFDA 3S9DB 2WVSA 3VG9B 2NTFA 3L9BA 5E2VH 4AEHL 4WNJA 3B34A 2OV0A 3UERA 4P5MA 3DOSB 4PRDA 4V1DB 3GFUA 4HAKA 1ORQB 2OCJA 3B9KA 1F45A 1WTGT 3VM5A 1KDIA 4JO8A 5AAWA 7PCYA 1T5XA 2ODIA 1RZJH 5DFTA 5KAQF 2BHFA 2FSEA 3LNDA 4GRLC 5AYTA 1D2OA 3IPBA 4Y4FD 4R7NA 5AZ2L 2ZG3A 2ADGB 5GJSH 4MHHI 2G9HB 2XLLA 5D1QA 4XXWA 4XVJL 5E1HB 3LKQB 5I73B 5KG9A 3QZOA 2HVKB 3VGBA 2Q7NA 4AW4A 3GK8L 1UCBL 3VFSA 4BFIB 4D8PB 2BMKB 2DICA 1MCPH 4OZ4B 3P73A 1D5IL 3BDYH 2ED7A 5GS2D 5DJ6B 3FCGA 4AT6B 2DW5A 4JFUA 1IKFH 1FIEA 4AW7A 3U6RB 1WISA 2VSMB 3NJJA 3GMMA 4XE0A 1IKOP 2Y1VA 4M8VA 2HN7B 4ODHH 2V7NB 1E3XA 4OT1H 5ICZB 2EVHA 1QSFA 1U8JA 1XQ4A 3U30B 4K0OA 4YDVA 3R7QA 1F3DJ 1JFQL 2C7FA 2OCFD 3Q9QA 2XX1A 4IYKA 4JFDA 1I1AB 3GMQA 4I9XA 1IM3A 4ZTPL 3L81A 1TR7A 1U42A 5AW2B 2G3NA 2YN5A 5TDOB 4HP5A 1H9DA 3D87B 3TWYA 4RFEB 1JHKH 3SGKC 4X99B 3SE4A 1U8LA 1BQSA 1G43A 5KS9E 1A7NH 3F6IA 4HW6A 2CK0L 1DVTA 2LFEA 5T1KB 3EG9B 4CBZA 4Y5VB 4M48L 2Z64C 4JRXA 4M7JL 4JFHD 1NANI 4F3FB 3D3VD 4QCIA 1YQVH 4ONFH 2AK4D 1D5XA 1DDTA 4QHNA 4U2YA 5KVGL 5AOLA 3QQ4B 2X6BA 2AV7A 3JUZA 4J6RL 4HHGA 4XXDA 5DQJA 3P3RA 2WQXA 3OPZL 5DF0A 4OIFA 2OMYA 3A4EA 3HC4L 2HT3D 4IRJD 3O4LE 2D31B 2ZCLL 4YNYB 2AQPA 3L48A 4B9FA 3DXAE 2ENJA 5CGBA 5H4ZA 3BKYH 5DZ9A 3WY2A 3IXTB 3NFPB 5AB0A 1AQMA 2R83A 5I5MA 3E38A 4Z7AA 5A7BA 5I1AA 5J12C 4Z7UE 5J9PB 4Y4HC 4S1DC 5JMRA 4LSTH 3CDFA 1WT5A 4UU9A 3AITA 1MW0A 4NZ8A 4X7DC 2PPAA 4ORGB 2Z8RA 3VXSB 5EWIH 1I82A 1U8HA 3VD9A 5DLMH 4WNQB 1IARB 2YEQA 4ENED 4P2QB 5DA4A 3KMDA 3Q1EA 1R6VA 2RAMA 3FQ2A 2FWOA 5CUSH 4KX9A 2WLLB 5BMFL 3NFSL 5ABZA 4GUPA 2JF1A 3F05A 4PY8J 5CEZH 5I1JH 5FYJD 1J9TA 1E9QB 1YHPA 2LVCA 2TSAA 1SBSH 2BP0B 1FL3A 1HH6A 2DL9A 2KT6A 1MXGA 4CVZB 3HMXH 1TTFA 3REVA 4WW1B 1R46A 1XGUB 3PNRB 2XQYA 3U2IA 1KB3A 2AEWA 4XVUC 5DK3A 2OS7A 2YS4A 3HN3A 5T1MA 1OM3H 3T4AB 2VRAA 2YGQA 4WWKB 5J13B 1NFDE 2K70A 3LKRA 4ANXA 5D7JA 4YHYB 4R5XA 2C9SA 4ECNA 4HBCL 1ZHLB 3U9WA 3K8MA 4EQ3A 2YAQA 4ZUSA 1B0GB 4ZJ9A 3TBVB 2WYHA 5A2BA 5GRYA 2H6OA 3GZPA 1PEWA 4FNUA 4KKRA 5CJXA 3RL1A 5HGBA 3FRPG 3MLZH 4HC1H 5IFHL 5DZOA 1XVSA 3L45A 3TVMD 1S78C 3VO0A 3QNYA 3WNNA 4PJEB 3N6YA 4EO5A 2EO7A 5IW6B 1SNRA 4I0PC 3GIVA 2V6HA 2OX5B 5DUPH 2YQ3A 1CE6B 4L37B 4MAYB 1A3LL 3FB5B 1AR1B 5L8JB 2VKXA 3O2VL 4ZNEE 2ZOKB 2FRGP 3VD1A 4X5PA 3IDMB 5IEHB 3OJDB 1EXHA 5ACLA 3H4HA 4P9ML 1FUNA 1T83A 1ZT1B 1UATA 2HG0A 4EZLA 4OAWA 3B7YA 4PRIA 3KNBB 4Y1AA 4NQCA 3T3PF 3FCSA 1SOSA 1OANA 3KYMA 3DUUA 4NZJA 4XPTL 2CBQA 2XYBA 5CCKL 1KLUA 4OTXH 1G9NL 2OZ4H 2XVBA 3DURA 3K6SA 1E4XL 4ZAKC 2L7QA 2NY7L 4MXVE 2FX7L 5DUML 1Q8MA 3UC0L 2WZ6A 4S1SL 3ZW3A 1K5NA 4G83A 2NNAB 5BUGA 1YEGH 5TH2A 2X3CA 4ZW6A 4QUOA 3C8KB 2UUDH 3WDJA 5A43C 5FECA 4PB9H 5CCGE 4EIUA 2AERT 3BGMA 4X6CB 4XNUH 4P05A 1R3LB 4M7LT 3UTTE 3SBWA 1JZ2A 4JDZB 3QJXA 3PWUA 4FFZL 3OZ9H 4LKCB 5AQ0A 3VXTB 1DN2A 4QHUB 1Z2KA 4PRHD 2HJLB 5F2FA 4E5XA 3JWNH 4U3CA 4C57C 1NCTA 1GRWA 2H6PB 3EH5B 2VDOB 2DQFB 4F9LC 1T1YB 4PJAB 5E8NA 4QRPA 5EC1B 1XCXA 3GSNL 1JG9A 4F7PB 4XBEH 1F3JB 3OAYH 5CGYD 5FCUH 5E7FA 3W38A 4L8BA 4NO0A 1Z9NA 3TN0A 5CR1A 2DQTL 2H2SC 5CINL 3ZBMA 2AVFA 4O4YL 3UYOD 1MFAL 1GGYA 1MHEA 1IGIL 3BH9A 3MR9A 3JV6B 4BJLA 3ALXA 1WDAA 4NQEE 1GZPA 3ZTNH 4NI6A 3Q8EA 3UG5A 1HEZB 4MJHA 3SGJA 2N0KA 4FQPA 3BUDA 1RZPA 4ODUA 4IBSA 4TMPA 5SWSD 4AEHH 1HYSC 2D7QA 2X0VA 2CDGA 3BSHA 3NZSA 5HD8C 4KNQA 2FWSA 2GSIA 2ZX8A 2GJPA 1NCNA 4JQXA 1HI6B 3QIBC 3NIFE 1QHQA 2OL3L 43C9B 3MRRB 1EANA 3DOSA 4V1DA 3KJ6L 1ORQA 4LCWB 4N8PA 4RFNB 5AZ2H 1ZD6A 4TNVK 2CR3A 4LU5L 4XVJH 3WLWD 4AYGA 1RERA 4IDJL 3LKSB 4QT5A 1IAOB 2A4ZA 4M7LL 1B9KA 1F5WA 1D5IH 5LBGA 4JN2B 3LTVA 5D71L 2ZUTA 2ADGA 3FS9A 1C9SA 1DANU 1RL1A 2G9HA 2V5MA 3FQ1A 3MNWB 5BRZA 3LKQA 1NC4D 1OCWL 4RGMC 3AWFA 1CGXA 2HVKA 3PWPB 2I9TB 4D8PA 4BFIA 4HWBL 5D7IB 2ROXA 2PYEB 4OZ4A 4TUKH 3UAAA 1M05B 2HFEB 5DJ6A 1BJMA 3ZE0B 5IQOA 5EIIB 1JFQH 3AMKA 2PP8A 1F86A 3BUQA 5KSVA 4PJDB 5HPOA 2HN7A 4ZTPH 2V7NA 4OF6A 3TCLB 3QUXD 4N8VG 3S2AA 2MOVA 1ADQL 4L4VD 4RWHA 4WEBL 5DD0L 4UTAH 2VDRL 4X5QA 1YJDC 1CO1A 5DS1A 3ABMB 4P2RD 4U1MB 4WK0B 4WO4D 2N4IA 3MOAH 4Z7NF 1C7SA 4PJGF 2DQCH 2CK0H 2NNRA 4WSKA 1BLNB 4M48H 3NCYS 3QIUB 3SOBL 5TDOA 2XI9A 5PAZA 4GT7A 4RFEA 2AXFB 3WTUA 2X2UA 3ETSA 4X99A 3QEQE 2GY7B 5KVGH 5T1KA 3EG9A 4Y5VA 4YDKL 5B8CB 4FTVB 4J6RH 5GRZA 1QSED 3IBOA 3PDDA 1MG3C 3BLBA 4YDZA 4F3FA 4IBVA 2O6DA 3TIDB 1A0QH 1T0PB 5D4HA 3QJTB 5T5FL 3GJFH 1CWVA 3OPZH 2MOQA 3LJ3A 5AKSA 2IWFA 3HC4H 2KL6A 1YYLL 3J27A 4QXUL 4UQIM 5TE7L 2ZCLH 2P8LB 2IFFL 2FX8L 3T2PA 5JIIA 4Q7DA 3IU3B 4LZKA 4PQXA 3T4YA 2VTFA 4G9FE 1RV6X 4AYEC 4D2NA 4U3HA 2WXKA 3H55A 4YNYA 1JV2B 4MFHA 1H3VA 3EHBC 4X7TB 5IB5A 1FLRL 1U3JA 3IXTA 3NFPA 4WKZA 3OZKA 1BXXA 2AXGB 3RU8L 1AG0A 1J87A 3V6OE 1B4LA 4IRSC 2CKBB 1PVHA 2RA1A 4KO9A 4ORGA 3UBXG 2EECA 3T0ED 5BMFH 4WNQA 7FABL 3NFSH 1SXAA 4P2QA 2VERA 1S7XB 4HXBH 1WV7T 4L3FA 1NAML 2GK0B 3FTGB 1S9WB 3A4FA 3RJOA 1J9SA 2V37A 3E3QE 2WLLA 4HLJA 3N44B 2JKXA 3OAZH 3QUHA 4D8OA 1WA0X 5JW4Q 4HAGA 2DM4A 1S7RB 4YZFF 1C12A 1E9QA 2AEPL 2BP0A 2UVEA 1M3JA 2Q7AA 3KL0A 1FBIL 5KOVC 1JVLA 3U36A 4DOHE 5JW4N 1I1RA 1VLXA 4L8CB 4HEPA 2ATAA 1EH9A 4C4KT 4CVZA 4TQHA 3S3SA 2BJML 2CHNA 5HDLA 1TZAA 4WW1A 4QJ4B 2R56L 1XGUA 4UIMA 1FFTB 1T4WA 4HBCH 4G7RB 3H7LA 1G5AA 1JCKA 3SE3A 3THMH 1KTCA 2BSEA 1CFNB 1E65A 2X3BA 2CGZA 3HHSB 4PJCA 3T4AA 4M1GL 4WWKA 4JY4B 5E8DL 4FXKA 4NBZB 1L7IL 5HHOE 4AY0A 1KTDB 5IFHH 1ZHLA 4H0LC 4JPKL 5KVFH 1PZSA 1B0GA 1TSRA 4MCZB 4M93B 3ARGB 5J3HC 1NOAA 1WAEA 3SDYH 1BFOB 2G60L 3MRQB 4CADA 5AVYB 4U6TA 3H2QA 3RVWD 5KAQG 4JK0D 4PLNC 1IJ9A 4PJEA 3L7EB 1Q94B 2VT0A 3FH5A 2JB6B 5D7LA 4AI7A 4JZOB 4F7TB 5CO1A 2IPUG 4KJWC 4KOBA 2OX5A 2J1XA 1CE6A 4L37A 4P9MH 2EDOA 1QD0A 4MAYA 2Q7YB 2D8KA 3FB5A 4S1RL 4GP8B 2R29L 4GUCA 2ZOKA 1IC0A 5EO0B 1U2HA 3IDMA 1WUZA 3OJDA 5A2LH 5IEHA 1JNJA 3L2LA 3PDGA 5I8OL 1ZT1A 4Z7IA 5CCKH 1G9NH 5LBSH 3HNSL 4XB8A 1TLMA 4E41B 2EC9U 1E4XH 4F93B 2NY7H 1BVZA 2FX7H 3UC0H 1QI4A 4S1SH 5HGDB 1NBCA 2DIAA 1BF2A 4M29A 4JNXA 4W4NA 3OXRB 1JGDA 1L0XA 3PJNA 4GUOA 1UA7A 4KK5D 3EJSA 1EAPB 3B2UC 2E3VA 3V6OC 2NNAA 3F58H 1XF2B 4BM7A 1WA2X 4X6EB 1OP5H 4Q6KA 3UP1A 3C8KA 2VLKB 3FN0L 4RMWA 5HJBA 3W0WE 2LLGA 4GNKB 4R96B 4AWJC 4FFZH 5KVEE 4BKTC 4YE0A 5KZCB 5L88L 1I9EA 3MLVL 1S3RA 3VWKC 3A6CH 2APSA 3E3QC 1R3LA 1UA3A 2XG4B 4DGYL 7PAZA 5ISZB 4LLQB 4JDZA 4JGNA 3INUH 4KMLB 5TK2A 5I0VA 4JQVA 3VXTA 4NJAL 5IM7A 4K5NA 2OJ1A 2HJLA 3GSNH 4JFOB 1RK1A 1G7HB 1TQCC 9PCYA 3MUHL 1NCDL 4RQQA 4S1QH 3RBGA 2B5IB 2Q8AL 2H6PA 2R27A 2DQTH 2DQFA 4LCCC 2VW7A 1T1YA 4PJAA 5E5MB 5EC1A 1F18A 3RGBA 5H94A 4F7PA 5IHWA 1F3JA 1CICC 3HC3L 3KVQA 5HBBA 2CR6A 2VC2H 4NN6B 1FAIL 1TVBA 3VFMA 3QVAA 1TPXC 2RFXB 2Z91A 4POYA 5FPIA 3RX9A 3R4DA 4GFTB 4DFHA 4A7TA 1MN4A 1EAOA 2YZ8A 2UZIL 3JV6A 3C60D 1YEEL 4Z78A 3HCVA 4Y5XC 2QADD 4OLYH 3LRSB 4Y2DC 1HEZA 1E4KA 5DMIL 5A1AA 3U4EA 4U0RB 1YNTF 4RDQF 2A0LC 2B9BA 2CO2A 3UFIA 4FNRA 5E6UB 3AY2A 4DH2A 4IDJH 2HVBA 3IPEA 43C9A 3MRRA 1JPEA 2X4SB 4NEHB 3QFJD 2NY4C 3MROB 1SYVB 3FAWA 4LCWA 1T2JA 2CA4A 1KXHA 3OF6A 3CFBB 2VQ1B 3OJMB 3TU6A 1OCWH 3LKSA 3EFDL 1W72B 3RAJL 5FV2A 4I89A 3DPBB 4JN2A 1BIIB 3VH8B 4OGXL 3S97C 3MNWA 2CSPA 4IKNA 1GC1L 4GRLB 5I2IB 2G3MA 3PWPA 4NOFA 4ZW8A 3FFCE 2I9TA 1ZS2A 1QLFA 2OTWB 5D7IA 4G82A 2PYEA 4WTZG 2WYZA 1QYGH 1M05A 3BD5A 5GGSY 3B2XA 2ATKB 1XB3A 2XN1A 3OMZA 5EG6C 1ADQH 4WEBH 2OR8A 4U05A 2VDRH 3QHZL 4EN2A 4XP9L 2WVVB 2HLEB 3CFKB 3QO1B 2X9XA 2A77H 4PJDA 4XC3L 4FEMA 3VGDA 3WLBB 3BSZA 3ISYA 3QRFM 3K2KA 4I18C 1WZMA 1BYNA 3ARFC 4U1MA 3VXUB 3UTOA 2WJ5A 3DX4A 3S8WA 2NYZA 1KV3A 1E43A 3UAJD 1JK9B 1IJNA 3ZDXE 2EQDA 2JQAA 1BLNA 1UB5A 4YDKH 1QBLH 3QIUA 4JPSA 1BHGA 3PL6D 1I9JL 1LK3L 2AXFA 4CMHC 4J3OF 5T5FH 4XHQA 5A2JH 4WHYG 2LAGB 5B8CA 3MMEB 1E0OB 3EYVB 4FTVA 1YYLH 4UWQB 4DKDC 5FM4A 3O45B 5TE7H 3A67L 3TIDA 1VADA 4PG2A 3T0VA 3CFCL 2FX8H 3LRGA 1IV8A 3OWEA 4WSJA 5K1VA 3GBLA 4ZS6D 2GSGB 2FE0A 2BRQA 4OI8A 3VSUA 2P8LA 2Y0SA 1EHNA 4HUMB 4NC0B 5I26A 2A9BA 2HT2C 3U0TB 1ONQB 2DIEA 1FLRH 4ELME 3IU3A 5HDBF 4LQFL 3JYBA 4XX1G 2H2PD 1A6WL 1IU1A 2X09A 1GSMA 1H3TA 5I76B 1JV2A 4J23A 3NBNA 1EHKB 1HAUA 4X7TA 4LARL 3L5XL 1GGTA 1JV5B 4IOFD 1DQJB 2BSCA 3TNNB 1I8LA 3KPRE 1S4IA 4YSOA 5I66B 3S8FB 4QO1B 1NAMH 2CKBA 5LGHL 2NZ9C 2EXTA 5FYJH 5J12B 6CGTA 4Y4HB 1S7XA 2EKSA 4KU1A 5LG6A 1T5KA 3NAAL 1BXVA 4LIQH 2GK0A 3VDAA 3FTGA 1S9WA 4EIBA 4MVBC 4IKJA 3MRPA 4IRZA 1B6DA 1S7RA 1XCTA 2BJMH 3SDAC 3NTCH 1TO4A 2J1YA 2R56H 5F44A 3RGVC 3PHQB 2PW1B 4G8GD 1FWXA 4L8CA 4W9JC 4TNEA 5F7EL 2YK1H 5AKTA 4KXAA 4M1GH 4XNYL 5E8DH 1ZGLB 4HJSA 1L7IH 4G8IB 4XMXA 5KYNA 3N1PC 3Q8AA 2ZTBA 4KBPA 3T71A 2AFNA 1YYML 1GYUA 1I9RL 3QZPA 3B2DC 2L7EA 1CFNA 5IREA 2CCWA 3FSVA 4BZYA 1N2RB 1GL4B 1MELA 4JY4A 2X4QB 1KCSH 2J8UE 3WMSA 2E47A 2JKWA 2G60H 1KTDA 4OZIF 4WENB 2LAAA 4G1EB 4NENB 4MCZA 4A37A 4GRWE 2B1AH 1OCRB 2ED9A 4WFHD 1LEGB 1PAMA 4NX0A 4Y9EA 5TQ2H 4AV4A 1BFOA 5AW0B 3MRQA 5ESAB 4YDIL 4QHKJ 1QKZL 4R0LC 1UZ6E 1W9XA 5D5MF 1RUKL 5D7SL 2R1WB 2NUTB 1Q94A 4P99A 2YMTA 3QORD 5H35B 3LKOB 5EU6D 2R29H 1CI5A 5JW3H 4JZOA 3RWCB 4OCLC 1C5DA 5F89B 2ARJB 4X0NA 1SF3A 5I8OH 3TA3D 1Z9LA 3V0IA 3CVHL 2Q7YA 4AGLA 4I0PB 4NQXB 3HS9A 5EO0A 5KS9B 2E4TA 4YVNA 2X41A 4DP8X 5HDQL 4JFQB 4MNQE 2KYIA 1U36A 4FYRA 3OAUH 3MRBB 3E6HB 4AUYA 4F92B 4AENA 3WNLA 4E41A 2QHRL 4G6ML 3S37X 1H3WM 2ZX7A 4G7SB 4ADIA 1QFOA 5HGDA 1M2VB 4H2AA 2CHWA 3O4LB 3FN0H 3SPVA 5ACMA 1GYCA 3OXRA 2XICA 3DXAB 5HJ3B 3ZTCC 3RYMA 5L88H 1EAPA 1FI8C 1XF2A 3MLVH 4ZMWA 3X1BA 4X6EA 4ZAKB 3BP5A 2G5UA 4JM2C 4JKKA 4Z7UB 4F7EB 1UXMA 3JVFC 4FEIA 4HKXB 4NJAH 1TCMA 4JPVL 3AS2A 3MUY1 1MFUA 3T65B 2XYCA 3U46B 1HEHC 1VHPA 4Z7QE 4DUVA 1M6UA 1MCFA 2XG4A 1KTRL 1NCDH 4LLQA 2Q8AH 4TLTA 2VN5A 1URIA 3OL2A 2EDJA 3UG3A 2DRUA 1G7QB 4K5OA 1ACZA 1G7HA 3HC3H 1V3KA 2VDPL 2YA2A 4NIKB 1FAIH 2FT8A 3NJXA 4HWEL 2N7BA 5EF2A 3GKWH 1T1WA 1PG7L 1U3HC 3SPJA 4TQIA 2UZIH 3G08B 5FOBB 1YEEH 3D2TA 4H1LH 4O2FB 5TFSH 5JHLL 2BNUB 4X6BA 2P7TB 2X2HA 1N64L 4PJCF 5DMIH 1MI5E 3PS6A 4CBPA 3N42B 4G42B 4I9WD 3BEWB 1B0IA 5DGQA 5CN2A 1OAUL 2AABH 3D34A 3LRSA 2QFPA 25C8L 4HIIB 1XSJA 5CS7A 1NFDB 5IMOB 3TLRA 2P49B 3D4YA 4UT6L 1ZV5A 4WU7B 3SDDC 4WF7A 4CW1B 4LBAA 1ZLWH 3P9MB 4ACTA 4MNGE 1BEYL 3PV6B 3EYOA 3ZKNC 3UBFA 2XC8A 1KJVB 1DQLH 2J6EL 2JKTM 1BQKA 3DBXB 4HGKC 4BWWA 3RAJH 2Y6SD 2ZUYA 5K9OA 2PO6B 2XQBH 3MROA 4TVUA 5IK3B 1SVZA 4GQ9L 2JLLA 1F4XL 3CFBA 3QIBB 4XMLH 2VQ1A 1OALA 5EH1A 3F04A 5F9DC 3MRDA 3JVGC 3DPBA 1LJMA 4Y16C 1BIIA 2E56A 4N22A 3VH8A 4J4PC 4URKA 3MLXH 4PV9B 2IGLA 2VOTA 5D1ZB 3TZVB 3ZTJH 2C3VA 5I2IA 3V0JA 2OTWA 4XP9H 1T7YA 4HUWA 5DWUL 4XP5L 4XC3H 3QQNA 3I2CL 4ODXB 1U8QA 2IAAC 5GS2H 2ATKA 1EK3A 3QUZD 1IGTB 5JDSB 3HFMH 3L2NA 2WAHA 1YEJL 2WVVA 3QJVB 3RIAK 3QO1A 3UPRB 4PS8A 1F1GA 2BS9A 3WLBA 1KJ3L 4NLHA 5JZ7D 1Q9LB 3D30A 1M71B 4EJ1C 5J1AB 1ED3A 1RUQL 1GS6X 5ICYB 3VXUA 1LK3H 4IU3B 3WL9A 1S9VB 1L9RA 3HUJF 4CN6A 1JK9A 1DHKA 2PPEA 3SCMC 6FABL 3FH8A 1QUNB 5C0DA 3A67H 1KTKE 3CFCH 5IB3A 1ZVSB 3VFRB 2G0KA 1X5XA 2ODHA 3O3DB 3M7OA 3MMEA 4G6AC 4U7SA 5EOCL 3O45A 4MX7B 2EC8A 2VN7A 3U0WL 3UAFA 5IWLA 1F11A 2Z8VC 5E2UL 3UTTB 1CF1A 5KUKA 2VCOA 3QUYD 3ZKMC 1JHTB 1N0XL 1T66C 2GJZB 3KE0A 1LDSA 1TZGH 4JZNB 4AGMA 2GSGA 5C3LD 3K71B 1BM3L 3WYRA 3WFDL 3AG3B 2KZ1B 2R9HD 2I25N 3U0TA 1ONQA 1BQLL 4TLUA 3CDGB 3H3BC 2UXTA 4L0PB 1I8IA 3R8QA 2LQRA 4FQXC 1SXSA 2AK1H 5I76A 4BQ9A 2F54D 2BM3A 1AGEB 1OW0C 5I23A 4U33A 1DQJA 3TNNA 5IW1B 3Q3GA 3AQZA 2PCFB 1E6OH 5I66A 1QW9A 4RGND 4L3EE 2E7HA 3NAAH 4KPHL 4NQEB 3B5HA 1MWOA 2X40A 4UIKL 4ZTOL 2B9AA 1AGCB 4QKTA 4BFRA 2DDQL 5B38A 3VUAA 3UABA 3PP3H 4JFYB 4Y4HA 4IRSB 3TH4T 1CK0L 5ALBL 2AEQL 1VFAB 2B08A 4TULL 5I8KH 4WIQA 4DVRL 1CT8A 3NIFB 3ORJA 1GTNA 2XQYG 3IEAA 4IGBC 4GW5B 2ORBH 3WKPA 4XNYH 3QJQB 3PHQA 5IMKB 2APFA 1JXGA 2PW1A 5I9QC 5A40E 1PLAA 4BUGA 3FDWA 1ZSHA 3MYJB 5FB8B 1YYMH 2K3TA 1I9RH 3MV9E 3FU7B 4RSYA 1L0YA 3SQOL 2Z1PA 4J3BA 4L3AA 3UCQA 3ZL4L 2EEDA 2D9QB 4HKBB 5C3TA 1ZGLA 4G8IA 4P2CG 5EORL 2W59A 5CP3H 3CN4A 3QB7C 4RDQG 5K93A 4PJ8D 3ERXA 3RB7A 3IDNA 1N2RA 2BPBA 1GXEA 2X4QA 2Y5TA 5EOTB 4FL4C 2F74B 4YDIH 5AKVA 4QY8A 2WMPB 3BAXA 4I1NB 4J27A 1AHWC 1Y6NR 3QI9C 4G1EA 3T1FB 1KPUB 4CU6A 2KMWA 1NBVL 1RUKH 5D7SH 5LHDA 3OR7A 5JXAL 1LEGA 1VCBC 3ALWA 4DETA 4Q9RL 5ESAA 3QXWA 2NY1C 1NICA 4LFHD 3R0NA 3VI3E 4YHMH 5F1IB 1Y1UA 5DZNA 3PHSA 5HHXL 3VTAA 2R1WA 5T1DH 1MCBA 3SKUD 3CVHH 3BKJL 3MLUL 3LKOA 4PCSA 2ZF9A 1MDTA 1PIFA 3RWCA 1UZ8B 3S3DB 4DZBA 5F89A 2ARJA 5ECJE 3ULUL 3UGXA 2PUQT 5DVOA 1VGEL 2CAKA 5TK4A 2ZPKL 5E9AA 1OCCB 4G6KH 4NQXA 3QEQB 3UCRA 5KS9A 3SKMB 1LE9B 3N43F 3BLKA 2QHRH 3VDCA 5GZNA 3H9ZA 4JFQA 4FF9A 2X1WL 5TPWL 2R0ZH 5CEZE 3MRBA 3E6HA 4OJAA 3GHPA 1CE1L 3PYCA 4JPWH 5D6CB 4IKLA 3STLB 2IEPA 1ZTXL 2EJ1A 5HHNA 1A6VL 3HMWL 1Z32X 1M2VA 3IB4A 1BZ7B 2NNFA 4G9FB 3V9EA 2XWEA 1Z9SB 1GW0A 4DPCX 3C12A 3DXAA 5HJ3A 3GEFA 4KKLC 2MKLC 2JSFA 2VSCA 3BWAB 2XN2A 2EUWA 2FD6L 3VG0H 4CC0A 1HU8A 3RWDB 4Z7UA 1QSZA 4HKXA 5DTFB 4R2GD 3U46A 4E5XG 3V4VB 2LE9A 3E7JA 1V3MA 3FFOA 3VRLE 4G72B 3VD5A 5D70L 3GINA 3A21A 3MNZB 2B77A 3Q5TA 2FAUA 4DK3A 4HWEH 1I9IH 1G7IB 5E8OB 3VWKB 5GGQL 1PG7H 1P84K 2ROYA 1R3IL 3ULVF 2R2CA 3CMOH 3JWOH 1UD2A 4JO3H 2P5EE 3P4OA 4P23C 5GGUA 1TQCB 1XL4A 2MNWA 4DOHB 1IB5A 1NJ9A 3MUZ1 4HGMA 3W2DH 3DRQA 2P43B 1JUFB 3G08A 5FOBA 4F9LA 4O2FA 5FX3A 4LCCB 1OAUH 2ITFA 1SHMA 2BNUA 2X9ZA 4RDBA 4FTDA 5DJCB 3RILA 2BWDA 2XZCH 4B27A 2XPYA 2FIKB 3TBYB 2KLRA 4UT6H 5IHHA 2B16A 4G42A 4YXHL 1NCHA 3A24A 4L1DA 1Y7VA 2EILB 3B83A 1G6RB 1HWWA 3MX0B 1TFHA 5AAMC 1BEYH 5KBPA 1NSNL 5AL8A 5IMOA 4FADA 1QRND 4LAQL 5HHOB 5KN5A 1QACA 3U9PL 4PHXA 4APQC 4EF3A 4Y5XB 4Y2DB 4WU7A 4B0MM 2OI9C 5ID0B 3S98A 3P9MA 5FHBH 1F4XH 2VW6A 1AZBA 4NPYB 4AC4A 5JXEC 2FBOJ 3PV6A 5KBDA 3VFUB 1KJVA 3DBXA 5FGSA 3CHXA 3WS3B 3UIZA 2IBZX 2PO6A 1KXVA 4JFEE 3HZMB 5IK3A 5EMYA 3QIBA 4LL1A 3BAWA 1QHOA 2NY4B 4ZT1A 4E9QA 4A2GA 1R24B 2XV2A 4XP5H 5IVZB 4P0DA 4DPRA 2TRYA 5D1ZA 3TZVA 3Q8CA 1PLGL 1OGAE 4ZNEA 1F56A 2IWGA 1YEJH 1U93B 4HIXL 4ODXA 1ETZB 3VXRD 3DI2B 4LSVH 4MQSB 4P5RA 5AG9A 1EZUA 1TTRA 4LEOB 4EEEA 5IHLB 1IGTA 5JDSA 2RR3A 5J4MA 1RUQH 3CU7A 5BZWB 4HCGA 2IOOA 2KKQA 3N1GC 5HY9B 3ES6B 1SXBA 1U8CA 4X83A 5DURB 1JERA 3TYFB 3EH3B 3EF4A 1ETA1 3BESR 1Q9LA 2WWNA 4LRIC 5CD3A 1M71A 6FABH 2NSQA 1CYWA 1CXHA 4ZOBA 3FT0A 2CHDA 5ICYA 4IU3A 2FLBT 1S9VA 2CHZA 2XZAH 3ROLA 1JGEB 4WI6A 3FU5A 4I18B 1M7UA 4WFFD 4GO8A 3ARFB 3GDCA 5EOCH 4Y0GA 4QIRA 5F6HJ 3U0WH 4H8PA 1AXIB 5E2UH 4ZPTB 1ZVSA 4LPUA 3VFRA 3W0WB 3O3DA 2PTUA 3RY6C 4TTDD 2Q3XA 1KELL 3ZT5A 1T1XB 1ODUA 4CMHB 5B3SB 5GGTH 1UH2A 5ENWB 2XFGB 2XX0A 2ZUQC 3DVNA 1JHTA 4JHUA 3UO1L 5D4IA 2GJZA 2AJXL 4GS7C 4Q8BA 4XB7A 4MBRA 2YRLA 1HQRB 3L54A 1UT2A 1RUPL 2PWFA 3FMGL 5DQDH 2Z31C 3FO9A 5HI5D 3FYEB 1NOFA 3MOQA 1MCKA 1DLFH 3LIZA 2CIIB 3KWXA 2D7PA 4I3RH 3ARZA 1SOQA 3HIZA 1XHHA 3ATEA 2X2IA 1MCEA 4ZTOH 4ZMAT 3LDBC 2DDQH 3BUBA 5IW1A 2EDQA 2PCFA 4N5ED 3OLDA 3ZX1A 4W6YB 1UJ3A 4B3VA 4NQEA 3L13A 1BMZA 4XP4L 3EYQC 1AGCA 5LWYL 1Q38A 2DMHA 4FHKA 4DVRH 4LHUD 1LL1A 3MSPA 3GJEB 1Z3RA 5EZLB 4JFYA 5E2JA 4ZMXA 5AOIA 4HEPG 2HG5A 5DD3L 3PQYD 3R7RA 2B4CL 1OK8A 3QR1A 1S8DB 3MLWL 5IHUL 2WZPD 4GW5A 5CCHE 2J7LA 3PREA 1HCVA 3U7WL 3ARGD 3CSGA 3L3JA 4YFDB 2KI6A 1UOKA 5D96C 5EORH 5IMKA 4D9QD 3RBSA 4XCNB 3MLTB 3P3UA 2VM4A 5K5YA 1D7BA 4X7SH 3LB6D 5FB8A 1KFAH 3FU7A 1AQHA 1P4IH 4DUXA 5DJDA 4NQSB 4HKBA 1LILA 1ASPA 1QZ1A 3DV6B 1JNHA 4NBXB 3F83A 4W9GC 3EFOB 4H2CA 4DQOL 2YGPA 3P11L 3RUGE 1XR9B 1DZBA 1B0RB 5HGAB 3FFCB 1FH2A 4N20A 1NBVH 4XO4A 5JXAH 3JWNC 4HH8A 2DYRB 4Q9RH 1X6NA 5EOTA 4S11A 2Z0UA 3CXHK 3NCBB 1F58L 2F74A 3O6ML 1N4XH 3QC5X 3T1FA 1KPUA 2K8MA 3K8KA 5HHXH 1D5RA 1D5MB 2WAQA 2B1OA 1X44A 2EE0A 4OV5B 3BKJH 4IK6A 3FSZA 1X7TA 5B21A 3WNKA 3WTSA 4LSRL 5C07D 1MW3A 1W8NA 4ZSOA 3VD7A 1EERB 3ILEA 1KYFA 1S5HB 2WQUA 4HWBA 3S0PA 4ZMZA 1VGEH 3LEXB 3DGDA 2V7HB 1SJEB 3BQUA 3O0RH 4X9IA 3CK0L 1UZ8A 4V2CB 3RJDA 2AF2A 4LBEB 3ZDXB 4C56D 4FQ2L 1WS8A 4K3DH 4JGMA 4M43H 4IMKC 2O6CA 2XTJE 3ECUA 1BPLB 3D33A 3RKDC 4LOEA 4ZPVA 5TPWH 3I6SA 5I19L 3T6ZA 3QEQA 2NXYD 5T3XL 4YL4A 1RZ8B 3SKMA 4JCLA 1YSOA 4JFSA 1UGNA 1NCWH 5LJYH 1LE9A 3QRGL 3LQAC 2UZXB 3K72B 5SX5K 1GGCL 5DHMC 5DEZA 3RVVC 4UT9A 3MJ9L 3RG1C 2F58L 1ZTXH 5F7BA 1A6VH 3HMWH 4NQDD 5CJ8A 5KZCD 1ADWA 3MXWH 2XSKA 3IE9A 1P7BA 3K2MC 3U0PB 2VXUH 3D50A 5ISZD 1NGPL 2VO5A 2OMUB 1QABA 1GPOL 1PNCA 4Y89A 3BRDA 3IFPB 3LN9A 2PR9A 3D39D 3I3BA 1KGIA 4ELMB 1NGYA 5CD5C 1PZCA 1BZ7A 1KCRL 4G9FA 2FD6H 1G0YR 4YSUA 1DVUA 1Z9SA 4PLKD 4NO3A 1CJYA 1E5CA 2QQLL 2FH6A 3V4PB 4ES9A 3BWAA 4GOSA 1RPQA 5D70H 1YMHB 1CVSC 3KPRB 2AS5M 4O5LL 2BSTB 2KZKA 2X1XR 5KVFE 5I1DB 3V6OA 4PGCB 3NSJA 1SEBB 5GGQH 4GAYB 5SWZA 1SN5A 1TYRA 2ERJC 2WJ7A 2C3WA 3MNZA 3DYPA 3NCJL 2CCVA 2Y7QB 4O9HL 1G7IA 5E8OA 3VWKA 2JJSC 1J05B 1N68A 4KQ4L 1WJ3A 3ZO0A 1GZQB 1NCJA 3F01A 5DJZB 1DQML 3K0YA 2W0PA 1DFBL 1AZUA 2DQUL 4MSWB 2IV9A 1G94A 2BNRD 3GDBA 4YXHH 1MJUL 1QLEL 3RTQC 2JH2A 1JUFA 2EDMA 4LCCA 2EXWC 1NSNH 2FIKA 4NNXB 1U3HB 1T20B 1VPOL 5BS0A 1X5AA 1JCVA 1LK2B 4MMZB 1A64A 1A9VA 2UWEF 2BP3A 1X5ZA 1G6RA 2W60B 3MX0A 1NGWB 4J8RB 1EPFA 1I8AA 4W4OC 2J8UB 4NC2B 5HHOA 1OPOA 4HFUH 4I5BB 1CGWA 1TQUA 1MZYA 2LFGA 4GRLD 4Y5XA 4Y2DA 1IGJB 2Z35A 5ID0A 3N9GH 4GRWB 1EDYA 4NPYA 2W9EL 2KQNA 3OHXA 3ZZSA 2VN3A 3UGEA 3WS3A 4E9VA 3TPUB 5DHXB 4ANWA 3WY4A 5CHNB 1SOKA 5BOJA 3PAUA 3AY4A 3HZMA 3O8XC 1J11A 1WH0A 1F90H 4W70A 5G4OA 2H3NB 3FBKA 1WAAA 5C0CD 1X7QB 2QTVA 2XTJC 2B7DT 1PLGH 3DO7A 3FTSA 4JEGB 3AT9A 1O0VA 1H3XA 5IVZA 1F13A 4A63A 5FCSH 5LN4A 4JM4L 3RL2A 5LXVA 2ESVA 2ZNWA 4WV1C 1B2WH 4PB0L 3ASOB 1U93A 5IY5B 3VTMA 4UNIA 5BCAA 1SDDA 1ETZA 2HKFH 2NX5E 3FQXB 1NC2B 3GB7B 4MNQB 4DVBB 4LEOA 3FONB 1LEIB 3TF7C 3WE6B 1CR9L 3B7RL 2VXQA 2ZWYA 3SIKA 5BZWA 1CG9A 3NACL 1A1MB 1RP9A 5HY9A 3ES6A 1OK0A 1JN6A 3U48A 4TKWA 3MYZA 2XXGA 4Q58C 4Q9CA 4B9IA 4DP6X 4P9HL 2CJSA 2YA0A 3WIIL 4Y4KC 1IGFL 3KWWB 1MLCB 3ROOB 1A7QL 3TP4A 3ESMA 3FFDB 1E2WA 4PWIA 4UQDA 1YECL 3MCG1 1JGEA 4KKBC 1J5OH 1J7VR 4I18A 4RH4A 3PWVB 4MAUL 3ARFA 1JF1B 2DMCA 2LR4A 4LOVA 1MFCL 3FQNB 2F7RA 2AQ1A 1PS3A 2VE6B 3KDPB 5F7AA 5CFHA 4TNWF 4HZLB 1E8ZA 1OSPL 1Q4NX 3SCMB 1IGML 4PJ7E 2AJXH 3WO4C 1JGIA 4Z7QB 3GSUB 1RUPH 4WUKH 5IBUB 3RI5K 3E80A 3VW3L 3RHWK 1XSKA 3FMGH 5ENWA 1CPUA 4JKWA 1D5BB 4NQVB 5E24E 4AZ8B 1DYZA 5EIVA 1HQRA 3BVTA 3I9AA 3TFKC 4HOMA 5GRWA 1CXEA 4A7UA 4FA6A 2WP3O 2JQMA 2HH0H 3RFZC 3GXPA 2DMGA 3T8VA 1PZ5B 2CIIA 2CLZA 4JFXB 1P4LB 5DJ2B 1U8KA 1FYTD 3EJYC 2XPGB 4OIAA 2Y2WA 3C6LD 3BPNC 2E6JA 1X9LA 5GS0L 1PZAA 2RIKA 1RAMA 3SGEI 4U1NB 1MI5B 4LAJH 4F8OA 1FZKB 2V4LA 4L2YA 4FQXB 2GEEA 4PD4K 4HEMA 4U7MA 4HCRA 3OQ3B 1OQOA 2X87A 5HVFB 3MLWH 1RULL 1WG3A 3L4XA 5GISL 5IHUH 3GJEA 3ZRFC 1WSST 2KH2B 3LXBA 1FO0H 4ZYKB 4LSSL 4KK6C 3U7WH 2J1ZA 2R23B 1I1FB 1DUZB 4MNGB 2HMID 4LDLB 2A74C 3D7PA 1SY6L 4JFHE 3GT6A 4YHIB 3WGVB 2OJEB 3QCUL 3D3VE 1BAFL 5KBLA 1MCJA 2NY6C 2UX6A 2AK4E 3HS8A 4C59B 4XMPH 2UYLB 1OTUD 4XCNA 3MLTA 4H20L 2HP4A 4A39A 4DQOH 3P11H 4AITA 4OLXL 5KYUB 1GA2A 1WWWX 3AB0C 5B3JF 4NQSA 5FA4B 2PTTB 1RU9L 3SODB 1AZNA 1Y18B 3DV6A 5JPMA 3KLDA 1TO5A 2ZT9C 1F58H 3LPFA 4FNSA 4JBSA 4B5EA 4QRRA 5F8QC 2JELL 3EDFA 4WGKA 4NPJA 1A6PA 5HGAA 1RHFA 3FFCA 2C7UB 2KUTA 1IZKA 2HSIA 5IB2B 3LZLA 2L4OA 1XF5B 3KR3L 1KB5B 2YPVL 1A7PH 1DLHB 3G5ZA 4GKLA 4HKJB 2DWXA 4I0PD 2KHAA 4N28A 4LSRH 1XDTT 5IJKC 1EFXB 1D5MA 7CGTA 3GLAA 3QEHB 5HYIA 3QQ9C 4FL4B 4E9YA 4OV5A 4QD2E 1PCXA 3QW9A 4QOKD 3BO8A 4UOW0 1AHWB 2VMDA 3QI9B 5DEGB 2IVFC 3CFUA 2CJUL 3CK0H 3P1VA 3QDMA 4JDVB 2APXA 4EQ2A 3MLSL 4FQ2H 3CJJA 1S5HA 2FJFB 2ZXCA 3EJJX 4ZMQA 4LSDA 12E8L 5E8PB 3LEXA 4Z77A 5J0BA 1OAYL 2NY1B 2V7HA 4KH9A 4N2BA 1LD9B 1K3IA 3APCA 2B0SH 3B8SA 4LBEA 2M83A 3DHMA 4JB9L 4K3HA 4GKSA 4P5KB 2IAMB 4Q4EA 1RURL 5FYJE 3O4LD 3C5ZD 2MTAA 5DT1L 5E94B 5EZOL 4FYSA 1QX1A 3LEVL 1A6UL 1RZ8A 3DA0A 4LIQE 4JKLA 2UZXA 3K72A 3VNYA 3VCLB 4UMGA 2A6KB 5F1OB 4ZAKD 1ITBB 1GPOH 2QVTA 3WELA 4BXSV 4G80B 2EVGA 1FV1B 4FNPA 1F97A 1YEWA 3MJ7B 4RFOH 2AEOA 3U0PA 4PWGA 1G1YA 1DVFD 2H0PA 2YJQA 2QQLH 2Y6TE 3IFPA 5DZPA 4ELMA 1A9EB 5ANHA 3WD5H 2QLYA 3IDYC 2IDCA 4Y88A 4O5LH 4KUZL 2DWSA 3IK2A 3SQBB 2N7AA 4OCRL 3V4PA 3L4CA 1A14L 1XIWA 1XH3B 3GS7A 1L6XA 3Q44A 2E75C 1YMHA 1G9EA 3KPRA 3CZEA 2BSTA 3ECWA 2ZICA 4FLHA 4L3EB 4MAZA 4O9HH 1V27A 4PGCA 4BHUA 4A04A 1SEBA 1VFBB 3BT0A 4GAYA 4ETQB 4P07A 1G7JB 4TL5A 4U3XA 3BPLC 3DJZA 3L3KB 3DX3A 3PY9A 1VEPA 2DQGL 1DFBH 3OLGA 5B1JC 2Y7QA 5I1HL 1HS6A 3VWJD 2DQUH 1MXDA 2H2SD 4GG6E 4OLZL 1MJUH 1QLEH 2Z92B 1KPRB 1J05A 1GZQA 5DJZA 3LZFH 5L7XL 2FGWH 3GIZH 4V11A 3WEAA 3MGTB 2EDEA 4AVJA 4B9JA 4TLSA 1VPOH 4NJ9L 3UTPD 5KBNC 5F9AC 3MKKA 3FTVA 3MV9B 1T0MB 4P23B 1Z9OA 4NNXA 1MHPL 4PIRF 1I75A 1LK2A 2FWUA 4MMZA 4JY6B 1LP9E 4GMSL 2W60A 1NGWA 2W9EH 5CJQL 1D6EB 4J8RA 4WJ5B 5EIQA 1ECZA 4D3CH 2J8UA 3QWNA 4I5BA 3O41B 4NZDA 3GTTA 3O2DA 1FFQA 3TT3L 1IGJA 1AJ7H 1NGQL 4UTBA 4LVNB 2HCZX 4YFLF 4APQB 2F6AA 5E7BA 3TPUA 2OI9B 3H3KA 5CHNA 2KERA 1S7UB 2V33A 4AUJA 5D7KD 2CK2A 2H3NA 1JWMA 3VI4E 1J10A 1SJMA 1KB9J 1IKNA 3HG4A 1MDAA 4DKFL 4PRHE 3WIHA 4KHXL 4U1GC 4PB0H 4OUOA 1IC4L 3U1SL 2P42B 2PWHA 3MRCB 4YGAB 5E6RB 1IILE 5GZOC 4Q6IC 4GLRI 2AC0A 1ZXQA 2W9LA 2L7UA 1I31A 2EE6A 4RNRB 4I4WA 3ILQD 4MJ5B 4GI6A 3JVGA 1CR9H 1C8PA 4Z3FA 4OJYA 4NO5A 3Q0HA 2JLPA 3EBIA 3VVVA 3IWVA 3CIQA 3IGUA 3FQXA 1NC2A 3GB7A 4MNQA 4WZ9A 4XMUA 3SEPA 3QPXL 4DVBA 1LEIA 3FONA 4P9HH 3PABB 3WE6A 3WIIH 3BZFB 1IGFH 1LO5B 2EXYD 3FCUB 1A7QH 4JY5L 5CGMA 4ZX6A 3WEMA 2CO7B 1YECH 5SWSE 4MAUH 4P2AA 1N8ZB 1MLCA 3ROOA 5I6KA 1MFCH 2CA3A 4K71C 3TV8A 4PGJA 3FFDA 1B3IA 1HSBB 1UFGA 1OSPH 3H4FA 3PFUA 4XMWA 1KXQE 3GPSA 3MRFB 1JZ5A 2R4SL 3PWVA 4JJHA 1A7BA 2QZQA 1BYPA 1JF1A 4FMKA 2AXHA 2VE6A 4YEFA 3VW3H 2YWZA 2VR5A 4HZLA 1RZ7L 3MGAA 3IXAB 3SCMA 5EEZA 1AAJA 4AL8L 3M46A 1S46A 2FECL 3DNKA 4ELKB 1OLLA 4CMMB 4NQVA 1D5BA 3EHBD 4AZ8A 1TTAA 3HKZA 3PWNB 4J28A 3C9NB 2QELA 3DKHA 4JFFE 5HVWA 3FTZA 4IS6B 5FO9B 2ZUQB 1BA9A 4YPGB 3WKYA 4CU7A 1GAFL 2M2DA 2WNXA 5IKCB 1UM4L 1KY7A 4Z5RB 1S7SB 2P5EB 4FI8A 4JFXA 1P4LA 4DK6A 5DJ2A 2R8SL 3IJ7A 2XPGA 3UTSE 2Z31B 5B38G 4FMFA 4YGVB 2P5WD 1RQ5A 2IQ9L 2GJ6E 3II1A 1RULH 2GT9A 4U1NA 1MI5A 5GISH 1FZKA 4FQXA 2J72A 4L4VE 1IFHL 1ZJAA 5GGRY 3QFDB 2DEXX 3U7YL 4LP5A 4P2RE 2WLIB 4LLYB 3K8LA 1LMKA 2WUBL 2I32A 3ZOAA 3U79A 1KYOK 2FB4L 3CZFB 1WHPA 2MOGA 4DP1X 4R3SA 3SQRA 3O0LA 5SV3A 2O5YL 1SY6H 1YY8A 3GS0A 1MWAL 3L9EA 4ZYKA 4XTRC 3QCUH 5FYLL 1BCIA 1BAFH 2VISA 5C7XL 2R23A 1I1FA 1IAKB 2F1EA 1AXTL 1HOEA 15C8L 4S0HA 2VGLM 5DHVB 3QUML 1ILSA 2CO1A 3ABKB 1WAAF 4K4KA 4YHIA 1QSEE 4JFEB 4HX1B 2OJEA 3H7BB 1KTBA 4URTB 4PJIB 4G2AA 2ZKWA 1P7QB 2UYLA 3MDJA 1CBVH 2JELH 5J89A 5F7LB 3BWUC 1T6WA 2OQJB 1MFVA 4LEXL 4KZ0A 3D2UD 4LASL 5D96B 5FA4A 3DC0A 3MRKB 5J3HD 1GJUA 1GKEA 1Y18A 2YPVH 5CGYC 5AW8B 3S96B 3DDFA 5T3ZL 1OGAB 4ZUTA 2C7UA 4PMFA 3NZ8B 5IB2A 1XF5A 3FOMA 1KB5A 1DLHA 5AVZB 2G9KA 4HKJA 1PNDA 2KPNA 3OWRA 4NIYE 1ZLEA 4NPKA 3MLSH 3RNKB 5D55A 3F8UB 1D5ZB 3QEHA 12E8H 1MQKL 1X9UA 4QRAA 1A4CA 5DEGA 2KPWA 1HXKA 2JCCE 3QI9A 2QQQA 3P2DA 4JDVA 4KMTL 4M5ZL 2WZ5A 5IIEB 4JB9H 3ZKQD 4TNVF 5EU7E 2ZXEB 2FJFA 1RURH 3RB5A 2L7JA 3DV4B 2CO3A 5E8PA 3QDGD 5INDB 5BQDA 5EZOH 4X7FC 3LEVH 5BV7C 1MZZA 2XWBA 2QJDA 2XWJB 4WGVB 2ZZUT 4L1SA 2QPDB 3JZYA 5ALCH 3JSSA 4OFYD 1E3FA 2IAMA 2WANA 4Y19A 4HH9B 1XL6A 3X1GA 4QXGL 1PQZB 3MN8A 4XNAA 5E94A 1NPUA 1QASA 2VDKL 2YUXA 3PP4L 4H0IA 2QSTA 3ET9F 3PWLB 1YA5A 2A6KA 2Y7MA 3K4ZA 1XV8A 3NESA 3GRWL 2B20A 4G80A 4WHDA 1FV1A 4FJZA 4ZFFB 3MFGB 1FL5B 3MJ7A 4FN0A 1G9MC 4FE9A 4FHBD 4MA3A 4OCRH 4RRPM 4ZOCA 1ZHBB 4JRWA 5ILTH 1A14H 4ZFZB 3SYAA 4BFGA 4PRID 3VVWA 2I69A 4U6HB 2KQMA 3QUXC 2IG2L 3SQBA 3DX7B 1EHXA 4Z3GA 3V55A 1AHMA 1NCGA 1OAKH 3X12B 3DUHA 2VZTA 1DQDL 1E2VA 3SPCA 2KZWA 1SHSA 1XH3A 5B3NA 5C86A 4WO4C 4B97A 2DM2A 2YOCA 2FGZA 3BKCL 5BQ7B 1I8KB 5MEND 2DQGH 4L3EA 1E4HA 1N26A 3RVTD 1RMFL 3QGVA 4BFKA 1PY0A 4ODSL 4OLZH 4XOBA 2HAZA 1ZVHA 3VB8A 4ETQA 2X4PB 5C0IB 1CICD 3T3MF 1G7JA 2Y36H 4KJPC 3L3KA 4OJDH 3AGWA 5L7XH 4RZKA 3LHPL 3RWIB 1XGQB 2CUMA 2DI7A 1DQIA 4JMNA 1O75A 4NJ9H 3HI6H 4DNLA 2HT4C 1KPRA 2ERJB 2Z92A 1EJOH 2X53A 4J3OD 4WHTA 5I82A 1SLWA 4L5FL 2K7QA 2BH0A 2NOYA 3L95A 3OKMA 3DIVA 1MHPH 1ZXKA 1XTMA 2A73B 4AMXA 4QLRA 1D7FA 4XMZA 5FFLA 5J56B 4PCYA 3H9SD 1T0MA 4PV8B 4P23A 5CJQH 4QRPD 3VFOB 5HPMA 5GGVL 5TF1L 4PY8I 4TQPA 2HKHH 2ENYA 3RUGB 4JY6A 1FFOB 3CX5K 5DZLA 5FS5A 4XHJD 3GJFB 3AS3A 1D6EA 4B9PA 3LKNB 1JRHL 4R90L 3P0GB 3O41A 3MGOB 4EMZA 1EGJH 1FHNA 4Q2ZA 5AAMA 1AMYA 4JQIA 2W0FB 2E76C 3ESPA 5EU7C 3MUUA 4YXLL 3J2PA 3X1NA 4DKFH 2NQ3A 2WO3B 3L5HA 1TEGA 4YHPB 4KHXH 5ERWB 1S7UA 3U1SH 1IC4H 3ZRCC 2FH8A 4X80L 2AKRB 2WNWA 3S36X 5FW7A 4CA4A 4B7LA 4G5ZL 2AAAA 4OF0A 2EEFA 5IUSA 1VZHA 5AW7B 3HE7D 2HWZL 3B3IB 4MRBA 5I30L 4FABL 4RLDA 3MA9L 3MRCA 2F8IA 5JOFB 1XAUA 1CFVL 3D48R 2O5NA 4YAQB 3ZHLA 2XTJB 2D4DA 2ZUSA 3I75B 3N1FC 4RNRA 5GPRA 3RWFB 4MJ5A 5IR1B 5JPNC 2ZUUA 4KGLA 1KN4L 4K9JA 5TE4L 2IALB 1CXFA 1ZJBA 1O7VA 2Y72A 4TYUA 1T80A 2Y7OA 2J8OA 4KUCF 4WV1B 5BRZD 5EEWA 3W0WD 5K59F 3PABA 3BZFA 1LO5A 1OPGL 3ZPDA 3DOHA 5DHYB 3TO4C 5BRPA 2I26N 4H8WH 4HJTA 3SHSA 2CO7A 2OMVB 3FTYA 1FGNL 1ZK5A 2RALA 2R4SH 1OARL 3D85A 1R75A 1L3NA 1HJBC 5AVRB 3O6KL 1UH4A 2CD0A 4R4FL 1E8WA 3BYYA 2G3ZA 2ZCHL 2VXSL 3RVWC 1HSBA 2AAVA 4LRIA 5E2TH 1RZ7H 1ZMYA 2X6AA 3MRFA 4PWFA 3WXWL 2J8HA 4Y4KB 5ICXB 5BOPA 1V54B 3UH8A 3CFIC 4XODA 3EADA 4LK4A 5INCA 3BAYA 1I85C 2BZCA 3O3BB 3QFJE 4NUGL 3HJ0A 1JHLL 1KNOB 3F6LA 5BW7C 5MHSD 3O11A 1SOXA 3HG5A 4CJ1A 3IXAA 4P04A 2L04A 3RRQA 1KLGB 1A1NB 4PAZA 4ELKA 5D93C 2DQ6A 1GAFH 5HYSA 4HC1A 3RY6A 4NDMB 2DBLL 4UAOC 3WO4B 2YUZA 4UM9B 2QVKA 2B1HL 3FU9A 1CLVA 3PWNA 3C9NA 4WHYH 3IJEB 1BVOA 2X10A 3MNMA 3QNXA 2AXWA 4IS6A 5FO9A 3HBQA 2NUPB 1L0PA 4YPGA 5IKCA 1LO4H 2IQ9H 4PJBF 1ID2A 2NZ9D 3VRJB 3V10A 1CDYA 2IMNA 3CPUA 1MHHB 3B9EA 3NUKA 4OBSA 1IFHH 4RVBA 4DO5A 4KRNA 1TZHB 3U7YH 2Z31A 4HJGA 4YGVA 1IAIH 3RFZB 3AG4B 2OSLB 2FB4H 4Y9FA 4QHMA 2V2WB 2BIIA 3JXAA 1HQ4B 1T4KB 3QFDA 2YAEA 3SDAD 2J8UF 4ZMTA 2WLIA 1MJ8L 3IMBA 4IBWA 5C7XH 3RGVD 4BELD 4L9LC 3TJHD 3CZFA 3L5JA 3TIEB 4S0SD 5D2LE 5HJDA 4AM0B 3QUMH 2XETA 4PG9B 4EXPX 1ZLVH 2YUVA 4GQPH 5FYKD 1IAKA 4BCZA 5HI3D 3QE5A 4W81A 4TSCL 3V7AE 3BWSA 1JF6A 3NH7L 5DHVA 4C58B 4BD4A 1NCCL 2J88L 4JFEA 1BD2A 3H7BA 4LASH 2X4TA 1E5BA 3EBGA 4N25A 4PJIA 2J71A 2EEAA 1P7QA 2A74B 2LU5A 2BXYA 5T3ZH 2OQJA 4HOWA 2NY6B 5MP6L 2YPLA 1AQDB 1DJZA 3MRKA 3S96A 4HULB 5I1EL 1E9OB 3TV3L 2ZOTA 4KV5F 5EB9A 4OJCA 3AB0B 1WAPA 3HZ3A 1OGAA 2YRBA 1PZBA 3MBXL 3JWOC 4EXKA 4F8TA 1THAA 3GHEL 2AQ3A 2NX5B 4HCFA 1QFWL 5KTEH 2QADC 5AB2A 1R5WB 2NY2D 3KM2A 1UXLA 4KMTH 4HS3B 3RNKA 4YDJB 2JKJA 2VMFA 2ALWA 1D5ZA 1Z0NA 2X9YA 3B2PA 4HZ1A 4OF3A 4HUUB 4AV5A 3BZ4B 1NA8A 4P2OD 5DD5H 3UJIL 5FA3B 5EN3A 1UACL 5IIEA 2VC2B 3FB6B 2P24B 2EAEA 3QS2A 4L4TD 3LNEA 3ZMRA 3U2JA 3DV4A 2JXMA 4KTGA 5INDA 5TGBB 3SDXF 4X5WB 4XAWL 1TKWB 5BXFA 4TVPL 2VDKH 1Z5HA 4P57B 1DN0B 3KL5A 3BIAX 4NFCA 1PY4A 3E9TA 3RVXC 3UTQB 3GTNA 1KIRB 5D7LD 3SD5A 4AJ0A 4BSVB 3GRWH 1PD0A 1PQZA 4Z7QF 4G8GE 1U8PB 4ZFQA 4BK5A 4AG4H 3RZCD 4PJ7B 5EOCJ 4IMKA 3KPSA 3PWLA 4GUQA 5IGXL 1EXGA 4Y4FB 1UFUA 4HLEA 4QF1B 3WDIA 1A7OL 2ZKXA 1NL0L 4TL4A 1KWGA 4XN8A 1HH9A 2EE3A 3BC9A 4ZFFA 2YPKB 4CAGA 1JIBA 4N86A 4JM2D 3JV0A 3LHAA 1VZGA 4P3CL 2WTRB 3UAEA 1RUAL 4K55A 1DQDH 2DQIL 4G3YL 4KDTC 4LESA 3KAAA 3P9WB 4JAMA 5DUBB 1T21B 3GLZA 4PRPE 4U6HA 3BKCH 4PLOB 3QNFA 4K7PL 4WFHE 3PGFL 4KY2A 1RMFH 3MLPA 1JS4A 3NSCA 4NQTA 1U95A 3IDYB 3DO4A 5DI8A 1S9KC 3GSWA 5D7EA 3UAJC 2WCSA 1I8KA 5BQ7A 3A47A 5T1JA 3LHPH 4HU8A 3MV8E 2UY7B 3PL6C 5EU6E 4KHTL 1NMAL 2W65B 1PU0A 1HL9A 3QWOB 2X4PA 5C0IA 1NDTA 4PCTA 4L5FH 1ROWA 3OGCA 4JKMA 3F5WB 4ZOEA 3RWIA 1KWKA 2YXMA 1XGQA 3P3YA 3DX9B 3F12B 4UTAA 8CGTA 1JL8A 2XOTA 1OD7A 2EVJA 3BPLB 4B95C 3OGOE 1LO2L 1KEML 1TQWA 4ZS6C 1PG7X 4I77H 3DARA 3BW9A 2H32H 2JJSA 3D3VB 4WLCA 4DGUA 3TGXA 5GGVH 2AK4B 5TF1H 1N59B 4HPYL 1FE8H 3WFCL 2YRPA 2RQ8A 3L4YA 3QDHA 3SDDD 4PV8A 3V0AC 1SRDA 4PJ5D 4ZX4A 2H2PC 1EQWA 3VFOA 1JRHH 4R90H 4GXUN 5E9DD 2ISDA 4PS3A 1FFOA 3WHE1 3KPQA 3GRBA 4IRJB 2HRLA 5E1QA 2X70A 2EVIA 2D0FA 1EJ6A 2WZAA 3GJFA 2DL2A 2HTLD 3F7YB 4IOFC 3W1ZA 3J07A 3QCTH 4ZUVA 3LKNA 4YXLH 5F1NA 2XIBA 1VEOA 3MGOA 4EN3C 3VSTA 4ZDHB 2V9TA 4Y16D 2F53D 3W57A 4W4OA 2H45A 4QRFA 2W0FA 3MZGB 4DAGH 4OM0L 2FJGB 1XGYH 4U4BA 4YHPA 2MCAA 5ERWA 5LAXB 2HRHA 5I30H 2BZ7A 4WI5A 2P80A 3UACA 4FABH 2VDQH 5B7MA 4YC2B 4L0ZA 2AKRA 1SXNA 3RZWA 2X4UB 3RFRA 4WWID 3AXLB 1W2KT 1JZEA 1RH8A 1B88A 4HIEB 5TE4H 1KN4H 1WYJA 1CGUA 5JOFA 4YAQA 2C3XA 3QK0A 4P46C 3IE4A 2MQ3A 1IGYB 3I75A 1RIVH 3PRZA 1DJGA 2K3HA 3D18B 4U1GB 3RWFA 5IR1A 1KFGA 1ZWIB 4LPVA 3PE9A 1OPGH 3IMUA 1YNKL 3HFFA 2IALA 3QXAA 4Q6IB 3AG2B 3FSAA 1F8TH 2Y1ZA 2FK9A 4QHLA 2ZCKL 2BW4A 3NG5A 4WV1A 1FGNH 4YSAA 1NCOA 1OARH 4OZHF 1PZUB 2XWTB 3O6KH 3VYPA 2TRHA 4R4FH 5DHYA 1X4ZA 1AY1L 3S4SG 1EXUB 2ZCHH 3APMA 2VXSH 1KG0B 4TQEH 1OP3H 3BPCB 4MMYB 2K4AA 3EJZD 2PXYC 2OMVA 1M2OA 2YRZA 2NLJA 2WKLA 4N90D 3V4UL 1C08A 4NUGH 4XE5B 5FO7B 5K69A 1C8QA 1YEFH 3MJ9A 2MCMA 3WO3B 3D51A 2GB2A 2YQGA 2PCXA 4IKIA 4Y4KA 3QORC 4K71B 1OAZL 3S5LG 3SD2A 5C2BL 3O3BA 3OKYA 3CFEA 3TVMB 3ZE1E 4ZXBD 2XZQL 4I48B 2OK0L 2X89D 3TA3C 5DVPA 4JO2L 4BZ2A 1YPZF 2B1HH 4OZFG 3T2OA 1ZV2A 1KLGA 4NGHH 2PP7A 2ZG1A 1A4AA 4LMQE 1TZOA 4NDMA 1EZVX 2O6EA 4P06A 4UM9A 2XY1A 3ELAT 3T8MA 4FP8H 3IJEA 3ZDYF 3H3PL 4GG6B 4OU3A 1TZIB 4YLCA 2EZ0D 2NUPA 4Z7VF 3KPOB 4BUHA 3SO5A 4K23H 5IUCA 4OLUH 4W6XB 5DR5L 3VRJA 4F2FA 2E46A 1MHHA 1HHIB 1JJUA 1H5BC 3LH2L 1TZHA 4G7YH 1MJ8H 1G5GA 1AIFB 3RFZA 2CCLA 2OSLA 2V2WA 5CBEB 5AEAA 2CPUA 1HQ4A 1YUKB 1T4KA 1E8YA 2A7BA 4IGBD 2XVKA 1NUGA 1LP9B 2M26A 1QFPA 2IQAB 5LBSA 4B9KC 3GSQB 3TIEA 1JBJA 2AQNA 2WQVA 3UTZB 4AM0A 1MCOL 3NH7H 4HUKB 5CZVH 1J5IA 1NCCH 3EW3B 3IMRA 4B9ZA 3WU1A 1TNMA 4Z7OE 2VDMH 3DTXB 3F85A 2PWEA 2XBTA 3M1BB 3WBDA 2XKSA 4G8FB 4FZ8L 1LQBC 1AE6L 1J88A 2IAND 4WU5B 1I1YB 1CB4A 1L7TL 3VI4B 1JGVL 2A74A 4JHWH 4PS4L 5AALA 3TV3H 4AC2A 1IAMA 4XO9A 5EUOE 3NIGE 4XXCA 3W9EB 2F7PA 2EDLA 4J7RA 4PRHB 1IBGH 2R59A 5L2KA 3ETBJ 4A7GF 3V0WL 1AQDA 3TBSB 3GHEH 4GMTL 3ULVD 2IO5A 1E9OA 3BHBB 2GBAA 1QFWH 3KYNB 1TVDA 2V2TB 4RMTA 3FT1A 4U6VL 1K4DB 3PAZA 2ZIDA 4HJUA 4PTTA 3HBZA 5LN8A 2NX5A 3ULUF 2F54E 3AZUA 1R5WA 3LPOA 4YHOH 2C4XA 4HS3A 3ZK0A 4YDJA 4D7PA 1L6ZA 3BZ4A 4RGNE 3ZGIA 1VGKB 1NPNA 3FUIA 2DLIA 4JG1L 4XAWH 5FA3A 5SWSB 4DPAX 1JZIA 1P6AB 1WICA 5JR1L 3N1QC 3RWGB 3FB6A 2P24A 5D8JL 2A9AA 1AGDB 4XT1C 1BREA 5KUMA 5TGBA 3WJJC 3WUWB 3N85L 1CFQB 1TKWA 4GW4B 2QSCL 4W9EC 3L6FB 1TSHA 4O00A 3OKOB 1DN0A 2E9JA 1KJMB 1YMMD 1KIRA 4BSVA 5BV7B 1A7OH 1VAHA 4GSUA 1U8PA 2PW2B 1NL0H 1OSZB 5L9DL 4PJ7A 3D52A 2ZAGA 4UQ2B 2K45A 4WCYH 4Y4FA 1SMDA 1WA1X 4HHWA 4P3CH 4QF1A 1RUAH 3G6JF 4JGUA 3VGGA 2DQIH 4G3YH 5ESVB 2EDWA 1BFTA 5HHMD 3RIAF 2AQQA 4ZOAA 1N5AB 1NC4B 1TLKA 2YPKA 1UWEH 3C2AL 4Y9GA 4G8EB 5KJ4A 4BFBD 4MJ2A 4JFFB 3QUZC 4K7PH 1G0XA 3JV4A 1QRKA 3PGFH 5EHFA 2WTRA 3QIWA 5ETUB 3S34L 1XO8A 3SYPA 3K0WA 2IGFL 3DHJA 5DUBA 4L1HA 1T21A 3HPJB 3E1F1 1M1XB 5JZ7C 2ZWLT 1HJCA 1KCUH 4N3TA 2H6UA 3UTSB 2XA3A 5E6ID 1FLTX 3NPSC 2VR9A 2VMCA 1J8HE 4B50A 3LPPA 5A7EA 3QUXB 2GQHA 2FDBP 3NCWA 4YVUA 3CBRA 4L4VB 5DK0B 1QP1A 2CXKA 2OM5A 3MV9D 1IM9D 4P2RB 4DN3L 1P5UC 5I1LA 4AYDC 1ET7A 2UY7A 3X1FA 3UG4A 4WO4B 2W65A 4ILDA 3QWOA 3ML9A 5DRZA 4AQAB 3CXFA 4X4XB 4RESB 1HL4A 1KDJA 3REWA 1LO2H 1KEMH 1RLBA 1IT9L 3F5WA 3IDIA 2XWZA 4PBVC 3DX9A 2Z4TA 4WW2F 3F12A 4N9GA 3HG3A 2BSDA 1QFUH 2C26A 2IWKA 4QTHB 2HYMA 4R6UA 3QUYC 3PWJB 4PJIF 2OMWA 5B1JA 1ULVA 1QSEB 4UM8A 2QMJA 3U83A 3D3VA 4M7KL 3MV7D 2CQVA 4O51A 4X8GA 2AK4A 2VN6A 3A22A 1N59A 1K6QH 2VDOL 4APQD 1D7DA 5AYQA 1FORL 3T6XA 1BQRA 4HS8L 1UYWL 5JXED 2B3RA 2ICES 4DGIL 3IFNH 5F97E 2XJLA 1T2QL 1P84J 3CFJA 3OJ2C 5KYWA 1GCYA 35C8L 4M5YH 4IRJA 1DL7L 4N8CL 2E59A 1MHCB 1PDKB 3F7YA 1JZ4A 3APDA 4HMCA 2JE8A 4RGNC 1FZMB 2DPKA 2X6CA 4PH8A 3ETBF 1VENA 2YD6A 1CD1B 1KGWA 4ZDHA 2ZYIA 1L3WA 4UDUB 4AZUA 1WO2A 4IIQC 2GEQA 3ALPA 2I9LB 3SDCC 1V8HA 4FQIL 3R4RA 2JCCB 3B56A 1UM5H 1VERA 3FQRB 5CEZD 4P5TD 2ENPA 1GS8A 2X4UA 3T2NH 1UHVA 3AXLA 2QHLA 2ZP0T 5I15L 1YNKH 4HIEA 1UT1A 2AQ2A 4F2ME 4PW9A 3SGDI 1IGYA 5GSVB 1T6VN 4PP1D 3D18A 3HNVL 1ZWIA 2D2OA 4C4KO 3AACA 1CDUA 3ETTA 1AY1H 1JI1A 1TNNA 2DJ4A 4Q6IA 2CJ3A 2VXTL 3VFGL 3G6AB 4PJ8C 4YDMA 5JPNB 1AZRA 1LE5B 3AROA 4HCIA 2NZ1<