3N2KB

Tubulin-nsc 613862: rb3 stathmin-like domain complex
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
428
structure length
420
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Tubulin alpha chain
publication title Stathmin and interfacial microtubule inhibitors recognize a naturally curved conformation of tubulin dimers.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 113
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3n2kB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3n2kB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3n2kB01
5JVDB 5CA0A 3JATB 3VOAA 4B45A 5CA1A 4HNAB 3N2GB 4X1KA 5IJ0A 4O2AA 5EIBC 1JFFA 4O4HB 4YJ3B 1W5EA 4YJ2A 3HKCA 3JAKB 2GVIA 4XCQA 4X1YB 5BMVB 5C8YB 3R4VA 4O4LA 3RYIB 3JARA 5GONB 4X20B 1SA0A 5IJ9B 1TVKA 3RYHB 3V3TA 4IHJA 3WGJA 4F6RB 2Q1XA 1OFUA 3E22A 3WGNA 3M8KA 5ITZA 4O4JA 3JASB 5EIBD 5KX5B 3VOBA 4X1IB 4EB6B 4TUYA 2BTQA 4O2BA 4TV8B 2VAWA 5JCOA 2VAPA 1RQ2A 5LYJB 4FFBB 3HKEA 5LXTB 3JAWA 4U3JA 5CB4B 5IYZB 5LP6C 3UT5A 4TV9A 3RYFB 1TUBB 3JALA 4IIJA 2XKBA 5LA6B 4DRXA 5CA0B 3HKBB 4ZOLB 4EI9A 3HKDB 3RYCB 2RHLA 3N2KA 5FNVB 4WBNA 3WGKA 3VPAA 5LOVA 5J2UA 3HKCB 5J2TA 4ZHQA 4I50B 4I4TA 5EZYB 4HNAA 3M89A 3JARB 1W5AA 2RHOA 4O4HA 4YJ3A 2BTOA 5MN6A 1SA0B 3JAKA 2RHJA 4X1YA 4O4IA 5BMVA 4B46A 4IHJB 5C8YA 3E22B 3RYIA 4I55B 5ITZB 4ZI7B 5JH7B 5LP6B 4LNUA 5EYPB 1W5BA 1FFXA 4X20A 3WGMA 5JQGB 5IJ9A 1W59A 4M8IA 3RYHA 1RLUA 5KMGB 2R751 5JCOC 3JASA 3CB2A 5KX5A 5CA1B 3ZBPA 4X1KB 4EB6A 5IJ0B 4O2AB 4TV9B 4TV8A 1JFFB 3C8LA 4U39A 3JALB 5LYJA 4FFBA 3WGLA 4YJ2B 2VXYA 5LXTA 1RQ7A 5JVDA 3VO8A 3JATA 5CB4A 3ZBQA 3N2GA 5IYZA 4O4LB 3RYFA 1TUBA 5LOVB 5J2TB 5LA6A 1TVKB 4I4TB 2RHHA 3HKBA 4ZOLA 3HKDA 3RYCA 4EI8A 5FNVA 4O4JB 5GONA 3RB8A 4I50A 4TUYB 5M7EA 2BTQB 4O2BB 4O4IB 1FSZA 1W581 5EZYA 5MN4A 2XKAA 3ZIDA 1Z5VA 3HKEB 4F6RA 4EI7A 4LNUB 1FFXB 3JAWB 4U3JB 4X1IA 2VAMA 2R6R1 4KWEA 3UT5B 3VO9A 5MN5A 1W5FA 4IIJB 4I55A 4ZI7A 4DRXB 5JH7A 5EYPA 5LP6A 1Z5WA 4E6EA 5JQGA 3N2KB 2Q1YA 4WBNB 5KMGA 4DXDA 5J2UB 4ZHQB
chains in the Genus database with same CATH superfamily
2ATCA 2M1ZA 4UHKA 3TTUA 1E18A 1W49A 1SVOA 5IDXA 2D2FA 1W40A 2B36A 1P1KA 2ZSIA 4EZBA 1YOVB 4N65A 3AK1A 2RJOA 3BH6A 3OAAD 4PWTA 2SCUA 2VAPA 5KHGA 1SFRA 4A27A 1TL7C 2PGXA 2WUFA 2IYYA 3K9LA 5IUJC 4PIMA 4OA8A 1VJCA 2AI1A 1YZ3A 2HO4A 2QUAA 4PPQA 4GW3A 2Q28A 3K58A 3AR4A 4GL4A 2AMLA 1D6SA 3GR6A 2FUG6 1Z4JA 2A94A 4PSAA 2X7RB 1BQZA 2QEQA 2Z6VA 1YOVA 4KU4A 2WUDA 5SY4A 3GFFA 2IEDA 4GAEA 1N0WA 3NH9A 4EGJA 4W9MC 4C5BA 1HYQA 2ZJ2A 5AVRA 1T0AA 3D6FA 2HF8A 3CCQV 1V2GA 2AOVA 3N87A 3SIXA 2Z3VA 1KFJB 3KXKA 5DT2A 2JJ1A 4F6RA 3BTOA 3T9CA 3MYYA 1O94D 3UT5B 3OOWA 2YNMA 2K1EA 3HB7A 2JL1A 5A4DA 1GN3A 1HR0B 2OUIA 2PRKA 2VHJA 4WLUA 4JVSB 3B3GA 4B9AA 3Q3VA 4G65A 1KR2A 4YRAA 4QPPA 1ZGGA 3S7TA 5AHWA 1OFIA 3DPIA 1HX7A 1XMJA 3B1WA 4CQJA 4Z3OA 2LO1A 4OP2A 1N2ZA 4CKBB 3LY8A 4R8RA 3UT5A 2DYRB 2CVZA 1WB6A 1C30B 5SYNA 4MPTA 3A32A 3PC2A 1ONBA 1P6XA 3NWEA 1DLBA 3ZRWB 3P96A 3U11A 1X7PA 3IT3A 2AHZA 1VYHA 2I6TA 2G76A 4FNAA 1SOAA 2OC9A 3B36A 1PV0A 1OBHA 4F4IA 4KR6A 1KD1H 1ZK0A 4RF2A 4CKBA 2ETVA 4YONB 4RHYA 2OHJA 4IDHA 1SU8A 3U2QA 1JHOA 1C30A 1L5WA 3SSMA 3ENWA 3S81A 2MCFA 2P6RA 3ZRWA 4CV2A 2A0FA 2QSJA 4XGIA 3JAWB 3OPXA 1ZGAA 5IT9A 3DC5A 1TNDA 1NHWA 1AI4A 2HP0A 3L8CA 4DUYB 5TARA 4RWEA 3CLUC 3D2LA 5ICGA 4UBKA 3L49A 5HCIA 2F3QA 4KH0A 1SRQA 2F23A 2VBFA 3IKEA 4YC7A 2IDMA 5CRIA 3ELUA 3UJNA 1ONIA 2IW3A 3VSDA 1N1MA 1P0QA 3HJRA 5TV2A 3JAWA 3ER6A 3IC9A 1UBJS 2VJKA 5E3JA 4ALIA 4CFSA 3KM0A 5TMEA 3KQMA 3W1VA 2XPCA 4UATA 1H0HA 5D6OA 4MAMA 1I3CA 2AE2A 4YR7A 4E22A 5L3RA 3PUXA 4C4TA 2Z08A 5J3JA 3FBGA 2QVZX 3H1KH 1FPMA 2HVYD 4B4KA 1NULA 3CWZA 4IWNA 5KHIA 1X42A 5IG2A 1GU0A 3QVGB 3P30A 1CG6A 1GCGA 1Q5PA 4JMPA 3S40A 3HCAA 3LLVA 4YXFA 2QAIA 3U62A 4C4YA 2WB2A 1RT9A 1TGYA 3W5IA 2GX6A 2BLNA 5EJ8A 2CC2A 4Q66C 4ZZ2A 2V6BA 2F8TA 2QWQB 4FN4A 3KLNA 1SDSA 1PJQA 3I9JA 3IKVA 3BCRA 3QVGA 4TLCA 5L3VA 3HH8A 3SDSA 1JDPA 3ZCPA 2N3ZA 2WU4A 3K04A 3GRUA 2XNDD 2OFWA 4LPSA 2XRFA 5TC4A 3GJXC 3H2YA 3OOHA 4AZWA 1SVKA 2SNIE 3KHUA 5DOZA 1ZD2P 4ZYUA 2VWHA 4M7OA 5HY0A 3H4TA 3NC4A 2H48A 4FE4A 2WSBA 5K0ZA 3J7AR 2FN7A 1KDVA 3EORA 4CCSA 3MEQA 1M93A 4CLRA 2QF7A 2CDCA 4AY6A 2WSLA 2LRHA 4UNIA 3EQ8A 1MX3A 3OI7A 1XRMA 4AUMA 2DY0A 2OO7A 4W7IA 3AY6A 1YCDA 1DBSA 3R3UA 5THKA 4Q00A 5ALXA 4DR7O 2P8SA 1EUDB 4FDVA 2CY0A 2O5CA 1ST2A 2GM4A 3DCNA 1KDOA 1AK1A 5K0CA 2JEZA 1P0CA 1W55A 2Q3FA 2VJMB 4LYDA 1KI7A 1OZGA 2OD7A 4X7BA 2DWPA 3WRWA 5I9TA 1DDGA 2WSIA 1NGSA 4D0RA 1TK2A 1ZD4A 4NBTA 3KJNA 1ISFA 2PHZA 2P90A 3DCYA 1JFLA 1INLA 1MNAA 5LQDA 2AXTZ 2ZIMA 5IYZB 4WZ6A 3WB2A 2FUCA 3CNOA 3D0RA 4J0CA 4MYSA 4EI2A 3RUPA 2VJMA 3KV1A 1U40A 3I1YA 4EABA 2NO4A 4LF6O 3WAKA 3ADCA 1KDTA 2OTCA 3TE7A 3QPBA 3VHXA 2Z3ZA 1UBUS 2O8BB 4UARA 5IYZA 1QVVA 4D3ZA 3FGOA 4PYRA 3HJTA 1E4YA 2DBRA 1N8RW 4YDSA 4OUDB 4H13B 1C8KA 1JFSA 2VXOA 3D1VA 2FRXA 1XCLA 1O0CA 2VH1A 1GPLA 4YRPA 3QELB 3EFHA 4QXQA 1GZ4A 3BFPA 3ZR4B 4GBMA 4H60A 1JIJA 1ZN9A 1YI2F 2ZBDA 3B8MA 2VP2A 3QPAA 5JXJA 2O8BA 4F4JA 2HSDA 1UFRA 5CD9A 3GT0A 3CNEA 2JKYA 4OUDA 2Y92A 1PZGA 3GJ5A 1BYUA 3OY7A 4KMSA 3FB5C 2PPLA 1M0SA 3HCDA 4P4TA 4C0QC 1TJ5A 4CQNA 1BG6A 1EGAA 3RFRA 2ZATA 2JLQA 3T38A 4IBOA 2J9GA 1TPYA 2XV1A 5KYXB 2D6FA 2VZ9A 4HN9A 2FC3A 4JUCA 4U7FA 1DKNA 4B31A 2JH3A 4Q3OA 3OT5A 1GTZA 1EAYA 2WTAA 4K0KO 3GY0A 1XRPA 4OGWA 1EXMA 3QE4A 4N03A 1SBZA 5KBYA 1LSOA 3C4QA 2C2OA 5KYXA 1SQ5A 2IE0A 1G60A 2JHCA 2IIQA 1HK7A 2RHRA 1RQPA 2PAFA 1XPUA 5YASA 3F2VA 1X8XA 1ICEA 2GBOA 4MWBA 4L8YA 1CUAA 1O3YA 4NMWA 4FWTA 1OGJA 1YI1A 1WKVA 2I3AA 1E2DA 8MHTA 3SXUB 5KVAA 1TTTA 4RPLA 1DEKA 3DZBA 4M9RA 3QUTA 3QNWA 1CQJB 3K9SA 3HU3A 4TRJA 4RTKA 4BJ5A 2O1SA 1P7CA 3TW0A 5G02A 4OXSA 2DW4A 2NNWB 3O93A 4FDAA 4AWXA 3PNLA 1R15A 2I22A 1NI4B 4MVRA 4LCUC 2UYGA 4RL6A 3V80A 5EYPB 5IBPA 5JQGB 1GOTA 4Y1EA 1R4ZA 1RC0A 4ZAFA 1I4LD 2BGIA 3IAS1 1CQJA 2R0QC 2CYBA 4KLRA 3IDSA 4X0EA 3DZIA 4CQLA 3VNQA 1GKUB 4PG7A 4P22A 2V97A 4GPAA 5B1BC 4NBVA 3QLJA 1QGUB 2DUUA 4QUIA 1M2NA 5MN5A 2WP8J 3KEOA 5EYPA 5JQGA 1R8QA 4OLBA 1CRLA 1RVDA 2BMDA 4BO4A 3A0BZ 5TIIA 1Z33A 4JCOA 4XB1A 3B12A 3NIFB 1JKJB 3LFTA 3UF0A 3GDGA 1Z2NX 3SBXA 1SB8A 5KU1A 1I51A 1TF7A 4PX3A 5LPNA 4PLPA 1BTOA 3ZI4A 2TMYA 2Q1UA 3MAAC 3UO8B 1JFRA 2QROA 2F59A 4LA4A 2VYCA 3IVRA 1PYDA 1NIPA 1H8HG 2FLKA 2VKTA 1CUBA 2L69A 2NSYA 2ID9A 4DLLA 4WINA 2FUKA 2Q4PA 3TNDA 1W36D 4CR8A 1JKJA 3ZWYA 3KJHA 1P4AA 1Z2CA 4JI0O 4XIJA 4TMXA 1G2PA 1T5TA 4P1ZA 5CYOA 5IAGA 2NUBA 2WJWA 2FE4A 2H1IA 4OEHA 1OXBB 1VE9A 4LZLA 5IDWA 4PZUA 1AS2A 3JVHA 4CEJA 1W30A 3O84A 1SKUA 1WCIA 4AX8A 4DVGA 3EZNA 3BSYA 3LZCA 4PFKA 1JIIA 4NIMA 5BUQA 2PUTA 3PGVA 4EHBA 3JZAA 3RODA 2QL9A 3U13A 3SJAA 4N0EA 4Z1VA 5JHGB 4TKLA 3KU1A 1E4OA 3FR7A 3HA7A 3H2GA 5CVCA 1G41A 4K3AA 1TQ4A 3JWHA 5F5LA 3M2TA 3NBXX 2GEBA 3AEXA 4M0MA 2BKAA 4IMJB 1ICIA 2AKYA 2XMPA 3EFEA 1O94C 1AHIA 2N47A 1JU3A 3PC8C 1R27A 3RFCA 1PFQA 4HS4A 4TROA 4C4AA 3U9SA 5JO9A 4KGZA 4HQRA 1TZCA 3AM5A 3T1VA 1YJXA 1YCGA 5K6TA 4BRWA 1KQNA 1ZK2A 1IXYA 2CW4A 2VNAA 4N8DA 3JTEA 1UBFA 1E1RD 1MENA 3PQ6A 3P4UA 1GR1A 3O1LA 4DA4A 1ZN2A 4Q1VA 4AP5A 3EK2A 4KCGA 4G4VA 1V7CA 4UVHA 4GMGA 2BE9A 4RYDA 2CB0A 3OTIA 1JS1X 4BNWA 4IQ8A 2O6LA 2HJWA 2IV3A 4KSCA 1GPMA 2VT6A 2ODMA 4FXOA 2CNLA 3NAQA 4H3VA 5FKJA 4LK2A 2JRIA 2QU7A 4RKYA 4MGYR 3BE6A 2YIAA 3BWYA 3DMFA 3SR3A 3JQPA 1SUDA 5AW0A 4MKFA 3TTVA 4ZVOA 5CNMA 1PRYA 5JVDF 4NOJA 2OCXA 1ZVMA 5KTTA 2C2XA 3FTQA 2IXBA 1RJWA 3IQZA 4EA6A 4GU5A 2QTOA 4PSDA 1E3LA 3KRTA 5F2NA 1OHHG 4OJTA 3TH5A 1PR3A 1ZJ4A 3CT6A 1J23A 5EJ6A 4YGYA 3VU9B 3REOA 4F5EA 3CEMA 2EL7A 2AR0A 4KAXA 3RUDA 2XCUA 2E4YA 1U8ZA 1SD5A 2ZXEA 3ROXA 1H4TA 2AJLI 5L9AA 4FYWA 2R11A 3OCZA 4DLAA 2WLMA 1VEWA 4XIFA 1N8RH 2IWHA 1OYOA 4AL4A 4ENUA 1OASA 3IJ5A 3VU9A 3MBMA 2I3ZA 4QTUB 4C04A 1Y3DE 2PQ2A 2WTXA 1YBMA 1D4AA 5H8WA 3UANA 1QNFA 1R73A 1AKQA 1ISHA 1U3DA 2I0FA 1TMOA 3ASYA 3Q3IA 1RXIA 1X9HA 4OGLA 2KYRA 3W8FA 2ASEA 1M56B 5TX7A 4F3KA 3LIIA 5LMNB 4YT5A 2P7IA 2IH2A 2K4MA 1RYEA 1FBTA 2AJDA 3FTDA 1IMOA 3DJYA 2GJSA 2V55B 4IHJA 5LQSA 4L02A 3HY4A 4G4IA 1KAEA 4D9FA 3MXTA 3R0IA 5I9MA 3OUTA 3HNRA 5AIBA 1UKZA 3SIRA 1C4WA 3K9QO 1QGAA 1HFWA 3Q8HA 3WKDA 4UCFA 1ZCAA 1L5FA 4C29A 2GT1A 3B6EA 1J00A 3T3EA 2YJGA 1HGXA 2ECOA 4IDQA 5HRUA 3C3AA 2ZSFA 1TC2A 3QLUA 3S27A 3NHJA 1L7VC 1FUIA 2O23A 3OEHG 1M5RA 4QGBA 2VJDA 2WILA 3ND9A 2VHCA 2QMOA 3F8SA 5JIBA 4WOPA 4DCPA 1EX9A 3UTDA 4TMZA 1EWTA 1OLXA 5C1IA 3QXXA 4UCVA 1B8UA 3AG3C 4HNAB 1A27A 1BOFA 3OOEA 3GLUA 4R1LA 2ZVYA 3WGYA 1Q84A 3D8UA 3CWQA 5K0SA 3KE1A 9GPBA 5JSFA 3MNFA 5DHPA 5AW2A 4ZVPA 4CF6A 1SRRA 2C04A 5AI4A 3BOSA 2NU8B 1BT8A 5D1HA 4A0GA 2NTYC 3E58A 3FAVB 2EIHA 2G3YA 4HNAA 1GUZA 3P71T 3WSVA 1YC5A 4B3TO 3EQ9A 5LP6B 3IB3A 3C6MA 1KEVA 5F77A 5IXYA 4MRVA 4XE5A 3IE0A 3H6KA 4JI6O 5HTOA 3NP9A 2WYOA 3BFKA 3BXPA 3SIPA 2NU8A 4XGRA 2V7QG 4XUCA 4EPVA 4EUKA 3ZRVA 2JJ1G 1K9VF 3QLEA 3KWJA 1CERA 2XVMA 4XM2A 5LP6A 3TETA 1RQNA 4CT5A 1XVLA 1OIVA 1YL5A 1O54A 1MNQA 1HQCA 4FGJA 4RDXA 1ZGCA 5JLJA 4QBTA 4L4ZA 3OX1A 3KQOA 1XEQA 2XDQB 3I01M 2CVFA 4PYJA 3V4OA 2WLIB 1ADBA 3DNPA 1I4EB 3UMJA 1USIA 3V4RA 4H4DA 1E61A 2G63A 2WK1A 3MWEB 3QOYA 1QYDA 4HPWA 1M1XB 1JJ7A 3K30A 4FD3A 3EAGA 1XQ8A 4NE9A 3SZOA 1SK8A 3CLRD 4HH1A 5JJ5A 3LM8A 3WKAA 4B3MO 1RCUA 1OA0A 5EXTA 3FWHA 1VQNV 3Q3HA 5ELMA 1YITV 1UM9A 4R3UC 4I9FA 3LY5A 1BJTA 3TAHA 2XDQA 2QPTA 1XDDA 1NH2D 4S1NA 3INYA 4J16C 4Z1MD 2ES4A 1XKXA 3MWEA 3AI1A 4NDZA 3ZJVA 3PDUA 4LPKA 4CM6A 4JLWA 2JGRA 2OTJF 2CUZA 3EUFA 2PKQO 2GVNA 1N2CE 4P93A 1Y42X 6REQB 1Q2XA 3U40A 3CZPA 3SC4A 3OZGA 3HI6A 3SPXA 3U9TA 2V6MA 2Z5GA 4AG6A 3IDOA 4H6VA 1CJCA 2LDXA 5EG5A 4NXNO 5TPWB 1Q21A 1U8UA 2RONA 1OOEA 2H1SA 4I3GA 2E2WA 4GZ6A 2L18A 1CZHA 1QK4A 3ZS8A 1H22A 1R0WA 6REQA 4U1RA 1M0TA 4BLOA 4PWYA 2RARA 3ANXA 3N3AC 3VQVA 621PA 2CTQA 3ZBTA 3T5PA 3ESXA 4PIPA 1PFWA 1WJGA 4BHTA 4LTMA 3S99A 3TJRA 1Q12A 1PYOA 1N2JA 4AB1A 5TPWA 1YKGA 2HDHA 3QUAA 1WNSA 2OXRA 2OIEA 2HLDD 3K0EA 3ZWVA 3C7KA 3RKSA 1G0OA 1FNNA 3HSKA 5F5NA 5L4LA 3H05A 2ZTMA 1C9JA 1S72V 1JOYA 1KU6A 4X54A 3C6KA 3WXBA 2V1DA 4E1BA 1J5XA 2OXFA 3MS4A 4M60A 4BKOA 3ZE2B 2P77A 3KX2A 3DXXA 4IR7A 4FC7A 4R81A 3K35A 1Z29A 5BY1A 5FP0A 5EJEA 4LXTA 4NTZA 2HKIA 3QEJA 4ZZIA 1HBJA 2HYIC 1PLJA 2R1UA 2W6IA 4J0EA 4V0ME 4FMCF 2CAZC 2OCKA 1JFTA 3P9IA 4D25A 1A8IA 3IBSA 2W70A 4MUNA 1ZWIC 1JSRA 3ABKB 4OX9B 1CNMA 3QWAA 2NQ8A 1ZC4A 4LF9B 3OQIB 3W2IA 1JFVA 4XQCA 5I5EA 3L0OA 2H0QA 5BQPA 2EX3A 2CXPA 3CC2V 4Q19A 1MC4A 1GWNA 4JI8B 3OBIA 1JIXA 1JBEA 1U8TA 1WDWB 4LRWA 1DJNA 5BOVA 3HDJA 4BAGA 5GVRA 1XZNA 4HDCA 1CF4A 4AF6A 4JLMA 3OQIA 1XTPA 3IR5A 1UF9A 2BAGA 2OZPA 1MQAA 3L8HA 1YJ5A 3PRYA 2ILTA 4BFXA 1FYDA 3DO6A 4TVSA 2HHHB 1TK9A 3KFLA 4FCTA 3DT6A 4ER0A 2XE7A 2R8OA 1HLFA 1LUVA 4U7GA 2E5LO 1QV7A 4II2A 3EWSA 5EC1C 1DGQA 5IZ4A 2PR7A 2GZLA 4BLTA 1RQRA 2H8PC 5CUQA 5K8CA 4AJLA 3LNNA 4QE7A 1U7DA 5IJXA 4R6XA 3ZWDA 1WPRA 3PWSA 5KDLA 1YMVA 3QPWA 4P7KA 4XVCA 1BHO1 2PY6A 4EB8A 1EA7A 1FLVA 2J87A 2JFUA 4GI2A 3AMVA 1UBTS 4UBIA 1CR2A 5HF8A 3VQXA 4CI9A 2CVQA 3AVUA 1SOMA 1M10A 1RFGE 2PQ0A 4MW5A 1QG0A 4Z4QA 2C8KA 4BB9A 3TKAA 1JHQA 2P69A 1A04A 1BA3A 3AHCA 3IPCA 2HB6A 4AUKA 5BSVA 2G17A 5JCOC 3FETA 5BWNA 2ZR3A 3CRQA 3GPCA 3ZBQA 4YJDA 1TZBA 4KHPO 1N32O 4YQZA 5GPBA 4F04A 4JYAO 4C2UA 2ZAUA 2A9HA 3HP1A 1D6MA 2X4GA 1MDFA 4EI7A 3C3JA 2GD6A 3GH3A 5KAMA 4GWKA 4XD2A 3HWRA 4FFDA 4WV3A 4IVPA 1B8NA 1NN0A 4EFMA 2G80A 3NIBA 1TO2E 3BF7A 2CNWA 1N2BA 1YD7A 1IPHA 4GLOA 3K14A 3RSLA 1NW7A 4G1VA 3MPOA 4OFZA 1V37A 3CYQA 4DB2A 1W87A 2PVSA 2FJPA 1DCFA 1WY7A 5AM0A 1RM1C 2B3DA 1Y63A 2H4WA 4D4KA 1N6OA 3NDPA 4LY6A 1CXZB 4I5SA 2I2CA 3RIHA 4E11A 1SVLA 4UNNA 3O3OB 3O47A 5AJXA 4JNCA 2GNPA 5HILA 3VQWA 1ES9A 2Z3WA 4OHFA 5C31A 3WK6A 3CXCF 2IITA 5JZMA 1ECLA 3U3MA 5DYGA 4CE6A 4LJ9A 3JPYA 3H5VA 3WWCA 4JEMA 5GANK 1CXZA 4RQFA 3QI7A 3R8FA 3DE3X 1VPLA 4F1WA 1M1UA 1JH9A 1ZI9A 5LDDC 1RWQA 3F49S 1U0BB 2XOKA 5FORA 2Q7DA 4D45A 1RPAA 5KKNB 1WOMA 1KH3A 1GFSA 3JATB 5BSUA 2BE7A 3LA6A 5F1PA 1X9IA 2PMPA 1J42A 4OHBA 3AR2A 4I2NA 4HTAA 3O8OA 2G28A 1NIJA 3VVBA 5KO2A 4FILA 1V8OA 3I72A 3NM6B 1ABBA 1Z2OX 3KCQA 3IP7A 5LNK6 3JARB 2QD5A 2D59A 3H75A 2XDAA 3SYLA 1PG5A 3B53X 3SEZA 3BGVA 2VS0A 4DY6A 3ER9A 1RI1A 3HVUA 1T36B 1YMUA 2XUZA 3T4ZA 3HRIA 4JJGA 1BXRA 4BDSA 3R2JA 4RESA 1CLEA 1T5HX 3DXRB 3BQMB 1Y81A 4II3A 3TUJC 4OXXA 1GYQA 1RS0A 1I6WA 1A77A 1NMQA 4K88A 3VHLB 1XL4A 3OHMA 4RVCA 1KBOA 2B6HA 2VK2A 1DPFA 4DQDA 4N9WA 4QGPA 4OI4A 2X8BA 3E8FA 3ZHRA 5G4VC 2ZI5A 2VLIA 5J43A 1A72A 4WUVA 1BEEA 4X60A 2DBVO 5TR9A 1J7HA 1OU0A 2FSFA 3ODGA 2BF4A 4HX2A 1OLUB 3FNQA 4NE7A 5NULA 4AQYB 3BS4A 2X5JO 3E8HA 1KHTA 4WL0A 3MMSA 3WX0A 3SYTA 1F6BA 1MP0A 2DPHA 1ECBA 4BQFA 3GEIA 5LM3A 2ONCA 4B62A 2QKAA 3UK7A 3FYUC 1P0PA 2AE1A 2E48A 4FR5A 3M1YA 4RTRA 4P32A 1MPTA 2J9FB 3OO0A 3HM9A 1GN4A 3WIUA 3GELA 3NTXA 3LFHA 3B13B 4AULA 1JQDA 3IUQA 1DV2A 2VQEO 5HW0A 4URZR 3N2EA 1M6VB 3PUZA 4JU8A 3MCAB 3CX7A 1ECPA 5EZYF 5JAIA 4DNPA 3E0XA 3GHHA 1KJZA 1P49A 3H7IA 3UMSA 5IVHA 3E5HA 5DHQA 4XSHA 3DHNA 2ZE8A 4BMOB 2PHNA 2J9FA 1JUDA 4RH1A 2IHYA 4X92A 1I5OA 3DZCA 3U3RA 3BABA 5HQ3B 2FWIA 5CIQA 5F7XA 3PIIA 5JY1A 2WM3A 1K92A 2HX1A 3ABQB 4FM9A 2R5FA 3WGNA 1B0ZA 5I3ZA 3I30X 4W5HA 1N2EA 3ECSA 4KFSA 2HBQA 2FZWA 3J81N 2X5XA 4E4YA 4MR7B 3Q4HB 4HD8A 5HQ3A 1BCRB 2QSAA 5T5QA 4RE5A 3P9KA 1I3NA 3DM9B 5A9GA 1HDYA 2XLCA 5AXCA 1Y3FE 4KUGA 3RH0A 4YRIA 3WP1B 4M1KA 4ZIRB 5CFPA 3EDQA 4OHKA 3GPLA 2ADQB 4B85A 3Q4HA 3IQXA 1ZGBA 3BXHA 3I28A 4QOIA 4C0AC 1TA0A 3W6PA 4BVKA 1BCRA 2RKOA 2A0XA 4B9EA 4NICA 3WYEA 5IC5A 2C8LA 1UC4B 4OJMX 3SPHA 1XTRA 2RB4A 5HMLA 5H2FZ 4ZIRA 2H59A 2BRUA 3BKWA 3CLUD 5LLDA 1HRKA 5L3SB 2BGJA 3VHQA 3GRRA 3U7EB 2J85A 4G5SA 3OKAA 4RVUA 1EVYA 1Q57A 1UFYA 3RVYA 2CWWA 3L93A 2IGBA 3VQTA 5HYVA 4DQVA 1KI9A 1U81A 3BUSA 3KQVA 1OV4A 4LFCO 3I8SA 2B3TA 2GA8A 3UYLA 3DL0A 4UCTA 3GC6A 5K8VA 1OKKD 4HFRA 1XUOA 1TEHA 4G09A 2WIDA 1LWOA 1RLIA 5L3SA 2ZUFA 1Z5GA 4IIGA 2EQAA 2WVAA 5JE8A 2E5FA 5HFNA 4KXVA 5GONF 3PYXA 2OB1A 3GQBA 5EFZA 3HUFA 1PNLA 4BZQA 4CMBA 1AF7A 5KTYA 1WLYA 1NVWQ 1LBHA 3X1DA 5KYWA 4OAOA 1LNQA 1M57C 2HPAA 2O50A 2GN2A 5TEVA 1HMPA 2W00A 3RJTA 1C3LA 1G38A 3P19A 1JRLA 4RH0A 2BFCA 1GDHA 3M33A 3OZRA 4TMTA 4QASA 5EBWC 2WV7A 3IOCA 3JD1A 2W8ZA 1X1DA 4JWKA 4YXWA 4LY0A 5HUQA 5CG2A 4C4ZA 2WE8A 5CTJA 1Q86W 4C3ZA 2JJMA 4NOKA 1NZ6A 3NRBA 2WW8A 2OHFA 1M74A 1XIVA 4WBSA 3DMPA 4RSGA 1L4NA 2D2CB 4MPDA 1ACMA 1UK8A 4TMFA 4JLNA 5F73A 1RI4A 3WGLA 3GVCA 1L1QA 4A2CA 3URMA 2ZYDA 4HNGA 1A9YA 4JVMA 4K5QA 4MW6A 2IG8A 2VDMB 3W9SA 1BE6A 1M1YB 1UT5A 3DP9A 1SZJG 4XRGA 3AUXA 3JXEA 4NQRA 5FBHA 4AZVA 5BSMA 3T7EA 4QJ4A 5CM2Z 4QGSA 2Z1FA 4UPVA 3A10A 4L3OA 3DMHA 3ILVA 5K3AA 3QF7A 3UUWA 4N9QA 4ZCPA 4CEHB 3UIEA 3F2IA 2PIDA 4K6KA 3QY9A 3TGUH 1DDOA 1LW7A 4C0XA 1XDUA 1M1YA 2L19A 5BN5B 1JLHA 1QVWA 3ZE6A 2QN8A 1O89A 4L76A 4P7GA 3I09A 2WSSD 1OI4A 2EARA 2J6IA 4LW8A 4BB0A 4WY5A 2V7UA 2GZ1A 5HFJA 1OYVA 1FDOA 1R0LA 3AYZB 4CEHA 2UVDA 4QU9A 4UM9D 1ML4A 4MI9A 3VR4D 4MVJA 3OU7A 2FU5C 3X1WA 3TGWA 1C3JA 3SHQA 2IYNA 4IGKA 2LNDA 2PGNA 4GKJB 1JX6A 4TQAA 4S04A 2YZKA 5B1OA 3RSHA 4QVIA 1YQGA 3HWUA 1Y33E 2BFNA 2FEPA 3DTYA 2XIQA 4NCJA 1IDOA 1OT5A 4K8OA 2VYQA 4AJEA 3FNGA 4L50A 1CEZA 1GXSB 2I5PO 4F21A 2E76B 4UCQA 3TR5A 1IVSA 3G6EV 3E82A 1VL2A 1MFZA 4X61A 2R48A 4BUJA 3IR9A 2ZR7A 5ERYA 1KXJA 3TZKA 2XB9A 4J0QA 3F6MA 4DMHA 4PM4A 2PEYA 3V1LA 2FMXA 3UYKA 1V96A 3MCWA 3WLOA 1GXSA 4MVXA 4LE2A 1YJ8A 3GJ3A 1UKEA 3QTCA 3A70A 4NFSA 4WIAA 2H65A 2OCDA 3SZUA 3ITKA 3A4LA 1C8BA 3A9UA 3OJLA 4JB0A 3L6EA 5FBKA 1RD4A 2YXNA 1CJBA 1IU9A 2O2CA 4EEZA 4X66B 4KAJA 4IXNA 3ZV4A 1P80A 4P4NA 4ZOAA 3OKCA 5JC8A 5KQPA 4HWSA 1Q1ZA 2O7RA 3CZMA 3C3EA 3G5UA 3K9GA 4P5DA 4U2CA 3CHXA 1OWNA 1MZEA 4BV2A 1RKXA 3W78A 2EJTA 5HIJA 4M46A 1GNLA 4OLAA 1UBKS 3Q7QA 3PU6A 4L4YA 1B6SA 5K45A 3GDOA 3QU9A 5CA1F 2QRNA 5F7OA 3PE4A 3QKRB 3ICXA 4FSDA 1SIOA 3VU1A 4FLYA 1RPZA 1WNTA 1QNLA 3T7KA 3SC6A 5ITSA 2FQQA 2P40A 2WTEA 3NDJA 4BGEA 2W4MA 3EEQA 4ZFNA 5K3EA 2O0JA 2GF0A 1EB8A 2F43A 4IHAA 3ZDBA 1F6WA 2BFFB 1MG0A 5ULLA 5EGSA 3J80A 3ZCTA 3QKRA 3HBAA 1I3MA 1P4SA 4IW3B 2ZIWB 1P1BA 4J1NA 3K0FB 2GN1A 1Y8RB 4EK9A 4QM7A 4EF4A 1B15A 3OLVA 2WZQA 3JALB 1XQYA 4K9DA 1Q0PA 1WB4A 3CUEF 5CVTA 2P3SA 2OK7A 2G5CA 2WJIA 2JVIA 4GHWA 2FZVA 2P35A 2BFFA 4MRNA 2PY5A 3SJQC 2WLTA 1B04A 4HNUA 4QRIA 4TZ0A 4B3SO 1V5WA 3ZWQA 4JOQA 4H3SA 3PE6A 1Y8RA 1BCCH 2B7CA 4P31A 5HK9A 4EFEA 4MMXB 4CCYB 2FZEA 3BRWA 1N6LA 1WMBA 4YDHB 4IFBA 1B4DA 3NHSA 1NP3A 3CS5A 4JZKA 4M9CA 1XNJA 1ZZEA 3MOIA 3M4JA 4IFEA 1ZRSA 1DF5A 1GGHA 4FIPC 3EC2A 3IPXA 1R8YA 3CF0A 4NJOA 3X1KA 4M1TA 1QX4A 4Y9RA 1EZ1A 4V3CA 3HCPA 1CK2A 4CCYA 1SETA 2XEDA 1WCYA 1ESDA 4F93B 3FPSA 5U1PA 4Y2UA 2FMTA 3SAJA 3Q40A 5F76A 4HXFB 4YCDA 4ESEA 3OCXA 3LT2A 2O3SA 3OTQA 1JQ3A 2HWYA 2IDKA 2AN1A 5JJCA 2A5DA 5MN4A 2XX3A 2GTPA 3J7AC 2FRDC 4JI5O 4JN6B 9MHTA 5IEBA 3N76A 1XLTC 3EJ6A 1WKBA 5ABPA 3PJEA 2IQIA 2QA5A 2GSDA 1MRNA 5IWAB 3EDYA 1VPTA 3GV0A 3Q88A 3HWX1 2BGKA 4P92A 1ZHOA 1RW4A 4YFVA 5HXZA 4OLJA 3GMTA 4QQRA 3MD9A 4F6RB 2HJSA 5JYDA 1JT9A 5IYBO 1I24A 5T3YA 2ITDC 4Y6PA 3K03A 3RTAA 2XUIA 2FP3A 2FNAA 2XMDA 4W7SA 1HL7A 3DWIA 1XE3A 2G4CA 5HBGA 1R8JA 1G5FA 2VOEA 4KG7A 5BW8A 5JNTA 5BQXA 5KUMA 5EQDA 4M0DA 1EDDA 1JEDA 1E9FA 3CSSA 2D1FA 3AG1C 1L7XA 3DC6A 1JJ2U 3AVWA 2C2YA 1NP6A 2OA0A 5LBTA 3GYBA 3UK6A 2KLBA 1JJAA 1VRCA 2XUQA 4DR6O 3P2KA 4YCJA 2J3LA 3O7WA 3MIZA 1TIBA 3JW8A 1CWUA 4X94A 4QBIA 3I61A 1EKXA 3FDJA 2BI4A 4F3CA 3O7MA 4WXRA 4F4DA 5EB0A 3L7KA 1J90A 1DFGA 1Q86H 3ND6A 5KLVH 5FRDA 2DHDA 4S2UA 3OZXA 4Z2WA 2EATA 3H1JH 4UC0A 2R85A 1I7PA 1ELOA 5CW2A 1LLUA 2BFOA 5DLEA 1LQTA 3TXYA 3WGIA 1YIOA 2JFGA 3M9WA 3SC3A 2PQMA 3NOQA 5LWHA 1EVIA 2HP0B 1TKAA 1FXSA 2WD9A 1P1RA 2A9PA 2GPTA 4WJKB 3ZCVA 1B42A 1XVUA 4FINA 1QANA 1IFXA 4QOGA 1A98A 2LDBA 2XAHA 2C59A 3TPZA 4HSGA 1D2EA 4PNPA 5C35A 1IOVA 1NV9A 4CLXA 4PZPA 2Z9DA 3UCFA 1KI4A 4Z7QB 1MJ5A 3SSNA 3DO8A 4NYMR 4QYMA 1T5LA 4B17A 1MG5A 1I4OA 5FV4A 4D7SA 4JFRA 2VRNA 1MIOB 3LLSA 1CQWA 3J7TA 4ZYYA 1PL6A 3GUYA 3FFBA 1Q14A 3TLZA 5ER9A 2LJ2A 5FBLB 4G25A 1AOXA 3GRVA 1KZYC 2ECKA 5C51B 4BJ3A 1OAAA 3D4OA 1TYEB 3VJRA 1GGNA 4DPLA 2W48A 1QKIA 5LHGA 2AD5A 1T0PA 4M22A 4FI3F 4MW7A 2LBXA 1F6DA 2LE0A 3QOXA 1UOOA 3P20A 1MIOA 1YB7A 5CB6A 4UUMA 3EIHA 3OCYA 2E3CA 1JWLA 2BOCC 1PR5A 4CHTA 1PNQA 2IDJA 4XJVA 1DQRA 1T1IA 1ULUA 3B2EE 1JQAA 3DP7A 1RRGA 2XOXA 1JD1A 4J94A 3LQYA 4MRPA 1BH6A 4MQ4A 2QLFA 5H9WA 2CDBA 4PNEA 1Q7EA 1P9OA 1H9BA 1XDGA 2HRDA 3LUTB 1XELA 2WJAA 1CRPA 3DDOA 2ATIA 2HCBA 2XOKG 4MLCA 3BZUA 4CLRB 2JA1A 2Z09A 1ZA1A 2REOA 3OIGA 5AVZA 3QXJA 4AN1A 1JR9A 1OVMA 1JKFA 4DJAA 3G9QA 2AWNA 2DR3A 2G8NA 2ZJ4A 4XARA 3R09A 2X3FA 4UVDA 2LKDA 2HIMA 3T9EA 4KR9A 3S6JA 3CE9A 1PWEA 4TXLA 1W6RA 2VPZA 3ABOB 2PEZA 3ZVRA 4DSNA 3LBIA 3FPBA 1PFUA 2OFFA 1ZNQO 2M6RA 1CZOA 4LHEA 5JJLA 3FRHA 4CI0B 2GCGA 3MWGA 3Q1KA 1KY2A 3ZDAA 3WOVA 4CS2A 6CHYA 1GO3F 2BI7A 4FN5A 2J3EA 1B6QA 5B64A 3AFOA 3V1UA 1QH1B 2AK3A 5E4TA 5D2CA 3CB4A 1GUYA 3VHXB 3FWKA 3AIIA 2Z1NA 1FXWF 2A7XA 3V2GA 4ZVNA 2HA3A 2QG6A 5E3HA 3VR4H 2PJDA 4DNQA 1PK7A 1VQLF 4EUSA 5HWEA 2JFZA 3A4NA 4XCXA 3DT8A 4M9QA 3LHFA 4EJ2A 1GPJA 3GZNB 2QRKA 4YTEA 1XR3A 3HCNA 5MFPA 3JQEA 5FAKA 5LQRA 3HJFA 1J0DA 1QH1A 1TE2A 1T26A 4R41A 3FSJX 4J0KA 1G5PA 2X3UA 2X0NA 3FDZB 4MUMA 4WKCA 5IAEA 3FYCA 1KPHA 1QO0D 1VKOA 4ARIA 2HP3A 1H94A 1R3LC 1N7JA 4FEAA 1KK0A 3GZNA 3I0ZA 5H59A 2CSUA 1YFKA 2JPDA 3PXGA 3STUA 3JQAB 3F5DA 4U63A 4G5HA 4K9MA 1QV6A 5JD3A 5K0NA 5CXQA 1SCNE 3LUKA 4PONA 4E5UA 2YRXA 4NYIQ 3FDZA 3O91A 4NF2A 1YJCA 1XZ8A 2NU6B 3KSMA 3DONA 1XQ9A 4V2UA 1XJ5A 1C3OB 2JCVA 3IUPA 5CNIA 3WGOA 3JQAA 1CNEA 2JGNA 4P0PB 4MGHA 1YZHA 4P5PA 4MGZR 2Z5VA 4L9AA 4H7PA 4LSZA 4CLEA 4PRKA 3MCVA 4KKVA 1GCAA 3J7AU 1UJ5A 3D6AA 1N6NA 3WLQA 2NU6A 3H6HA 3KSDO 4IJMA 4JI4O 2A5LA 4WFGA 1C3OA 3AG6A 3D5EA 4N54A 3OBYA 1ECCA 4DWWA 1IM8A 1L5NA 1OFTA 4Z4CA 4QAQA 3WLRA 2CLLB 1KL7A 2QHXA 3ZIAD 4W7HA 3L1JA 2XZDA 4YP1A 3N3BC 1N6RA 4EKWA 1NLUA 1CT9A 1UMBB 1GPUA 4NONA 4MW0A 2R8PA 3EPPA 3O31A 4BWAA 3QUWA 4IZOA 3VX4A 2OBYA 1AQUA 4IFTA 3GVXA 4CN8A 2GH1A 5ALKA 1XZDA 1VKZA 1X80B 5CX1A 3UA3A 5JS7A 4LXIA 3F7TA 1TW3A 3U37A 1XHEA 1MA1A 2OEPA 2YJTD 3FRJA 4CW7A 4RHXA 2H6LA 1RLTA 4G63A 4MJ7A 1UMBA 4R2XA 4CQLB 5A1JA 3SI7A 2YCLA 5B8FA 2QZJA 4LDAA 2P9TA 1QCCA 2P79A 3RJMA 1NF8A 3OFNA 2R8ZA 4X64O 1X80A 3C43A 2VL7A 2VAXA 4FR2A 4OSPA 1KS2A 2OP1A 2PGAA 1P84F 2QTAA 4ZEOA 1H5QA 1QOPB 4PA7A 2IOFA 1J8DA 2KBEA 3ZW8A 1NVVQ 2R8RA 5I4CA 4JTAB 5TVGA 1H4QA 1TUGA 1GSHA 3NETA 3L46A 5FLEX 2C1XA 4BZXA 3W8NA 2ICAA 7AT1A 1RYZA 5HDBB 4MWGA 4PHCA 1M1KW 4U9IS 5EINA 1HE2A 5F7JA 3HJCA 1E2QA 1T9AA 2AF4C 5G3ZA 1L5HB 3T1TA 3ZHXA 1KWKA 2B1QA 4B3GA 3FD8A 2ALEA 3I04M 2AD1A 1N33O 3SJCA 1TU3A 5U9CA 3JYHA 1KFBB 1GGVA 2YS6A 4CEJB 3EDCA 4KE6A 2JIQA 1J5EB 3UM9A 1MH1A 1WCIB 2WM8A 4Q7QA 5LXTB 3ABSB 1X59A 2QMZA 3W5CA 1XZBA 4YXWG 5AW9A 3C2QA 1L5HA 2V0CA 2GUZA 4UTPA 3A2FA 2JAXA 2GKOA 4ZOQI 3JZIA 2P2NA 3FKSG 5KNCA 1JQ0A 1E5TA 2OFOA 3BE5A 4D6XA 4G67A 1U0EA 2YR0A 1FDUA 1G42A 5LXTA 1U3UA 2D2IA 4D4HA 4RDIA 2H8KA 3FGPA 2M6LA 1XUQA 4YYZA 4D5EA 3TXSA 2FJ0A 4QJ5A 1BAPA 4WECA 3V7UA 3VVCA 1H6AA 4N7JA 3WK7A 4LRYA 4A1FA 1U2DA 1C29B 3HYTA 2EBFX 2JCYA 4R3WA 1LUAA 4FZ5A 4KZKA 2PUHA 5DLDA 3QVMA 4QPJC 4O4IF 2UZIR 1LRLA 4I1YA 4UCUA 1WY5A 1YIJF 3I6YA 2I6RA 3ASNB 1F8XA 4PLVA 3L72H 2EFGA 4JEIA 4QIWF 1YFJA 3O9VA 2Z58A 3ELCA 1Q44A 2VQFO 3FE2A 3VPCA 2PGIA 1SCDA 1L5OA 4IUCS 2C4UA 2WABA 4I9QA 1EFDN 3KYBA 3R23A 4MV4A 4BKRA 3FUTA 1B8OA 5ALRA 1KQGA 4L8LA 4X1KB 5AW4A 5GV7A 4IEEA 2P2LA 3QMWA 3BHIA 2SKEA 3IB6A 3OR7C 1UK7A 5CB8A 1R3IC 1SELA 4IL5A 2PUEA 3FNEA 4CETA 3DXFA 3LQFA 1R64A 4YRMA 1J07A 4RQAA 4FLMA 1PF5A 4IINA 5J2UB 1FFYA 2OQVA 1DSSG 4X1KA 2FFAA 3G9UA 2PLRA 4L7VA 1CF9A 3E9EA 2P4KA 4FLVA 4D8WA 3PD0A 1XZKA 1B1CA 3M2PA 3H5IA 2RGNC 4QDOA 2Z9CA 4ZU6X 3D00A 4ZCTA 1ODCA 1JJVA 3WBFA 4RF3A 1E1YA 3TIFA 2PYJA 5J2UA 1ZW6A 5K3DA 1O9GA 2W2LD 4OIFA 4H44B 3ZXSA 2AJBA 1NAHA 3P8ZA 3O38A 2BELA 4R16A 3KAJA 3U7HB 1EB9A 2FYTA 1M6EX 1Y3BE 2YZ2A 5TDHA 4BX2A 5B1IA 3VO8A 1GT6A 1YVEI 3SJ7A 3LHKA 3I5DA 1AR4A 2PL9A 3AG2B 4NP6A 1PIWA 3RARA 1YVDA 4BCDA 4QYSA 5AESA 1J21A 3VKWA 4JL8A 1SKYE 3LZDA 4XCQA 1WO8A 5MFZA 3NDRA 1KYZA 4MTXA 2CDYA 5HE9A 2P6MA 3NUGA 2IH1C 1NZJA 2OE2A 4NESA 3P32A 4N48A 4I1VA 1YACA 1ZH6A 1XI1A 3S55A 4OLFA 1YS4A 3EULA 3L5OA 3K5NA 1H2HA 1RCTE 3RJ5A 5C5IA 2XYPA 4LRUA 4G01B 5BR7A 4E70A 4IHJB 4BNFA 2JJ2D 4HLNA 2C8JA 5JASA 2GEKA 2HFJA 1YF2A 3WFVA 3VNUA 1NM5C 4LZAA 1GPNA 2B4QA 1GN6A 2B8NA 2CUKA 1IG3A 4YRRA 1ZQ1A 1ONOA 3I8OA 2IXDA 4GOXA 4C4PA 1TB4A 4MW3A 2ZYIA 1RBYA 1NDHA 1YRQA 3PF8A 2IUUA 3IAS6 1LDNA 3C14C 4LOJA 1QXSA 1KO7A 2FPLA 5FI1B 5K09A 3ZV7A 1DVRA 1NONA 1P9RA 1NQ5A 2QJFA 3EXHC 5IK2D 4Q3LA 1FLAA 1JDBC 5JI3E 1F20A 1DEOA 1OLXB 2QYOA 1N3LA 4ALNA 3C4JA 2QTSA 2QLLA 5B6JA 1QG2A 3RC9A 5DB4A 1XZGA 1QKJA 3IIKA 3QU7A 3OQPA 4HB0A 3GRZA 1K5SA 4Q15A 4BP1A 3LDTA 3FPJA 4XJTA 4G5XA 4GLLA 3SJBC 4QU0A 1B2LA 2BT4A 1S7GA 5G41A 2XBUA 1SBHA 4IJ6A 1X8LA 1SPXA 4KI7A 3DNFA 1W8DA 3G8YA 4PAOA 3FYHA 3U16A 2JI8A 4UZFA 1UDCA 4GX1A 4KXRA 3CXRA 1P72A 2IYUA 2MOKA 2Q0AA 2HVKC 3DBHB 3WNVA 1GEEA 3WR5A 4MDHA 1OXTA 4QU5A 3V8MA 1Z4IA 2MMGA 2OV8A 2IPAB 3TVTA 3D7SA 3JVVA 4X62B 2FKNA 4ZP1A 1W85B 1WMSA 4O5OA 3ETNA 3QJYA 5GAPK 1O95A 3HM2A 3OIYA 4RY8A 4XSVA 1DOHA 3L04A 1EFVB 3DBHA 1Y4SA 2OM6A 4HDKB 3L6DA 1VQ9F 1M1KH 4Z51A 3FB6C 5EIWA 1JTVA 3MFQA 2Y1DA 5FPTA 1L0LH 2HR3A 2X6TA 1OTYA 1EJ2A 4RA6B 4PG6A 5HX7A 2RH4A 1W85A 2EJWA 2CVHA 1DJQA 2XODA 4IZHA 3PI7A 4M83A 3WLJA 1UM9B 4XUGB 3H4IA 1EFVA 3MOSA 1BX3A 4HDKA 1KI3A 3MWLA 4NG5A 1ZJYA 4C7JA 5CU7A 1IE3A 3TLXA 1MUUA 3D8TA 2YXBA 5BORA 1FJGB 3M81A 5DCUA 4RA6A 2JFWA 3NR2A 3BSSA 3PR3A 1KF0A 3A6JA 4RSRA 4E33A 2FW6A 2GN8A 3DAYA 1QR9A 1H66A 4EYSA 5BXZA 2IWRA 1Q7RA 1JLLA 3CJTA 1WUJS 4OPAA 3PTLA 1I1HA 1A4XA 4HB2A 2APJA 1L6RA 5BO5A 1A82A 3WG7C 5TQ2B 2GB4A 3JAMA 1J2UA 1UBLS 1DQPA 4PNZA 3VSAA 3WQBA 1HQKA 5CPBA 1BS2A 2WKPA 2ONKA 3U6BA 3IBCA 5GINC 1TJYA 4DCCA 5C8XA 3Q8MA 1AQIA 5H1YA 2GI4A 1MTOA 4LX0A 1QYIA 5TQ2A 4OMUA 4PBTA 1X87A 1V3VA 5I9LA 1P2VA 1S96A 5F12A 4X93A 4MB2A 4A2PA 4BWYA 2DRIA 2G5GX 3RSCA 1VQPV 3CGWA 1LTHR 3JVEA 3T7RA 1ULHA 2GZSA 4WZBB 3B9RA 1Y1KE 2PN1A 4R01A 3RSOA 2F17A 3JS5A 5DM60 2EIMC 3F5FA 3R3XA 1F3OA 1R6NA 1S3FA 4ER6A 3QTBA 3ERNA 2FMIA 4TSFA 4DZTA 4N40A 2BCCH 3T7CA 1K6XA 1LC3A 1VDZA 3DDZX 2ZRGA 3HJNA 1GO0A 4BATA 1Z68A 3IAEA 2WU8A 3FM9A 2YN2A 4WZBA 2HKOA 4BVRA 2DFLA 1GZHB 4R8SA 1LBIA 2IV7A 1C1HA 4Y6RA 1KDZA 4L85A 1MXHA 2E85A 4QDXA 1JHMA 1NV8A 4XI9A 3ZS9A 3GJSA 4IYJA 1BQEA 5D1NA 1O0SA 1GADO 2ODBA 4L3VA 2OCIA 2C3MA 4LRXA 1YA6A 4EHKA 2QY9A 3BA8A 4QXOA 1Z0FA 4QOHA 2I1VB 4Z9XA 4MH0R 4IMIB 2G7ZA 2CDNA 1MB0A 3BA6A 1GNTA 4R7CA 2OSVA 2I91A 4WLOA 2Q6LA 4PJ0Z 1ZGHA 4ZCRA 4I0WB 2C98A 4RD2A 4TZZA 1SC1A 3A6GA 1JKIA 2DR2A 1TQ6A 4YRBA 1K6EA 4X8LA 3N6XA 5ENVA 2AZMA 3P9XA 5IKXA 3QGMA 1KO1A 1A5AB 4RZIA 2YYYA 1E6UA 4LC1A 2LKCA 1QP0A 1ZSNA 5CK5A 2V4ZA 1A8PA 4FMTA 1Z5NA 1RXVA 1LDYA 5ICCA 4TVKA 2H3EA 3AFGA 1SD1A 3RVLA 3NTOA 1ODFA 1N5KA 3J81M 2Q5HA 5C46F 1HH4A 4FZ1A 1XEAA 4F8YA 3CUKA 1Y6RA 2V6GA 2P68A 3HLKA 1DXYA 5SZIA 3PFKA 2RKBA 1XKLA 4AQ7A 1DAFA 3Q3EA 4JTCB 1XWIA 2QKYA 3UMRA 2ECQA 3S1AA 1WXGA 3VBEA 4BO6A 1QP8A 4RMJA 1NNLA 2CJPA 1S3SA 3KFXA 1M2JA 1YTFD 1AZSC 4X8OA 1H65A 2OZKA 2RHGB 2QQEA 3WGKA 4MV9A 3P2YA 4Z7OB 5JFGA 4URYR 4BMDA 3IQEA 3TQIA 1OFHA 5EWLB 4LWZA 2GZMA 4A6PA 2P41A 1E96A 3QVOA 5EUBA 3O8LA 3T3HA 2B5UA 2A1IA 3H04A 4U4AA 3WVNA 3TQRA 5HJ5A 4DY4A 3KVNA 1X25A 3RB8A 3T4DA 1SBCA 1TCVA 1HL3A 5B37A 3O4IA 5ENZA 5EWLA 3E5NA 4KQJA 1BS1A 3UJDA 1JQEA 1AKWA 3NORA 5IASA 1A8HA 5IVIA 1VQKV 1QDLB 3TUIC 2XSZA 5ECGC 3DVAB 1DAPA 1GPWB 1I6LA 4L15A 3W5DA 4IIFA 4NQZA 2GJ9A 4JOBA 2R1VA 3SVZA 2OHWA 1CEQA 1Z74A 3H99A 4V0OA 2OCCC 1H2AS 1MKYA 4LGMA 5B3JA 1G5QA 2CK3A 1YK0A 2NT4A 1EFUA 3PNVA 1M3SA 4R1SA 3AJDA 3N8KA 1GUBA 5BMVF 4MV5A 4EGFA 1DFHA 3A9WA 3T5CA 3ZDDA 3DVAA 3K8QA 1JP7A 4YP9A 3O8OB 3K09A 2VJOA 4XQ9A 5TF4A 2WWIA 4RF5A 4DGSA 2GCPA 1JU4A 4QDJA 1N1DA 2YZMA 4DPKA 5J9FA 3LQRA 1YR3A 2YFKA 4AT1A 3QTLA 2NO0A 2YYZA 4DTIA 4IIHA 3OE4A 4RJTA 3PQ4A 3DAHA 1BXRB 2QI9C 1PCXA 1SESA 2Q3EA 3ZWPA 2DR0A 3AM1A 5M29A 1IK4A 1UP7A 1P0FA 3GWZA 2W2TA 1PZFA 2H07A 3ZQUA 2NYVA 3CD6F 5CBHA 3EF0A 5JHHB 2ZKIA 1UBGA 1TUBB 3WI7A 1FA9A 1I7LA 5BWCA 3CZCA 2JJ8A 2WJZB 3ANTA 4WK2B 4FS3A 4YJ3F 2E1RA 4XQ0A 4WFKA 3WL5A 4DKJA 2F8LA 5BR4A 4KQHA 4GM4A 3T5GA 1TEVA 2ZIVB 3NAMA 1PGNA 2EFHB 3U3XA 5LU8A 3I5YA 1S8NA 5BQ3A 4RZUA 4P7BA 1TUBA 2UUBB 1UP6A 1K4YA 4JLOA 1PWZA 3DFKA 5I48A 1J2RA 4RGYA 1UADA 1UPXA 4I9HA 1PR2A 1ZINA 4EJSA 2A0UA 1N36O 3PJSK 2QX8A 4PZLA 2XVYA 4B44A 2PD3A 1XTBA 3NVMB 4UASA 2DB3A 4TV9F 3T61A 1QVFU 2PV0A 3KCXA 2QLJA 4KPFC 2EIKB 2O1WA 1MF7A 2HPVA 1N5OX 2QGNA 3RKRA 4FMDF 1QQ7A 2BDUA 4PANA 4BDTA 3NC1C 5F7ZA 2GEDA 1T0HB 2Y27A 3OMWA 3HV0A 4BNDB 4XGQA 4ESHA 4U6NA 1G9XA 2P22C 5K0BA 4EDHA 3U5TA 2OZBA 1PJRA 4LP8A 3VI3B 1YJNF 3UMVA 1AVTA 4GE0A 1N57A 3KXPA 1II9A 3DL7A 4O59O 1MHPA 3ECAA 5FLKA 2Y69B 4DR5O 5FNVF 5H3HA 4IZ6A 2ZIUB 3NGXA 4JX8A 3CN9A 3W4KA 4KYTA 4BNDA 3PN1A 3P9QA 2PZLA 5JBNA 4EFKA 2EIXA 4ZVLA 5T6BA 1FFWA 3HFGA 1QCDA 3PX7A 4QJBA 1WUYA 4DIBA 4DW1A 3OPMA 4CH4A 1HNZO 1U5AA 5AK6A 3LGAA 3AILA 4D46A 4C82A 3SZRA 3UT6A 4RDCA 4KW7A 2QM3A 1HFKA 2ZRQA 3K4QA 2ARHA 4NBUA 2EJRA 1WPGA 2DQZA 4TTJA 4DV6B 4NWIA 2CCKA 2HNBA 2FGKA 2C0QA 2GHIA 3PRJA 3GW8A 4B2IA 4KV7A 2F3PA 4F86A 2R6JA 4HNTA 5THQA 3UWSA 3TR0A 4ID9A 3BQ9A 5DXJA 1JEQA 2DPGA 2B82A 4GR9A 5TMPA 4KIUA 3TXXA 2ZRNA 4GVXA 4LSGA 3F7MA 1M33A 5EMKA 4M1ZA 1W3EX 3VAAA 3WS7A 2HYDA 1AKMA 3SMVA 4R1NA 3GA7A 5DCLA 3V8BA 2NVWA 3IKMB 3DFMA 1QUEA 4GGPA 4H1VA 1X7YB 2QDXA 4Z6KA 3WDLA 4X6LA 3I2KA 1JQJC 5LQMA 1XRLA 3TLYA 1WV0A 2FI1A 4JI3B 4Z9BA 3TCUA 3GQBB 2BE3A 4YAWA 4FFMA 3K20A 2RK4A 5FULA 3WK9A 1P75A 2CHTA 2CFRA 3RR2A 5KYWB 1PR4A 4PGAA 1D9ZA 3K4HA 1MGOA 4MS1B 3SGLA 1NG1A 4WZAA 3BTVA 4Q9IA 1TKCA 2P91A 5FBZA 2F9MA 2H5IA 4FGKA 2QLTA 1X7YA 4ROTA 5EY5B 2BFCB 3AVXA 5K6RA 3ZJ5A 2WQ7A 3PPWA 2ZQMA 3GLQA 2FHSA 1F5NA 1HRDA 5CT4A 3APQA 5IM5A 3NZEA 3DPUA 2B78A 2KTUA 1IHYA 3TRFA 4G5GA 4MS1A 2HLHA 3WWPA 4ZEXA 1Q82W 5ADHA 4YY3B 5BWLA 2MINB 9LDTA 5I6DA 2FAXA 1QIEA 1DKOA 2E87A 3Q5GA 1A8SA 4JELA 2R8BA 2OCYC 2ADFA 4MEAA 2I9KA 1P74A 1QQAA 4KUEA 5AJYA 1E2FA 4E5SA 1VL1A 4X6XA 4XWWA 1KJJA 121PA 2MINA 1YNOA 3SDBA 2EKZA 3QMPA 2H57A 5G1PA 2WU1A 1S89A 1CJKC 3O73A 5FPYA 3CCLV 2CSXA 1LX7A 1S0VA 2BYTA 1I7FA 1SM4A 4RUFA 3VYVA 3PSAA 3ZPXA 2POQX 1EUCA 4HYOA 2WWWA 2P06A 2JFNA 3NJ8A 2ADOA 1YU6A 2AXPA 3NEAA 5E9AA 4K9KA 2VQ6A 3BWVA 4D9HA 1QFSA 3IBYA 1NQOA 3M70A 3S7ZA 1ZA2A 3PXDA 1HEIA 3PTAA 3W04A 1QVGF 3KC2A 2PUSA 2QTWB 2J32A 3G4SF 1UBNA 1F2UB 1GGFA 4BKMA 2Q7XA 1N6IA 1TT7A 3MWKA 1U2TA 2JGMA 1SQBH 2PH1A 2ZJAA 2VK4A 5IHXA 2YHIB 3NUQA 2CZGA 4F92B 1BFUA 2R5NA 1D5WA 1ZOLA 1F2UA 3ROGA 1IBCA 2VP6A 4QUAA 5IM4A 4EUNA 3MVEA 3ND5A 1UOQA 2P27A 3UWMA 2RAUA 3KZOA 3RC2A 2VO1A 4NV3A 1Q3HA 2YHIA 4YT8A 2EILC 1MO6A 3PGXA 1ADFA 3G71V 1FP4B 4Q4LA 3TEMA 3ROZA 4M1QA 3PNYA 1S0UA 4L27A 1F06A 2BONA 1V35A 2ECPA 1C80A 2B8TA 2IZ5A 3EEIA 1C50A 2QRPA 4GBGA 4GG1A 5G0VA 2A1TS 1UJ6A 3A37A 1RJGA 2BM1A 1FP4A 2ATEA 2J1LA 2HP8A 2Q9LA 2FUEA 2A9RA 3FMIA 5FTLA 4L5AA 4PA3A 1QR6A 4KQFA 3RBAA 4MTGA 3LT4A 2OXCA 3GJ8A 4RO0A 3JASB 5I8WA 2PS3A 4WNYA 5IBRA 4A36A 1E98A 4JJIA 1EHYA 3KUDA 2R7NA 3G9TA 3OE5A 3UATA 2JNWA 4R2KA 4F3RA 1VKNA 2LWIA 3FOBA 1RRVA 1IXMA 2POCA 4CYMA 3ZLTA 3OF2A 5DW0A 3DE7X 4ZC8A 5AKZA 2X2OA 3OTGA 5FPQA 4DQXA 2JASA 1ECJA 1G2QA 1OI2A 3JASA 5ARCA 3GN2A 4CBCA 2F43B 1DV1A 4GLXA 4Z86A 1HDOA 3GRYA 4DC9A 5ALQA 1MORA 1A5SB 3T9DA 1LLCA 1U7OA 4FI3C 2VRCA 3EXEB 1F8FA 4RTOA 2C2WA 4KQEA 4NG4A 3B5JA 3K70C 4NTWA 1OCRB 2EULA 5D8DA 4BRZA 1J9ZA 1JR3A 2O1XA 2BZSA 5TXGA 3GLIA 4I4LA 4A3SA 5DNWA 1PJZA 2PSDA 2YWJA 4Y2VA 1R5JA 1W2BF 3LDEA 4RK4A 3RASA 3B1VA 4CCWA 1Z35A 2GSMB 4UE3S 3EXEA 3KB2A 4W8HA 2HW8A 4UHDA 1MU0A 4FYIA 1YIAA 3ACDA 5HFLA 5G53C 5TGTA 3HFSA 1TQHA 2PMWB 2WLKA 1Z7BA 3W5JA 1ZCJA 5J40A 1HT2E 4I5FA 4PGGA 1OYYA 1R0CA 5BN3B 3QI2A 3IC5A 3VR3D 3ZKAA 2NXWA 4EKDA 5ALLA 2IA5A 5AKIA 3QLVA 5B3SC 3ZE8A 3GUCA 3FNHA 1M75A 4J2HA 1SCUB 1OCCB 1JE1A 1ZXXA 3N6VA 1HP8A 1K97A 4P86A 5CBKA 2AX3A 1PEAA 5BN3A 1E0SA 2PGDA 2BN4A 4IXTA 1WXEA 2V0NA 3MJRA 4QOFA 4C30A 3CWBH 1IBKB 4OQFA 4UXJA 1KJWA 1MO5A 4U2BA 1PL0A 1SUSA 2O20A 2AN5A 3WTCA 2LGWA 1SCUA 4A91A 4ZVQA 2AF3C 5FEUA 3RBVA 3H1BA 3U3OA 2MIIA 2FTKE 2R65A 4TTAA 2W6IG 5CVVA 3QVTA 2PM8A 5AJUA 4IV8A 4GWGA 3EPHA 4G24A 1CR0A 2GXQA 1EFTA 1E9VA 5JZ9A 1JG4A 1V5GA 4JASB 1FMLA 1BA2A 2E89A 4LJAA 3ZE0B 1NMSA 4NE2A 1C1DB 2AOXA 1CRQA 1PFKA 3WRYC 4EG8A 3V7EA 1QX3A 1WQ4A 4RXMA 3I12A 3OIVA 1X39A 3AHHA 2KB1A 2DJVA 3FVWA 1MZFA 1NU6A 3FWPA 3NNDA 4JASA 1VJTA 2I6DA 4YWHA 1IBLO 1XEWX 3OE7A 4ASUD 4NZZA 1C1DA 3ENKA 1NQTA 2JLRA 3JQCA 1YQQA 3TTXA 4OMFG 5EL0A 3WGVA 1V25A 4LF5B 1G3UA 1A7JA 3TVDA 1DG9A 2CKMA 3W9BA 3T5DA 3S29A 1ORWA 1J22A 2IX9A 4MVMA 2Q4RA 3K0BA 3TO5A 3HPLC 2ZJ8A 3VYTC 1VLLA 3LQ1A 2DULA 3OJEA 4ZI5A 1XU9A 2W2QA 4NBRA 3RIYA 1KNQA 4KP7A 2Y4TA 1TPZA 1DB3A 1I2AA 3L9XA 5DBFA 3T5MA 2WWFA 1NXOA 1PP9H 2EQ5A 3MQ2A 2VJAA 1E2HA 2W0XA 2GCIA 2GAOA 2X8LA 4AKTA 4GC5A 5EE1A 1PJ4A 3HQ4O 4UBOA 4XQEA 1A3CA 1IBRA 2Z01A 2AQIA 2QRZA 4KUMA 2Q7EA 4O5AA 3ESQA 4Q3BA 1K63A 4IVQA 3PJFA 4M0LA 3PHCA 1JDUA 4RLFA 2ZYRA 4PR0A 5F2EA 4C7OB 5HPYB 2ID4A 3LOPA 2NP7A 3TG8A 3OKFA 4RKEA 4R6ZA 4C07A 1VIBA 3VRHA 2ZR2A 1JG7A 3Q85A 1E6WA 3BBLA 2XXBA 4QJIA 5T3UA 2IHUA 2ZRDA 4KQ6A 1BX0A 3PCTA 2R66A 4NOLA 4WFHA 3VNAA 3RT9A 3EWAA 3VPXA 4X65O 2OT3B 3BFVA 2P7TC 4C7OA 4BQEA 2WAXA 3BD6A 1XK7A 4WCFC 4YH1A 1DIGA 5B1AC 5HFMA 2OLEA 5CAEB 1XI2A 4HXGA 2YMQA 2FQXA 4O2BB 2DH6A 3GIDA 5JXWA 4MPPA 4ZAGA 4MKXA 1W4BA 3TECE 1B76A 2VAVA 2VGNA 4E1VA 4EA9A 4LJ8A 2X0KA 4LWOA 5DIFA 4P80A 1JLSA 3D6UA 3TOZA 5DCVA 3WG9A 4GX5A 3PJDA 5AK0A 5GP1A 2O06A 4D4LA 2C20A 3E7FA 3G8AA 1E3EA 5CAEA 1PT5A 4U02A 3KYDB 4O2BA 4GL2A 5AKEA 3SBEA 5JD4A 3W6OA 1NQXA 4EATA 2OGZA 1QKKA 3CT4A 2CK3G 5IXJA 4DV3O 1E9RA 2WU0A 2QAGC 2WJYA 5CTAA 1NBMA 1VPWA 1NX9A 2Y0IA 3D7LA 4D4GA 4M9XA 1Z8DA 1E3SA 5ESWA 3M3PA 1W0KD 3OMIB 3VH3A 3KYDA 3AUYA 2CHSA 3KUCA 2O2JA 3NP7A 4JQOA 5HOEA 4NK5A 4B7XA 2AN4A 2PWPA 1BJKA 4NAVA 3O8NA 5CLLA 2V3CC 4RXUA 1E0DA 3L0PA 1USGA 3IAHA 3W9UA 4S24A 4H33A 3K6RA 3EIEA 1ZM2A 3ZDYB 4TYYA 1HO3A 1XFAA 4W8OA 3RS8A 1RWWA 3FSGD 1CSEE 2TSYB 4INAA 5ECWA 2ENUA 3A2NA 1U96A 3K0HA 5IRCD 3U49A 4L5BA 3CSUA 3OPYA 4LUCA 2QP9X 2MTBA 1X2BA 1RXSA 2IW1A 3FOEC 1WP9A 4BVFA 5KTOA 2W6QA 3FLMA 2PV7A 1K33A 1XCOA 1J9GA 4BC1A 1H3FA 3EDRA 1H05A 4OHPA 4DVJA 2DVMA 4OF4A 4MGIR 1NMUB 1IL0A 4CIYA 2FV8A 5L4NA 1CDEA 3NI2A 1E7QA 1C3EA 4FLZA 3TINA 1KZHA 3OONA 2V8BA 1VG1A 4ZCMA 1ZMXA 5K4AA 1UT8A 4Y2GA 3KR2A 3OZFA 3FOAA 1II8A 1U1CA 1BDMA 3SHWA 3L4SO 4PC2A 1QRTA 1HZJA 2WF9A 3DOEA 4UD2A 2A30A 2DZDA 1WWKA 3UAGA 3QNEA 2NO5A 1XTKA 2BTEA 4M0FA 2X8WA 4HB3A 2V3VA 4WERA 1FKAO 3HV2A 3CTMA 5C8ZA 4MGEA 3CZ9A 1PJBA 4EMSA 2ISCA 3ETGA 2X9LA 3W7AA 4JJKA 4QUKA 2G9NA 2QUBA 3NATA 3BRQA 1YFLA 5JECA 3WYDA 3R0QA 4J1TA 3LWQC 1VMEA 1WB9A 1U9CA 3C41J 4CL0A 3WPXA 4MUEA 2LCIA 1X74A 5EHZA 3AONB 4YASA 1CJMA 3CRAA 2PUVA 5IHPA 1Q95A 2H1WA 3ZIUA 3GD5A 5BUZA 2ZJ1A 3T0IA 2IHKA 1Q0SA 5B58T 2XECA 4HOYA 4PGHA 1SBNE 3ZMZA 2COEA 1ID1A 3HVIA 1FPOA 1TCBA 3HABA 3AF1A 2DQ3A 1Z0JA 1PU2A 1UFOA 1GN8A 2QY6A 1NW9B 2IS4A 1JXMA 3V7NA 4KXFB 3BSWA 4ZCSA 2AW5A 2I62A 1SPBS 1XN1A 2KQXA 4HYEA 1GVHA 3KDAA 4R2MA 3BE8A 4C8EA 1YI2V 2QX9A 5CX1B 4RX1A 4R9SA 2ZIGA 4OKNA 1IAQA 1G21B 3OLCX 1SQPH 2NXEA 1XXHB 3Q5DA 5AJZA 4B6SA 3EXIB 5CMLA 5TLSA 1ZVKA 2H9YA 5D3QA 1TYCA 1MRZA 5GJBA 1EIWA 1UZMA 1CUUA 3O0TA 4LMPA 4MYTA 3RAPR 4CF4A 4EGQA 4BQSA 3RVRA 5B4UA 4H3HB 5TPZA 2R7AA 5JALA 5DHSA 1P5JA 4UM7A 1K5HA 1G21A 1XXHA 3FPCA 4RWZA 3EXIA 5CDFE 4KLAA 2W6JD 3HNPA 3G2LA 3E81A 1BRTA 3KLBA 1YBAA 2I8CA 4FCCA 3DQZA 4AMBA 1GZ0A 4ARAA 3OEWA 4HYTA 3VH2A 2YV1A 4ZJUA 1EXWA 4UQOA 3TZLA 5I4BA 1NTZH 3I2IA 1UDXA 4DCJA 1XLVA 4HVTA 1TMYA 3KOXA 1H38A 5H4GA 3SYNA 1DRKA 4EG4A 5A9SB 2ZOVA 3C5VA 4HGOA 1BO6A 1K7CA 2Q49A 3KZXA 1MOSA 3SWWA 5ALNA 3FCEA 1XA0A 4ZC1A 5JPIA 3WWEA 2XQKA 3COYA 1GAXA 2HL6A 3C3PA 1WF6A 4PO3X 1L4UA 1W59A 3EGIA 3WDMA 3S2EA 2X8JA 4MS4B 2GNAA 5A9SA 2IPOA 3ON1A 3O82A 2GUZB 2LQTA 4KQKA 2N9UA 3N86A 4CUZA 1KJNA 3I3SR 4WCEV 3JYPA 4P0TA 4H7KA 2CMDA 5BR8O 4KFMA 2B35A 2JZNA 4EVSA 4RFLA 2J4FA 1AI6A 3UBTA 2FKAA 3OQJA 3W3ZB 3K12A 5JATA 3PENA 2EBWA 4IUBS 4MS4A 2X1MA 5IUKC 4R71A 3TKYA 5LCXA 3NHYA 3UBMA 3DE6X 2VSQA 3O9OA 4GOND 2Q1XA 4RABA 4S3MA 2WLLA 1VPVA 4TV8B 3UO2A 3QUBA 2OG2A 1Z18A 4HNQA 4QLBA 3FPEA 1GPKA 3PFCA 5F2OA 1LXCA 4WXEA 5JWPA 3CLTD 1BVHA 2YZNA 4AZTA 4E5PA 4C8GA 2Y71A 4LDJA 1KERA 2HF2A 1CVLA 2JS5A 3ZWXA 3L0IB 2H4YA 1FCJA 1W46A 1L5LA 1CU1A 5D3KA 1EM8A 2JLYA 4TV8A 2ZTUA 1TCUA 4NCXA 3UUGA 1K8RA 5L4SA 1WVMA 5E9JA 3JSLA 4EO4A 3TW6A 3K1TA 5FUQA 3SS7X 2BFDA 4I4IA 2ODQA 1RR6A 1VBMA 4QE3A 4LHZA 4XLZA 4Z2YA 4KGXA 1YZUA 2BEWA 4G2KA 4DRXB 1HE5A 4CM4A 4MI1A 3R9KA 2I2WA 2Y0CA 4I66A 5K3FA 2ZJ3A 2XCSB 3AI3A 4IGGA 3R5TA 1SR8A 5HQTA 3HEMA 2WJPA 1CZUA 2P9FA 1F9AA 4C5CA 3FUXA 1XKTA 5AUPB 5E1MA 3O3MB 4MVJG 1CRWG 4DRXA 4U7DA 3CZRA 5JC1A 5CBPB 1D6JA 4OJKA 2I2XB 3A6HA 2G36A 3A1DA 4L4UA 3L74H 3LA8A 4FHCA 2WIAA 1ZCZA 4C3VA 3G2OA 3PQ8A 1RZ3A 1ECFA 4M49A 3MMPA 4RULA 3S0JA 4DCSA 4H1UA 4C87A 4BCCA 1VIAA 4F2HA 1DI0A 1FMCA 2IYWA 1DWQA 2H9IA 5AWFC 5CBPA 4HDSB 4C8IA 4QX6A 3B4SA 1EDZA 4FX2A 4LXHA 5LUBA 5CCDA 3RTGA 2AYYA 5K03A 2QM0A 3UWOA 1GM9A 3V97A 3C0KA 4JAAA 1FYJA 2ZAIA 4HUQB 2D5AA 3X1XA 1USWA 2WT4A 5ADWA 1E2BA 2O14A 4HDSA 1NUAA 4MQ5A 3GG2A 3V7WA 4ABYA 3RVPA 5KTNA 3OT1B 4ZV9A 1G9SA 4WKPA 2QB5A 1J1IA 1OPXA 5CA3A 4O29A 2WVGA 2PGGA 2FE1A 4R8CA 3SPCA 5F1KA 1YULA 2Q5JA 1XEFA 2GGSA 3EODA 3IQFA 1KSFX 4HUQA 3TSAA 4LZJA 2A5GA 2WHQA 3VYSC 2XAJA 2EF0A 3GLHE 3TQTA 3DYIA 5BWMA 5KC9A 3CVVA 4Z49A 3UOAB 3KKKA 3WZMA 2H1OA 4QLOA 5ECDA 3OT1A 2HMYB 1JVMA 3DHWC 5DIZA 3Q6MA 4GECA 2O3JA 4O4JB 2VSXA 4KN8A 1NJIW 1MIHA 3A4YA 4F5WA 4JVLA 2ANBA 4TTQA 3VYWA 1FNSA 1K7YA 1RM3A 1S3IA 3G5TA 4QD3A 3VZPA 1XPRA 1CIJA 3OMNB 1E9CA 4ZXFA 4WOKA 3KTFA 2F43G 1VPDA 2KG7B 1PNVA 4RZQA 4O4JA 2HR1A 4R1QA 2IHZA 3PQFA 4D26A 2IYQA 3G5LA 5B2FA 1W4RA 2ZBFA 4W63A 3L02A 2XKKA 4BTEA 2J07A 1RKBA 2JAPA 5FBVB 3APOA 3C90A 4IQGA 1XNRB 3QHPA 2KG7A 4LBWA 4LRTB 3P9RA 5E9WA 1Y4AE 1P7VA 4PN7A 2VATA 3GEGA 1NDUA 2AUNA 1NW8A 1THGA 4NI5A 3ZWKA 2MYTA 4I8DA 1OYWA 1W2GA 1Z6XA 2EX1A 4TTVA 2XRYA 4NZYA 1SXJC 4N3BA 4EUHA 1WB5A 1XL1A 1LPOA 1OX5A 3JD2A 2F8SA 3W06A 2A88A 1OZHA 3AG4B 2B61A 3E9YA 2AXEA 1DLJA 2OBMA 2G0NA 1RBMA 2QSZA 4YP0A 3NK7A 1SKMA 1QIJA 2FMKA 2KB0A 4EWLA 2NNLD 3OEED 1R0KA 3IH5A 2A59A 3LDUA 4DLXA 2V1UA 1U99A 3D2CA 3W2HA 1QORA 4HAOA 1ORRA 1E77A 4G9BA 3CHYA 4QPCA 4A6EA 2JLAA 5FUBA 2JA2A 2ZRBA 3QOFA 4BNIA 4L73A 3LUHA 5K3CA 1NS1A 3WB9A 2PRZA 2QL7A 1O57A 4IICA 1A2QA 1BDHA 1R4AA 1O5TA 3BCHA 1NUPA 1ORQC 4CM8B 1GG5A 3CW8X 2F3RA 3C3KA 1OR8A 4G8CA 1LX6A 3UH1A 2B83A 2INGX 2H3HA 3OF3A 2WTMA 3R7SA 1T1SA 4CF5A 4RFVA 2VSNA 1UFIA 2WNHA 2ZK7A 2CEKA 3WZLA 1YKFA 2J9XB 2HXYA 5H6QA 3I34X 1CQZA 3HB5X 3PEVA 2C00A 3WQHA 2IEYA 4CM8A 1RHJA 5KWJA 2EFJA 2DFTA 3EIFA 3PZRA 2Q4OA 1TAEA 4Z3KA 1R9MA 4A15A 4JB8A 4A1OA 1UUFA 3RSGA 1FRZA 4RQOA 1H6BA 5DX8A 1DMSA 5FT9A 3W7WA 4IT5A 2ZVDA 5BUSA 3K8OE 2A9QA 3ZMSA 1JPNA 3L6UA 4YLYA 3K5HA 1RP3B 2ACEA 3WLTA 2WUGA 1VF6A 2P8JA 5EXSA 1JFFB 1K98A 4YLGA 1JLLB 4UQPA 1F4NA 1L5KA 1Z8NA 2O8CB 3KVRA 3F7NA 4TKUB 4KMOA 5A2QN 2EC5A 2IGTA 4HAXA 3Q9LA 3GGJA 2CUNA 1NZDA 3EGVA 1Q8IA 3OM3B 2PJZA 2GPNA 4KH1A 3EC7A 3TQFA 1JFFA 2FYUH 4D9MA 2QX6A 4ZRDA 1F4MA 3NALA 4IVNA 2O8CA 1PVVA 4TKUA 4OHWA 3E7DA 5FWAA 3EXG1 3NFYA 4D42A 1T6XA 5LZ8A 4J3FA 4MX8A 3V4SA 8LDHA 3CCFA 4EI9A 3D9QX 5JS8A 4GLFA 3NTUA 5ES4B 3HYLA 5ITWA 1MJFA 1EEXB 5BWBA 3TSCA 5MN6A 2HVJC 1WB8A 2C5BA 3CXUA 1T2VA 1CY6A 4GYYA 3BL6A 2YZ7A 1P7YA 2WFLA 1FX1A 3MJ4A 3ZCXA 3G67A 4LSMA 1CUGA 1T6NA 3B85A 4PYLA 4UB8Z 5IJAA 3GZJA 1PKXA 4Q03A 5KVQA 1HMYA 1AR5A 3CX3A 2A92A 5AKGA 4ZO6A 2CF6A 3FWYA 5LP1A 5LR6A 5EMHA 2UXCO 2OTJV 4MHOA 1YI8A 4AKSA 3AUSA 4Y7DA 5DGTA 2KE5A 4DSZA 3DL4A 1G8KA 2ZIZA 4YUWA 4QYXA 4Q3DA 3UJPA 3V1TC 1LTKA 3KPUA 5JARA 5CJJA 4NBLA 5AOCA 4OX9Y 1TIPA 3PLAC 2Z2JA 2G25A 4V39A 4UUNA 4UMFA 5IAOA 3VDQA 2C03A 3DC7A 4M2LA 4DV1O 4BVHA 3VTKA 2HUPA 3F8TA 2CMKA 5EEGA 1BD4A 2AH5A 5ED0A 1W73A 3KYJB 1ENZA 1A4IA 3GJ0A 2R44A 3UXEA 3IGAC 4N8EA 2VH5R 1NBMG 1HDCA 1TYBE 5GZ1A 4XWOA 1PDWA 4UW9A 1QYWA 4AWAA 2FP4B 3ZBPA 4BIUA 1ADCA 4K28A 3IXQA 5KHLB 1SQXH 3OTWA 1NVDA 2KSQA 2W42A 1P8JA 1AUPA 3V8EA 3DZ8A 4JGIA 1F7UA 1JI3A 3N74A 2UZ3A 5EZQA 2ZXUA 2PZSA 1RM0A 2ZM5A 1QO7A 3UV7A 4MA4A 1ZICA 2J30A 5EI5A 1Z0UA 2IZ6A 4F9TA 2FP4A 3CLTC 2DTEA 3IDFA 1E3WB 4RY9A 1HNXB 3CUUA 2Q21A 2WIFA 4BMCA 2Y67A 4MVCA 3ZN0A 2WU3A 2G38A 4CQMA 2VIIA 1IDN1 1GPDG 1V9LA 4DSOA 4KQMA 1MN6A 1EK5A 3GCDA 2O5RA 2ZTSA 3Q10A 2EINB 1YUBA 3NONA 1ZWLA 4Z1OA 4KN5A 1NNEA 2ZCJA 3MWYW 1RLJA 4HNVA 3LLMA 3H1IH 4FYPA 2PMKA 1DZIA 1E3WA 1VQ7F 5CYFA 4KQ9A 1MOQA 1PKEA 3S1AB 3KQQA 2P2YA 3ZI0A 4I08A 1PNOA 4TTSA 3UPDA 5KTKA 3CCMF 3C7CB 1U0NA 4YECA 1AHPA 2ROQA 2WHRA 3IEPA 1DEHA 2Z8YA 1V11B 4YCSA 4M8KA 4DV5B 1U28C 4M1OA 3MBKA 1W88A 5B7GA 4GZMA 1RXWA 3IBGA 4JXXA 3M34A 2CWDA 3C98A 1W5TA 3DAGA 4LQ4A 1VHLA 2PZBA 5KEIA 3JD0A 1N7IA 1F1BA 3G02A 16PKA 3KZKA 2GJ8A 1AKEA 2FFRA 2O2EA 4IUYA 4MW4A 1KOLA 1V11A 4FFWA 5J2TF 5EE0A 3C6YA 3HZOA 5H02A 5CT8A 1C0PA 1TAGA 4XEUA 2OTLF 3HS3A 1XL6A 3SHTA 3IIIA 3CVJA 3QENA 2YY7A 5CVDA 1Q11A 1RKVA 2JCGA 1ISPA 4KQGA 4FPXA 3KR0A 1QO9A 3UY4A 1I7SB 5LWQA 3DMYA 5A71A 3RC1A 2R1VB 3DOCA 3ABZA 4C81A 3RDPA 3I52A 4PO8A 1MA3A 1R1BA 4TYNA 4BWGA 2RCVA 2BW0A 3R9XB 4ZQHA 2WLJA 4D02A 5TSDA 5DBHX 4RJKA 1HXHA 3T7AA 3MTAA 1AV6A 3TSOA 3H11A 5CG1A 4NV1A 2CN1A 3UH0A 4FGWA 3VR5D 3DHEA 1FJ2A 8ADHA 3K70D 5C1PA 3K57A 1CETA 4FZ3A 3RT3C 1GYPA 1KI2A 3JYQA 3NHFA 3R9XA 4Q3KA 3FI9A 4ZMRA 3BWCA 1YVPA 3JVIA 2CHFA 2OCAA 3TMKA 2C4KA 2Q2VA 1DUVG 3M6VA 4YAFA 1CUJA 2G9VA 4RV5A 1NVKA 1D2AA 3TNFA 3WJ7A 5BT8A 1VLHA 1O87A 4DR2B 4LNUA 1FD9A 1UQRA 3Q2KA 4HBZA 2O07A 3GFVA 3L84A 1PG0A 4QELA 4GSYA 3UKDA 4D5GA 2I4IA 2BDEA 1U8FO 4DV4O 2ZJOA 3ZCSA 2LBTA 1ECGA 3G7SA 3SHVA 1FP1D 4N7MA 5KTRA 4YHBA 5FJJA 1AXRA 2VNJA 2ALJA 5ALHA 2ZVQX 1RABA 1ZL0A 1PQWA 2BLLA 4CJXA 4F06A 4JFAA 3A8TA 1CW2B 2DFNA 2DBZA 1VIMA 3EG5A 4E5YA 2XYRA 3JQDA 3OFNG 2QV7A 2R7KA 1U90A 3CC4F 1B23P 2ZCEA 3UHPA 3FTEA 3BAZA 1XBLA 2K1SA 2XWBF 1SU7A 4EJSB 1A9QA 1O5IA 2JIBA 1HZZC 4FFKA 3QFRA 4PFJA 4F1KA 2O2IA 1MZVA 3N2YA 1BXKA 3CXCU 2OV1A 3FVQA 2BEVB 2DFKB 3QQ5A 4DK0A 1N9GB 3EVNA 5B3LA 4RM3A 2PMEA 3SFTA 2EJCA 1AA9A 1GSIA 1K1EA 3NHWA 2G72A 2N74A 1XZLA 1CR6A 3V1KA 5FLYA 1ONNA 1YS1X 2ATXA 3ZNOA 5ICMA 4BGIA 4JT8A 1DTOA 1KIFA 1HT3A 4TLDA 2QNBA 3O85A 4R50A 8ABPA 2XUOA 4PXSA 4A4DA 3QA9A 3KHKA 4Y2RA 4XLTA 2QR3A 1Q1BA 4A82A 3AF5A 1EYZA 2BEVA 4KN9S 1R18A 3LGXA 1N9GA 4K9QA 1V4VA 2IBSA 4ETWA 4Z7JA 2Y8EA 2G4LA 4KWTA 2P62A 3U7FB 2A4KA 1K66A 3BD8A 2DPXA 3WDKA 3T7DA 3MTQA 1RPRA 4ZDJA 4XWGA 3LC0A 3NTQA 2WOOA 4ARVA 2O0MA 4ZT3A 2HS0A 2FSVA 5DRTA 4A9AA 3ZXUB 3PI6A 5BN1