3N2JA

Azurin h117g, oxidized form
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGGSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the reactivity of different forms of azurin by flavin photoreduction.
pubmed doi rcsb
molecule keywords Azurin
molecule tags Electron transport
source organism Pseudomonas aeruginosa
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3n2jA00
2PPFA 1F56A 1UATA 1AANA 2NRDA 2P80A 4ENZA 1NICA 2IWFA 1NIBA 2FQDA 2HZHA 3IE9A 3JT2A 1ILUA 4DP7X 2XXGA 4QKTA 3UAAA 2H47C 2GSMB 4YSPA 2DYSB 4KO9A 4A2HA 2BP8A 1NTDA 3QJQB 1KBWA 5B3SB 2FQGA 1JXFA 1NWPA 3GYRA 4DP1X 2HRHA 1AZCA 4YVNA 4BWTA 2OJ1A 2PPEA 1JZEA 3WG7B 1A4BA 4YVUA 1A8ZA 4DP9X 2HXAA 2YARA 3OQRA 3AY2A 2RACA 4Q89A 5I6OA 6PAZA 3AG3B 1SF5A 2FQEA 3V9EA 3FU9A 4YSUA 2FJSA 4DP5X 2XU9A 1V55B 6PCYA 4G70B 2VM4A 5AKRA 1L9QA 4A67A 2FT6A 3EHBB 4A2FA 1E65A 4E9TA 3PLYA 3WI9A 1AG6A 4GP8B 4YSSA 4F2EA 4BDVB 1RKRA 4G72B 3U25A 4DP0X 4UAHA 2OCCB 5E9NA 5LDUA 4N4YB 4AKPA 1IKOP 1ET7A 1M56B 1SFHA 3ZX1A 3PCYA 3S3CB 2YAHA 4Q8BA 1SHXA 3NJLA 4YL4A 2BW5A 3HEIB 3NSFA 3BQVA 3NSYA 3ASNB 3OD3A 4JHVA 1N68A 1NPJA 2BP0B 1KGYE 1TU2A 2N0MA 1J9TA 4BXSV 3WKPA 1J9SA 3T9WA 2FNWA 3V9CA 2J56A 2EILB 4A2EA 3FPXA 4HIPA 4E9WA 3CDZA 4BK5C 3ABKB 2UX6A 4GP4B 4E9RA 5I6MA 2EINB 3TASA 2PCFA 4DPCX 3SBRA 1AS7A 1OCCB 3NJIA 1WAEA 5I6KA 4W9ZA 1OE1A 2A3TA 3IBOA 5I28A 1J5CA 2HRGA 1ZIBA 3PAZA 3EF4A 1RZPA 1KCWA 5TK2A 2IDTA 3NJJA 1PMYA 2VSKB 3AW5A 2I7OA 4FA7B 1DZ0A 4NB7A 3L45A 4G71B 2YAQA 3FQ2A 1OCOB 2BWIA 4DP4X 4BXVA 3SQRA 1NIFA 1ZPUA 5B1AB 1AAJA 1NIAA 5AZUA 2AANA 3FPYA 1L9OA 2XYBA 2X88A 4JKNA 1L9PA 1JZGA 1SF3A 3X1GA 4W1TA 5B7MA 1JZHA 1ZDQA 3ZBMA 3DTUB 3OMAB 3FSAA 2OV0A 3EH3B 3ZIYA 1A65A 2JXMA 2HX9A 2IAAC 1HAWA 2VW6A 1GS8A 1VLXA 4JHUA 3GDCA 1SDDB 1RZQA 2B08A 2YXWA 4A66A 4E9VA 3FSWA 3X1EA 3HB3B 2BP0A 4KO7A 2P80D 2IDQA 1ZIAA 2HLEB 2J5WA 4YSQA 2TSAA 2ZWNA 2IDUA 2B3IA 1JXDA 4M3HA 1OCZB 3QJSB 2BZ7A 2DV6A 1BYPA 4DP6X 1AS6A 1IBZA 4TXVB 3NSDA 1XB6A 3WIAA 2FTAA 3PPSA 3SBQA 3UGEA 1JOIA 1E30A 1OE3A 2UX7A 4YSAA 4K9JA 2GB2A 1YLBB 5I5MA 3ABGA 4GYBA 4HCFA 1HFUA 1KBVA 4F7KA 2FWLB 2VMJA 3ABMB 1URIA 2EIJB 2ZOOA 1CC3A 4HHWA 3KW8A 1AQ8A 1SHWA 3DIVA 1OCRB 2YAEA 1JVOA 1OOWA 3CZUB 1CURA 3OMNB 3UABA 5AFAA 2UXVA 3FS9A 3N55A 3X1FA 1EZLA 1AZUA 1WS8A 4HZ1A 1GS6X 1GSKA 5B1JC 4AKOA 2PLTA 1ZDSA 3QJUB 3EH5B 2GC7C 3S3DB 3TA4D 3TU6A 1A4AA 2FT7A 3UACA 3NJGA 1J9RA 1ID2A 2R7EB 1ETJA 1OE2A 4E9XA 4MFHA 3OM3B 2Y69B 1BAWA 2PPDA 4AKQA 2CUAA 5I6LA 1V54B 1AACA 2BW4A 2UXGA 2Y1AA 2DY2A 1BQRA 1NINA 4BWUA 1PNCA 2ZXWB 4YSRA 3NJMA 1MG3C 2AZAA 3T6VA 2GIMA 4AI7A 2QDWA 3NJHA 4FAAB 1FA4A 3AG4B 2GI0A 2VSMB 3NT0A 3UADA 3CVDA 5B7FA 5D4JA 1BXUA 3H4HA 4QLWA 4YSOA 4A68A 4CSPA 4F2FA 1M57B 5B1BB 1BEXA 2BHFA 1PLAA 2VW7A 2ZONA 3QJVB 3S8GB 4HHGA 2VW4A 3FQ1A 1PY0A 1ASQA 1SFDA 1I53A 2YXVA 2XUWA 3FQYA 3EH4B 1T5KA 2WSDA 2CBPA 3WNJA 1ET8A 1WS7A 1NZRA 1E67A 2GHZA 3OMIB 2GC4C 2XV2A 4YSTA 1IC0A 3G5WA 1V10A 3AG1B 5I26A 1AG0A 4ZK8A 1HAUA 3N2JA 3KW7A 3FT0A 4WKXA 1JVLA 1AZNA 1N70A 2X87A 3MX0B 3FSZA 3IN0A 2YQBA 1BQKA 3NP3A 1NPNA 2YAPA 2PP7A 3FYIB 4BDVA 2BP8B 1NIEA 2XVBA 3IEAA 2XX1A 4YSEA 3QJRB 2EIKB 1OF0A 4DP8X 1IUZA 5I6NA 2H5UA 1MZYA 4NAJA 3AZUA 2MTAA 3UAEA 1OV8A 2IDSA 2VM3A 1XB8A 4P5RA 4YSDA 3NSCA 1BXVA 2JKWA 3T6WA 1J5DA 1KCBA 4X4KA 1J9QA 1XMEB 2YAOA 2J57A 3S8FB 4DPBX 4BWWA 2GBAA 3X1NA 1ASOA 1KYAA 2CAKA 1GY1A 2CCWA 4GXFA 1W6WA 2XWZA 4AX3A 2DWSA 3T6ZA 4WTQA 3T71A 1GR7A 1XB3A 4GP5B 1AOZA 3H56A 1PAZA 2PPCA 1MZZA 5IY5B 2IWKA 3FSVA 2PPAA 4CSZA 4DP2X 2AZUA 3FYEB 2JFCA 2FQFA 3DKHA 5D4HA 1GY2A 5FC9A 1FWXA 5B1KA 2WO2B 5A7EA 3FU7B 1IBYA 2XV3A 8PAZA 1M9WA 4A2GA 1CYXA 1ILSA 3BVDB 2LLNA 3NYKA 3CDZB 4KO5A 2TSBA 3CVBA 2UXFA 2CALA 1PZAA 2AVFA 2QT6A 3NJNA 2HX7A 1L9RA 1SDDA 4KNUA 3NJFA 1BYOA 2IWEA 4HAKA 2BWDA 4G7QB 4AZUA 1QNIA 1PCSA 4PAZA 2CJ3A 2XV0A 1BXAA 2XLLA 2PP8A 3PXLA 2AFNA 1JZIA 9PCYA 3NP4A 2IH9A 4KOCA 4HCGA 1NWOA 1AZBA 1PF3A 1WA2X 2XX0A 3D12B 3H4FA 2HX8A 4HCIA 1QLEB 3MBWB 4G7SB 2QPDB 1ADWA 3PAVA 4A2DA 1AIZA 1B3IA 4P5SA 5I6PA 5B7EA 2PP9A 1BQ5A 1E5ZA 1ZV2A 3AG2B 1PLCA 1TKWA 5I5JA 2W8CA 4NERA 4GY4A 4EF3A 3FU8A 5B1JA 1A4CA 2PCYA 2EIMB 3CG8A 3GXUB 3ASOB 1PZBA 3TBCA 2DWTA 5I5IA 4N8UA 1W8EA 3ZDWA 1ET5A 1JXGA 4HALA 1JZFA 4DPAX 3FU7A 4E9SA 1SJMA 1A3ZA 1WA0X 1TEGA 2IH8A 2H3XC 1NDTA 1AZRA 2XXFA 3QQXA 1X9RA 3WKQA 3RYMA 2R7EA 2WO3B 1E5YA 4KNTA 3WNIA 4YSCA 1CUOA 1X9UA 4RH4A 1KV7A 1PLBA 4G7RB 3X2QB 4KOBA 3CVCA 2FT8A 1KDIA 3TBBA 7PAZA 3NJKA 1GS7A 1KDJA 1R1CA 3ABLB 4E9YA 1FFTB 1JZJA 1JERA 4M4RB 4KO6A 3SBPA 1L9SA 1WA1X 2BO0A 1AS8A 1QHQA 5ANHA 4UANA 2DYRB 2MRYA 3ERXA 2YAFA 5PCYA 4L0PB 1SNRA 2W88A 4UF7C 3JTBA 5TK4A 2BZCA 1MG2C 1NIDA 1PZCA 1DYZA 1GYCA 2VN3A 5D4IA 1CYWA 1L9TA 2J55A 5F7BA 3QPKA 2I7SA 2QPEB 1ASPA 3C75A 2Q5BA 4E9QA 5F7AA 7PCYA 5EHFA 1EHKB 2QDVA 2IDFA 2Q9OA 4PCYA 1AR1B 5PAZA 3T6XA 2E86A 1W6LA 2I85A 3PAUA 3QJTB 3X1BA 2UXTA 1RCYA 1MDAA 3IN2A 4KNSA 2YAMA 1PNDA 3S3BB 1TEFA 1GW0A
chains in the Genus database with same CATH superfamily
3MLVH 3EGDA 1MCPH 1QFUH 3KL5A 1KXQE 5IB4A 4EE2A 1X6LA 2QKIA 1AO7A 1AANA 3HB3C 5TPWH 2AXWA 4HC1A 4BEIA 4YLCA 4KJWD 3B1TA 4ZMLA 1YEGH 4FN0A 2C4FT 1ZT7B 1OZTG 1UA6H 1SXZA 3KPSD 4IBTA 4NCDA 1MWAA 4PJBB 4W9LC 5EDSA 1MXDA 5FCUL 3OX8A 4XCFL 4P8QA 1BAFH 1DO6A 4O2CB 1R5VB 1NWPA 4U1IB 3QORD 4ZUVA 3ARDA 4EKJA 2WQXA 3MFGB 1PKQA 2BNRE 4HWBA 3FCBA 2PPEA 5TF1H 1JPTH 1QOKA 3WS6C 1NOFA 2QLVB 4JPWL 1MIEL 3GMOA 1IAKB 4JN2B 1QABA 1TVBB 3TF7C 4TSBH 5DMJB 5E1AA 2WLNA 5DZVA 4WI0B 3UYRH 1BZ9B 2E74C 4JM2A 3WO4B 3MXVL 3B2VH 3BI9X 3T65B 2X6MA 3VGAC 3QEGL 3R8BB 4MWFA 1CTOA 1P1VA 4W9DC 5J6HA 1MREL 4A2FA 3RTQD 4Y19B 3RRQA 4AENB 2VGLM 2APTA 1JFQH 4GP8B 1N5AA 1LP9A 4QRTA 4PWEA 1CF1A 5T3ZL 5E9NA 2YQGA 3K46A 4N4YB 1TYEB 3L6FB 5GZNC 3BO8A 3MV9A 2AEOA 4NZTH 4N2HA 4LKCA 4XP1H 4TNGA 1KCUL 5T5FL 4BZ2H 4PU2A 2MPVA 4DUXA 1J8HA 4Y9FA 1ND0A 2AQ1A 3ASNB 1ZEAH 1XGUA 4WI9A 2CR3A 4GQ9L 3QZNA 1ZT7A 1I9RH 3T9WA 4UQ2B 3MRJB 3VXOA 5J06A 4KHXL 2EKSB 4GQZA 5IHZB 1MI5D 1LWHA 4O2CA 4PLKC 3BQUD 1BOGA 2XN9B 2YPLB 2B59B 3FPXA 3MV8D 1RJCA 2X4TB 3CN0A 4JO3L 3MOQA 1UB5B 4ATTA 1RQ5A 1V8HA 3RIAF 4OTXH 3FQWB 3AT8A 3NIGB 5JHDD 1S5IH 1NGYA 1OCCB 3GK8L 1ETB1 1MRDL 1OE1A 3DX0A 2VRQA 5I28A 2BNQB 4GPVA 4ZW3A 4N2DA 5C0EB 4FMKA 1CFSB 2VLJD 1B4TA 4WI0A 1KCWA 2H4EA 4OGXH 4X4YA 2PN5A 4MX7A 2IDTA 3ZRCC 4AQEA 1M3JA 4AC4A 1FZMA 2DQHL 3OXSA 5I8OH 3OAUH 4ESKA 3L45A 4EXKA 5AB9A 3FU0A 4QWWC 3T65A 3ZZSA 4B6ZA 2Q2LA 3G6DH 2ITCB 4KXZH 2BWIA 2WVUA 3B9VA 3KWTA 3SQRA 4KWUA 2FSEB 2E46A 5AZUA 4KVCL 2FBJH 1F90H 3TIEB 2IVFC 1KNOB 1U8CB 1L9PA 1I7RA 2YGQA 4KKLC 3HNVH 5B7MA 3GXNA 2FAUA 4RZCB 4YE4L 1WEJH 3L6FA 3EH3B 3Q8EA 3NCJH 3U7AA 4NUGH 1HINL 3CPLA 1PX4A 3M17B 1NBCA 4UTBL 5JIQA 4WI4A 1UT1A 5TQ0H 2EVIA 4HQQH 2H3NA 2V9UA 5I73B 3HAEH 5AVUB 4IRZH 3GSOB 4H2CA 2C1PB 4FTVE 2XPYA 1ZIAA 4QDGA 3ZRSA 3K71A 1P4BH 4OFQA 2E27H 3L5IA 5ISZA 4Q9RH 5IHZA 4AC2A 2X2JA 3VQLA 4F58H 5EZLB 4L23A 2B59A 2H9GB 1WUNT 3JTSB 4KHTH 2X4TA 4MVBC 4NM8H 4ZQKB 3A6CL 1PG7H 5AAMA 5I1JL 1E8XA 3T0DA 1IARB 2IAMD 2KKQA 4ORGB 5GZOA 4N0YH 4DVBA 3OKKB 1FF5A 4MD0B 2OI9B 4WUUB 2DQUH 1TNNA 5KS9E 5JQIB 1E30A 3P0GB 1JZ3A 1M3IA 1F3DH 5JUEH 4S1SH 2VMJA 3AREB 2CK2A 2DJSA 3FCSB 4D7PA 5A2CA 4XMVA 4IGBA 2OZNA 2DBLH 3HBPA 5E6YA 2YAEA 4NLAA 3WUWG 1P0SE 1K4DB 5SWZE 1K8DB 1XGRB 3Q13A 4PQXA 3WXVH 3CZUB 2X0VA 2ZUYA 4HEMA 4MCYA 3ISYA 3QULB 5LBVA 5CZXC 3TIEA 4AQZA 1WGOA 1RP9A 3WNOA 1JE6A 4RMSA 1PYWA 2ENQA 2VC2B 4PV9B 4PUBL 2IFFL 3FOLB 3M17A 2VXVL 4L9LB 5FIEA 2ICWI 3FSOA 2BSED 2YHGA 4U6VH 5IHUH 2N0KA 4O9HH 1T2QL 3VO0A 4RMTA 2F1EA 5IROD 5DC2A 2NCMA 2NR6D 4QRRD 2Y06H 3GSOA 2MMXA 1PNCA 1KTJA 3NRFA 4TPRL 5CEZE 3HC4L 1I9IL 1UEMA 1A3RH 3T1FB 3QDJB 3T6VA 1S7QA 3BKYH 1OLLA 4WHDA 1G0XA 3CFCH 3FRUB 4XNYH 4FAAB 3EJYD 1WIUA 4JFPB 1F1DA 1G9NH 5D2NE 4BA8A 3AM8C 4HF5L 3KBPA 4YHML 5HVGB 3U0WL 4AYBA 4XP5H 3OKKA 3H4HA 2H32H 3DX9A 2AEIT 1E8YA 4JDTH 4WUUA 3I74A 4P9ML 1NANI 1RJLB 4XNUH 1Z3RA 2CPCA 3OJMB 2I25N 2WZPA 3GLZA 2MNUA 3T2PA 1P4UA 2XVKA 3REVB 4YIQB 5CJ5A 2V3FA 2EIZB 3N1FC 4NS0A 4Z78B 4MJJA 2F8IA 3EF7A 5F3BA 3ZDXF 3TFKD 3CDYA 3FO2B 5EO0A 3QDMA 3FTZA 1MFAH 1XGRA 1WS7A 2Q1EA 2ZOLB 3BAIA 3VYNA 1KBGL 3FJTA 1HT6A 1ACYL 4ZQTA 1HAUA 1OAQH 5EWIH 5L6YL 1A22B 4NO5B 2BFVH 1ETZA 2YOAA 4ES9A 4DN3L 2IBBA 5K59E 3ENEA 1N70A 4OIIL 2ZF9A 5EZIL 4AGOA 2CLRB 5G5DB 1TCRB 2YQBA 1XSKA 3UTPE 1R3HB 4J3TA 3OKDB 3MCG1 1IV8A 5GGVH 2Z93B 5C08B 4AGNA 3D0AA 1EXUB 4P5MB 1EH9A 1V7NH 4ZAKC 4KKNA 4JDZA 3KPSE 2YD1A 1V5JA 1QQDA 1CIUA 2X6AA 3MLSH 3L17A 3SE9L 3R7QA 5IVXB 3L3OC 3TZVD 3QDJA 3VQ1C 3DX8B 5I6NA 3VD7A 3QRFM 4LCCC 3X3FL 4CVZA 3FU6A 1ZRUA 1MCJA 3U30C 4OFVA 5FS5A 5JA9A 4N5EC 4NKQB 5JPMB 4MAYB 1CE1H 2HG5B 1C5DB 4QYOB 2ICEB 2VDRL 4TKWA 3FRPA 4M29A 1T7YA 1S7WB 1UKTA 4JUSA 3RL1B 2YGOA 2B5IC 4NSKA 2NY0B 3F6LA 1EJOL 5EB9A 1PAMA 2NY7H 4FI7A 2DH3A 3K74B 5GQBA 3V0FA 4J1UA 4GI6A 4OCLC 5ANMA 4D0DB 2EDQA 4F8TA 3WELA 3MV9E 2CCWA 4YDVB 3K72A 2ZOLA 3LEXB 1W2KT 4ABWA 3O8XB 5HYJD 1MFCH 1S78C 2DL9A 2EUVA 3L5JA 1V7MH 4XI5C 4NN6C 3FULA 1EV2E 2KI6A 2XFGB 1H5BA 3LS4H 3UP1A 1KLUA 2JNZA 1RL1A 4MLSA 4LFHD 2E75C 4LXFA 1IEHA 1E9OB 1R3HA 4HJJH 4JRFA 3JWOC 1DO5A 3OKDA 3QEQD 2COQA 5C08A 3UROR 5B1KA 4FYQA 2DQDH 1MCSA 2XKNA 3LKPA 1Q94B 3PIQB 3BUYB 2XV3A 3GDBA 3P77B 4J6RL 4P5MA 3B8YA 4NIYE 5A7EA 3D69B 2HRLA 4TULL 4XMXA 5D8JL 2L0DA 2X2UA 1H3PH 2V9QA 1OPOA 3PWVA 4LLDB 2FX7L 3MUGB 1MI5E 5KVDE 2UXFA 3BP5A 3UTSD 4Y4KD 2A9NL 2FWSA 4PGZA 3MV8E 3DX8A 2CHXA 1MLCB 5DZJA 3TT1L 4QXGL 1NGWB 4D9RE 1A3LH 4EOWL 3HG2A 4ONOA 5JHDE 1NAKL 2DAVA 3D4YA 1ZT4B 2XV0A 5C07D 4CC1A 4WHYH 4MAYA 4U7KA 3S6CA 3UYOD 1C5DA 3PXLA 5FLUA 1D6VL 3O81A 4F15B 2VLJE 1SLXA 1KOAA 2IH9A 3FDWA 4AVKA 3U82B 3RL1A 3UZVA 1XGTA 3WNLA 1PY9A 1PF3A 4QUOA 2ZTBA 5H2BA 3VI4F 1S2EA 4EJ1C 5GRVL 1SMDA 2GBTA 3ZKQD 4ZUWA 2BRQA 1UZ6E 4YDVA 4DGVH 5KYWB 4H40A 5FYJL 5BPPA 3LEXA 1DLHA 5E1HB 3WYRA 3WFDL 3F62A 4JKMA 4RGMC 1WFTA 1EEYA 1Y0LA 2C7FA 3EDEA 3P4MA 4M7JH 3ZR6A 4BSWB 5I75C 3BFQG 3PWUB 2CDGB 3VMOA 3UOAB 3RGBA 1G1CA 3DROA 1E9OA 4JPVL 5D1ZC 1PEZA 5I15H 5ISZE 1JHKL 4P9HC 1G7JB 4PRNA 5DWPA 1A3QA 1N59B 4LHUB 1FAKT 1V27A 3D69A 5EF0A 3QR2A 2DQJL 4W93A 3CFMA 3FW6A 1N0LB 4GW4B 1A5FH 2YD3A 1GGCL 2OMBA 3MUGA 3WKQA 4LVHC 2OBGA 1VENA 4EPSA 1E5YA 2JI3A 2VR9A 2DLGA 1IT9L 1MLCA 4KOBA 2WKOF 1M1XA 3CVCA 3DX6B 1KDIA 2VDLH 3IE4A 1GS7A 2FNBA 2WBJB 1KDJA 3QG7H 3TBYB 1BQSA 4BUHA 1DN0B 4FMVA 5DDHB 2VZ1A 3SZ6A 3ZKSD 4Z7QE 2R83A 2K45A 4PJ7F 3STLB 4H8WC 3C60B 3AXLB 1FV1A 3SE4C 4UF7C 5CFHA 3MJ9L 3UG3A 4OQTH 4PREB 4WV1B 5I1GL 2R9HC 4BFIB 4XNMB 3Q2LA 1X7QA 5EO1B 1OAYL 3GTNA 3QJFB 4JO5A 1NC2A 2J55A 4GMTL 3FFCB 5EC2A 3V6OC 2I7SA 4I3RL 3C75A 4TM9A 4WHTA 3RIFK 1I7ZB 1Q1JH 3S2CA 1B88A 1C12B 1MJJB 2V17H 4YDKH 4KX8A 2WBXA 3U7YL 3PWUA 2CDGA 2YD7A 1GC1H 4IDJH 4LLAA 1ODAA 4OZHB 1H15A 2ROYA 4P4RB 1G7JA 4L8SB 3ZE2E 4LHUA 4FFVC 4LCYB 5IM7B 2AJVL 3EJRA 7FABL 4ZS6C 5MEND 2RQEA 4XP6L 1N0LA 1KEMH 1S46A 3SGKA 1QSED 2E9WA 2FEDD 3OKOB 5CSGA 3IJSB 3KYOA 5EOCH 2WXFA 3AU0A 1SY6A 5D5MB 5H8DA 3DX6A 1E6OL 2QPSA 4N2AA 4YGAB 5D1QA 1TTGA 4XXCC 3WTSA 4TNWK 1DJSA 3SKNB 3EOTL 3ZUCA 1W0YT 1CYGA 3ILPB 3STLA 5CEZH 3RX9A 5CJ8A 4HWEH 3EBIA 3AXLA 1JJUA 1OSPH 1CLYH 4YHIB 4EIZC 3REWB 4AM0B 4BFIA 1BVNT 4XNMA 4BCYA 5FKPA 1TLKA 1WQVT 3QJFA 4GKZB 1A0QH 2AXGB 3FU9A 5D2LB 1RLWA 4Y2LA 1EO7A 1BG1A 1HCVA 1I82A 4R96B 4TUKH 2BLFA 1EWHA 1Q0XL 4OLYH 3GBMH 3TPUA 1JS4A 2I60L 4ODVH 5JMOC 2P8LB 4MMXB 3ABZA 2EDKA 4L2YA 5AKRA 5DXWA 5TDPB 5CINH 3Q5TA 4EDXB 5FW7A 2L7QA 1QNZH 2MIZA 3BVTA 3WO4C 2QTVA 1I1FA 4UDTB 4R5VA 5DUPL 4F2EA 3LEVL 3PDOB 3MRDA 4IKIA 1NANH 4K2UL 2IV9A 3FT2A 4ILDA 4JGNA 5FM8A 1EQWA 3PHQA 4FQXB 5DVNA 3VXMB 3BKCL 1JGDB 2ZG3A 3SPHA 15C8L 3V5KB 3EOAA 1Q72L 1QBML 2D31B 2OX5B 4QRQB 1SEQH 3OD3A 1J11A 2K9FB 4TUOB 4A6YL 4Z0BL 2AGJH 2GJ6B 3I84A 3IJSA 4GRWE 4OT1L 1EUTA 1A6ZB 4LGRB 1KN4L 4G6AC 4BXSV 2DTMH 4U1JA 1VKXB 3D09A 4UV4L 3JWDC 4X8CA 3ZGHA 4GINA 2ZOKB 3QYMA 1D5XA 5ES4B 1D5ZB 1S6NA 3U9PH 3GI8L 1T83A 1RD6A 4OLWL 5ANME 2BVQB 4Z77A 2L7JA 2X28A 4J4PA 3NJIA 3L08A 4BHUA 5EBWB 4G1MA 1OL0A 1THCA 3PQYB 4GRMB 4WJKB 2IPTL 4H0HB 3VMNA 4KMTH 1ZIBA 3JWNG 3BEVA 1SXBA 2AEPL 4GKZA 2I9LA 5TK2A 5D2LA 4JO2L 3CDGB 2J4WH 1S7SA 2WXLA 4EZJA 4R96A 3VGGA 4OFYA 5ID1B 4NB7A 2EXWC 5JHBA 2FX9L 2HJFB 2PR4H 2I32A 4MMXA 5A6LA 2VLMD 4OZGB 1A7QL 3U36A 2WWNA 5TDPA 4TQEL 5D1XC 4XNQB 1OTUC 4EDXA 1FGVL 1T2XA 2IOIA 4NT6A 4EKXA 1LD9B 4HD5A 4KXDA 2CKBH 2C7UA 2XYBA 2JI1A 1JZGA 3MRCB 1A14H 1VEPA 3OAYK 1HXKA 3PDOA 1GOFA 1M2OA 2NSQA 1QRND 3C12A 3LMJH 5GPRA 1WFOA 2WHVA 3AWFA 3A21A 1N9PA 1XZWA 4N24A 4XBEH 1YEFL 5TDOA 3PWPB 4FQXA 4NZFA 3ZIYA 4AYSA 5A2BA 4C47A 2FEJA 1M7XA 1KN2L 5GGSY 5C92A 5LXGH 3V5KA 2BSSB 1NFAA 2OXHA 2VM9A 3HLAA 4G11A 1MCWM 2D31A 2OX5A 4GXUM 2HAZA 2AITA 5HGGS 3FSWA 2A4ZA 2EDXA 2BVTA 4O00A 4DNLA 2IDQA 3OAZK 5AVWB 2HMID 1MWOA 1VKXA 3IFOB 2XRAH 2AC0A 5JZ7D 4I8DA 3MV7D 4YSQA 2BMKB 1IFGA 5I73C 4QRPA 1JXDA 3V4VB 3SSGA 3ULUL 3LN9A 2Y3AA 4UT6A 4LSVL 1DQJA 1SN5A 3G3LA 4H13C 3SBQA 1KENH 4HUKB 3UGEA 5KVDH 3CHQA 3WFCH 3ZMNA 5EBWA 2HT3D 2QQNL 4GRMA 1YLBB 4HKXB 3QQDB 4KY2A 5IFHH 2X44D 1FLRL 2J6WA 3Q44A 2OI9C 3W5MA 4JDEA 2I07B 3CCHA 1FZKA 3ME0A 3NH7H 4NPYB 3KCPA 5HHNB 5K1VA 4LLYB 4P46B 3UDWA 3VYPA 3AREC 1ZS2A 1FFNA 1L6PA 4XNQA 4F93B 1CURA 3CZJA 1NBQA 5BOPA 2AQTA 1R0AL 3MRCA 1T4KB 3WGVB 1E4WH 1O7DC 2OKMA 1LTXA 4LSDA 4IBLT 1CZ8L 3TU6A 3UJTH 4KITB 1WD9A 4E9XA 1ETJA 5FO8A 2BINA 1RSFA 2BRRH 2PO6D 1CGTA 2Y69B 5IR1A 3M46A 4FFYL 4L9LC 4QJ4B 3TCLB 5KVFL 2FWUA 4N2LA 1VSCA 5EBMA 4LVEA 3T77B 2EE2A 4DHLA 3KDMB 3R19A 3QAZB 3GRWH 4G1EA 1GYVA 3QFJA 4GOSA 5E00A 4YUEH 1CBVL 2AEWA 3D2UD 5EU4A 3RBSA 1ZHKB 3GSUA 1UH3A 4PRPB 3EJZD 4XNAA 4DF9A 4R0LA 1P6FA 3VFGL 3N06B 1O9ZA 1R47A 3BPNB 3GPSA 3V4PH 3VRJA 1JI1A 3RDTD 4GAYB 2BHFA 4LSRH 5DQDH 2CCLA 3QJVB 4R7DA 2BHZA 3S5LB 5IJVB 4DKFH 1D7BA 4I0PB 4B3EA 1I53A 3RDTA 1HKLH 1QYGL 3TVMC 4Z23A 4NPYA 1RJYA 3A24A 4K9EC 3NBNA 5DHMC 1A6TB 1E67A 3BT2L 5TH2B 1NKRA 5MERA 2V7HA 2F7OA 3G5WA 3O4LD 4M6NL 3D48R 2JWYA 3MCLH 2GTZA 4GKLA 3FHAA 4HOZA 4JJOA 4WUKH 3J27A 3LPOA 4J3SA 2AV7A 3EGSB 1BBDH 1RZJL 2UZIL 1JFHA 3F12B 4OUUA 4ZTPL 1SHSA 3SKJL 2X3AA 1KG0B 5MENE 5HI3C 2BCMA 2R0WH 1QSEE 4MAUL 4B0MM 1BIHA 1MFBL 3BUQA 2XVBA 3IU4H 3T3ME 5IJKC 3OWEA 2Y7MA 4F8OA 3T77A 4LCIH 4WTZG 4PRHA 3KDMA 3MRNA 4NO2B 3HMWH 4C4BA 4X0KB 3BVWA 4OI9A 3CUPB 1QWHA 4PWKA 3Q8BA 4LVNB 1FNSL 4MQXD 3O45A 4RFOH 4WSKA 1UJ3A 4NKOA 4KUCF 4NWTH 5ICXB 3PFQA 1VZHA 4E41D 3DV4B 1K72A 3MUY1 4TLKA 4TLTA 2FEEL 1QHOA 4GAYA 5GGRY 4PTUA 2G9HB 4X7TA 1XMEB 1WFIA 3QB7C 2ZWSA 5JPMC 5AW5B 1ZE3H 4YDNA 3S8FB 5D7JD 2ZAIA 2WNWA 3N85L 2ICEC 4YFLI 1B0WA 3BDBA 3GD1C 2EE3A 3MSPA 2P7TB 3V0JA 4AYFB 4NNPH 4JHWL 1W6WA 2NY0C 3MHZA 1O5PA 4TL5A 5FM5M 3SDAB 3T0VA 5HYIA 3RX8A 4XHQA 3Q3GB 1UT2A 5CIPA 2ZSWA 1WHOA 2YRPA 1J1PH 4LLVB 4ZXBD 1AOZA 4FOMA 4GFTB 2CRYA 3IVKB 1LK2B 3CU1A 1I8UA 4NXSA 5ID0B 4U1GB 3Q8CA 2J6EA 3F12A 2Y0SA 3EGSA 3O8XC 4X98A 3WFBL 2OMYB 1KG0A 3OTTA 5T1MB 2CLZA 4XMUA 2FQFA 4BHUI 4O5LH 3UX9B 2W9DL 1LO4L 2JCCF 1NAMB 5EF1A 1ZA6B 4EAEA 3HS0A 1ZLWK 4CU8A 3HB3D 3NYKA 3CDZB 2OMWA 3VJ6A 3CVBA 2OTWA 4N8VA 2AQNA 4FLRA 2R2HA 1YEKL 4JKPL 2WXHA 1JNLH 1F4HA 3FH7A 4X0KA 4E5XB 2PMZA 2F54B 4AZUA 3IJ7A 3DIFA 1T1ZA 2Z7ZA 4MNGE 4NKDB 5E8OA 3EG9B 2AK4B 3JTTA 3PHSA 3T8XA 4EN2A 4ODXB 4GRWH 3SDYL 3C09B 3MLZH 4HAGA 5ITFA 1LLAA 4X5PA 3W82A 2C3WA 4G3YH 2G9HA 3PHAA 4P3CL 1DVUA 1T5WB 2OXGB 4IU3B 4F15C 4FQPA 2MQ3A 5EEYA 4GEJA 2O6FA 2MHAB 4K73A 4X6DB 2JV6A 5DJZA 2P7TA 3SPCA 1ANUA 4WY7H 4MQSB 5I0YA 4BFOA 2D4FA 3HR6A 4LOEA 1PS3A 2P8MB 2F53D 4PJIE 2DLHA 1GRWA 3B9KB 1QRNE 1WTLA 4GY4A 4P23B 3S37X 5C0IB 2XWEA 4ZYKA 5JPNB 2GT9B 1N0XL 4NC1C 1BZ7A 3D4GA 1T89A 5F8RC 3WFHA 1SHMA 2B1HH 5T1MA 5EN3A 4Z7IA 1ET5A 1JXGA 5C71A 1H8SA 1Q9LB 2FUTA 2NY3B 4QRPE 3L1OH 3ZY7A 5GZND 1MAMH 3UZEC 2WYHA 1NAMA 2G5RA 5DVLA 1WWCA 2ZPKL 1UWEL 5IB1B 2H3XC 4C83B 5B39G 2FR4B 2PYED 3MV7E 4B9YA 1QSFB 1JWMB 5FPIA 5GRVK 2DLFH 2WO3B 4Z9KB 3U79A 4TVUA 3AU1B 1XCTA 2BOBB 1KPVB 2VL5B 4JKWA 1F6LL 4OCRH 5DK0A 2F54A 4J39A 1BSIA 2VIRB 3IPBA 3RWCA 4YR6A 3ZZQA 4ZMYA 4E9YA 1VF5C 2O5XL 5IHBA 5KSAA 1YZZA 1KFAL 1S7RB 1X5YA 2DEXX 4MJ6B 4PLKD 1WA1X 4OGYH 1HS6A 4MD5A 2B1AH 2R8SL 2DYRB 5CBEA 4DO6A 2WBJC 2LFGA 3MLXL 3AQDA 2GHWB 1PJ9A 3I75B 1HZKA 4HUVA 1FH5H 2DQIH 4G6FB 1BEYH 3T09A 1QR4A 5J4MA 5CD3B 3C60C 4OZ4A 3F83A 4I7ZC 5BV7B 2QR0A 3T0EC 1GYWA 3L5XH 5HDRA 5F0JB 4WV1C 1K6QL 1CR9L 5HGAB 1IGCH 1MJUH 3BLPX 4H88H 4QWWD 4DKAA 4OD1L 4NQXA 5BUGA 5JPNA 2E47A 1SJEB 2FH8A 3INUH 3VGFA 3T6QC 5LAPA 1WG3A 2J1ZA 4KROB 3OR6A 1H3WM 1FIEA 3IN2A 3Q6GL 2IPKB 4KKLD 5KSVA 4XPBH 3AABA 2HFFB 4XVSL 2RMNA 4AE0A 1JZEA 1M2VB 3WIIL 3QT2A 3EJCA 3QARA 5IB1A 3ET9F 4FJ6A 3SZKC 4P2OB 3LZRA 4NP4H 4X6CB 2Z31C 4PGCB 2FQDA 2UUDH 4ETQB 2G3ZA 1JWMA 5SWSA 4EVNA 4L8SC 1P2CB 3AU1A 2BOBA 3DBXB 4Y16B 1V3KA 3GNML 3H3KA 5I30L 2VIRA 4F57H 1JV5B 2CJUH 4PY7B 4Q9BA 3VWJC 3BWAA 5JIHA 1JXFA 5J56B 3VD0A 3PP3H 1S7RA 3F64A 4JG5A 3IJEB 4AEIH 1DFBL 4MVBD 4LBEB 1EAQA 4NXKA 5CZVH 3TT3L 4NCC2 1OM3L 2BVOA 3IF1B 3A23A 3ZYJA 3MO1B 2H0FA 6PAZA 3BKMH 3N1GC 5DEGA 5IIEB 4HS8L 2X12A 5GISH 3V9EA 5INDB 4F92B 4G7VL 5F0LB 1KELL 3E38A 2V5SA 1KCSL 2M2DA 1X9QA 4PHZA 4XP9L 1V55B 5IQLA 5HGAA 4G70B 4ATWA 3DJZA 3QHZL 4S0HA 3MNZA 5E51A 1XVSA 1IC5H 1LK3H 1SJEA 1ZLSH 2BSCA 4Y4HA 1O5DT 1IGYA 3C2AH 2IOOA 4X5WB 5KS9F 5CZXD 3ROLB 3I3BA 2DMKA 2IPKA 1OXYA 3HNSL 5E8EB 4FZ8L 1DBML 3QG6B 5DD1L 2Y22A 1XSIA 5JXAH 1TTUA 5B8CC 3CHXA 1VFMA 1NCDL 2YKLH 3UPCA 4P2OA 1HCYA 1SBBA 3B1UA 1NCWH 3O3DB 2CZNA 2H3KA 2BC4A 1JGUL 4J3XA 3WKPA 2D4DA 4Y16A 1SY6H 4GT0A 2WO4A 4X6BB 1N7ML 3HMXH 3P54A 4E41E 3GXPA 2A9MH 2IBGA 1EGJA 3O6LL 5DURB 1XV8A 1F86A 3IJEA 3L3KA 2DMHA 5C0NC 2QGEA 5C1MB 3BMWA 4BFFA 4LBEA 4OZFB 1VAHA 2OMUB 2WC7A 1OPGH 1SUHA 2YPKB 3GLEA 4OKVB 4UQIM 3R8QA 3T0XA 5JHLA 2EH7H 5IIEA 4DGUA 3T04D 3BN9C 4UM8B 5FOJA 2VUKA 3GMLB 2QMKA 5KSBA 2W1NA 3IJYA 4FQHB 3BEWB 4J2XA 5DR5L 1I8MB 4XMKH 2XHNA 1FE8L 1ZV5A 3CSFA 5DF0A 3CSGA 4DP4X 1MRCH 3FMGH 1J5OH 3BOVA 2QLYA 3GSNB 1T1WB 1MCWW 1OLZA 1S9XB 1QW8A 3K2UH 4G9DA 3DBSA 1BGXH 2HH0L 3ROLA 4H8HA 3OMAB 2HPOA 2OSYA 3LRGA 1RSYA 3QG6A 5CLZA 1KJ3L 4KQ4H 2V2XA 3JYCA 4PRIB 1WAAE 1VACA 5J9PB 4LLQB 1G7MB 4RMBA 3KLAA 1P84J 3BHBA 3WSQL 3LXAA 5IB2A 1PSKL 3O3DA 4LPCA 2WP3O 1CD1B 4KTDL 3ZTCC 5KZCB 1Z3GH 4H8UA 3VH8G 4YH6A 4ZAKD 1I85A 3IM1A 5IJCC 4S0SD 4WSJA 3QO0B 2WLHA 4P06A 2N4IA 4X6BA 4HETA 4AEEA 3Q05A 5CJOH 4OY9A 3VFPA 2NTSP 3L16A 3FUNA 2FATH 1DBAH 3WY4A 2JTDA 5LNDA 4FXGA 3LQZB 2C9VA 4JFEB 5D6CB 5ESQB 5K59F 3DV6B 4JS7A 4F8PA 4JM4H 3DTDA 4UU9A 1CLCA 2V6HA 4PJEB 4RNRB 3FTWA 2OMUA 4N6QA 3P30L 4N5ED 3WKML 3W9DA 3HZVB 2B15A 4X9FA 2QSQA 4Z3TA 3SDXE 3GUTB 4NNXB 3DSNB 3MGTA 3VXRD 4U1SB 1X5XA 4DTGH 5C0CD 4M4RA 1I7UB 2A73B 4OJFL 4YHPB 3DO7A 1UOWA 3KW8A 3BEWA 1I8MA 1CU4L 3RVTC 3L3IB 3NIDE 1KEGH 5CS7A 4EUPB 3BP4B 1WISA 4PY8J 1QR1B 3CQQA 3DRTA 3UO1H 5I16A 1T1WA 4QJ5B 1SN2A 3KPMA 4FFZL 3X1FA 4MA7L 2EYRB 1XH2A 1S78D 1GGBH 1T22A 4P46C 4PTTA 5J1AB 4XI5D 4IK7A 3HAEG 4M43L 4MNQD 3DDFA 3S48A 3WEAA 2OULB 3ZSTA 5K9QG 4P49A 4LLQA 1G7MA 3ES6B 4HWNA 5I1EH 2BERA 5ICYA 2ATPA 3B7YA 3BAEH 3GMMA 4MFHA 2QFPA 5KW9L 4OM1H 2ALAA 3WXWH 3QWQB 5FECB 1HHHB 2BW4A 1FO0L 1OANA 3H54A 1HCZA 1NEUA 3N1PC 3OKYA 5KYXB 4NC0B 2AF2A 1U3ZA 3AAZA 4U6TA 2ZSVB 2JKJA 3QZMA 3NJHA 3HN5A 2YSSB 4G59C 4UT6H 1GIGH 3PF2A 1OWRM 4NBZB 3V8CA 3DV6A 4DQOH 4R3SB 2FWOA 1DJHA 1OAZH 4PJEA 1UD2A 4X6FA 4QLWA 1BD2D 4A68A 4FADA 3HZVA 4NZUL 2UY6B 2F7IA 1INEH 1D5BA 3BGAA 1WP6A 1S8DA 3DA0A 3WTTA 1I7UA 1AYRA 4YHPA 1QO3A 4J23A 4LRIC 5DD5L 4UT7H 2YLHA 2J7LA 3LNHA 3KPTA 1WE5A 4TNVF 4EUPA 2BY3A 3BP4A 1M05B 3CFBA 5F9DC 1QR1A 1NMAL 4I0PC 5AW7B 3FL7A 1N18A 3EBAA 3AG1B 2EYRA 2XVGA 2XI9A 3QCVH 2ZXAA 3SYQA 5SWSE 3RJQB 1DHKA 5HDBE 4KXCA 3QO1A 4XPFL 3IN0A 1HXYA 3NP3A 3NZ8B 5TQ2L 1UM5H 5BOZG 3MV01 5E6IB 3LX9A 5D1ZD 1KWGA 4IRSB 4DN4H 3N0PB 2VJ8A 4FNSA 1H0DA 4JGMA 4AUYA 1RU9H 1UZ6F 3DDGA 5JIKA 3RNQB 4ZFOL 1O6SB 1ZAGA 4RRPM 3R1GH 3TN0B 3OV6A 4P2QB 3DSFL 2ZZUT 4F2ME 2E8ZA 2NMSA 3NN8B 1LO0H 1QFWM 4UNVA 1E5CA 2HLAA 1FN4A 2C3GA 1IL1A 1BM7A 1OAUL 4R3SA 1QFWH 1WHPA 2WNXA 4B41A 3RUGE 4GUOA 4LDCA 3ESNA 1J5DA 2R0LH 3L5WB 4YK4C 3SB3A 5IVNA 4D8OA 3EW3B 4J3BA 5FM5O 4JB9H 1XXFC 2FJFA 2RBLA 3SGJA 4FHJA 1NEZB 2R9HD 1S7XB 3MLRH 2OPCA 3LZFL 1M05A 1A47A 2ZAGA 2KH2B 2QGBA 1UCBL 3H56A 5EV7A 1N10A 3FT3B 5F3HB 5GRXG 3TXAA 5JW3H 1WFUA 1Y6MR 1VZIA 2YRBA 4BRVA 2PPCA 4Z7QF 3SDAC 3LZOA 3G6AB 4EO5A 4K8RL 2R39A 4M03A 5AVRB 2DWXA 3MXWH 3R4RA 1VGKA 4J2QA 4ZFZB 2ZXBA 2DWYA 1BV8A 4XWOC 3S34H 3QIWB 3FU7B 3OAWA 1UVQB 5I1CL 4FFVD 5IJDC 1RZGA 2QZQA 1SQMA 3GBNH 4B9JA 3RNQA 1O6SA 4ZS6D 3QZLA 2O93L 4FE9A 4N0UE 3CX5K 4P2QA 2C9PA 4KZCA 1U3JA 4WO4A 1GXEA 5CGBA 4D0BA 2VLRD 3ZHNA 4L4TB 4AMKL 5B21A 3FUJA 5F1OB 2H0EA 3G6JE 1G9MC 4W9HC 4CUCA 3I9GH 5KSBE 1S4IA 2O72A 4F1SA 5BW7C 4DUVA 9PCYA 1HQRB 5IVZB 1WC7B 1ZPLA 4LARL 1P7QD 3NPZB 3ZE2F 4U49A 2YC1A 2GY5A 3VD3A 3D12B 4N1EA 5L8LB 2HX8A 2W81C 4NKMB 4Q2ZB 1I4FB 3SGEH 1KLGB 1NEZA 3C09C 3H6AA 4GO9A 4A2DA 5B22A 1JNJA 3DOSB 4XP4L 1PY4A 3CK0H 4OM0H 4RA0C 1BG9A 3BH9B 1T03L 1U33A 5DHVA 1OCWH 2HRPL 4GAAA 4PPTA 5KANI 5K69A 2W8CA 1X5AA 2JXMB 3FT3A 4WWOA 4NM4H 2Y25A 2YN5A 4X4MA 2XBDA 3DVGA 2CGRH 2C3VB 1RIVL 2J1KA 5EFIA 4MDRA 3B9KC 1P7KA 3EYFB 2FCBA 3VFWA 1OAKH 4P23C 1JV2A 4Y9EA 4DIXA 4HOWA 5CU5A 3FU7A 4HS6B 4XO4A 4Y19D 4GUCA 2XTJB 1T20B 4EI5B 3WE6B 2J25A 2QEJA 2XXFA 1XF5B 4AXWB 2D3VA 2K3HA 3RGVB 1VCBC 2NY3C 4WHYG 4I3SL 3KZ8A 1M7IA 3O2VH 4KNTA 5I0ZA 3KJ6L 2OJEA 4RH4A 4D9LL 4WFFD 1MIML 2APVA 4DFHA 4G6AD 4HUXB 5IMOB 4H20H 3V0GA 4RGNE 2QV2A 5T1KB 4EIBA 1ZTXE 4PP2A 5DWUH 3CLEL 1AHMA 2Y5TA 4GI8A 4M02A 4B9PA 1CVSC 4JPIA 2EDWA 3NA4A 1HQRA 1QHQA 2DH2A 5JQ6L 3VXRE 5C0CE 3NEEA 3GHBL 1J18A 2FECI 4JCLA 4TLUA 5E1IA 4F80A 4Z8FL 4HK0B 3MJ8A 4RBPK 2BZCA 4NKMA 2WGNB 1I4FA 1WBYA 2XN9D 2YPLD 3GSRA 3UCQA 1DYZA 1BQHA 2XNAA 4UMGA 4ZW8A 1Y07A 3PNWB 4GRWF 3RY4A 1EFXA 3CZLA 2QPEB 3LKSB 3WN5A 2PCXA 1ORSB 2P45B 1AQMA 3BH9A 4UQDA 5CUSL 2XA8L 2G2RB 3CH1A 2VDRB 2XSKA 3CLWA 1AGBB 1S7TB 2EXWD 2BNQD 4P59L 3DGCR 1E28B 2ZCLH 2GKIA 1EJ8A 4FP8L 5I8KH 5BV7C 1FFOA 3CSYB 2X1OA 4MNQE 5D1XD 2PW2B 2OMVB 1OSYA 3II1A 3RZWA 1KSRA 1OTUD 4B9FA 2C3VA 2NY1B 5C0BD 4XNDA 4TQHA 3K0YA 2NZIA 1T80A 3SQOL 1FPTL 2Q3ZA 2YAMA 4FA8A 2GTQA 5I66B 4NIKB 4I4WB 4KZEH 3OMZA 5DD6B 1L7TL 1ZHLB 3EJQA 4L5FE 1IM3B 4HS6A 1KYFA 1T20A 3VGHA 3L7FB 4ENZA 2PCPB 2JIXD 5DTFA 3TYFB 3RGVA 3PFUA 2HUEA 4PJ5A 1NUDA 4HULB 3VRLE 4GAGL 5EOQH 3KMDA 5J1TC 3I02A 3WE1A 5BQ7B 4HMCA 4E0RA 2VO5A 1BD2E 2FQGA 3BZFB 2PXYA 4PW3A 5IFJA 2BVPB 2YSTA 2Z4QB 4LDLB 4Y16C 3B2MA 1F13A 1VDGA 3SYPA 2WOBA 4TNEA 1DQVA 1KC5H 3BAWA 3OJDB 4PHXA 4U1KA 3AY4A 2L4OA 3RIKA 1JPFA 2FD6H 4Z1PA 1QFUL 5I19H 2RFXB 4ZBJA 2OMNA 1AGFB 5TPWL 4GQQA 3RDJA 1TQCB 2G2RA 2WW8A 2XU9A 3VFNB 3DVIA 1GW6A 1SVCP 5D1ZI 2FO4A 1AGCB 1UA6L 3LN4B 2WINA 4XGZB 1VB9A 4Z76B 3HZKA 5CAYB 2D7QA 1DLFH 3P9LA 3ARED 2PW2A 2OMVA 2D8KA 1BAFL 1L7IH 2TRYA 1RKRA 3HZMA 1ZD6A 4MHHI 4N2CA 4CVXB 2HPTA 4PWJA 3RG1C 2Y1YA 2AV1B 5I66A 5IWLC 4I4WA 1M56B 1RZ8B 4C4KO 5TDNB 2EYTB 3E2HB 1JPTL 4PJCE 3IDGB 5DD6A 5E6RB 4L9DA 4F7CB 2XBZA 5LKNA 5BZDA 5IOPB 4KX9A 1FYTB 2AKRB 3ETSA 4TSBL 5EPMB 4ZJ9A 4F1ZA 2WP3T 1Z0NA 1IBGH 1OB0A 2V5TA 3UYRL 4F3FA 1BA9A 2X9ZA 1LM8V 3MGOB 2ZJSH 4TQ8A 1OGAB 4IBQA 3QUXA 3JV4A 1C5CH 1TF4A 4JAMA 3BDXA 5CWSB 3O6FB 4MD4B 3IXTA 4IEFA 3D25A 5K9OA 5M95B 4HIPA 1OF2B 3BAXA 1ECYA 3KPOB 2Z4QA 5C2BH 4N9GB 1MQ8A 1JFQL 4I9WD 2OA9A 4H25B 2Q10A 4W9ZA 3HFML 1LEIA 2W0FB 2VN4A 4NZTL 4S1RH 4XP1L 2D2OA 5DD3H 3EFFA 4A55A 1LO3H 4XBGB 4CKVX 1AGFA 5E6UB 4UQ3B 3V6OE 4FA7B 1DZ0A 5C3IA 1ZEAL 2F8OA 1XL4A 4K55A 3TVMD 2Z1PA 4DO4A 1SBSH 2WZAA 1AGCA 2XWBB 2VWEC 1I9RL 1SQ2N 3H3BC 2BNUB 3T8MA 4Z76A 1U2YA 4F91B 1RUKH 3GM0A 4L1HA 3FPYA 5A2LH 1X5FA 1FNLA 4PIBA 5ESAB 3TV3H 3VD4A 4U1MB 4UILL 1HILB 4XTRC 3C6SB 2EYTA 3P3RA 3VFSB 3D4ZA 4F7CA 3FQXB 4PJFE 3L1EA 1FG2B 1S5IL 1U93B 2HX9A 3BGMA 1D7CA 1I9EA 4LEEA 5F1IA 2VDQH 5B3JE 1TQSA 3OJVC 3LAFA 1CFTA 5HI3D 2QVMA 1JZ7A 1OSZB 2OYKA 1UXSA 3ZL2A 3QA3B 1Z9SA 4OGXL 3TONA 3MGOA 2X1PA 3ARXA 2VLRE 2JJUA 2HLEB 1X5JA 2ILLA 3OAUL 1U8OB 5C09B 3HG1B 2R23A 3N9GH 2J44A 3IU3A 2ODIA 4Y2OB 3G6DL 3O6FA 2R1YB 5GSRB 3ZU8A 4UQCA 2X1QA 1FQ9C 1YUHB 2V33A 4OIFA 2FBJL 1J48A 1F90L 4PJBE 1I1CA 1YG9A 3P0YH 1I8LA 3HNVL 1XGQB 3E1F1 1YEHH 2X41A 1WEJL 3B7TA 1CTNA 3A6OA 3A47A 2BSRB 2WLIA 2ZXEB 3NCJL 4NUGL 2K6YA 3SE3C 2UWEB 3ECBA 4OBSA 2OMZA 2BSBA 4X4ME 3T3MF 4HHWA 5TQ0L 3EXLA 4HQQL 3A5VA 4ZNEA 1SHWA 4IRZL 5LBSH 1C9SA 3MBXH 3Q2VA 5D7IA 3X11B 1P4BL 2NY0D 1SRDA 4Q9RL 3ELAT 4FLSA 1GSKA 2QQLH 5ESAA 4F58L 1ZDSA 4IBSA 4NM8L 4U1MA 4GUQA 1RHHA 1G7PB 1N8OE 1HILA 1PG7L 5E9DB 3S3DB 3TEXA 3LH8A 3C6SA 2WYTA 5BO0D 4N0YL 4TV3A 3UACA 3NJGA 1U93A 3O8XD 5EZJB 3D5OF 4ONGH 1MN4A 3QIBB 1GJUA 4HXBH 5JUEL 2A2QT 5A2IH 3HR5B 4S1SL 1U6AH 4LCWB 4OCSL 2Y1AA 4WFFE 1JXJA 2K4AA 4K5OA 4F7EB 3FUHA 3UIZA 2NXZB 2OL3H 2ZXWB 1U8OA 4U1HA 3X3GL 5C09A 3HG1A 2DBLL 4CGTA 1O7VA 2R1YA 5GSRA 4POYA 3WXVL 3BGFB 4HX1B 1LEGB 4LDOB 3G04B 2X2HA 4A6YB 2AJXH 3FQUA 3BUIA 1XGQA 2GJZB 3ZK0A 4LNRA 5I2IB 1KV3A 1G4MA 1X9LA 2AK1H 1CICB 1Z9MA 3QHFH 1HVXA 1T1XB 2C9XA 2VW7A 2ZONA 2DKSA 1OEZW 1HNGA 4JL1A 4U6VL 2H6UA 2UWEA 4L8DA 3NIGE 1LILA 3MREB 4A63A 4K3GA 3L4WA 1ZTXH 4O9HL 1U95A 4QHKJ 2BNQE 5FYKU 1N6QH 2DMCA 4BK4A 2Y06L 2XWTB 4XN7A 5KN5B 5D1XE 3X11A 1A25A 4XCNB 3E9TA 5G2NA 1V10A 1A3RL 5C0BE 3BKYL 4PEEA 1T6WA 5JOFB 2Y2WA 5I1KH 3CFCL 3KW7A 3KPLB 1G9NL 2JELH 3RWEA 1G7PA 1I9JH 2DLIA 3K6IA 4PJ5E 3II2A 5JIPA 1JDDA 1LNUA 4XP5L 3MX0B 1BLNB 2K6WA 2NQ3A 5F7WC 1TJHH 2AHIA 2XTLA 5EUOB 3WV0A 1E4HA 4XNUL 4MDIB 1URLA 2W0KA 3QIBA 4BUQA 1F6AB 3GJEA 35C8L 3HR5A 3LB6C 4UYQA 4LCWA 2FDBP 4HT1H 1DR9A 7CGTA 1QPXA 4MZ3A 2APBA 5F44A 2YMXH 3KNBA 5E6IC 2D73A 2OFQA 4PJIF 2DQFB 4IRSC 4KKBC 1YN6A 1R9FA 4L5FH 1R17A 3SCMB 3WEXB 1MZYA 4S1QL 5AOLA 4HX1A 5I8CB 1UFGA 2XZZA 1LEGA 1SN0A 3G04A 3TN0C 4N2BA 1OAQL 3BE1L 3F7VB 1CB4A 3N44B 4Y2DB 2A83B 2W65B 5EWIL 4AQ8C 2AS5M 2GJZA 2F58H 2BFVL 4NN5C 1P1ZB 5GIRA 1FNHA 3U2SA 3EGXB 4G8IB 3WNNA 4HFWB 1CICA 2BOCB 3BJLA 2UZPA 4X4KA 3RU8H 1FAIH 4M1GH 1CQKA 2HVBA 2DB8A 2WBJD 3MREA 5GGVL 4M56A 3X1NA 4JGUA 4PG9A 2ZYHA 3OXRA 4H8PA 1KYAA 3KR3L 4U6HB 3CVHH 3F6IA 2XWZA 3WUWB 1REIA 1GZQA 3C60D 5DI8A 1A7NL 1TT6A 1ESOA 4WTQA 3T0ED 1GTNA 1OHQA 2CDEA 3H42H 4Z7NB 3FO0H 2CR0A 3F7PC 1KIRB 3VFOB 4MCNA 4XPTH 3FFCD 2NNRA 3D34A 2PPAA 4CGUB 1G7QA 1BLNA 3MX0A 3SDDB 1CE1L 3F00A 5AW2B 5MI0B 5FC9A 1BMGA 4WW2B 2XPZA 1KIPB 4AEHH 3AJ7A 5I5RA 1P9MC 3MRQA 5IKCA 2GK2A 4RMUA 4WK0B 1UC6A 2LLNA 3Q1SH 4JPQA 2AJUH 4IHBA 3D8MA 1NCHA 4RGOH 2Z31D 3QIWC 3U46B 5FA4A 3VMPA 1KUMA 4ERSH 2EDMA 1HDMB 1IGIH 3SCMA 3VCLB 3WEXA 3GLAA 4FQQB 1TMQA 4GQRA 4KKQA 3I3DA 4I9WE 2ITDA 4MJIA 1MFCL 4MA3B 4QO1A 1V7ML 3C08H 4Y2DA 4JFDA 1J05A 3MLWH 1JUFA 3VWJD 1P1ZA 3EGXA 3RB7A 1TJGH 2E76C 3A67H 4G8IA 4HFWA 5DMKA 4Z7VA 3OF6A 4P5KB 4NYLB 2MCMA 4OLEA 1QP1A 4HJJL 5LNEA 1AZZC 3NZHH 1W72A 2RR3A 2ATKB 1SJXA 2DWEA 2JKNA 4HCIA 4NBXB 4P5SA 4U6HA 1WRFA 4XBPB 5AVZB 3QS3A 3OHMB 1H3PL 3WUWA 3DMMB 3E0GA 4H8WH 3GO1L 1KB5L 3CZNA 5E7BA 4Y4FA 3VX1A 2J1WA 1HYSC 3FT4B 1T7ZA 2WWOA 3CFJA 5DJ6B 4TSAL 2K3TA 2F7PA 1A3LL 5HHQB 5B1JA 4ABUA 2CHDA 4Y5VC 2HYMA 3F6JA 1MY5A 2DWTA 3LS5L 3KGRA 3FCTB 4ZOBA 1W80A 4K23H 4GRLB 1YDPA 3Q1EA 3VFRB 1ZA3B 1F02I 3ARWA 1GH7A 1S9YA 3QWOB 1ZHNB 4Z7UB 3W0WD 2NUTA 5M7QA 4NHCH 2DQTH 3SY0B 1A9VA 2EAEA 1TEGA 2VLLB 3V0VB 1FJ1A 1QSVA 2JMRA 4M8QA 5DT1H 3VACA 4BFNA 2WANA 3W0WA 4PJHA 3WU1A 1FP5A 2XTJC 3VXMD 4DGVL 3FRPG 4EI5C 1J9CT 5A6MA 4O4YH 3OR7B 3CFDA 4B97A 4NQCB 2V8LA 4JKLA 4FFWC 5EUKB 1JERA 2P5EA 3GZQA 1QATA 2NLJB 2AERT 4FFYA 1FSKB 2X4UA 5IVXE 2BO0A 2GJ6D 4M7JL 2E4FA 4O2EA 3EJUA 3L2LA 2MRYA 5C0ND 3WCYA 4WI8A 3THMH 4NYLA 3ZDYB 1IBBA 1VEMA 3GB7A 5D7IE 2V2TB 4P4KB 3H6JA 4F8LA 5FYLL 1KPUB 4AV0A 5I15L 3VD1A 2X40A 2ATKA 3WHXB 1R24B 3LQMA 4MTMA 5E08H 3PGDA 4CMHB 4IMKA 3BN9D 3EO1A 4JQXC 3G08A 3DI2B 3II3A 5DC4B 2VZTA 1A5FL 4A7QA 1BVOA 1TZHA 1DE4A 1CGSH 3CAFA 3PQYD 5AKVA 5DZNA 5IG7B 2VISA 3KEDA 1T2JA 2VDLL 1VIWA 1LWJA 2E9BA 5KBKA 3QG7L 2N1KA 3L7EA 4MYPA 1RCYA 5F7EH 4C4KT 2B2XH 2E56A 2FHBA 2IDSA 1GW0A 3QDGB 4ZUUB 5CSBA 3WD5H 3QWOA 1QBBA 1ZHNA 1CXFA 2NY1C 1HHJB 5CBAA 2WN2A 2VLLA 3V0VA 4OQTL 1PFCA 2OR9H 4PY8I 1SEBA 3CBKB 4Y5XC 2FO8A 3FT9A 4ZD3H 3IRPX 4FYSA 3PWPD 1I7TA 1PW3A 3UAFA 2Y5EA 4YHKL 5EO9A 4ANWA 3GMNB 4A2HA 3OR7A 1NTDA 1U21A 3V8OA 1Q1JL 5EMYA 1P69B 2H26A 2NLJA 4KPHH 2V17L 2GIXA 4YDKL 1XFPA 1A4BA 4BFEA 2YMTA 3X12B 1Y1UA 3IJ9A 1GC1L 3JWDH 3AY2A 1WAAF 3CZFB 4IDJL 4X5XA 5JTWA 3JYBA 5I6OA 3AG3B 1E5BA 2LFEA 1JK9A 3EYOB 3U4EA 5IW6B 5HDLA 5IESH 1B9KA 3LIZH 4HBCH 1SOSA 1KEML 2WKGA 3UPRB 3FTXA 3VM7A 4CU7A 5EOCL 1J1XL 2ADJA 3RVTD 2FT6A 3QI9A 4AYGA 1UWXK 1DFXA 5GGSA 4NC1E 1TQCC 4UCFA 3PY9A 3PGCA 4XPAH 1M71B 3RPIB 4BDVB 1NCBH 32C2B 1IMHC 4JREB 3BPLC 3HJEA 4RMQA 2NT1A 1BFOA 2NYYC 4J12A 3PCYA 4OCMC 3SDXF 5CEZL 1GPOH 4PBVC 1OSPL 3NJLA 1CLYL 1HHJA 4Q8BA 4S11A 2SODB 3RVXC 3UJIL 4IJ3B 3NG5A 1XGPA 2P9RA 3DHUA 4WSGA 3QNXB 4OLXH 2OW7A 3MAWA 1A0QL 3NIDF 5DO2C 1J9TA 3RWFB 1EEQA 1OD9A 4ANXA 2AXJA 4OLYL 3GBML 4ODVL 3DX4A 5D7HA 3QH3B 5DEZA 4A2EA 1E7VA 1NC4A 5CINL 1QNZL 3S88H 3SDCA 3ILQC 4KMQA 3U1SH 2EINB 3TASA 3X12A 3O4OB 3FB8A 3BCFA 4KAQH 1WAEA 2GBVA 1MAKA 2MNJB 2NNAB 4K5MA 1KYOK 3LSOA 2ESVB 3ARTA 1M9SA 1AOHA 2ZUQC 3EYOA 4OU3A 4BBWA 3CV5A 4PGJA 5AQ0A 4PRPD 1HSBA 4DAGH 4I18B 4X8JA 4AH2B 5ADOH 3CC1A 3MJWA 4HC1L 2YWYA 1AY1H 3T0EE 1KXVA 5K33A 4BUGA 2AGJL 4U6YB 3UPRA 3PS6A 2DTML 5T1DL 2DKUA 3FFCE 4M7LT 5C97A 5B1AB 5K9JH 3QFGA 5EIVA 5FAAA 3MLUL 1C08B 4I0PD 5E5MA 2VYRE 3APNA 2WSKA 3M8OH 4PJGE 5LWYH 1O9WA 4PD4K 2ZXCA 4R5TA 3SN6N 3FSAA 3NGBB 3U6RB 5KTEH 1KZQA 5C0JA 1GTFA 1PU0A 3VB9A 2BIPA 3KPNA 1BJMA 5HHVH 1JWUB 5DHYA 1RZQA 2B08A 5BXFA 2JB5L 4K7PY 3DVNA 4E9VA 3LKOB 3V0WH 3IMSA 4XMZA 4MSWB 1YNTA 3EOYG 1FZJB 1VHPA 3MNDA 4HFUL 1KJ2H 4G9FA 1BF8A 5HI5C 4Z7VE 2AJZA 3JZYA 3F58L 3CN2A 2EVHA 1NMBH 1YPZB 2PR4L 1NBYA 2Q76B 2WLKA 1OCZB 2VC2H 2BZ7A 4NJAL 1U0QA 2NSMA 2VXQH 3CD4A 3C5JB 3F85A 3VG9B 3RL2A 4JPSA 3D06A 5E0FA 5GGRB 3H85A 4HZAA 3WIAA 1R3LB 5D5ME 3TO4B 2CKBL 3K5RA 5HDBF 2R29H 1A14L 4P2RB 4IOIB 3LMJL 5DJ8A 2H45A 1P53A 4BCZA 4HUWB 3ZJAA 2ESVA 5I5MA 2XKSA 3VFMA 3I50H 3TC9A 3AROA 1NFDA 4PJAE 5LXGL 4I18A 3MACH 3EO0A 2X1WL 1OCRB 1EO5A 5JXEA 3FK3A 4OFKA 4R8WH 2XQYK 3TJHC 2XRAL 1KT2B 3OMNB 4X9IA 3N55A 4NRYA 4JZNB 1GS6X 2WLLB 3CLFH 4WO0A 3RVWC 3QJUB 1K5NB 3CVIL 3DHMA 3ZQXA 1LO5B 3RFZB 1BFVH 1J8KA 3RUGF 1MFUA 2GC7C 5D6DA 1H3UA 3W0WE 4PJHE 5B3NA 3J07A 2V3EA 3CDFA 3SDAD 4AJWA 5IGXH 1C16B 1JPGB 1QFOA 2R7EB 4XNBA 5KVDL 3VA2C 4XPHH 2J21A 3WJLA 3OM3B 3PGFL 3QUZB 2W60A 4R83A 3B6SB 4A7SA 2DMBA 3LKOA 3NCYS 4DW2L 2P5EE 4NUMA 1JK8B 3DWTA 4QHNB 4XWOD 5E4AA 5E2JA 1NINA 3HRZB 2H0PA 4JG1H 4WCYL 3NH7L 4NQQA 4GW5B 1RY7B 2FJUB 4PRAB 1FA4A 4U4IA 3DYOA 2J8OA 1BF5A 5JYLA 4JL2A 4HWZB 5GGRA 2NXZC 3NT0A 5B7FA 5HYQB 3OC8A 4YSOA 1E4WL 1DQDL 2HWZH 4F2FA 4RWHA 3BGFC 3KLQA 3ARVA 4ZFFB 4G6JH 3S8WA 4X99A 3QQ3A 3DGDA 1QLFA 3WDIA 5FDWB 2A6KA 2AK4D 2BRRL 1AKPA 1HYRC 1NGZA 3FQYA 3KPQB 4F27A 1K5WA 1JPSH 3WNJA 2XACC 1T66C 1UEYA 1OO2A 1TSRA 1F0LA 3N0AA 3C6LC 3QSKB 1KT2A 3FTSA 1JZ5A 1BZOA 4K15A 2VDMH 3G6JF 3GRWL 4AITA 4JFFD 5F7NC 1MHEB 4YUEL 5KSBF 1CFNB 4OZGE 4KDTA 5H94A 3T0WA 2X87A 5T8IA 3V4PL 1BQKA 1GYUA 3UAJA 1Z66A 2C8NA 2XJKA 3B9KD 3K3QA 2VABB 1Z7JA 4LSRL 4P23D 4F37F 2X9XA 3V9FA 4QHNA 3PWPE 3IEAA 2AXFA 5JA8B 3HRZA 3STBA 4DKFL 1HKLL 3ARYA 1A6UH 1OF0A 4HH8A 3BAJA 4W9CC 3JVFC 3BZ5A 4JN1H 3EADA 1OZUA 2FEEI 3P2DA 1IUZA 2NY3D 4HMDA 3FQTB 4ABQA 1MEXL 2MJWA 2NY2B 4PS7A 1GGIH 2AABH 5H37H 4ODSL 4YSDA 3FUKA 5HYQA 1HL8A 2Z0BA 1QSFD 3MCLL 5BO1H 4WUKL 4ZFFA 1BBDL 1QVOB 1KTCA 4D8PA 3IFNH 3PWLB 2WZ5A 4QAWA 4MQ7A 3RZCB 2R0WL 1J7VR 1XIWA 4Y5YC 4FERA 2P48B 4PV8B 3IU4L 5GS1B 4ZUTB 1PZ2A 3ARBA 4NFBA 2DWSA 4N8PA 1DBBH 2I24N 4DSYA 4LCIL 1AFVH 4O02A 3HMWL 4FXKA 5AVXB 1MHEA 4G6FD 3D2TA 3GS7A 5IY5B 1RFDH 1U8PA 2FJGB 4EBQL 4RFOL 3UIYA 2WTOA 4NWTL 5A43C 2CH8A 1MCRA 5BS0B 4OI8A 4I9XA 5EIIG 5D4HA 3P0VH 1WV7T 4X6EB 4A2LA 2XN1A 4RQQA 4KGJA 4LCUA 4M5ZH 4OJDH 3V2AR 3BWZA 3SDDC 1B4JH 4LRNL 2L8AA 3L3JB 3QYNA 5MI0C 2QELA 4WW2C 3K7UA 5ENWA 3ARFB 5GGTA 3ZDXB 4XBMA 4CAGA 4NNPL 2KS0A 4FABH 3LH9A 1D9KA 4G7QB 4ELKA 3B3IB 2AI0H 5B4MC 4NPJA 4ORZC 3VXTB 5IMKB 4I48B 4LDEB 3KVDD 4QRUB 3MNVB 1FO0B 2QQKH 4I1PA 4CVWA 2WLZA 3HRPA 3MYJB 2AFNA 1JZIA 2CHZA 3ZMRA 1DANT 1QEXA 1CFVH 1OK0A 3DGGB 1WF5A 1QVOA 3ZR5A 2VJXA 4AJ0A 2CRMA 3B9DA 4KVNH 4BGLA 2XX0A 5A16A 4FQ2H 1IKNC 3K8MA 5DEFA 2LLGA 4O5LL 2W07B 4Q6YA 4YWGL 4UM9B 4HU2A 1YAIA 4GSDH 1K3ZA 4ANUA 1C8QA 1CS6A 2G0LA 4LL1A 4AM0Q 4GXVH 3SPIA 1YO4A 4AG4L 2YFOA 2VITA 1E5ZA 1HOEA 4UUJB 1LJMA 3WGUB 3AVEA 1NGQL 5I5JA 3FF7A 3MN8A 1JNLL 4LSUH 4D3CL 1UM4L 3JV6B 4BA0A 1LDSA 4HPYL 5F6IB 3DMMC 3EDDA 2EIMB 3CG8A 3FC8A 5HYFA 2PW1A 5BS0A 4XH2A 1HWGB 2YXMA 5I5IA 1KCRL 1K3IA 1I1AB 1G4RA 1U8JA 2OCFD 2C4FU 4LP5A 2VLKD 4MKMA 4OF5A 4TTDC 4G3YL 3TLRA 2Y1ZA 4XRCA 5EEUA 1WA0X 4NRXA 4WHCA 3HC3L 1U91A 3L3JA 4GRLC 1X9RA 5T33H 4PGEB 1PD6A 3RWIB 4YSCA 3FO9B 3MRPB 1BDYA 1KV7A 1HH9A 4WI2A 2YPVH 3ECVA 1Z0MA 4XO8A 1SZNA 3BT0A 2VQ1A 1RZJC 1I3RB 3HE6B 1IAIM 3MU3A 1GGTA 1FO0A 4QRUA 1N5YH 2ED8A 5ALCH 2D7MA 4CILA 1U8QB 3EDJA 1IAIH 2XYCA 1JRHI 3VDCA 4CC4C 1EANA 4PJCF 1DCEA 4IRJC 4Q97A 2B1HL 3PP4H 5TK4A 1W72H 1AYOA 1FSKC 3GHEL 3ZZLA 4OLVH 3L1OL 2VN3A 5DURD 3GJFB 4UM9A 1ZWIB 3MJ7A 4APXB 5J0BA 1KJMB 5AW0B 3TA3A 3MRHA 3MRBB 1CDIA 1NBZB 4P4KC 3Q6FB 5CHNB 1GCYA 4UUJA 4X9BA 5F7AA 1EZUA 3VAEA 3VD5A 5E4IA 5EHFA 4CMHC 4EEEA 4OCRL 4F9PA 2JKIS 1AR1B 4CMMB 1E8ZA 4DKTA 1MSPA 2H6PB 3SEPA 1KTKE 5F6HJ 3F7KA 2VMDA 3IMUA 4OLUH 2VT0A 5CLYA 1L3WA 4FKEA 4JKKA 1T21B 1M6UA 3QQNA 1E27B 4OGYL 2XT1B 3PHOB 4B9ZA 2B1AL 3C5ZB 2IMNA 4N8VG 4XTRD 2E0PA 4ZMVA 3AWGA 4ZS7H 2P80A 2P26A 3IDYB 2GUYA 2BIIA 3VI4B 3ARQA 3V5DB 1FH5L 2DQIL 5FUOH 1FFQA 2XXGA 3BW9B 3EBHA 3UAAA 4AGMA 2Z7YA 4PGEA 3FO9A 1YMHA 2YGVA 3MRPA 3GZOA 3T4AB 4KO9A 5EZOL 4PRID 2FB4H 3L5XL 3QXAA 1BQLH 1TZOA 2V9TA 4ZDHB 3SYAA 2IADB 1IGCL 1MJUL 4H88L 3NTCH 3HE6A 4TRPH 4MMYB 1DJGA 2VXSH 3INUL 1UACH 4P5TA 1P5VA 5F7FA 3WG7B 5KZCD 3LKNB 2A74A 4ZFOA 1FBIH 3VTMA 1HTYA 3OQRA 4FZEH 4PJFF 3DETC 5AAWA 4L48A 1HZHH 4XPBL 1ZVSB 5B3JF 4XR8C 2PTTB 1HHKA 4N25A 4JFED 4RAUA 1P6WA 1U36A 3TIDB 3MRBA 3B7UX 4NP4L 1YNKH 3WTYA 1DVZA 1A9EB 6PCYA 3NFPB 4JFFE 1TFHA 1JHLL 4U1LB 4KQ3H 5TJWK 3O2WH 1NCTA 3IAGC 4X6DE 4CMMA 2IJ0C 3WI9A 4F57L 4KTEH 2CJUL 3A3YB 3NCBB 1G0DA 4M5YH 4PJBF 1QPPA 5F7UA 4AW4A 2OCCB 1T21A 3C5SB 2EO9A 4AEIL 3ULVL 4X0NA 1MJ7L 3LN5B 5MEOA 3DK0A 4PJ7B 1TJXA 4QHKI 2YOCA 4QTHA 4JREC 4IW4C 3G9VA 3VG0H 1Q9KB 3BKML 3DJTA 1RZKH 2GSGA 4QRFA 3VI4A 5GISL 1NPJA 4FLQA 2BP0B 1XTMA 4GNKB 4WNQA 3GSXA 3WY3A 1TU2A 1UURA 5B39B 2VAAB 3KCWA 1FL3B 4MXQC 5KVGE 3R4DA 2AJYL 4HSCX 5DC9B 2F6AA 3BVNB 2IADA 2EILB 3WNPA 3UBXI 3BP7B 1OAJA 1UOKA 1IC5L 1LK3L 4H26A 5T3ZD 2DKMA 3C2AL 1JTOA 3SBRA 4ENEC 4K07A 3D3VB 4NDMB 3FB6B 5TFSH 3OB8A 4APQC 3F7RA 4WW1A 3C9NB 5JXAL 1R4XA 3B5HA 1Q1PA 1UG9A 4PCTA 3O4OC 1T1YB 4HGKC 1NFIB 3TIDA 3FH5A 4RMVA 2IANA 1JNHB 4U3SB 3V4VH 1NCWL 4HIEA 3F7QA 3NFPA 5KAQF 5ICZB 5EORH 3WTWA 3ZE0E 1G87A 5HPOA 4NUJA 1JDAA 2PETA 2Y9RT 2KZWA 3D0VA 1SY6L 1G6RA 4YNYB 2WKOA 3HMXL 4JFVA 4WTXA 4KRLB 3X1GA 4W1TA 2NW2A 3SJVA 4NO3B 5EBLA 5FK9A 3P3TA 3U1QA 2MWCA 3E6FB 3RX5A 1BX2A 5F96H 1NPUA 5I6XB 4PJ7A 5JIMA 2W0LA 4UWQB 1OPGL 5CGMA 3BKJH 1NUFA 3JT0A 3JBG7 1SDDB 3NIGF 2EH7L 1AH1A 5FO7B 3NGBC 1HI6B 5AVVB 2BP0A 2IOMA 4R2GB 5DSCA 3LB6D 3PPEA 5KEZA 1FL3A 3V7AE 4WFHD 5L2KB 4XMKL 3K6SA 4UOZA 4EI0A 5EEWA 2NNXA 1VADA 4C56A 2XJLA 1MRCL 1TETH 3FMGL 5E6ID 1J5OL 2E9GA 1HOCB 3E3QE 4XHJC 4IRSD 2E4TA 4KKBD 1FLTX 1KLFB 1E6JH 2AJ3B 5IBUG 3AC0A 3GKZA 4QT5A 1BGXL 3TN0D 3FKUS 3ZTEA 3FB6A 3VG9C 3ABGA 1IC4H 4KQ4L 5D7LB 4HCFA 1RK0A 4F7KA 3TEYA 4RISH 3TO4C 1MCDA 1MKFA 2G5BA 1SDYA 1T1YA 2OMTB 4O2FB 1GVIA 2BHYA 4U3SA 4YHOL 2GSIA 2IXQA 1F4XH 1G7LA 5ICZA 3G5ZB 4NI6A 3TH3T 1AMXA 4U7SA 4J8RB 1YQ2A 3FS9A 3QZWG 4JVPA 4FHKA 3LHPH 3S37L 4YPGB 1Z6JT 1XEUA 3E6FA 3OHXC 3FB5A 2VLKE 2VKWA 1J1OL 4ONFH 4N2EA 2Y7LA 4P07A 1MUJB 5F9WC 3RFZC 1CI3M 2DYPB 5IV2A 2B16A 4QOKD 1ZJAA 1A7RL 1BXXA 2ZD0A 4I2XB 3GQFA 3HBGA 3NOIA 4DTGL 1Y18A 2ZICA 3H3PH 2W91A 4MNHB 2BWQA 4IS6B 4Q4EA 4ZPVB 1L5GA 3TJEH 4WZ9A 5L2KA 1OW0C 3QUZC 4QOKA 1KEGL 4FNRA 2GBUA 5DJCB 2QDWA 3MLTB 3HI6H 3QIWD 4R97B 3UO1L 1WAPA 3D0LA 1KLFA 2BJMH 5D4JA 2ED6A 1GGBL 4ZOCA 4KDVA 2X4PB 3MUZ1 4QHLB 1K9TA 4H8VA 2B7DT 1C7TA 2O4EA 3IRZA 3RY6A 4QGYA 4L4TD 2QSCH 3Q43A 2OMTA 1ASQA 5I1EL 3BAEL 1T04A 2UZXB 3OKLB 8FABB 4OM1L 1E50A 3WXWL 4TNVK 5AVQB 2P44B 2DM4A 2XPGA 1AKJD 3B5GA 3BRGC 3N04A 1JF1B 3JWNC 2N7AA 3QUYA 4JG0H 2J8HA 1YEJH 2VR8A 3MR9A 3P4NB 2WTPA 5IHLB 2OYPA 4YPGA 2EVJA 1HYSD 4UT6L 4TF4A 5HY9B 1JRHH 1GIGL 2DRUA 4L2LA 3O3BA 3EKCA 4KK5C 4DQOL 1NCAH 3L1GA 2OR8A 4PJ8B 1DP0A 2UZYA 2A6DB 1JGLH 3H9SA 5GRZA 1CDHA 4OCXH 1E4XH 4CC0A 2QTEA 1I8KB 4L29A 5KSUA 1WZKA 2R0ZH 3RX7A 4PBXA 1UQSB 4E2OA 4IS6A 2NQDA 3VYOA 3RWJB 4ZOEA 3VH8B 4UT7L 2FUQA 1FL6B 3ESMA 3U0PB 3MLTA 3NCFB 2KC0A 3AZUA 2HJLB 4LVOB 4QLRA 3NPSC 4EI5D 2XTJD 5LGYA 3HE7A 2N59A 1IGJB 2CPUA 3QCVL 2HLFC 4QPEA 2X4PA 1JI2A 3O3AB 4FFWD 3LKQB 3NIFE 5EBGA 3NCEB 1KCBA 4D9QD 1CL7H 1R3KB 4JFEE 2Q8AH 1TFPA 3OPUA 4QXTB 4RFEB 3K81A 1JGEB 4FQ1H 1BREA 3LJ3A 1G9MH 2A6IB 4G8GD 4JRLA 1UM5L 4PV1C 4MB4A 5T1KD 8FABA 1AE6H 1HHIB 5CN2A 4L18A 5T1LB 2VN6A 1W0WA 1JF1A 4GXFA 2P8PB 1RU9L 1KGJA 3RZCC 3R1GL 2CXKA 1HIMH 4BZ2A 1CDBA 2R51A 1LQBC 1BM3H 4RX4A 5E95B 5GS1C 1Z5LA 5IVXF 5HY9A 4BD4A 4LPXA 3TTSA 1QFWL 3HAEB 3K8LA 4H44C 1IE5A 3H2QA 1A1OB 2C9QA 5D7IF 4XE5B 1GY2A 3PWNA 3QC6X 1LMIA 1FWXA 6CGTA 1NOLA 3PNRB 2WB7A 3RNKB 1FYHB 2R2EB 2P5WB 2IDCA 1G7IB 4MA8H 4KXBA 4JB9L 3D18A 3P73B 2P1YA 3PYCA 4C55A 1T3FB 1ILSA 2NY1D 3BYYA 3ROOA 5DS1A 4G7YH 5AUMB 3VSTA 4XWGL 4LF3A 2TSBA 3VH8A 3WO3B 1DBJH 1KJVA 1PZAA 1VERA 3MLRL 3SE8H 3WBDA 2EIDA 1IM3D 3KWXA 4L1SA 2IWEA 5BRZD 5T3ZE 3QNYB 3KYMA 2HTLC 3N1MC 5A7BA 4U2YA 2XQYA 2IALB 3ARFC 3TBVB 5JW3L 3QFDB 4Y1AD 1T5XB 3MLYL 5KVGH 4G8FA 3MI6A 1NWOA 1CT8A 1MCNA 3WFEH 4CN4A 1SOQA 4RFEA 1YN7B 5F7KC 2APXA 2BS9A 1I3UA 4Y1AA 3DJRA 5CP3H 3S34L 3SJVE 1G1OA 2Y2YA 2EDDA 5IB3A 4B50A 4D0CB 3GBNL 3TEZA 1RK7A 2AQPA 1ZV2A 4Z7WA 2OR7A 1MJ8H 4O02H 3KPRB 4U31A 2N01B 1M6OB 5CSZB 1YSOA 5IEKB 4U6XA 4IIQA 3HAEA 5DHXB 2VR3A 2EYSA 1H8LA 2CK0L 1A1OA 2PWDA 5F6IC 1YECH 1P5UA 3UTTB 2NYYD 2P5WA 4M61A 1YNLH 2VDNH 3H0TB 2YA2A 5BV7H 2HT2C 2IH8A 2JH2A 5TGBA 1I1AC 4PJ9A 3RVXD 3C8KA 5FX3A 4WWKB 2WPGA 4DESA 4NO0B 1MCCA 5FYJD 3CK0L 1USQA 2WK2A 2H32B 4OM0L 5IW1B 4G7RB 3GBDA 2R69H 4YPJA 5DO2D 2XV6B 1L6XA 3QNYA 3X14B 5JOEA 1OCWL 1FYTD 2VR5A 5DJ2B 3LKRA 4NM4L 1N64H 1AS8A 1F41A 1CDJA 1OGAD 2CGRL 2YBRB 3ILQD 2QHRH 3RKDC 4RWYH 4KKZA 5FR3A 1YN7A 3L4CA 1OAKL 4NJ9H 2DIJA 3PRZA 1BZEA 1S5HB 3COOA 5D4IA 2ZKWA 2OSXA 5KBPA 4NQEB 5F7BA 2DEYX 3FHEA 2JCCB 2VH5H 5DQJA 4M1DH 3INOA 1LE9B 4D0CA 3UC0H 5AVTB 2W38A 5HPMA 1U42A 1XF4A 4IK6A 4A7VA 4JFOB 1MDTA 2E86A 3NJXA 4KBPA 3FQRB 4WFED 1ACXA 2VXTH 5EU6D 3U4AA 3FTGB 4ACPA 1FNAA 5DWUL 4QOKE 1KZYA 1AR1C 1IIIA 2VERN 4GSRA 1F56A 1IAOA 1L0YA 3IJ8A 1JWSB 4AIZB 4KJYB 2GAZB 1FVEA 2I9TA 1ILUA 1AQDA 3C5ZC 4LLWB 4OCWH 5JDJA 1PPIA 3MA9H 1F97A 2VUOA 5I0VA 1CBJA 2H32A 2DYSB 3IDYC 3H7BA 4KUZH 2BP8A 5HI5D 1CN4A 4HHAB 1UGKA 4G6KH 3B56A 4HEPA 3EH2A 4JE4B 4K8RC 3FF8A 4PJGF 1TJIH 1WBXB 5I8KL 3T4AC 3WEMA 3HC0A 5FHAL 2KHAA 3VE0B 1WCBA 4BELD 2BNRB 4L4TE 2CMRH 2BS8A 3WJJC 4KZEL 1DJIA 1QA9A 4DEPB 4JFQA 1M7DB 4NKIH 3D39A 4YBLB 3IWVA 3MMEB 1RMFH 4TVPE 1NBVH 4DKEH 1E5UI 2H2SC 4UI2A 4Z7VF 2QADB 4WI3A 4U0RB 3H9SE 5I18H 4IKJA 4JQVA 4U33A 3TBSA 1L9QA 3I6KB 4X7SH 5EOQL 1MCQA 4JG9A 1B2WL 3V4UH 1HQ4B 4OZFH 2QFRA 1AG6A 3GI9L 3TJHD 2GEQA 5D5MF 5EN2B 3FTGA 2C34A 2JJSA 3MJGX 2AEQH 3CC5A 4WU7B 1PTZA 1YMMB 3RVWD 2EUWA 1AMYA 1KB5B 2VDOL 3OGCB 1XF3B 3EFDH 4PJAF 4NEHB 4F9LC 1KXQA 1KC5L 1N68A 5AB0A 3GIVA 1RXLA 1E7UA 2FD6L 3ZLQC 1RUQL 3EFOB 5I19L 4MRCA 2N0MA 5E9DD 3VNZA 3GSNH 2OQJA 4XO9A 4CW1A 1WFMA 4IKKA 2FBRA 3ATAA 3MRGB 4R4BA 4FEMA 2XTJE 1GZPB 2HN7A 2ZOTA 3HVDA 4NP9A 5GJTL 4JZJA 2Q87A 1PQZA 4BQ9A 5KAQG 5T3XD 4YC2B 1F11B 4U4BA 5IW3A 3VDBA 1IB5A 4BK5C 1BQHG 1DLFL 4AWJC 1CFQA 2O5YH 2CIIB 2C5DC 4NQSA 1L7IL 2BNRA 4PJHF 2NXZD 1DUYA 4G8GE 1S7VA 4FI6A 3BXNB 4EZMA 4JCMA 5FFGA 1YJDH 3EF4A 3NABL 5INCB 3W9EA 3W2DH 4AOFA 2G9KA 3DX3A 4LSSH 3QJOA 1OTSC 4LSQH 4DJMA 3AW5A 3S98A 3KD4A 1IBGL 4TQIA 3K2MC 3SKUD 5MEQB 3UBHA 2LLLA 2ZJSL 2WQVA 3I6KA 3QR1A 4L4VA 2R2BB 4JY4B 4E68A 1C5CL 1T66D 1F18A 1HQ4A 2MQGA 2F5AH 3C6LD 5F88A 3BUBA 4Q6IC 3R06A 2DW5A 2K7PA 3KDPB 4FD0A 3NFNB 2AMGA 1U3HA 4QXUL 5JORA 3TM6A 1YC7A 5F9JB 4XO5A 2O5ZH 1HAWA 1GS8A 1CE6B 3B9EA 3LH2L 4ETYA 1FL5B 5IEHB 5DD3L 1OKEA 1FZOA 4HJUA 5SV3A 3EFOA 1LO3L 1TQWA 4KO7A