3N2JA

Azurin h117g, oxidized form
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGGSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the reactivity of different forms of azurin by flavin photoreduction.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3n2jA00
3L45A 4E9VA 1JXFA 4DP6X 2CUAA 4G7QB 5I6NA 1PMYA 2IDFA 1URIA 5A7EA 3QJRB 4NERA 4Q89A 2HX8A 2DYRB 1PZBA 2X88A 3UAAA 2UXTA 1BXAA 4N8UA 2WSDA 3FPYA 4AKQA 3DTUB 2E86A 2DWTA 3T6WA 2UXVA 2JFCA 3NJLA 1PZAA 2BZ7A 1KGYE 5AZUA 5B7MA 1KV7A 1TEGA 3IBOA 4BWUA 4BDVB 2XLLA 4DP8X 4BXSV 3FSAA 4P5RA 3NJFA 3AZUA 3N55A 1XB3A 4CSZA 1E65A 3V9CA 1FFTB 4G7SB 2R7EA 5D4JA 4E9TA 3ABGA 2RACA 1PLCA 4AKPA 5AKRA 4HIPA 1ADWA 1XMEB 1ILSA 4YSAA 3FQYA 1KBWA 1E5ZA 3S8FB 3NJJA 1FWXA 2IDQA 1OE2A 2UXGA 3OMAB 2XUWA 1SFHA 2ZXWB 2YAEA 2J55A 2A3TA 3NSYA 3X1NA 1EHKB 2GIMA 4P5SA 1HFUA 3SBQA 1ASOA 1DZ0A 2MRYA 3UGEA 4M4RB 3CVBA 5PAZA 2TSAA 3D12B 3ABLB 3NJMA 4UF7C 4A2EA 3UACA 4DP1X 1GR7A 3TBCA 1XB6A 2EIJB 2JXMA 4A2HA 2HXAA 1OV8A 4HCFA 4WKXA 3T6XA 7PAZA 2FT7A 1PY0A 2GI0A 2PLTA 1BEXA 2BWIA 4YSSA 3NT0A 3PXLA 3SBPA 1OOWA 2B3IA 1GYCA 2HRHA 4E9QA 4W9ZA 1B3IA 1JXGA 5B1AB 2XXFA 2PPAA 1RKRA 4F2FA 1CURA 1ILUA 2YARA 2VM4A 1FA4A 1OE1A 1TKWA 1AOZA 1PF3A 1ZIAA 1J9QA 1M9WA 1BXVA 1AS7A 4YSUA 1N70A 1NIEA 4KNUA 2PP9A 1HAUA 3QJUB 3ABMB 5I26A 1JERA 2QDWA 6PCYA 2CAKA 2FQDA 5B1BB 5I6OA 3JT2A 1EZLA 4DP9X 4M3HA 1AZCA 3OD3A 4W1TA 1AS6A 3H56A 3PAUA 1M56B 3CDZB 3JTBA 3U25A 3EHBB 3FS9A 2OCCB 1BYOA 2UXFA 1NIFA 3EH3B 1DYZA 2YAFA 2P80A 4HCIA 3WNJA 3NSFA 1ID2A 1JOIA 4GXFA 1BQ5A 4KO6A 3NSDA 3S3BB 1YLBB 3QJQB 3ZX1A 3AG4B 4KO9A 5EHFA 2XV2A 2XU9A 3T6VA 1X9RA 3WIAA 5B1JA 2Y69B 1BQRA 3FQ1A 4BK5C 3KW7A 2FQGA 3CZUB 2J57A 4AX3A 4DP4X 6PAZA 2XVBA 3DKHA 3ZDWA 1V10A 4KO7A 1NIBA 2VW6A 4A2DA 2AFNA 2PP8A 1PZCA 2IH9A 3FU7A 3FU8A 1PNDA 2XV0A 1RCYA 2YAHA 3IN2A 4ZK8A 3X1BA 3AG2B 1PCSA 1AS8A 2I7OA 5D4IA 1NZRA 1QLEB 1L9TA 5I6MA 2H47C 2EIKB 3T9WA 5I6LA 2YQBA 2IWFA 3DIVA 2AVFA 2XWZA 3OQRA 2IDTA 3H4FA 1AIZA 1NINA 2IWEA 1CYXA 1NICA 2VSMB 3IN0A 4L0PB 1JZFA 1R1CA 1L9RA 2Q5BA 4KNSA 4AI7A 4ENZA 1BAWA 2OV0A 2W8CA 1A65A 2HX9A 2TSBA 3HB3B 9PCYA 1GW0A 2FQFA 1J9SA 4E9SA 1AZNA 2GC4C 1A4AA 1PAZA 3IEAA 1SNRA 1TEFA 1M57B 3T6ZA 4E9RA 5I5MA 1OE3A 3AW5A 2Q9OA 1WAEA 4YSRA 3UABA 1GS7A 5I28A 1RZPA 1KCBA 4QLWA 1NTDA 4GP4B 1MZYA 2NRDA 4FA7B 1NDTA 3QJVB 1SJMA 1ET5A 4YVUA 3UAEA 3QJTB 2ZONA 4G70B 2YAQA 3EH5B 1WA1X 2EIMB 2FTAA 5IY5B 1HAWA 1N68A 4UANA 5D4HA 4YVNA 3MX0B 2PCFA 2CBPA 4WTQA 3FQ2A 3OM3B 1A3ZA 1I53A 1V55B 1AZRA 4YSTA 3NYKA 3FYEB 3SQRA 4BDVA 2IDSA 4F7KA 1MG3C 1AAJA 2H3XC 1L9QA 3QPKA 1CC3A 3QQXA 2I85A 4JKNA 2HRGA 2UX7A 1SDDA 2VSKB 2FJSA 2GHZA 3UADA 1ET7A 3FSVA 2XYBA 3OMIB 4G71B 4AKOA 3AY2A 1SHXA 2OJ1A 3RYMA 1JZEA 4G72B 1AZUA 4QKTA 3PCYA 4BWTA 1SFDA 1JVLA 3S3CB 2BW5A 1QNIA 2EILB 3MBWB 2IDUA 4HAKA 2IAAC 4MFHA 2PPCA 1E67A 5B3SB 2BP0A 5I5JA 3SBRA 1GY1A 5B7FA 3ASOB 4KO5A 2DY2A 3TA4D 4A67A 1PLAA 1WA0X 1X9UA 2GSMB 2WO3B 3ZIYA 2YXWA 2YAOA 2BW4A 1OCOB 5I6KA 4G7RB 4JHUA 2YAPA 1IBYA 1OCCB 3CVDA 3WG7B 1BYPA 2BP8B 2FT6A 4YSCA 2MTAA 1V54B 2YXVA 3NJIA 1AZBA 4EF3A 4JHVA 5F7BA 1A4CA 3NP3A 8PAZA 3ERXA 4DP5X 3CDZA 4X4KA 2BO0A 2EINB 1T5KA 1ZV2A 4YSPA 2HLEB 3HEIB 3FSZA 2GC7C 2FT8A 2YAMA 3GDCA 3NSCA 4E9XA 2DWSA 4GYBA 1PLBA 1E30A 3N2JA 4HHGA 3AG1B 3TASA 2JKWA 2XX0A 2BP0B 4GY4A 4TXVB 3WI9A 2H5UA 1JXDA 2IH8A 4BXVA 2LLNA 5LDUA 1A8ZA 4HHWA 3NP4A 3WKQA 2FQEA 4K9JA 3FYIB 3QJSB 2BHFA 3S3DB 4A68A 4PAZA 1MZZA 1SF3A 3X1GA 3IE9A 3CVCA 3OMNB 4A66A 2GB2A 1KYAA 1ZPUA 2GBAA 2ZOOA 4YL4A 3ZBMA 4CSPA 3EF4A 4A2FA 4HZ1A 3S8GB 3WKPA 1ZDQA 1ASPA 1ZDSA 3GXUB 4RH4A 1SF5A 2VM3A 1NPJA 2XXGA 4GP5B 2VW4A 2CCWA 4DPAX 4N4YB 1NPNA 2HX7A 2QDVA 1BXUA 4DPCX 1SHWA 3T71A 2VW7A 1KCWA 1KBVA 1JZIA 1WA2X 2Y1AA 3FSWA 1J5DA 2CALA 1ET8A 4FAAB 3X2QB 1JVOA 1L9SA 2DV6A 4HCGA 3FU9A 7PCYA 1J5CA 1ASQA 2IWKA 1NIAA 2X87A 1IUZA 3EH4B 2DYSB 2VN3A 3ASNB 1JZGA 3PAVA 4KOCA 3GYRA 2WO2B 5FC9A 1TU2A 3NJGA 1NWPA 1AQ8A 5I6PA 2XV3A 2QPEB 2N0MA 4NB7A 1IBZA 2BP8A 1SDDB 1OF0A 5F7AA 5TK4A 2B08A 5B7EA 5PCYA 1WS8A 2CJ3A 1KDJA 3PLYA 1OCZB 4YSDA 2XX1A 1IC0A 2BZCA 1UATA 3CG8A 4KNTA 4YSQA 3BQVA 1VLXA 2PPEA 4GP8B 3WNIA 1KDIA 5AFAA 2AANA 2BWDA 4UAHA 3PPSA 1AANA 2W88A 1CYWA 4HALA 2PPFA 5B1JC 1NIDA 3NJNA 3X1FA 3NJHA 4A2GA 4E9WA 5I5IA 2FNWA 5E9NA 1GS6X 2AZUA 1MG2C 4YSOA 3ABKB 2R7EB 1WS7A 1J9RA 1W6LA 4DP2X 2PP7A 4E9YA 2HZHA 1BQKA 1IKOP 2PPDA 1JZJA 3H4HA 4PCYA 1AG6A 3AG3B 1A4BA 3G5WA 2P80D 1GY2A 4NAJA 1ETJA 1ZIBA 3V9EA 2VMJA 1J9TA 1MDAA 2J56A 3FU7B 1CUOA 1RZQA 2UX6A 4DPBX 4DP0X 3NJKA 2QT6A 3TU6A 3BVDB 1PNCA 1L9PA 4Q8BA 1W6WA 1GS8A 1JZHA 3FT0A 2FWLB 5B1KA 3C75A 1NWOA 1AG0A 1XB8A 1L9OA 2J5WA 2PCYA 5TK2A 4YSEA 1QHQA 4F2EA 3KW8A 3X1EA 1AACA 2AZAA 3PAZA 1E5YA 1GSKA 4KOBA 1W8EA 3FPXA 3TBBA 4AZUA 5ANHA 1OCRB 4BWWA 2I7SA 1AR1B 4DP7X 1F56A 2ZWNA 2QPDB
chains in the Genus database with same CATH superfamily
2L7JA 1KNOA 3N40F 1SBSH 3HI1A 4X4YB 1K4CA 4QNPE 3MJ7A 4HF5H 1TZIA 3TH4T 1TLMA 4NERA 3PDGA 3VI3A 4FXTA 2EADA 2YXMA 4KX7A 4YE4L 3RDTD 3WUZA 2P26A 3MRMA 3IJ9A 5ERWB 4O2EB 3V7MA 2MCAA 1K2DA 2ZAHA 2WLNA 4IW4C 4MCZB 5IROC 4Y9EA 1CLCA 1TEGA 1Y07A 3JWOH 3S2CA 2BY0A 1T3FB 5BJTA 3Q9PA 2ESVD 3TYFB 4DW2H 4Q7DA 1P7QB 2N7SA 2VITA 1MI5A 43CAB 4URTB 1SJEA 2AW2A 2LW3A 3EKCA 4R7LA 1QI4A 3OKEA 2BIQA 5HHQA 1HVXA 4CSZA 2OMYA 2RAMA 3V9CA 5I17A 1AGEA 3IDGB 3KJ6H 5DYOA 1GOGA 2EDFA 2PTVA 4ACTA 1YHPA 3ABGA 5FUOL 4Z9KB 5D7IE 3APCA 3LKRB 4MHHI 5IZ7A 3D9AH 4TSAH 1A0QH 3QXTA 1LE9B 3R1GH 5DWPA 1F41A 3GSNL 5EU5A 3T65B 4MNGA 1HI6A 2C3GA 4Q52A 2C9UA 4KVPA 4JPWH 2ZCKL 2CIIA 4OJCA 3VXPA 4Z0BH 3LEYL 4MMYB 1BFVL 2Q0ZX 3RGBA 1B4JH 3G3LA 1JV5B 4IBVA 1FFPB 1U8HA 3Q48A 2F53D 2G75A 3OAYH 1A6TB 1CGYA 1SFHA 2HLFD 3HR5B 4HIHA 2FX9L 2A9DA 2WXMA 3ARBD 5BZWB 4AT6A 2F1BA 2N1TE 2WQRA 1X9QA 3QJFA 3F83A 4JQIH 1EHKB 3SBQA 1SBSL 3HUJF 3KBEA 2EYRB 4M93C 3RNKA 2W80C 4Y4KA 4YO0B 3VFRA 4A2EA 4DVRL 3STZB 1K5NB 3WNOA 1TQBC 5KVDE 2PR9A 4GG6F 4LOVA 3BZEA 3TBCA 1PSKL 5IHZA 3K71A 4HCFA 2X44D 1U42A 5EOCL 2B7DT 3MN8A 4HC1A 4R7VA 3KDPB 1MHPH 4X7EC 4IJ3B 4DZ8A 4QLRA 1Q1JH 5FW7A 1XCTB 2VWEC 1BWMA 4O02H 2WSKA 1R6VA 5JO5A 3KXFE 3IDYB 3SE6A 5BZDB 2NXYC 1CE6B 1AO7E 1MRFL 3FFDB 4QOKA 3F5WB 4RQQA 4GIOA 1ADQH 3L3GA 1NAML 3CU7A 1VHPA 3IAPA 4KRPB 1R24B 1QSVA 2XFXB 3H6JA 3BUQA 1G7PB 3X12A 4PB9H 1D5MB 3MNMA 5IBUG 1QFHA 2F5BL 3ABMB 4NFBA 4XMLH 5GGTL 1UWEH 4I48A 3B9KA 4LHUG 1PX8A 4I7ZC 5DJAB 5C1MB 1MY5A 5B38B 1IGIH 2BSCA 2QKIB 4M3HA 3OX8B 5D1QD 4PS7A 2ZG1A 1M56B 5TF1L 3HG3A 3FJTA 4L4TE 5LWYL 1HIMH 1BF2A 1YEKL 2ICWI 2KDGA 2Z8WC 4UQDA 2WLLA 2X9YA 4W93A 1FH5L 4GRWF 5TE6L 5EOQH 3NIGF 2DIEA 4AEIH 2ZOUA 1DBML 1KCUH 1YLBB 4JJOA 1CWVA 5CIPA 3V5DB 2B5IC 3REVA 1ZS8A 4I1NB 3FB7A 3QORD 1WICA 1QSED 5E00B 1F00I 4HZAA 4J2QA 4OJEH 5KYXB 1I31A 3V52H 4CW1B 4XXWA 3AS3A 4L4VD 4ZMNA 4HK3J 2AGJL 4WFFD 1V10A 2NY7H 4TNWF 4M7KH 4FNPA 4HUUA 1UKSA 5KG9B 3EXLA 4JY5H 1EA9C 5AG8A 5JDSA 3AREB 3V6OE 2WKLA 3CFEA 3C5ZD 3KPNB 5CLZA 4B9CA 2C9AA 3UTPD 1UXWA 4JB9H 2IH3A 2ZNXA 3ETBJ 4NNPH 3U4EB 4JZNB 1P4IL 4YR6A 1RPKA 3U7AA 4YDKL 2WVSA 3IGFA 3E1F1 5F96H 4X6CF 2A9AA 1MFCH 2A1WH 3FT2A 3KD4A 4ENZA 4GS7C 2R23A 3WFDL 2G3MA 3S97C 4PREB 5IQNA 1ZGLA 2CO2A 2FQFA 4GSDH 1E27B 2Z0UA 2ATAA 1YUHB 1BPLB 4KI5E 5DMGD 5I0VA 3T6ZA 4PTTA 5ABAA 3VNZA 4BZ2L 2AQTA 2IGFH 3FB5B 2JKXA 3WS3A 4NENA 2IFFL 2NUPA 2TAAA 3UZQB 3BSHA 1Z66A 3VGBA 1TJXA 3QXDA 1MJ7H 4ODTH 3O45A 1JYXA 3HE6C 3UBFA 1DBKL 4NKOA 1CT8B 3U30C 1IC7H 3LRLA 1GYUA 2ZUXA 4XI5C 4APXB 1G94A 1IEAB 2Y6TE 3JTTA 3QC5X 3NFNA 3Q2LA 3ZU8A 2D3JA 4KJPC 3D2UA 4XMZA 3NDYE 3BVTA 4NQCE 2OL3A 5IOPB 5E6IC 4YEEA 1SJVA 3ATEA 4CGUB 4QDGA 2FTAA 3L2LA 1E4XI 1HAWA 5D4HA 3HHRB 2C4FT 2OMUA 1H3VA 5KANG 4J4PC 1L3NA 1ZLUK 4Z7WF 1ZGLP 2AEQL 1KF9B 1NAMA 5AVQB 1ZCRA 3AU1B 3UTPE 4A6YL 3CV5A 3ECBA 1MCPH 4HDIB 4IU3A 4DW2L 1NFKA 4HS6A 3VFTA 2GCYA 3QQXA 4PRIB 4JKNA 3GMMB 2X4TB 5IVOA 4UQ3B 1U92B 2VISA 1UA6H 3KR3L 4RX4D 1E8WA 4KXZH 5FGBC 3LQAL 5A3IC 1EAOA 2WVVA 2WBJA 2X1WL 5DO2D 3C8KB 2OCJA 3ZYOA 5ILTH 2C4FU 1SFDA 4HEMA 1WBYA 3V4LA 4POYA 2F6AA 4FYTA 5ESAA 4WV1B 2WCPA 1UCBL 2MOVA 4KTEH 1KELH 1NCWH 2CQVA 1YMMD 1U8IB 4GNKB 1RK1B 3BVVA 2BP0A 3LN5B 2K6WA 2YLKA 5L2KA 2Y24A 5AW4B 5DMKB 1ZT1B 2JI2A 2BVYA 2PXYD 3AXIA 3BT0A 3U79A 5IHLB 2L7EA 4UILH 1WA0X 4XBGB 2CBMA 2NZ9D 5I30L 2DLFL 2VZ1A 4G7RB 4UB0H 4E42B 1IBYA 3ZGIA 1I3UA 3HZ3A 1IAOA 1WAAE 1PX3A 4QNPF 4ABWA 4OLWL 4YOKA 1F45A 5I71B 2YN5A 1NMAL 2VLKB 3CDZA 1U93B 3AFLA 4F93B 3T8MA 5I1EL 3WE6A 1KCUL 4L1DA 3T08A 4RDBA 4X4MA 4QRRE 5L8KB 3IVKB 4K71B 4JFYB 3IDUA 4OCRL 5EOQL 1WFNA 1R75A 3RHWK 3LKSB 1S3RA 5DUBA 4PIBA 2G2RB 3GSNA 2FUQA 4RRPM 2E9WA 4XPHL 1S7SA 4MCNA 2LLNA 1N8ZB 1WD8A 4XOCA 5C2BL 5K59F 1K6QL 3DUHA 3UPAA 3RJOA 4A68A 2X3CA 3KPSA 4KXAA 3A4DA 5ISZD 2JKRM 3M46A 2Y3AA 2HVJA 3KH4A 1KLFA 2AMUA 3PGFH 4OLZL 4P46B 1AQHA 2VLJA 4NQQA 4PGZA 1C9SA 4U7MA 4LSRL 4CSPA 4RIRA 1U95A 1ETZA 1RZ7L 3S8GB 5CIPH 3WJJC 2E4TA 3MGOB 1G1KA 3HCVB 5IBLC 1OY3B 1UG9A 2C3VA 2VM3A 1OT1A 1M05A 1VACB 3T3PB 1KXHA 2IPUK 2CCWA 2EC9U 4HXBH 5EZJB 1DJHA 1NCGA 4JFDB 3MLTB 4X9BA 5HHOA 5E08L 4H8WH 1QPKA 4JY6A 1NPNA 2QDVA 4QY8A 5CCKH 3OJMB 1TCMA 5CILH 3RZCD 2Q7NA 1BAGA 3V6ZA 3J7HA 5DS2A 5L4MA 1KBVA 2EC8A 3K6NA 4OV5B 2A74B 1J5DA 3LSOB 4HUMB 4LDLB 4QR7A 3O3DA 3DX2A 3GB7B 5F9DC 3UG5A 2KQMA 4FMVA 3VFPB 1Q72L 4OLVH 2L4OA 3RDTA 5HHPA 1N18A 1WD9A 2X6CA 4Z1PA 4ZNEA 1DVFA 2DYSB 3N41F 4UDTA 3M8OH 4YHMH 3PAVA 5I1KH 4GMTH 5INCA 4YNYB 4ABUA 4N0FB 1UM6L 5DTFB 3KVDD 3GD1C 1Y6MR 3VM5A 3FBQA 1NWPA 2J3SA 5I8CA 3OPUA 4YQXL 5KUKA 1AJ7L 1G9NL 1IAKB 3MRCA 4HV8A 2N0MA 3TIDA 1Q9KB 3ZXAC 1PZ5B 5B3JE 1WS8A 3ROLB 3O3EA 1UTDA 5DWUL 4YSDA 2Z6FA 3G5XB 3V6OC 3UO8B 1HE8A 5C0IB 1M2VA 4OLZH 1A6WL 3DK2A 1V27A 4E41A 2QZQA 3OXRA 5DO2C 4CDHA 3WY3A 3VXSB 5HVFB 2AANA 2BS8A 3VO0A 4RFOH 1P4LA 3MO1B 3IMBA 3I6KA 4WO4A 3PWPA 1AMXA 4A2GA 2CBTA 4AYEC 1T1XA 1TQVA 2FNWA 2G2NA 2VLLA 1WUZA 3LZOA 3HC0B 4X9HA 4YDLB 4HFUH 5JA8B 3H42H 1TJIL 4I4WA 2B1OA 3B2MA 2W65B 2KBGA 5AVVB 5BS0A 5F70A 4IBWA 1OOAA 1RIVH 2DQFB 4OZHE 1Z9MA 3OXSB 3CDFA 1A3RL 4NQDE 5B4MD 5BXFB 4GSQA 2VMJA 2F7RA 1T1WB 3QRGL 4H1LB 2VZOA 2N7BA 2IGLA 1MFUA 5GGRY 1AQMA 1SYSB 4PS8A 3E9TA 4E5XB 5KANI 4RA3A 5J6GA 3CMGA 1YEWA 2PR4L 4OD1L 1FFNB 3T4YA 5IQ9A 1CPUA 3EG9A 1OCWL 2HKHH 4PJ9A 4LSSH 3UTOA 9CGTA 5I74C 3S37L 3UDWA 1OAXL 4K0OA 1ZSDA 1CLYH 4XI5D 2J8HA 5JW5B 1LP9B 3CFKB 1MIML 4J8RA 4MNHB 1XR8A 1E9OB 1AACA 1JFQL 25C8H 4KRPC 2DQTH 3CUPA 3MMEA 2C5DC 1DLHA 1KIQB 5FAAA 4RSYA 3WN5B 3ULVF 4EIBA 4ZPTA 4EOWL 4OZGE 2DWYA 1HT6A 2XVGA 5DMGC 1PVHA 4M7LH 3GI8H 3OZ9H 1UFUA 2QBWA 2Q1EA 5EU3A 2GIYA 1WBXB 1BCIA 3ZRCC 4Y5XA 2X4RA 4PCKA 1OP5H 4GKNB 1YVLA 2B16A 2CO7B 1JK9B 3I75B 4X5XB 1J0ZA 2CHNA 1NC4A 4AYID 5HDLA 2NY7L 4OGQC 2F74B 2KERA 2WSDA 4L5FE 3IPBA 1EBAA 2DWTA 5INDA 3QRFM 5A6LA 5BPPA 2XQYA 3L3IA 3V0HA 1GMIA 4OM0H 3C5ZC 1MW3A 3NESA 2XWDA 4H26A 4BXSV 2OXGA 4NQED 3ETSA 4K5NA 4RAUA 5BUPA 5FA4B 1QLEH 5AWNH 3UJIL 3DHPA 4KKAC 1INQA 4Y1TA 2ZKHL 5DC9B 4Y4FD 1VB9A 4G7SB 3A67H 1TJHL 1NANI 1WQVT 1P6WA 1F11A 4N9OB 3FFOA 4AJ0A 4OD2B 3IB4A 2WXRA 4OTXL 4U0RB 3OHXC 5FGCB 1OK0A 4OCXH 5KVGE 4I9XA 5IVXA 1GL4B 2K4AA 3TGXA 4YSAA 4IIQA 1NCDL 1WDAA 4BFGA 3GMNB 3CFTA 3RVWD 4F9PC 5DJ8B 1NGQH 5HDBE 2R0LL 3N44B 1AGCB 4OZIB 1M6OA 1H0DA 1VFAA 4GO6B 3WFBH 2GABA 2GIMA 2CHDA 5DD5H 3SN6N 3TYGH 2FWOA 1DZ0A 4O51A 3FNKA 3UGEA 1N9PA 3ZHFA 3RPIA 4C47A 2MCPH 2WJ5A 4XCYA 12E8L 2HSIA 3U6XA 3QZWA 4ZTEA 3D3VA 1NBVH 4YAQA 5ICZB 5D1QC 3MCLL 2JXMA 2R0ZH 5HHVH 4XB8A 3VX1A 2X6AA 4B9FA 4X9GA 3Q0HA 3O3AB 1JK8A 2K1MA 1ZJBA 1P4IH 5I23A 1BAFL 3HMXH 1I9RH 2BRQA 1T83C 3TPUB 4OJYA 5I30H 3MBWA 4Z0XA 3RJDA 1J8HB 2VDOL 3ULVE 1U8NA 3DVGB 1XF5B 4ERSL 3L4VA 5B38A 4K23H 1CI5A 1Z3RA 2NXYD 2H9GA 4OFYD 4PJ5B 1EEUA 3ESUF 1HILA 5DQJB 1QSEB 1NIEA 3QRLA 4KNUA 5D7SL 5H2BA 4APQA 4E41D 3MRJA 1Q0XH 4IM8A 4PD4K 4R4FL 3TVMC 5I26A 1T21A 3PYCA 2GEQA 3NABL 4KROD 3ZMNA 1OZTG 2ADIB 3MODH 4DOHE 5ADOL 5B1BB 4P59L 3B9EA 1ZY9A 2F53E 5K9QI 3BUTA 5JQ6H 3EYOB 1PY9A 5CJBA 1GTNA 3KBPA 1EPFA 3VH8A 3H42L 4AUJA 3GBEA 2EKJA 4WI3A 4AQAA 2EICA 3FBKA 3G6AB 2IADB 4AUUA 3DRQA 1C5BH 2KHAA 4XVSH 1YY9D 3CSYB 3QFJD 5GS1B 4DWHA 4EMZA 2AC0A 2WXNA 4D0CA 4Z7IA 2E5EA 1JGUL 4QYAA 4KQ3L 4HJ0D 3BYYA 1GZHC 4RMVA 1CLOL 1TVBA 4KO9A 4NM4L 4TRPH 2O93L 2R69L 4HD9A 4JREC 4WHTA 4WUKH 4XMXA 4NN6B 2ENQA 1RZJL 3BHBA 4A63A 4JRXA 4QRRD 4FG4A 2MNWA 3G6AA 5E6SB 6PAZA 2MCG1 1V7MH 1TOXA 5E8PA 2VJ8A 3DK0A 4JM2B 1LP9F 1FZKA 2BVUA 2FL5B 4F3FB 5IB2A 4LCCA 3EBIA 4KI5F 1HQ4A 1T4KB 2K70A 5DRZB 2H0FA 1PCSA 2ADJB 3KJ4C 2UZYB 2VR7A 4ZUUB 3ZDXB 5I19L 1FP5A 1INDH 1VFBA 5AOZA 3CZNA 1P5VB 5ECGA 5SX5H 5MEOB 5IROD 4PJEA 4M43H 1EO8L 1VFMA 2CNZA 1HH6B 3T3MF 2BHZA 4APQB 5A2KH 5KSBF 1I4FB 3K4DA 1I7TB 1ZK5A 3H4FA 3IN0A 2G5UA 4LSPH 1CYXA 1MCLA 1DJZA 1HHHB 1T7ZA 3GWJA 1Z7JA 2C7UB 4PY8I 3W0WB 3MA9L 4J5VA 3VFOB 5A43C 1F3RB 4D3CL 3WEBA 2Y7MA 1UOLA 2BSBA 3EDJA 1KPUB 4Z3GA 4TULL 4WW2A 1KMGA 1NMCB 3NPZB 4NZTL 1KCRL 2IXQA 2X89A 3TPUA 4NO5A 3S7GA 1IARB 1A7NL 4ZXBC 4E9LA 1P4UA 4M8QA 5KSVB 2EP6A 5ANMA 4XN5A 3ARGB 3FCGA 3T1WA 3MJ7B 2X4OA 3T0DA 3MHZA 1MY7A 2FWSA 4GAYB 3RWHA 1FGNH 2BSTB 2DYPB 4TF4A 4HUWA 4KJYB 5DQDL 2EDBA 1MVFA 3CLEL 4TL5A 4UT9A 4K73A 4PJFF 2VDNL 1ZLDA 1IGCL 3BRDA 3BZ4B 3KPPB 3CC5A 3QCTH 1YC7A 4Y4HD 4L8SB 3RL2A 4CVXB 5EC2A 1OANA 4S1DC 5DDHB 3SGEI 3CE1A 4UT7H 1A22B 1ETB1 3L5XH 3AB0B 1XX9C 1KGCE 2OMNA 1SY6L 2IC2A 3KG5A 1S7XB 1KN4H 3IDJA 1EV2E 4M5TA 4K7FA 4Q6IA 2IDSA 4YMPA 4XRCA 4C54A 1L9QA 2IXQB 4K2UL 1K8IB 2Q6WB 1L6XA 1QUNB 5D1QB 3GHBH 3GSQB 3NOIA 3JV6A 5BOZG 1O9WA 3L9EA 5C3LD 2H6PB 4S1RL 3D48R 1QWUA 3ME0A 4FULA 1JPST 5C08D 4JPSA 2XYBA 3OMIB 2G0LA 1EHAA 4PJGF 3P0YH 5AAWA 4CADA 4Y16D 4G72B 2QFRA 3QJHA 2DQIH 3KYKH 1J86A 3MRIA 2B9BA 4Y8AA 1KCVH 1RPQA 2A73B 1BD2A 4ZW5A 4FS0A 5T3XL 3SBRA 5EDSA 4B9PA 3NCCB 1PLAA 4MJJA 4NZRH 3W9EA 2V5MA 4K5MA 4F7EB 4AGPA 1DSYA 4LLWB 2ISDA 1NDGB 1GHFL 1RVFH 4DN3H 3O9WD 2A6KB 1NLDH 4MCMA 2YKLH 1BXXA 1WCBB 3NIFB 3SE4C 3UJJL 2VLRB 5IR1A 3MNZB 1FFRA 1YEDA 3NJXA 3MUJA 4MGXA 5D2NE 3C09C 4ZS6D 1OGAB 4YHPA 4PSPA 1AZBA 1FZJB 3JWNH 4JPIB 3C5ZB 4WEMB 4CC0A 4DP5X 2VMCA 1PG7H 4XWOD 4YSPA 2WNXA 3FSZA 3TNMA 3O6FB 2YAMA 4ODHL 2F19L 5DJYB 4PV9A 5GS2D 2B2XL 3MV9E 4P4RA 3WU1A 2BIHA 2FR4B 1KBGL 4IMLB 2NY5H 4LSUH 3JWDL 3TT3H 1JGVH 5LDUA 3HPLB 5C08E 2OYKA 3PHSA 4OQTL 3A4FA 1PKQE 3JWNC 4K9JA 4XP5H 2RGSA 4DKEH 4G1EA 4IRZL 1AQKL 3UGUA 1N4XL 4HWEH 4M9PA 5HYSB 2YMXL 4M6AA 4P2AA 1A0QL 1DBBL 5DC4B 3QSKB 2NX5B 1LO0L 3EF4A 4FLHA 4RGND 2JH2A 3U7WH 3CH1B 3RWGA 1I8LC 4LEOA 3BD4A 3QEUB 1MCEA 3GXUB 3GBLA 3QEQE 3I6KB 3IM1A 3VRJA 3T0EA 4PJDF 4EXKA 2AJSH 3CFCH 3W39A 4KH2A 1OAKL 3BUYA 4DQOH 4XCFL 2JCCF 1EO8H 2B4CH 1SJHB 2HX7A 4MDJA 5DK3A 5EO9A 2FBJH 5JW3H 4U3SA 3QIUB 1SLUA 1X5JA 4LP5A 4WHDA 4XNQA 2VLJE 1HXYA 3IDMA 4L1SA 3VGDA 5I8KH 4N8VA 4JFFB 4H0GA 4O02A 3QHZH 2GTWA 2PWEA 1KJ2B 4M3JA 4FTVD 1H3PH 1H3UA 4F8OA 1YYCA 5DZPA 5AYUL 5E5MB 4Q56A 5CGYD 5IG7A 4UINL 5E23A 1YEGH 5I1LB 3FOMA 5IESL 2CMRH 1G6RB 1ADQA 3H2QA 4TV3A 2YPVH 3F05A 4OF8A 2FCBA 3E0GA 4POZD 5EBMB 3GYRA 1CQKA 5KYUA 4F8QA 5FC9A 2YEZB 5FYLL 3CIAA 3X14A 5I16B 3VRIA 1WIUA 3BWAB 1R3JA 5JMRA 1Z5YD 1VGEL 3Q13A 2CDEB 5KJRL 3B4NA 4DAGL 3MJWA 1ETA1 4FXGB 4NC1C 4S1QH 4M9OA 4Z7QF 4U1SB 3B7RL 1CF8H 3WFHA 4JY6B 3H3PL 2A9NL 3AQZA 3LRGA 1VLXA 5IK3B 2F18A 3PIQA 3ULVH 4FFYL 3PHOA 2EUZA 3J2PA 1RSYA 4HALA 1NIDA 4X6FB 2D3LA 4YBQD 3RTQD 4FQ1L 5CSGA 3RWFA 4B50A 3NFPA 4YPJA 1TQUA 4TN9A 2OMTA 1MCSA 2AJ3A 3FK3A 1HL8A 4F37K 3STBA 4NC2B 4KPHH 4AL8C 2PP7A 4AENA 1JIBA 3HBPA 4YHLH 2AXFB 1JTTA 1CD0A 3KL3A 1Q0XL 2PWGA 4H20L 2GTZA 4LCVA 2I9TA 2W9DH 4FERA 3BZFA 3IPFA 4U6VH 4IHOB 4YXHH 1G7QB 2IFGA 2GY5A 5J56B 4FZ8H 5ETUB 5CLYA 2LFEA 4HX1B 3D39D 5IJVA 3ZDZF 2QMKA 1DFBL 5FK9B 2YEVB 3DROB 1U3HC 3VXUA 4UIKH 3D39E 5IFHH 3ULUH 4Y0GA 4AL8H 3EO1B 2H2PD 3POCA 2O30A 4XOEA 5KYWB 3EJQA 4X6BB 3LHPL 1I9RL 1MCFA 3QZLA 1QHQA 4XHJD 2FSEA 1J0KA 1GGCL 3LNHA 3MCLH 4B7LA 4LSQL 4ZW8A 5E24E 5E9DE 3QHFH 1D6EB 2Y72A 3NK4A 4AM0B 4LLVA 4P46D 1BQHG 5IIEB 1BVNT 5FYKU 5MERB 4MDJB 2OJZH 4O4YH 4NN7B 5JPNC 5DD5L 3TYGL 2ZCLL 5DLMH 1C8QA 3DUSB 2ORBH 2OI9C 3TNNA 1ZT1A 4W68A 3BGMA 3VFWA 1BYNA 4G5ZH 4ZFOL 1XIWD 1O9VA 2ZUTA 3U9PH 5HXMA 1JGLL 1FFNA 2GJJA 4IOSD 2WUBL 4ALAL 4DUXA 5EDXA 4MS8C 1WEJL 3LIZH 3LH2L 4OT1H 2LVEA 1R9FA 3QFGA 2X6BA 2Z31B 3B2UD 4UIMA 1PZSA 5AZUA 3WSQL 2XLLA 3BUIA 1TQCC 2X2JA 3LKPA 2V5SA 4JBSA 1KPVB 4L4TB 5HD8C 1M7IA 4PSRA 3NJFA 4CGTA 3KL5A 3E9UA 4MA8H 1WFUA 4H2CA 4NZ8A 2AS5M 1HZKA 5FHBH 3QFJA 3NCJH 4DCQA 1VA9A 4XN9A 1HSAA 3VXTA 1TVHA 3Q6GH 2CDEA 5JHLA 3K7UA 1VCAA 1V7NL 1I8MB 2NQ3A 1BFVH 1OKEA 1R3IL 2RCSL 3INUL 3BPOB 3EYFB 3DO7B 1JPFB 2AKRB 1QBML 3MO1A 3OKOA 4FNRA 3NAAL 3WFEL 3QQ4A 1RFDL 3DX6B 2N1KA 4HG4J 4YJZL 5EBMA 3VA2C 3KLKA 4JZJB 3DOSA 3IGAB 2VAJA 1DO5A 3OXRB 4MXVE 4TLKA 1J5HA 3QQNA 3I74A 1FWXA 3LZLA 3LD8B 1OE2A 4PLKC 3WY4A 5CJQH 4F9LC 3QEGH 1U8MA 3QI9D 3RTQB 5MI0B 4PTUB 4PB0L 5KEZA 5DJCB 4D0DA 2GTWB 4RMRA 1JRHI 4MAYB 5JQIB 4LSVL 5AVYB 1AXTL 4QUOA 2E9JA 2Q76B 4P3DA 1TPXB 3NMEA 3SKNB 5DTFA 3NJMA 4CMMA 4FNLH 2F61A 5I19H 3AXLB 4YLQT 4HKBA 5DT1H 1E2VA 5JXAL 5BVPH 1WZ1H 4XMTA 2JIXD 1AO7D 1I1AA 4EPSA 1YEGL 1BZOA 3SSGA 4GH7B 4P48A 3OHMB 1R17A 2Y36H 3QXAA 1U3ZA 1BEXA 2AAAA 2PLTA 4KVNH 4YSSA 2KC0A 1ITCA 3MUGB 4UDUB 2DD8L 3G9VA 2J2ZB 4MB4A 4FQLL 3F6IA 2XC8A 2ZPKH 3MV7E 1I8KA 4XVJL 1BBDH 4E9QA 2IQ9L 4KWUA 1VFUA 2JMRA 2XBDA 3ARFC 4U2ZA 4YDJB 2CO6B 3U4BL 3NEXA 4A7VA 3EJPA 3H53A 1IM3B 3QUZC 1PYWB 3V0JA 4KKNA 2JQMA 4KMTH 1RMFL 1VACA 1TJGH 3MNVA 1VDGA 4J23A 3CFMA 2WQAA 4PJGE 4NNXA 3QZWG 4YSUA 2IH3B 1RIUL 1JPSL 5AAWC 5D55A 5LDSA 2YPVA 4F8TA 2DTSA 4GIAA 1I85C 4JL2A 4PR5A 3CHPA 1ZXKA 4ZD3H 4X6DB 4IRJA 5DJYA 3CVHA 5TQ2L 2X70B 1IFHL 1MHHA 3RBGA 3DBXB 4JDTL 1Q9LB 4ZODA 1IM3A 3RB7A 1S7VB 4DN4L 3H56A 3SGKA 2WWOA 4HJIA 4HWNA 2I5YH 4OZHF 1KN2H 1QRNB 4QI3A 5D7LA 2IV8A 2P80A 3G5VB 15C8H 3NSFA 5F1IA 3B5GA 4CU8A 1F90L 3DXAB 1BQ5A 4NP4H 3M7FB 1WCBA 3VX0A 2VLRD 3MI6A 3GUTA 4PBWD 4K8RH 2KZKA 3PHQA 1UACL 1UT9A 3ZX1A 1V5JA 1A3LL 3SDAD 3OKNB 1ZS8B 1U93A 4ELKB 3SDXA 3T6VA 4HJ1A 4NRXA 3MFGB 2QGCA 3MFFB 2YPLB 2X4SB 4GMTL 3K6FA 2ZKXA 4NHCH 5J3HC 1CBVL 3KLDA 2CGZA 3QJHB 2YKLL 1E2WA 3D33A 4XC1L 1D2OA 5FDYA 4QJ5B 5EO9B 5C2UB 5I71C 3I3EA 3FU7A 2ETWA 2ED8A 3KYMA 4JLRA 4S0SD 5JR1H 2FYYA 2WP3T 2NY0C 5LGJB 4LIQL 1G5AA 1R33A 3TO4A 3VYPA 2ITCB 1EJFA 2XG4B 5D1ZI 2V0AA 1Z9PA 2PTTB 1WIPA 3S34H 1UOWA 2ZP8A 1KY7A 1NEPA 2ZE0A 5T1KB 3D34A 3OBAA 1NL0H 3WMPA 3K46A 4RQQB 4X42A 3HAEG 3TZVD 2JQAA 1CICC 2JB6B 2R0LH 4N6RA 2I9LB 5DFTA 1RZ7H 4LARL 4IIZA 5J1TC 3LXAA 5IUCA 4F7TB 2UWEB 1J18A 4UQ9A 1HNFA 1M57B 3B2DC 4OSUL 3C5SA 5AVRB 3LRSA 4HK0B 5JHDD 4GOSA 4L8SA 5E6ZA 5IQMA 2KLSA 5MENE 4RFEA 3BGMB 1CIDA 3VFWB 1PD6A 1PW3A 2UYLB 3MOBH 5BRZA 4OVUA 1OLZA 2X40A 3WXWL 3D25B 1T1YA 4QEGA 4WI7A 3VXMD 3O4LB 5FO7A 1NDTA 4WI4A 4KQ4L 2A0LC 3G5ZA 4QTHA 3BEVB 2VDPB 2N3JA 3QJTB 4N8CL 1N3NB 3A6OA 4X5PA 3EIFA 2P48B 1FAIH 3CXHK 4HK0A 4FFVC 2NY6B 3O6LL 1A7PL 1HESA 2QVFB 4HIHB 1IGCH 2E56A 3BI9X 4N9GB 4UANA 1Y1UA 1W0WA 4FKKA 4KKBC 1U8QA 1WP6A 1XGQB 2CBPA 2FLRT 3MLRL 3OM3B 2VDKB 3DOHA 4ZZKA 1LDPH 1QMUA 2IEPA 3UAFA 2XXMB 1AZRA 5T1JA 1WUNT 3ZUCA 4JO1L 4AMKH 2WAHA 3TFKD 3Q1SL 3F7RA 1A6WH 4LFHD 1U8LA 1CC3A 1U8LB 2E6QA 1FIEA 1HKFA 2BXYA 3GTVA 4DGVL 3DSFL 1JRHL 2K8MA 2UY7A 2ITCA 1AR1D 2MJWA 4LQ1A 2E9IA 2HJFA 3VYOA 1L5GA 2ZUYA 4JMXA 2OJ1A 2J6EH 4JVWA 2IGTA 2VXQL 2NYZA 3NFSL 5DRWA 4UINH 1CLYL 1XZ0A 4O58H 4PJBF 1FPTL 3MBWB 4NRYA 5GGUB 5FYKL 4GS7B 4LSSL 2WWMC 3UZEA 1AE6L 3QFJE 4NDMA 3KLHC 2EEAA 1FNSL 1DVUA 1Q9WB 2O5ZL 2Y1VA 4M48L 2PR4H 1EWHA 4K3EL 4KTEL 1URZA 5IK3A 3SDXB 1X9UA 4R7DB 4Z7UA 3NEEA 4XP6L 5FYKE 2HVKA 1QG3A 4ZPVB 4KVCH 1EQWA 4HS3A 3H1ZA 4OF0A 1A5FL 4D9RE 3WKMH 1IJNA 2PN5A 1RD6A 2J1XA 5T1KD 1R3JB 3DXAA 2VO5A 2NX5D 4YSCA 3RWIB 4TUKL 4FJZA 4NQEE 3BDXA 1AKPA 3C60A 1QRNA 8PAZA 3ZDYF 2RD0A 3REVB 1XF4B 3FFCE 1UT1A 2HKFH 3GIZH 4C56D 3GBMH 4UV7H 3LPWA 4YXLH 1NCAL 2CH8A 4QXTB 2ZWLT 1PLBA 2AV1B 2HRPH 5EIIB 5G5DB 4Q9QL 5ANMB 1F6FB 3BC9A 2VDRH 1K6QH 3HC2A 4KK6D 4N8VB 2B39A 2BVOB 2IH8A 1ODAA 1HILB 4JQXA 4PJIB 3WIFB 2P1YA 3A67L 4OCWH 1FUNA 2A9ML 2PTTA 3KCPA 3ZKXC 2FGZA 1SJHA 4J3SA 1WCQA 2KDYA 1SYVB 1AJ7H 1P7KA 3D39A 5CBAB 5LGJA 3EOAA 4ZD3L 4M5SA 5TE4L 2QVTA 3A21A 4P23C 3HJ0A 5E8OA 2WLMA 1CZ8H 4GXVH 1OHQA 1YEFH 2QVMA 2R8SH 1DR9A 1I4FA 4LEBA 3HKFA 1F4YH 4LL4A 5D4QA 4YX2L 1ERNA 4WLCA 2XWBA 1NMCC 1SDAB 2XFXA 1TJGL 3FMGL 3O3AA 2D7QA 2X3AA 2YD2A 3Q5TA 1Z9SB 4GP5B 2VW4A 4ONGL 3F3HA 3GI9L 3LIZA 4JEGB 5FYKD 1XF4A 1U0QA 4DTGL 3QDME 3L1OL 2P5WD 4JVPA 4B3VA 3QCUL 4A38A 4OBRA 4YLCA 3ZTDC 4DZ8B 2R27A 1YAZA 4GFTB 5GS0H 4LDEB 1H0DB 5IJBC 2R56L 1EDYA 3LZRA 4XCNB 4XMPL 2HVKB 4B7IA 1KTCA 2X87A 4XB7A 4GAGL 5JYMA 5J11B 5FO7B 5FB8A 2DD8H 4LCCC 4Y1AE 4ZFFA 3LXUX 1GOHA 2YD7A 4LPTA 4K5PA 2I07B 5E8DH 3W2DL 2DWEA 5AVWB 4GEJA 1B4LA 1T5XB 3TN0B 4HWUA 2B08A 3L3DB 4G82A 3CVHL 3AC0A 1KFGA 2QQNL 1BVLA 4G9FD 3TJHD 1E28A 3LB6D 1IM9B 4L3CA 4RRPG 3BQVA 3BCFA 3MYJB 4F7EA 3T5WA 5IHUH 3INUH 1T7WA 5FGCE 2YGVA 2W88A 2WZ0A 3ZL2A 4D94A 4G11A 4R2GD 4PVBA 4JM4H 1UXSB 4K94H 1UXLA 2DQCH 1MG2C 2W94A 3D0LB 4HPOH 4CBPA 5D71H 3MNDA 4HFWB 32C2A 4FFYH 5GGRA 1AFVH 1R0AH 3TJPA 2XWJB 5FA3B 4FMKA 4XX5A 4Z3EA 2XG4A 1RIHL 2X4RB 3CPLA 4HKBB 1FHGA 3V9EA 3FU7B 1E4KA 4UMSA 4M4PA 1QW9A 2IDCA 3GSQA 5HYIA 3SD2A 1PJ9A 4FFWD 4X8JB 1DP0A 3QR0A 5EB9A 4M7JL 1NCBH 1F97A 4OZHA 1FVCB 1AQDB 3FT0A 4YQXH 3G5ZB 2FWLB 5FFGA 3U7YL 2MPAH 3HMWL 1F6AA 4ZSOE 3WKML 1EJ6A 2J5WA 1DVFB 1NGZA 5EZLB 3HNVL 2YHGA 3VFUB 1A6UL 3EG9B 1XGYL 1WV7T 3B3IA 2OP4L 3FH7A 3B3IB 1XR9A 1ZWIA 2EKSA 5FM8A 2WXGA 4XAWH 5IJVB 2V8MA 3HI5L 3VFUA 25C8L 2J6EA 4E9TA 4ZFGH 1CN4A 3O2DL 4Y4HB 1I8IB 3GMLA 4FQLH 2I9TB 4N0UA 1SMAA 4JY4A 1KGCD 3TBYB 2MCMA 1UD4A 2DYRB 4P23B 1T6BX 3VGHA 4DOHB 5E1QA 1JHLH 4F9LA 2UXTA 1NFDA 2O6PA 3FUIA 5C0AD 3EW3B 3QJOA 4Y2DD 3FPYA 4OD2A 4DVRH 5K5YA 2IJ0C 4YS4A 2ED7A 2E7HA 2X4QA 4GW1B 4IOIA 5A7BA 3Q01A 4MXVF 4BA0A 5GXBB 4HUNB 3OR6A 2CLVB 4JKWA 4WI0A 4P5RA 4FF9A 5D7LD 3Q1SH 1RUQH 5FA4A 3KWWB 5D1ZB 2UY7B 3O8XA 1TENA 4Q9BA 1TTFA 4IBZA 4HFWA 4FJ6A 2X1OA 3ROLA 2ZX8A 4PP1C 3TEUA 3EZJB 2HFEB 1CU4H 4R26H 4KRLB 4JHWL 4I85A 1K4DB 4PWGA 2BS9A 3BAWA 4YNYA 4L8SC 1JSYA 1ZTXL 3I9GH 5TF1H 3OKNA 3FB6B 1JF5A 2BSED 2R9HC 3BPCB 2OBGA 2PETA 3FB6A 2C9PA 2UXGA 1IFRA 4LK4A 4CKQA 3RZWA 4Q0XH 4R7NA 1IGYB 1VGEH 1W0YT 2V3DA 4JGJA 4ZAKA 3NABH 1L0QA 5E5MA 3WXWH 2CIKA 3ZE0F 2YK1L 4OI7A 2IBBA 3K1DA 3G5VA 3BHBB 3QULB 5ECJE 1M1XA 4ZXBB 3DHJA 5PAZA 3LKQA 4ZAKC 4PUBL 1A6ZB 3UACA 4G6JH 3CFKA 2WQXA 4BKSC 2NW3B 4JS7A 2DQJL 3QUMH 3KWWA 4JQIA 2XJKA 1QW8A 1TZHB 4PWIA 2UYLA 5BRZB 1BZQK 2AXHA 2R83A 4A2MA 1MCOL 3LRSB 5JXAH 4H8UA 3FQNB 3W0WE 4CKVX 5GSVB 1MH5B 4I18A 4NUGH 3B56A 4QF1A 4F7TA 1C1EH 1HSAB 2NR6D 3OTTA 4MAUL 5B1AB 1IL1A 4LVHC 3PPEA 4QAWA 2YARA 3EFDH 3JVFC 3KWVA 4NP9A 2W5PA 2BNQB 3F2LA 1AIFA 1IKFL 5F89B 3VI4A 5ACZA 4KKPA 3S98A 3U2SB 4NHUA 5DUJA 1RU9L 1QUPA 3D2UD 3V4VH 2ID5A 5BOPA 3MGTA 3BWSA 1OTUD 4QIRA 4QRTA 5HYFA 2BRRH 3CN4A 3FO9A 5F8RC 4QWWC 1FORH 5IKCB 3TS8A 4KUCF 1EZLA 1CMOA 5ABDE 3O41B 5EZLA 2VDMB 3ES6A 3OD3A 3WHXB 1L0XA 3SPCA 3CDZB 4AYMC 3H9SE 2JCCA 4LAQL 2Z8RA 4WHCA 1IGIL 4GEIA 4L3EB 1KIPB 3IU4H 1G9EA 5ITFB 1BWWA 4ODUB 2ADYA 4E42A 1KG0A 1CGUA 5FKPB 3MRPB 3RY4A 3I6GA 2XRAH 3TJEH 1I3RA 5F1NA 5LN8A 2WLYA 2WUBH 1R46A 1U33A 1Y6NR 5JQHC 4P9HH 5D2LF 4O51B 3GB7A 5B1JA 2DMCA 3VXUB 5J5EA 5KSUB 3U6RA 2BP3A 2VABA 1I8MA 2O5NA 4Y1AA 1BF8A 4PFEA 4PTTB 4B27A 4DN3L 2OSXA 4J8QA 5C6TL 2ROYA 4DCQB 5C07E 1MHPL 3NCWA 4N2IA 5F89A 3VI4B 3KMDA 1N10A 2X6UA 2X6MA 1A2YB 5BV7B 5KJ4A 3GFUA 1KXQE 1RJCA 3CCHA 4QTIH 4WI0B 5EIVA 2Z31A 2CE6A 4X5WB 3IAQA 4IDLA 4I18B 1D5RA 2BDNL 4MBRA 3WIHL 2YQBA 4OIFA 1SBBA 4KRMB 3LH9A 3WGVB 3WJMA 5J1SC 1HL9A 3NA9H 4RISL 3VG0H 3MCKA 2R0WL 3SDCD 3NIFE 1ACYH 3D18B 3H3KA 3TNNB 1KBKA 2XN9E 2OTPA 4GPVA 4PJ5D 4UOJA 4RCAA 5KVGL 5DD1H 1JN6B 3QDGB 4KHTH 2E9GA 1KFAH 1AGBA 4Q58C 5MERA 4HUUB 2ICCA 3L3IB 4W9GC 2O6DA 1S9VB 1MJJA 2WIIB 2CHZA 2AGJH 2NYYC 4XPFH 5HHNA 1S9XB 1M1XB 2ZSVA 2B4CL 5I5MA 3FCTB 3MUGA 2ENJA 2FATH 3MNZA 4NWUL 3MRFA 3CC5B 5K9OA 4JJ5B 4KHXL 4AIZB 1JCKA 1FL6A 2VB5A 1J8RA 2J25A 1KT2B 1KT2A 1HCFX 4G6KH 2EVGA 4FNTA 4K2UH 4XO9A 1QRKA 1I8UA 4OBSA 5E4EC 4N22A 2H45A 5AVTB 4PY8J 4NC0B 3V6OA 1KYOJ 3MNWB 4LEEA 5GZNA 2X2YA 3ARGA 2IV9A 5C0BD 4ONHA 3ULVL 2NMSA 3FU5A 3PJLA 4HIXH 1IAOB 1NUGA 2O4EA 2JF1A 3WTTA 1HTYA 2BJML 3NVQA 4X80H 1HOEA 3A3YB 2JKIS 4XBEL 2WO4A 5E1AA 5C0RL 4J3VA 4ODSL 3H8NA 4J3OD 3ALWA 1MPAL 2C7UA 2A83B 4Q4IA 3QQ4B 3NYKA 3BE1H 3VCLA 1BMZA 5GPRA 4GUOA 3T4YB 3R18A 2IFFH 5FLVA 4ENEC 4OF6A 4FLQA 4A55A 3JWNE 5FM5O 3SYOA 4D8PB 4WV1A 1AZZC 2I85A 3GM0A 2VJXA 2VSKB 4LU5H 1NAMH 2BVEA 4JFFE 2ADJA 5D7EA 4EAEA 4JHBA 5FECA 2XQBL 1XGRB 3QQ9D 4L3CB 1Q72H 1BJMA 3Q8CA 4DFHA 3GXDA 1T7XA 3HMWH 3S37X 1V3KA 4XCFH 3A4EA 1E67A 2WIMA 4I3RH 5EC2B 2LHAA 1IKFH 2WQ8A 2DY2A 3OG4B 3SE9H 4DQAA 4M1GL 4H0IA 4GUCA 4XNZB 5IHZB 1C8PA 3ARQA 3PV7A 4BGDA 4GO9A 2J20A 3RWHB 3FOMB 3SOBL 4AIEA 5C6PB 4K71C 4NUGL 4X8CA 3C5ZA 3LKQB 1BP3B 1TJMA 3LXBA 5ITFA 3T8VA 3BCDA 5LNGA 2FT6A 3MUZ1 5E0QA 1V54B 1XD0A 4W9CC 5JUEL 3VAEA 5GGUA 3NJIA 4GW5B 4EF3A 2WZAA 2XTJE 4C55A 4R7NB 3RKPA 5EPMB 3VFOA 4XNZC 4MAYC 4NKOB 4LSUL 3NCEB 3O2VH 3OGCA 3GRBA 4LLAA 1L5GB 5KYWA 3AWFA 3LVEA 2KQNA 5DJAA 4GT0A 4HWBA 3QC6X 4ZMYA 3FO9B 1VPOL 3T09A 2ZXQA 3IK2A 4WUUE 5FOBB 1A1MA 1U3YA 5HI4C 3ZKSD 3G7TA 1WGOA 2Y25A 3K0WA 4PRHB 2XWBB 1PLGH 3CIQA 4FQ2L 4JM4L 4OCRH 3T0WA 5ACZB 1AGEB 4M8UA 4XNDA 2D7TH 4WU5A 3AM8C 4AIOA 2E76C 1RUPH 2HUHA 3K2MC 4FQ1H 1GTFA 2KYIA 3NG5A 3PS6A 2BHFA 5D96C 5CLWA 3Q5OA 2ZOWA 5IT2H 4OJFL 43CAA 4JZOB 1ZV5A 1IGML 3IE9A 4NN5C 1XF5A 3GTNA 4TYUA 1X44A 2GBAA 4LQFH 4BHUI 4ZO8A 5F6HJ 2MQCA 5HHMB 2EXYC 1SXAA 3M07A 4HZ1A 4P5TC 3UMNA 1ASPA 3CCHB 1GC1H 2HJKA 3MDJA 3KPSB 5CJXC 4AK2A 1S7XA 2E7BA 2EE2A 1THAA 4LSDA 3QG7L 1F2QA 4HJSA 3TBWB 5EOCJ 1A6ZA 3QISA 1ZV9A 2ZYHA 3HG1E 4YAQB 1O5PA 3T71A 4ZFGL 1DEEA 5LJYH 3BAYA 1OGAA 4FA6A 2CMRL 1JBJA 3UTSE 3P4MB 3RWIA 3IKKA 4A1RA 3QPQC 5IR1B 2JLLA 3UCQA 1MHEB 3CQFA 1P7HL 3OV6A 2P28B 3BP6B 3FN3A 3FCBA 2VN3A 3SDXF 3I84A 4CVZB 1XGRA 1H8LA 2J4WH 3ASNB 3BKJL 5CD3B 3I6GB 3W3BA 1S9WA 4GBXB 1SXNA 3L08A 4N3UA 5AYTA 2Q76A 4JG0L 4P2QB 5KS9F 4FABL 5I6PA 1KG0B 4HMEA 4JN1H 5CBEA 4HA1A 3RWJB 3QDJD 4C4KT 2X5PA 2WWKT 4X8JA 3RVUC 2FLMA 1ORQB 1XIWB 4LLMB 5FO9A 1QSEA 4PRBB 4TVPL 3LX9A 2XTJD 5DRWB 2HT4C 4WY7H 4GP8B 4NRZB 3W39B 2BWDA 4AQOA 3EYUH 3PPSA 1LHZA 3W9DA 2IIJA 2G60L 3B9KB 5DC0A 4E68A 3X1FA 2WLJA 4DKEL 2CGRH 2WHVA 1UUSA 1D5MA 3BDYH 4NN5B 4IRSC 4NZUL 3VXTB 2NZIA 3D85A 3PQYD 1BQKA 2DEXX 3C8KA 5G5DA 1K4CB 1EXHA 2DMBA 3ATAA 4Z7QE 5LAPA 4XCYB 3QUKA 1DDHB 5DJ0B 5ACLA 3BQUD 3C60B 4PRIA 5FHAH 4JGMA 5C09D 5IVXF 1WZLA 1IFHH 3A23A 1TXKA 3L3DA 4PRHD 1R3HB 2DMKA 2LU7A 3BVDB 1VFAB 4MLIA 4JRXB 1UM6H 3FCTA 4NI6A 1SVBA 3L8QA 4N20A 4F2MB 4ODBD 1QKZL 3O6FA 2V9UA 1S9VA 2XZAL 2IOIA 5IF0B 2ZG2A 5D72L 3WEXA 4F27A 4RESB 3L2MA 4ZJ9A 1N7MH 1Q9LA 5F7EH 4Z18A 1FFOB 2EDEA 4AGQA 3NZUA 1FRGH 4U33A 1G7HB 3TBBA 1J0HA 3MBXH 5IQ9B 1U9KA 4BWWA 3HZYA 1IQDB 1F1DA 2UWEF 4FYSA 1VESA 3MJGX 4XZ4A 2R39A 1IGYA 3VD9A 3QO1A 3ATFA 4X0NA 3HG5A 4YLBA 4ADGA 3FZUC 1T1WA 4PJCF 1DO6A 5I6NA 1NKRA 2BM3A 1F3DH 4TQEL 2NY4B 2QGEA 4X6DE 1JWSB 1LWJA 2DQFA 4NQSA 4WU5B 3WELA 5C71A 4OAWB 1KJMB 5FFLA 4F5CA 3T6WA 8FABB 4L8CB 4OCMC 4POUB 2X12A 2JJTC 5B7MA 2Z31C 1K8DB 5JMOC 4BWUA 4CVUA 4AMKL 3U6RB 3PFQA 5KSUA 3FSAA 2VRKA 2XVKA 3U4AA 4W6WB 3W9DB 4KAQL 5JW4Q 4GBXD 4PWFA 2MQ0A 4FQ2H 2MH4A 1NAKH 2WNKA 1W0WB 4I88A 4JM2D 1IBFA 1UM5L 2BHUA 2YD5A 3JV6B 1ZS2A 3G5XA 4NN7C 5AL8A 3QDMD 4GW1A 4AKPA 2ICES 1ZVYA 3HHMA 1UXWB 4MRBA 4HLZH 3O2DA 3P9WB 5EF2A 1JMXA 4X6EA 4OSUH 2EDHA 1JYVA 5I8CB 2YPLE 4JY4B 3RZCB 1D5BB 2BOCB 1E5ZA 4N0UB 5KVEE 4J2XA 3FUKA 4KDTA 5FFOA 1T1YB 3WHXA 4Y7OC 4FL4B 2H6OA 4M5YL 2ZXWB 35C8H 3H0TA 1GMEA 1INEL 1N5AB 3OKOB 5IW1B 3U83A 5IKCA 1IVLA 2YAEA 1BJ1H 1X5ZA 4H8PA 4IGBB 1FC1A 1KCSL 3MLUH 2MRYA 3ZKQD 3TV3L 5KYXA 3MGTB 4WFGD 3D12B 4Y4KD 2ZOLB 4WEBH 4ALAH 1G0YR 4G43B 5T1LB 4PGEA 1XB6A 1BAFH 3VTAA 2ZIDA 5E5UB 4A2HA 2JB6A 1OV8A 5TDPB 2C26A 4HSQA 7PAZA 4BGLA 2BY3A 2OZ4L 3OVUB 4CN4A 5MEQA 3N04A 2BWIA 3I9IA 5CP7A 5EU7E 2P47B 5H2BB 4YFLI 4LF3A 1NFDF 2FJUB 3RGVC 4J3WA 4O58L 1U95B 4YHYB 3ARFB 4X9YA 2FD6L 3OX8A 5J4MA 1LILA 1LQSR 1TZHA 1S3KL 4WGVB 2F68X 3MRHA 5E4EB 1CDYA 1OGPA 2MNUA 2GBVA 4W9KC 1XXDC 1NGXA 4W6YB 3U0TB 3ZTCC 1ROWA 5F1KC 3QJUB 2NX5A 3BE1L 3DPBB 2VXQH 3NFSH 1SM3H 3RQ3A 1IAKA 3MRCB 4HV8B 2WV3A 4P2QA 1EZSA 1X4ZA 2JXMB 1INEH 2XTSA 1KV3A 4OD1H 4Y5XB 2FL5A 3TPKA 1A6VL 1DJIA 5IB2B 4Z7OF 3KLAB 4HPYL 5HHPB 3QAQA 5EPMA 3MXWL 4N0YL 3RDTB 1BYOA 3CD4A 2RIKA 5KVFE 1RH8A 1IQDA 4LZKA 3CZKA 5I75B 1TVDA 5IT2L 1QLEL 4WY7L 2EDLA 4NCC1 5F1IB 4GXFA 5AWNL 1YCSA 5HHOD 3BESR 4AG4L 3WD5L 4PQXA 4IK7A 4HS3B 1OK8A 3KGUA 5CEYB 6CGTA 5IP4A 1XR8B 3KWUA 5DSCA 3TVMA 1EJOH 2IOOA 2E75C 2Y6SC 3GMNA 4DEUA 4JFZL 3FSOA 4JPIA 3OF6A 2M2DA 3INOA 5I1AB 1AR2A 5L9DL 2Q20A 2W0PA 3WHE0 5LQBL 1GYWA 1F11B 3DETC 4LCWE 3O2VL 5F93C 4QHPA 2VMEA 3DKHA 3OWRA 4M62L 2DI8A 3QUKB 2VW6A 3P69A 4LPCA 4X6FA 2MQ3A 2NTFA 5DJ0A 5CKAA 2Y06H 2IH9A 1QFUL 1ZEAL 4L4JA 3MV8D 4P23A 3CSBA 3VQLA 3VQ2C 1BVOA 2C1OA 5SV3A 3GZKA 4QD2E 1EBPA 2LU3A 3EBGA 1BX2B 3LKNA 2EH7L 3LKPB 3U4BH 3FT4B 5DD3L 3OAWA 2IPTH 4OUOA 1S5IL 2ZCZA 2Y0SA 2XWZA 5F9OH 5DUBB 3SHSA 4D8PA 5I17B 1A47A 1E40A 1JWSA 2WN3A 2IWEA 3CN1A 4OY9A 2OSLA 2CO7A 2SODB 2EEDA 1UENA 4HJUA 2GHWB 2W8CA 4LEXH 3KYMB 4JLRB 1XHHA 2TSBA 3P73A 3F8UB 3R7RA 1ZA3A 4NX0A 1FO0H 1G6RA 5K1VA 1BZDA 1F6AB 2QLVB 1CGWA 2QV2A 1HL4A 4XC1H 1A4AA 3TA3C 3CFBB 2DLGA 4F37F 1QWHA 2AJSL 2Q2EB 3KPMA 4KTGA 5T33H 5TFSL 4KK9D 3KEHA 3MV11 1FCGA 1L7TL 5SX4I 3Q8AA 5DVKA 3IWVA 4PTUA 4GT7A 2WTOA 2HJLA 2CHWA 3OHXA 3CHQA 3E8UL 4N2BA 1NBZA 3RNQB 5A2JH 4O9HH 3FUEA 2A2QT 3PL6D 3MKKA 4OFYA 4MJ6B 2ZCHL 4ZYKA 3T0EB 1MRDH 1OW0C 1BEYH 4APQD 4N0RA 2O61B 2R4SL 2ZONA 1RK1A 3C5SB 2BSSA 4GMSL 2EIMB 1MREH 2Z8SA 2H3NA 3PWVA 1KLUA 4Y9BA 5ICXB 5DEGB 4EIZC 3MX0B 1P5UC 3GO1L 4UTBA 4WCYH 1BX2A 1XSIA 4XNUH 1QAWA 4Q9CA 5CD5D 3ZYJA 2ZP0T 2ALAA 3LPOA 4ZTPH 1CFTB 3IMVA 4JPKH 1YA5A 3BN3B 3D18A 1JDAA 1DVYA 1BIHA 1BVLB 5ALCH 3DHUA 1MG3C 4NO5B 3HIZA 1QYGL 1SLXA 3IDNB 3FFCA 2GCYB 1XD1A 3VFTB 1CD1A 1G4MA 3EZ8A 1MAJA 3RWFB 2WYTA 2D2CC 2GHZA 5I82A 3PQYE 1FO0L 1A6AB 3UADA 1EX0A 1Z2KA 4K3JL 4M6OL 3THMH 1N5YH 1CD8A 3AREA 2A83A 2EXWD 2IGFL 3KNBA 4L3ED 4G71B 4AJWA 1MEXH 2YWYA 4PM1A 2KL6A 5T5NG 3Q8EA 4H26B 3WFHB 3ARDB 5I0XA 1MXGA 2XPGA 3K8KA 5DHEA 1SN0A 4OZ4B 4Z8FL 4HWBL 1C5CL 2FB4H 4AM0A 3HPJB 4TNVF 4Y1AB 1A1MB 4LXFA 2CZNA 4ICWA 4XVOA 1B2WL 5DD6A 3MLYH 1IAMA 1OW0A 3QHTC 4HGKC 1CDIA 1WFJA 4TTDD 1LNUB 3HFML 4LRIC 3FTZA 4HIEA 4CVZA 5CD3A 3UZVB 2WO3B 3UZVA 3NH7L 5F7MC 3ZN6A 2NLJB 2VDRB 3BLKA 5E5LA 3IJSB 2AXGB 2XZQL 5F21B 4AL8L 4P3DB 3WBDA 4NENB 1QKZH 2P5ED 3O3DB 3O0RH 1D3CA 1GGIH 3BW9A 5D1ZD 5HP5A 2ZXDA 3QWRD 4FQPA 2WSPA 4D0DB 1NFAA 1D5XA 2CCVA 2I69A 3L5WB 3P0VH 4PS3A 5E6UB 2ARWA 1TVBB 1WH0A 3APMA 1UC6A 1ZHKA 3ERXA 4WFHE 2Y5QA 4XNQB 2YJQA 4PBVC 1LMIA 2JCCB 3OB0K 5HHOB 1BA9A 5B21A 1DQDL 1JN6A 2X28A 3QDGA 4PJXE 3HW7A 2XXCB 4JZJA 2VN5A 4GRWE 3D85D 5HTSA 3BN9D 4EZJA 4YC2C 4QO1B 4PR5B 3JTSB 5FW8A 2CLVA 4OF7A 2VKXA 3H3PH 3DO7A 3TM6A 1DSWA 2XX0A 5AALA 1WPCA 4UQBA 3IDNA 3CH1A 4X9FA 4GINA 3A24A 4ZUVB 3KPNA 5AAMA 4HKJB 2YD1A 1E0OB 4PP2A 3SDYH 3AITA 3T0AA 3S3DB 3OXSA 2ADIA 4LGRB 3GMLB 2WVTA 3TWCH 4XMLL 1KPVA 2AJXH 4G43A 4L4TA 3DOIA 3L54A 4RGMB 4FXGA 2VLJD 1I8KB 4YL4A 2ILLA 4LNVA 4S11A 4MVBC 2QSQA 3BAJA 3PWVB 5LVEA 2G2RA 2XWCA 3GNMH 1UGNA 4MSWB 1ZDQA 3NCJL 1BGXH 2QADB 1TZGL 3VCLB 4HLJA 1I1AB 2ZF9A 1CDJA 4ZRGA 3LZQA 2H26A 1JHTB 4AEHL 2XTLA 4CMMB 6FABL 3D1MC 4R7DA 3MRPA 1P4BH 4OGZA 4HGMA 4QRPD 4Z7UB 5FYLD 3RZCA 2HJLB 4LIQE 4JPVL 3CFCL 3GEWB 3I2CL 4ODUA 4XOBA 1PZ5A 3WFDH 1Q9WA 3L81A 4AC2A 3T2OA 1MF2H 1JGIA 4L8DA 4QXGL 4YDNA 4ACPA 3HNVH 2P24B 5EG6C 2M8XA 2NR6A 3D2UB 4FOMA 2ZSWA 5C08A 1TYRA 4V2CB 2AXGA 4L2YA 3D3VB 1P69B 5F7YC 5H35A 4HJJH 1MCOH 1J1PL 2HTLC 4FLSA 2IAMC 4IRJC 4I48B 1LO3L 1YNLL 2XV3A 4Y9CA 1B4TA 3SJVE 5DD6B 1NBQA 2QVIA 3I50H 1H9VA 4BUGA 4OW6A 8FABA 4L8CA 4FZ8L 3QI9B 5CFAA 5FECB 3O8XC 4JRXD 5AB2A 3FRUB 3CSPA 1AXSA 3K8MA 4LSRH 2PPEA 1RUAH 2YLHA 1MCNA 4ATWA 1SJEB 3GSNH 4G9FE 1NGPL 1AANA 5BO0D 4KI1A 5B1JC 1A6AA 1V8HA 3BAXA 2CPUA 4KROB 2H6PA 3ZTNL 2PNDA 2XKNB 1SXSA 3TN0A 4O2EA 2UZIL 3HZYB 4NNXB 3NA4A 3OMZA 2BMKA 2WXJA 2WKOA 4RDQG 2NPLX 1FVDB 4PCYA 5CUSL 5E1IA 2APBA 1A4BA 4JDVA 3V0FA 1ZIBA 4BZ2H 5FB8B 2NY2C 3HI1B 2CO6A 2Z7YA 3E8UH 3ZZQA 2EIDA 4YO0A 3T2PA 5KZCB 2VXTL 1FZJA 2BH0A 5ICXA 4YHPB 5I8OL 1E6JL 2YGNA 5DDHA 5I6XB 1MW0A 1JXJA 2OR9H 5DGRA 2CIKB 2QPUA 2ZD0A 3MNWA 3OL2A 2W38A 5AOJA 3ETTA 4NFCA 2AQPA 2A6KA 3VXNB 3V0IA 4HCRH 1CGTA 2JCWA 3N3EA 5KYUB 5IW6B 4QHKI 4P99A 3EJRA 4PBXA 3HC3L 4N6RB 5K9OB 5KJRH 3I50L 4HC1L 2HUEA 3M45A 4UILL 1SQMA 2RA1A 5FK9A 2GT9A 4F57L 5L88L 4AZUA 2AJZB 1KIQA 1MRCH 1KJ2A 3HB3D 4PLNC 4R4ND 1Z9LA 4KK5D 1GC1C 5ETUA 3JBG7 5I8KL 4Z7VF 3RU8H 4J8RB 4MNHA 4WW2B 3ARDA 4U3SB 5GQBA 1NCWL 2BDNH 1RURL 2WZPA 4CU7A 3M1BB 1SN2A 1TTAA 3PWLA 5C0EA 4M3KB 3E2HB 5D1ZA 5JW4N 3LAFA 1P7QA 3DVGA 1UWGH 4K3JH 1U8NB 4LSVH 4EUPH 1GJWA 3MCKB 2GIXA 4JO3L 3SCMD 1VENA 4JRLA 2CSPA 3FHAA 5EORH 2DLIA 1DEDA 3TJEL 1E3FA 2UXVA 2JFCA 4RA0C 1YAIA 4DESA 2YPLA 2YGPA 1CXEA 4HS8L 1OQOA 4KJQD 5HYSG 1CE6A 4QOKB 4PGEB 1PBYA 5T1LA 2RCSH 4FJYA 3H7LA 2NTFB 5CEZD 1JGEB 3GSUB 3ECQA 3BSZL 5EEXA 4FTVE 3QWOA 4B97A 2LGNA 3HI6L 4HDIA 4IU3B 2NT1A 1KCKA 1YJDH 3HOGA 1U8CB 4QYOB 2RJMA 4OZIA 4ODXA 4Z3JA 5F8QC 1KBWA 2JQZA 2C9SA 3UC2A 1UM4L 2NY3C 1J11A 5JOEA 4NXSA 1WSST 4IBTA 2P42B 1UKQA 3M7OA 2M83A 4OZHB 1S46A 2OZ4A 4URKA 4DEPB 1ASOA 3NTCH 5CN3A 2ORBL 2VSDA 4AQAB 1CFSB 2BFVH 3DX7B 3N1MC 2ZF8A 1LO4H 4UDTB 5B39G 3L4UA 3L5HA 3KVQA 2HXAA 3QHFL 4XMWA 1DVZA 2OSLB 3EAKA 2FBOJ 1JAEA 3MLSH 3B34A 2FE0A 1S7UB 3B9KC 3QEUA 2WXQA 2ZWKA 32C2B 4JRYE 4DKFL 5GS0C 1DBAH 3QDGE 3C12A 5GRYA 2DQJH 3ISRA 2DQDH 2NY6C 5BO1L 1G7PA 1RZJC 3X12B 2VUKA 4MBOA 5TQ0H 3T0VA 3QZMA 1VFBB 1HEJC 3U2SA 5JPMB 5FWRA 1WO2A 2FNBA 2NNXA 3BZFB 5EUOF 1T4KA 1JK9A 3MOQA 4X5XA 5DRZA 5FO2A 1FA4A 1H8OA 5E2WH 1RUMH 2DYPD 3BMWA 3N42B 1JI2A 3TOPA 3OAZH 1U8QB 1W15A 1XGQA 4ES8A 4PRPD 3KYAA 3VA6A 1FYTE 1U2YA 3WO4C 4Z0BL 4NZDA 4OFIA 4P9MH 4HU8A 1CO1A 4XRCB 1AI1H 4PRPE 4HISA 3BLPX 1RY7B 4MMZC 5TJWK 2NNRA 5CN2A 5EIIA 1W16A 4IJ3C 3S36L 5I1GH 3H9HB 5DXWA 1A7PH 2DLTA 3TN0D 2BIIA 3C6LD 5GRWA 4CNIB 2ZOLA 4ICXA 4L0YA 4L29B 2YAFA 4MD0A 2XSKA 1U8CA 4QYOA 3MODL 3DRQB 3K74B 1FI8C 1OPGL 2E6PA 1H3XA 3B5HA 4ZTPL 5I16A 1U2CA 3BPCA 4X5LA 1SLVA 4MMYA 4CJ1A 1F5WA 3FQXA 5D7HA 1U8PA 2PYED 4P5KB 2WQVA 1R34A 3LRHA 3W9EB 2I9LA 5L4FA 5FWQA 3VE0A 5G4MA 3TBTA 4NC1E 1M42A 1PU0A 1YNKL 1U2HA 3D85B 4E2OA 1S8DB 3DPBA 1FNEA 4X8GA 3GBML 4YXLL 2FQGA 4DP4X 1E4XL 3FCUB 2F1AA 3FU6A 1J1PH 3VFMB 4BZ2A 2QV4A 4KX9A 1HS6A 3CU1A 5I1CL 4IGBC 1MIEL 3TT1H 4PJ8A 4LRNH 4XP4L 1BVKB 2C9VA 2HJFB 4KRNA 5TE7L 3AREC 4N2DA 3OR6B 5D6DA 1HHHA 3S35X 1UJ3C 4WEUD 1HXMB 1NZRA 5GGSA 5KW9H 1MFBH 2NCMA 4MXQD 3VXRE 4LLVB 4PJCE 5CP7B 4HCRA 3U2JA 2R0KL 2W0LA 4Q6IB 1FNFA 4D3CH 2ZUQB 3MFFA 3OQRA 2DICA 2H2SC 3CSFA 1NM4A 3ZOAA 2OKMA 3WTWA 3L17A 1U8PB 1G1YA 1GW0A 4WNQA 5SWZE 2O5YH 1CBVH 2X4TA 1S7QB 2XTJB 4ZOEA 1AZNA 4H1LH 4KKRA 2Z0BA 2DOCA 2MCPL 3ARUA 2VCOA 3NCMA 3WO3B 1KZYA 4YHZH 1DCLA 1QSFB 4PWJA 3TO4C 3LD8C 2NY2B 2PWFA 3P4MA 1OM3L 1T5XA 1X5FA 2JB5L 3HTLX 3IMUA 2XBZA 4XVUC 1DEEB 2O26U 1MJJB 4WWNA 3X17A 2NXYB 2HWZH 2BSTA 3WTXA 4MD5B 2XA8L 1KULA 3W57A 4NP4L 1V7ML 4NLHA 3P3YA 2EECA 3DX3A 4X6DA 2ATPA 3N85H 4MQTB 4NQXB 5EN3A 1ZPLA 2YAQA 4FQXB 5GISL 1BECA 5JHAA 3C60D 2X2IA 3GHEL 4QRUA 4FP8H 5GHWL 5AOLA 4DEPC 2AEWA 5AKSA 3SDDD 3L9BA 4NJ9H 4MQXC 4Z77B 1Z9SA 1Z9OA 2CCLA 3D4ZA 5ADOH 1C7TA 3GMRA 1UH2A 1AAJA 4GI8A 4PRHA 4G7YL 4WJG3 4HMCA 1P5VA 2F58L 1UXSA 1TT6A 5DYOB 1TUPA 4MB3A 4PN6A 3FT1A 3FO0H 1HQ4B 1MQ8A 4HOXA 4YE4H 3S5ZA 4ABVA 3AGWA 4P4KB 4GSXA 3ULSA 3K6OA 1JL8A 4PI0A 5EEVA 1G9MC 4QKTA 3QO1B 4BWTA 4KZEH 3OZ9L 3KCPB 4NKDB 1CGXA 2B3RA 2W9LA 4PLOB 2BVTA 2I60H 4H13C 2Z65C 3RUGF 3GRWH 3QIBD 3QS3A 4Z7NE 1FLTX 3O6FC 2I07A 4KO5A 4P2QE 4O02B 4R2GB 3ZT7A 3TA4D 3LJ3A 1NCCH 4QXTA 2AJVL 3O4LA 4LMQE 4P2OC 3WEXB 5IF0A 4DO5A 1AXTH 3PAYA 5D1XD 4WGKA 4F7PB 4MB5A 3ZQ9A 2VMFA 3DX6A 3L9YA 5E7FA 4JREB 3FT3B 2YAPA 2DKSA 3CVDA 3WG7B 1YMME 3PFUA 4HBQA 4MSWA 2VR4A 4E41E 4XTRC 4IKLA 5AOMA 1TVHB 4XCCH 2AQRA 2Q8AL 5DVMA 4KJYA 1FAIL 1ZHLB 5C97A 3KBFA 4XO3A 3MLTA 2PW2B 4IIQB 5EZJA 1QTSA 2OMZB 4LLUB 4GYBA 1MHHB 4HHGA 2H8PA 2CJUL 1PG7X 3TASA 5IQ7L 1IL1B 2DI7A 2F5AH 2FHFA 2IMNA 2WTRA 4UV7L 3HC0A 3K91A 3E2HC 4KITB 2AK4D 1ETZB 2Q87A 4EI5C 4UNTA 4BCZA 4YEFA 4XN7A 1CGSH 1OWRM 3FOLB 5G4NA 2DQCL 3LYRA 1BOGB 4K94L 1IGTA 2OMVB 4G8FB 3BFWA 3DARA 1TG8A 4JZOA 1MZZA 1SF3A 4QXVA 3KLLA 5DFVC 3M1BA 5B3JF 5LGHH 1CFNB 2ZOOA 3VG9C 5K1NA 1FYTD 2E7CA 2O5XH 3QZOA 1XVSA 3CX2A 5EUOE 3ULUC 1XBDA 1KC5H 1RJZA 3D08A 4NRXB 2NY1B 3LKSA 2F74A 3V79C 2AJYL 4BQ6A 3QXAB 4JG0H 3VGEA 3GMPA 5AVXB 4ELKA 2G3XA 3H9ZA 4PG2C 1L9NA 2E59A 4LOUC 3S5YA 1OB0A 2CLRB 2NLJA 4OM0L 3ZMEA 3GPEA 3OGCB 1SXZA 5HBBA 3RVTD 1O0VA 2QELA 5C0GA 4N9GA 3SGDI 3SKJL 3SKNA 1M7DB 4GW5A 4M7LT 3RG1C 1IQWH 2YC1B 3HBZA 2RH0A 1OGTA 3X11B 1G7MB 4F1SA 3GZPA 3K71B 2F1EA 4MYWB 5HHNB 2IMMA 4XMVA 5ID0A 5TTRA 1FPTH 1MFBL 3EYVB 2YOAA 2EDTA 3MV7A 1HX0A 4JFXB 4QY8B 5T3ZH 3VWKC 4RWHA 3TC9A 4FNSA 4ISVB 2WO2B 1SGKA 3TV3H 4IRJB 2IAMB 1AQ8A 1MIEH 3TT1L 4WK2B 4M6NH 4NB7A 2YD0A 4JZNA 3KHQA 5B7EA 4X5RA 2X4QB 4ZUWB 4C83B 1OCZB 1EFXA 4LOFA 4RNRA 3T2QA 4N0CC 4H1LA 1R19A 3WTSA 3WTVA 1ZXQA 4HK3N 5JDSB 1IT9H 2EZ0C 3GBNH 2BNRA 4NNYA 4ZQTA 4UAHA 1FBIH 3D0AA 1M7IB 2EO7A 2GI7A 4JAMA 4N6QA 2NSXA 4LL9A 2DIAA 3SDCB 1VCBC 5JYLA 2FVNA 4Y4HA 1I75A 2Y7NA 1U92A 3EYQD 4PJHA 5T1KA 4KKCD 1XGPB 2AZUA 4KI5C 3ZO9A 2J5LB 3CSTA 1EJOL 1WS7A 4IKIA 4EN3C 5DQJA 2VABB 1XR9B 3CDCA 2HZHA 3BKCH 3QIWD 3LXCA 4BA8A 1XT5A 1B3JA 4CJ0A 2A6DB 1HKLL 4K15A 4YHOL 3BZ4A 4BH7B 2YEQA 3CZLA 2JE8A 3RL1B 2NOYA 3N85L 1R5WA 4RGOH 4EEEA 4MJ6A 1KXTA 3DC0A 3R8BB 3DUSA 4Q9RH 4L37A 3SD5A 3ZE1F 4W4NA 1J8HA 2VZSA 4QHKJ 1NBZB 2H0PA 3RNQA 2ZSWB 5C08B 2HWZL 3L16A 5IG7B 3MZTA 4DIXA 1A6VH 3NJKA 3TU6A 4NT6B 3ILEA 1NUDA 4NT6A 5FYLH 1IM9D 4TQEH 1NCOA 4NFDA 4KV5E 1BZEA 3X3FL 2DLHA 1UCBH 1CDUA 4HT1H 4NO0D 5F6HI 5E0FA 4APXA 3QIBB 5IEHB 3LH2H 1BM3L 4XWGL 4DKFH 2FK9A 2PW1A 2XETA 4DGYH 2COVD 3QCVL 3HI5H 3QUXC 4AYDC 3MRFB 3FO0L 4GRLB 2K4WA 1JTOA 3WS6A 4U6YB 4QRTB 5GGRB 3V5HA 1UT2A 1SYSA 1E6OH 2ZSVB 4X98A 3DX1A 1DQTA 5HGBB 1YPZF 4R83A 4AY0A 1YUHA 4W4OA 4OU3A 3FT4A 1MCPL 3UC0L 3L45A 5BXFA 1F58L 1GPOL 4X6CB 2GJPA 4ZMAT 2BNQA 3EFFA 1PFOA 1URIA 1GGCH 2FIRT 3GRWA 5BZDA 5BS0B 3AUVA 3AJ7A 4Z7VE 5CZRA 3SBWA 2C3VB 4R8WL 1PD1A 1KTJA 3HCVA 5GHWH 4ZUVA 4AENB 4NO3B 1EFXB 3ZDXF 4LVNB 3EGDA 2AXWA 2YMXH 1KGYE 2OMTB 2R1WB 2Y3NA 3EYQC 4PMEA 5CCKL 1FE8H 3LNGA 5CN1A 4A6YH 1KJ3H 1CK0L 2P7TB 1YNKH 3PHOB 1UADC 2EZ0D 1F42A 5E1AB 5DVOA 2XPZA 4N0CD 3BVNA 1K3IA 5IBUB 2ZXGA 5D4JA 1NCJA 5CCHE 4ZXBA 4IS6B 2WBJC 2JLPA 5KYNA 1DHKA 5AKRA 4NKMA 3CSYA 1SMOA 3PGFL 2F19H 4WO4D 1PAMA 4C8XA 2DJ4A 4OFPA 2P5WB 4XNBA 1JWMA 4N85A 3UYOD 5AW5B 5B22A 4OT1L 3NJJA 4I9WE 1JF1B 1JV5A 3PHQB 3LPGA 2VXQA 4LLWA 4JJ5A 4AIZA 3E3QC 1LYQA 4PJ9C 5I1LA 3UZQA 5AUMB 3GMPB 3IETA 3QP3A 3SIKA 4YWGH 4LCWD 4ZPTB 2WLLB 2YOCA 2ZCLH 4HSAC 5DLML 2IPKA 4MAYA 3VXSD 5KBMA 3QNZB 1OAYL 5D7LB 2ITEA 2A73A 3MRJB 4U3CA 5DVPA 5EMYA 1RU9H 2WIIA 3CVBA 1HXYB 1KXVA 2AQNA 5I1HH 2HB0A 2K0RA 4NJAL 4PJ5A 1S7VA 3O8XB 4K9EL 5E8OB 4LSQH 3HKZA 4LOUD 3ES6B 2NXZB 5B8CA 3OKLA 5HYQA 4U0RC 3KHOA 2DL9A 5EBWB 1VZHA 5HY9B 1P7KB 3D39B 1NLBH 3G08A 4MAUH 3V6BR 2GI0A 4A7UA 3NA9L 3VG0L 2QLYA 1I7RA 5LGYA 4WHYG 3WIFA 4AZ8B 3NT0A 1X5KA 4IOIB 4YZFE 4LF3B 1AP2A 4FNLL 4BSWB 5JXEA 5KVDL 1NH6A 3OG6B 3FL7A 4KMLB 1JXGA 4KZEL 2G3ZA 2XXFA 3V52L 3OJDB 4I0PD 3PJNA 3HR6A 1ZA6B 3PIQB 3D5OF 1PYWA 4LFHG 4JJHA 1A2YA 3MGAA 2LE9A 3QHZL 4HQQH 3OAZK 1E6JH 5BOJA 1AD9A 1JG9A 2A5UA 5F3FA 2DJMA 1X4XA 4I4WB 3DGGB 2JJTA 4UIMB 1O6SA 3V95A 2VLMD 4H20H 4TMPA 4XNAA 1ZWIB 2EKSB 1KGUA 2QDWA 4IMLA 3T0EE 2FQDA 3QPXH 3KPPA 1AGCA 1CFMA 4KH9A 3GZOA 2ZUWA 5IMMB 4HVBA 2EDNA 3V4VA 4NXKA 3FO2B 1HSBB 3RURA 3GKWL 3OZKA 4CA4A 1ZMYA 2WY3B 4K9EC 5HI3D 5CM1A 4YDZA 4GAJL 4I3GA 3RX9A 4AV4A 3RNKB 3DX4A 2DW5A 2X0UA 5CLTA 4PJ7F 5FXCH 5EO1A 3QULA 2V2TA 1RJLA 1DVQA 5DJCA 2PYFB 4JFFA 2OL3B 3VI3F 3CXDL 4KO6A 3KPMB 2VLRA 4QGTA 4AEEA 1MPAH 5C07D 1KPUA 3O6KH 5KS9A 2G75B 5IQLA 4ONFL 4HOWA 4ZX6A 3IMRA 1RZGB 2NY5L 2NY4C 3MCYA 2BJMH 4OFQA 2XV2A 3C08L 4MNQA 3QXDB 2AQ3A 4W6XB 4JKKA 3EO1A 3DJRA 2A6JA 2VDKL 2KPWA 3O6FD 1K5WA 1W72L 5EU5B 3VSUA 3QIBC 1K8DA 3KW7A 4HJJL