3N2KB

Tubulin-nsc 613862: rb3 stathmin-like domain complex
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
428
structure length
420
Chain Sequence
b'REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Stathmin and interfacial microtubule inhibitors recognize a naturally curved conformation of tubulin dimers.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 113
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3n2kB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3n2kB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3n2kB01
3JASA 3HKBA 1W5FA 4YJ2A 4DRXB 4EB6B 4LNUB 3M8KA 4B45A 4I50A 4TV9B 5C8YB 4X1KA 2Q1YA 3JAWA 5LP6A 2BTQA 4O4LB 4ZOLA 1TUBA 2BTOA 4EI8A 4YJ3B 4TV8A 2VXYA 2VAMA 4X1IB 4WBNA 5IJ0A 1TVKB 5LOVB 4I55B 5GONA 3ZIDA 2Q1XA 3N2KA 4O4JA 4FFBA 3JALA 3M89A 2RHJA 5ITZB 5EYPB 3RYIA 4O2AB 3VO8A 5KX5A 4X20B 1W59A 3HKCB 4ZHQB 4HNAA 1W5EA 5LA6A 4ZI7A 1FFXB 4O4IA 5IJ9B 3JAKB 3WGNA 4EI9A 3RYFA 4I4TA 2RHLA 3R4VA 4X1YB 5IYZA 3HKBB 1RLUA 3C8LA 1OFUA 4IHJB 5J2UA 3JAWB 2BTQB 3HKEA 4ZOLB 5LYJA 5JCOA 3JARB 5CA1B 4IIJA 2GVIA 3RB8A 4WBNB 5IJ0B 2RHHA 3UT5A 4U3JB 5CA0A 5JQGA 1FSZA 2XKBA 4TUYB 5JH7A 2VAPA 4F6RA 1SA0A 3HKDA 3N2KB 4O4JB 5FNVA 4FFBB 5EZYA 3RYCA 1W581 5MN4A 3N2GA 1Z5WA 3JALB 3ZBQA 5CB4A 4E6EA 4KWEA 4O2BB 3RYIB 4HNAB 3E22B 4ZI7B 3CB2A 4O4IB 5EIBC 4TV9A 3RYFB 4O4HA 5KMGA 3JASB 5IYZB 2XKAA 3VOBA 4YJ2B 4I50B 4X1IA 5BMVA 4X1KB 5JVDA 1RQ2A 5EIBD 5LP6B 2R6R1 3HKEB 3ZBPA 1TUBB 4I55A 5J2TA 5MN6A 4B46A 3WGJA 4IIJB 4TV8B 5LXTA 1RQ7A 1JFFA 3RYHA 5CA0B 5GONB 5ITZA 3JATA 5JH7B 3WGKA 5M7EA 5EYPA 4F6RB 4O2AA 3HKDB 5FNVB 4XCQA 5EZYB 3VO9A 5CB4B 3VOAA 5KX5B 4X1YA 5LA6B 4DRXA 4EB6A 4LNUA 5C8YA 2VAWA 4O4HB 4I4TB 4IHJA 5KMGB 4DXDA 4O4LA 1Z5VA 4YJ3A 3JARA 5CA1A 4M8IA 2RHOA 5JVDB 5BMVB 5MN5A 3V3TA 1TVKA 5J2UB 5LOVA 5LYJB 5J2TB 4U3JA 4TUYA 3WGMA 2R751 5LXTB 3VPAA 1JFFB 5LP6C 3RYHB 3UT5B 5JCOC 5JQGB 4EI7A 3JATB 4O2BA 4U39A 1SA0B 3RYCB 4X20A 1W5AA 3HKCA 3N2GB 4ZHQA 1W5BA 3E22A 5IJ9A 1FFXA 3WGLA 3JAKA
chains in the Genus database with same CATH superfamily
4V1CB 2QAGB 5LMUB 5DTJA 3AU9A 2HHHO 4ZEWA 2NU7B 4C87A 4FGWA 1EI9A 4EQ6A 3B8MA 2ZETA 3EEIA 2JAQA 3NLLA 2IIQA 4CMIA 1Y1QA 4BVRA 1O94C 1EVZA 4IHJB 3AVUA 1C7IA 3QNWA 1MGPA 4BO7A 4J0GA 2IOQA 4L4YA 4B83A 1OX4A 1B3RA 2E5LB 4RH1A 1OT5A 3OBBA 1PGJA 4K1XA 4LY9A 2FE1A 4P82A 5C4MA 3LK6A 4DMLA 1Q74A 4HB0A 4YRZA 4OQNA 1DKRA 1L7AA 4WWHA 2ZBRA 1DHRA 1LBSA 3SGIA 1K7EB 2GHRA 2SKEA 3P96A 1HMYA 5AM1A 1B42A 4R7GA 3BA6A 4MVRA 1G6OA 2O7RA 1KEUA 3GH1A 1H66A 3P4YA 2L82A 3JYHA 3UUFA 4WJKB 4NI5A 3OFNG 1QGZA 4C7BA 1DAMA 3A0UA 5C9ZA 4X1KA 1YZYA 1KVRA 1QCEA 1FUUA 2CL0X 4MUHA 4QOSA 1RYFA 4M60A 3OE7A 4NYMR 1R3DA 1UDRA 1DJOA 3MD0A 1E1YA 5CG1A 4QO8A 2C2KA 1GG5A 1DC8A 2YKGA 3HM9A 5K5EA 2ZR7A 4HADA 4MUBA 4UC0A 2GTSA 5L3GA 4U7OA 2QM0A 3KIPA 5EIBC 1ZYUA 3ZLVA 1CKEA 3MHSC 4MWSA 4X1KB 1GU0A 2AYXA 4CU5A 4GM4A 1AXGA 4FLTA 1RR6A 4DV7B 3ND9A 3CMAF 6NULA 1XPRA 2QN8A 3ECSA 2JPDA 1ESMA 1JTVA 4AI8A 1QC5B 2QZZA 3W8RA 3MRSA 5J4HA 5DV9A 3KEOA 4P22A 5FUWA 3VM6A 3NDRA 1R5JA 1J7KA 3CW8X 4BYMA 2VHJA 2NUPA 4N1AA 2EHJA 4F2GA 3RT7A 2I4RA 4JBWA 3CWZA 1E1RD 3UBTA 3DZKA 4DGQA 3OTOB 4ER0A 3JCMM 3VNSA 4QIHA 3OQJA 2NU9A 4F4LA 2ZAUA 3Q6IA 4U8GA 1T1SA 4MQBA 3JQDA 4D1YA 5FPTA 1H2GA 1IXMA 3V1YA 4NBUA 4F6CA 4MR8B 2QOEA 1FZTA 3TE6A 2FPKA 3BCCH 5JSYA 3WICA 1XAHA 2E1RA 2X0LA 1T6YA 5KYTA 4LH7A 5BRNA 1Z0UA 1C7QA 3CPQA 4C3OB 2CVQA 1QR6A 3Q3JB 4ZEOA 1JUDA 5CDTA 5E1DA 1MEOA 2F4VO 4RJIA 3QGMA 4EVSA 1AVMA 1O9HA 1OB2A 1KOGA 3HFSA 1NW5A 2ZBVA 3W05A 3GJ4A 3T3IA 2O2EA 3EODA 2ZVDA 4DYDA 4FLXA 1MF7A 2R7AA 2HPHA 4NRDA 2YIMA 4IT5A 1NTZH 3I6BA 4B6PA 1QIEA 5KNCH 1H0HA 2WPDG 4Z0TA 5JLJA 3GDHA 1YBAA 3DL2A 2I7XA 1ONPA 1Q1BA 4YNBA 3VDXA 4PFSA 1C14A 1EN4A 4L4UA 4D4HA 3QKIA 2FNAA 1JV2B 1TYAE 1DC7A 4PU0A 1E9CA 1HDOA 4MS4A 1T0BA 4MVWA 4FMPA 2F93B 4MW8A 4WINA 5LQDA 3QYPA 2OR3A 5JSFA 1C9EA 3BCSA 1YR9A 4TMKA 4BC1A 2IXTA 3ODGA 4L07A 2CH7A 3ABKB 3G0DA 4UD6A 1WN7A 3JQ9A 1W88A 2I29A 1UBHS 4BIMA 4ZO4A 1GDTA 5BNZA 2RGCA 3GZTB 3OX4A 3AG5A 1BEZA 2IYZA 1A27A 4F71A 3T2MA 2PQ0A 2GZMA 3U4DA 3G79A 4U3JA 5FJJA 3LKDA 3ZHTA 3GGJA 1VJ5A 3NC0C 1I4LD 3SYPA 4N7RA 2A0YA 1W1UA 1M2WA 5CLGA 2PYZA 3IQIX 1UFYA 5EKTA 1K6XA 2CH7B 4JQCA 1I4EB 4UBMA 2IXDA 5HF9A 2I6XA 4R9SA 1ISGA 3FYHA 1TM2A 4DV0O 1CQJA 5BXZA 3OFNA 1JLLA 2YR0A 1NLYA 2I6SA 1ZIOA 4IRXA 1LB1B 3MT8A 2LTAA 3W2IA 2AJBA 4F38A 3WJQA 3FUCA 4BE4A 5KAMA 5JNWA 4MYHA 2IZZA 4U3JB 5CAEA 3NEAA 2NQ2C 2QEQA 2AC4A 4WERA 1LV8A 5AW4A 3AZPA 1F3LA 1P45A 4KK3A 2Q1SA 4BMXA 3DHWC 4IVQA 4D9IA 3U4MA 3PICA 4IGGA 3V4LA 4ESVA 1U7XA 4ZIRA 5I47A 4XJXA 1JLLB 3UF0A 2FQ1A 3QUAA 4TMVA 3WPWA 1NM5A 5ANRB 4D45A 2GPNA 2B4RO 3EAFA 3OESA 1KKLA 1LRKA 4CIBA 4MO2A 3QUTA 2ZKLA 1Q3EA 4EPYA 3AG3B 3PQFA 4H6PA 1W19A 1H2AS 3BXEA 3VR5H 3GPBA 4XIGS 4IVNA 2I7TA 4I50F 2NSYA 5LA6A 4UBJA 2O4UX 3B70A 4INAA 1JEDA 1OAPA 2Z30A 4MVUA 3QNMA 1NOIA 2I9PA 1ZSYA 3B8HA 2FLVA 3IPXA 4PZYA 1BYIA 1QTQA 5LDDC 3IQWA 3VZDA 1VGQA 5B3LA 4E11A 1Q15A 3HLYA 1Q14A 1IHOA 2Y0EA 4OMCA 3QE4A 4URZR 3LNCA 2AXPA 2ZYTX 1H1LB 5EYPA 1ZVQA 1W44A 3T34A 2LFRA 1OXBB 1UK8A 4G8JA 2P4HX 3K0CC 5LA6B 1KH1A 2VF2A 3ZIAG 2B94A 4IIGA 3DLCA 3A28A 1RPOA 4UZFA 5FX2A 3MZ0A 2Y0IA 4JQZA 2YVKA 3O3NB 1ZIDA 4ZHQA 4HYYA 3ZY5A 1MU0A 2CCKA 2WWRA 2MJLA 1S8NA 4O3FA 5HEKA 1MKYA 2XITA 3F46A 2V4UA 4OMUA 3IAEA 1ECBA 3H65A 2IG8A 4L73A 5EYPB 1RAEA 2VHUA 1B3BA 3JAKB 2WPDA 3FBGA 1IY1A 3Q4GA 3NV7A 3LWNA 1LK5A 2QUBA 2OG2A 1O9BA 3K2QA 4I6GA 4XDZA 1AUVA 1E7KA 1VKZA 4J0EA 1ZJJA 4R1PA 1NY5A 4IIJF 2P2LA 2Z9CA 5HILA 1AZWA 2BM0A 1MNGA 2GCIA 4TXHA 4IBOA 4WOJA 2GZ1A 1QFMA 4DLPA 3CYFA 3TTYA 2FR1A 1RQPA 3RYHA 3SIVA 4RQTA 3MMSA 3GK3A 2AFRA 4EBFA 2VWQA 2QS9A 4FX2A 4LWPA 2MHCA 4N3BA 4EF4A 1XMJA 1Y5IA 1Q0RA 4IGIA 1KL7A 3THWA 4Y6OA 2QVGA 3FF4A 2GZSA 2YZ2A 3DWFA 4TWKA 4ZT5A 3RTEA 3LDHA 1ULTA 4HYTA 5E7QA 4A82A 3ASOB 2WZQA 2BGIA 5KHAA 3D3WA 4DUGD 2Q7DA 2C9BA 3CD6F 2CMHA 3CMMA 3DSQA 1T6NA 1U0LA 3R7WA 2WTUA 1JRLA 4Y2VA 2X4GA 1KOJA 3F0TA 1NVEA 3JAMA 2O7SA 1BHSA 1GPKA 3T5TA 5AVYA 1Q3KA 1NVWQ 4BXOA 2P1RA 3UJHA 3LWVC 1JJ2F 2PHZA 3WGOA 4BKMA 3DWGA 2YTZA 2Q1WA 2R6R1 1QVFF 5FI5A 4DC9A 2QVLA 2ZI3A 3GNTA 3PKZA 3D3WB 5M7EA 4N40A 4C81A 2KI5A 3ZLUA 1YACA 4QIWF 1KYXA 4O1HA 1NNEA 4QDZA 1NOJA 2EW2A 2Z5FA 1M34B 3R7WB 2EJ7A 1JXMA 3EYAA 3GL9A 3FFBA 1MV5A 4JC5A 3DNMA 4BXOB 2C54A 4RESA 2MMGA 3PUXA 3AEXA 1ENOA 4RL4A 1MVNA 3AG4C 3RFTA 2WIJA 5DP1A 1E92A 4D26A 4M37A 1W48A 4M89A 5HRUA 1M8FA 1MVOA 4S1PA 2QG4A 4UB6Z 3TAXA 2VNHA 1AUQA 3UMGA 3AK2A 4YXWG 3VCZA 3PWKA 4EL5A 1LQUA 2OOSA 4WCEV 3M70A 2WM8A 4IFIA 3K0TA 3PHBE 2PT7A 3X44A 4J0FA 4A6DA 1HLGA 4NENA 3KKMA 2IF2A 2EP8A 2FTKE 4FGLA 4ZAWA 3FNFA 4J2OA 5TGTA 2LBXA 5K0ZA 1UJMA 1V35A 4HZ3A 5EESA 3FPGA 1KK3A 2GF0A 4J07A 3CGGA 1ZW6A 4LI0A 4G0YA 3LUGA 3TXAA 3IEMA 1F4PA 1H2XA 5AQEA 2ZWOA 3VQWA 4UNPA 3LBIA 2XIQA 1W46A 3QV1A 2VHVA 4HEA1 2CBZA 2HH9A 2XVZA 1ORQC 4MS2A 4PGAA 2CXOA 1X7WA 3F6BX 1VMKA 4CMCA 4MOWA 1IEVA 3BQNB 3SAJA 4IXNA 2FWIA 3DCJA 2O2GA 2AFIE 2C0QA 2GD1O 4CTJA 2V03A 4E1AA 3GUCA 3OP1A 3C45A 1WPBA 4C4RA 2LDXA 4HSEA 4ZKIA 3QPDA 4KHZA 1NE7A 1K75A 2FZ4A 2J4CA 1E5TA 3HA3A 1L0LH 3WDSA 1T1IA 2FZWA 2E4AA 4BWGA 3G71F 4A2PA 1GKLA 3VSBA 4R1TA 2Y3IA 4PE5B 4LZZA 1LC3A 3I9KA 5IBRA 2JL1A 1IK6A 4ENPA 4EKYA 2J87A 4DKJA 3QNEA 2X8BA 3CCRF 3B60A 3AFOA 1GN2A 2HL6A 2UYJA 1EESA 1OOEA 4FYYA 1QE3A 4ER7A 1Z4PX 4LZPA 1H8EG 2QWRB 2OGZA 1CZHA 4ZVNA 5GZ1A 2AZ2A 1N9KA 3OCJA 4B1FA 2BR3A 1GILA 2WT9A 1U04A 2O8NA 5IVDA 3CZRA 1IFXA 5DYWA 2M1XA 5AKJA 1PNVA 2R70A 4DPLA 3NHSA 2XUGA 3FFXA 2Q0OC 1OCEA 3RWMB 2Q6AA 5CBKA 1XZDA 4QELA 1RI2A 2J33A 1ZMRA 2HU8A 2WLLB 2C84A 1NC1A 3NXSA 5FBHA 1NFRA 3QVGA 3U3ZA 3C4JA 4H3SA 4BJ1A 4CT4B 2DMRA 4L4SA 3QWHA 3G2JA 4MA0A 1M8PA 2GNAA 3CZ9A 1IQPA 3TSWA 4AKIA 1U8YA 3R3ZA 1RRVA 5B1BC 1Q43A 2BE3A 2EEPA 2Q8NA 1K86A 2JCGA 4MKFA 3QUCA 1RYNA 5LFAA 1HE2A 2BMFA 4TXMA 1E8MA 1KVUA 4PLCA 4DJDC 5LHHA 2JLUA 4BVBA 2KBEA 3ACCA 4RUKA 1WD7A 3TSYA 1BVUA 5EQJB 4J76A 4O02B 1C7JA 1RXSA 2J9ZB 2GS9A 3I5UA 3UJCA 1FSPA 2OQ2A 2H2AA 1LLQA 1ZVKA 5J4YA 1R9GA 2PX0A 5EZQA 1N6NA 3VBBA 1J5PA 1ID1A 3B3QA 4R1LA 1FMCA 3HYLA 2MW2B 5JATA 3V46A 1QO9A 2IYTA 2JFQA 1WB5A 1TU3A 2ZJZA 1YS6A 2QY9A 4PGGA 2ZCEA 2DTXA 1KP9A 1CZUA 4H3KB 1IBCA 5HIIA 4UD2A 3GB9A 4M99A 2WWVD 2H2DA 2V7GA 1Z8FA 4N5DA 5F9FA 5JJJB 2RGBA 3KT3A 3VYWA 4P54A 4BNVA 3WGYA 2QNBA 1T1RA 2XNDA 3QX7A 1E8DA 1JU9A 4UCOA 3D4BA 1GHTA 1Y74A 3SSOA 1XZBA 1AGRA 1J90A 4GLOA 4DR2B 3HUFA 5C5IA 1GZ0A 1J33A 4YXWA 3NT4A 4WI1A 4J43A 1XZMA 2RNBA 4UM5A 1P5JA 1LJ8A 5DDIP 1SCUA 1KYWA 2CV0A 4B6OA 2NV6A 4J29A 4Y6LA 4COOA 1YRAA 2GK7A 1P80A 4RHEA 3TRIA 1E9SA 4QPNA 4WEOA 3RTAA 1LPSA 1HKHA 2AEEA 3ZWAA 3IR6A 1Y74B 4DLRA 2H0RA 4LHZA 4MTFA 1I0IA 3LUBA 2X8JA 3SHOA 1MXFA 2AXEA 5A4JA 1E4EA 1SCUB 3NXKA 3D0RA 3UKJA 3Q7TA 1EJ6A 3OX3A 2H2IA 3AERA 1LGYA 4RDIA 1E58A 4MYTA 1EE1A 1PT6A 3RFFA 2HW8A 3LPAA 4GEGA 3PFHA 2FAXA 4G56A 3KXIA 2NYUA 3SZGA 5EJEA 2V1XA 4HQOA 2XASA 5CTAA 2ZJAA 1M72A 4H1HA 1AV7A 4U2DA 2CTWA 1YTFD 1JQAA 1SBTA 2FSPA 3OHMA 1KU0A 3PHCA 3HPQA 1RRFA 3AERB 4LSWA 3L49A 1GDDA 2BM1A 1PZXA 1WUKS 1H8EA 5FEUA 3HP4A 2IHNA 1OFIA 4RC9A 4DTIA 3D6HA 1DQRA 4DJ5X 4MB2A 2ZATA 1EXMA 3UAGA 4MQFB 5BXQC 1Q1NA 4AMUA 4RELA 1FFHA 3NTLA 3BA1A 2RIPA 3LYBA 4O59O 2CLHB 4RVHA 1VMEA 1U8TA 2ZKOA 3M6IA 3WADA 1V48A 3GRAA 2PT5A 3BFRA 2AI1A 4OV6B 2JF0A 3KVNA 4PIPA 3FPBA 4Z0NA 3UCEA 2WP8J 4YRJA 1KYZA 2IPNA 5FLKA 4LRTB 5TNXA 4F6LA 4R8SA 2WBLC 1XKTA 4MRVA 5LL6P 4XIFA 1DLIA 3LUTB 3BAFA 4QRDA 2JLZA 1U2SA 1YKFA 2ODTX 5JI2E 3H18A 1T26A 5AKEA 1Y4SA 4B3TO 4W6QA 1PL6A 2Y4OA 2ONYA 4Q01A 1Q6UA 4RKRA 3UJDA 1IDOA 3JAMN 5FYQA 4WUTA 1D5CA 4OM8A 3VVMA 4P38A 2AK2A 2PNFA 1COZA 5DX0A 1VE3A 3CCMF 2FU5C 3ED5A 4QFMA 1GGEA 2E76B 4B3BA 4F5ZA 5HXUA 5HDQA 3ZGNA 4K8RB 2BKLA 2FZVA 5IEJA 5G0VA 2DB3A 3RVSA 4Y6QA 1EK1A 2R9VA 5IYZB 5KSWB 2ZT8A 4WNCA 4PG5A 1F8FA 1EZ4A 1MOQA 1SU8A 3TMAA 2X9GA 4IRUB 5F7JA 4UDXX 1OR8A 4ZBMA 5HWEA 3RCBA 3A9TA 1I9CA 1DC6A 3LL7A 2GAJA 2CGNA 3CNQS 2AGAA 2H08A 3DQQA 3LDAA 3K70D 4ZVOA 2F2TA 4NE7A 1TT7A 1TZCA 4AL4A 4DXHA 3FHCB 4MHSA 4M1ZA 3BZUA 2OHWA 2VHYA 3OA2A 4HDKA 1PV0A 1E64A 1G3MA 2JFHA 1ZWIC 3UMSA 3KJIA 4FYIA 1NJ6A 4FLFA 1H1TA 1AR1B 1ZCZA 1VK3A 2WT4A 4GDFA 2WU8A 1BXGA 1Z39A 4ZIBA 1QMPA 2W0XA 5IJZA 1QQAA 2QUZA 2CXPA 5J2UA 3OMXA 3UT0A 2BDUA 1QVFU 5IUJC 3WWCA 4NEQA 3F7MA 1M1YE 1CT9A 3ZDEA 2DYRC 4JHXA 2WIAA 1KQFA 1O2DA 5ILQA 3I3OA 1FB5A 4HDKB 2D54A 3N8GA 3TLGA 3GBPA 4N41A 3QFRA 3SDSA 3IS3A 3MBMA 1KK1A 5BWCA 2OGSA 5G4UC 4IS3A 1BXGB 4DM7A 3H1KH 2CHSA 1FNMA 1QB8A 2H2GA 3DGFC 4MPDA 5J2UB 1Y3DE 4OJQA 1M0EA 4JL5A 2VPQA 1KNJA 1O0CA 1V41E 3DTVD 3Q1KA 1MZPA 3P3NA 3UC5A 1WF3A 3K7EA 3AILA 3WGQA 4UHHA 4LDRA 4L08A 3B5JA 3MSCA 2GMWA 5LZ2A 5JXJA 3WGNA 2GYUA 3P32A 1X19A 3UV7A 2CY0A 4PZAA 3M3PA 1GZ4A 1V1MB 4FEAA 4YXFA 4XJVA 1I3CA 1EQ2A 3LSUA 3O5AA 4FVTA 2PA3A 4I6JA 4GIBA 1EMDA 1Q6ZA 1JQJC 4AVYA 1QDEA 4NCJA 1UKAA 3F7NA 4B82A 2VP4A 3LUFA 1PJZA 2BGKA 3TCUA 3SQNA 4F93B 3MYRA 2IS2A 1GWNA 3E9NA 4W5JA 1OXXK 4K9LA 2P0AA 4NONA 1TJ3A 2BKXA 1O8BA 3SF8A 3FSGA 1VLQA 4CG2A 2IQQA 4Z2WA 5EXDA 5I7VA 2V7QD 2FYTA 2HLDD 1HNWB 4J16A 1FNBA 4MGKR 5DU2A 2CVPA 3KKNA 4QJFB 3DDHA 2WZDA 4QUGA 4M36A 3G0CA 1QCYA 4EY3A 2ZAMA 3PD7A 4X6XA 1EX6A 3DEZA 4BVGA 3JWEA 2HA5A 1E2DA 3W4IA 1KYIA 1V8OA 3UFXB 5FADA 2NAFA 3DXRA 4NR0A 3VI4B 4FEEA 1G9SA 5LU8A 2YVUA 2F1OA 4WA7A 5IN5A 3SF8B 3ESRA 3IT3A 3WYAA 1LBIA 4H17A 3SBOA 4QOEA 2UYCA 4XB2A 2PS9A 3QNUA 3M6AA 4RO2A 1S5HC 4OHYA 1YCHA 2IEAA 2P1ZA 1JDBC 3BWYA 4FYMA 4G0ZA 4L16A 3AETA 3OLWA 5E6UA 3CWCA 4K0KO 1LUWA 3BRCA 2KM1A 1Z8NA 5CUQA 3PYXA 2ZYGA 4RAIA 2GZAA 3NH6A 3OZVA 2BDTA 1Y6XA 4CIDA 1NW8A 1P74A 1C0LA 3CG4A 4RPGA 3BH6A 3NTVA 3V3TA 1N2BA 4ZQFA 1Q1AA 3H5OA 2VT2A 2WJVA 1W9MA 3FCEA 3PXBA 2BUCA 1V3UA 1LX7A 3G8YA 3UJ6A 4KX5A 1QLWA 1RWWA 4DG5A 3DE7X 3V3KA 2PYDA 2WKRA 1R5BA 4G0MA 2ODWA 1CK4A 3NFRA 1WUIS 2X23A 5K1XA 3AETB 3BCRA 5E6UB 4BNTA 5IKEA 3N4YA 3HU1A 1NMEA 3OLXA 4UB8Z 3LRTA 3B13B 4DWOA 2DC1A 2GAFA 4IS2A 4LDAA 1XJWA 3U11A 1XA4A 4KAXA 1BMFG 1XTZA 1VOTA 1XQ8A 3AUTA 4RJJA 4C0JA 3ZOZA 4OK6A 1YQTA 2X1VA 2M6RA 1SETA 1KPIA 3KZOA 4H2DA 1TM7E 3O3CA 3GVXA 5E7JA 2HXSA 4CVNA 3OQBA 3KQHA 4BATA 1P0IA 4DA0A 1TX4B 3ZE6A 2NR5A 4ZI5A 4LOAA 1QE0A 3H86A 4NV3A 2Z3ZA 2P8JA 4ERHA 4CWAA 2HP0A 3FROA 1KEPA 5E4JA 2CWWA 1NW4A 2QDKA 5LYYA 3DFMA 3CWBH 2XBLA 1RLGA 2PZSA 3FPSA 4EHBA 4QDUA 4X8AA 3DDWA 3IAS6 4LYYA 2D6FA 4EX7A 1S4QA 4BHTA 3SBDA 2I2FA 1XTTA 1EN5A 2IUYA 3USZA 3S1AA 4YMTA 4UU0A 1JKMA 5K8CA 3V1TC 5GW7A 4D98A 1Z7EA 4J7XA 3QLUC 1ZNZA 4AUKA 5DVZA 1NXQA 3OEEG 3PG5A 5KVCA 1QK3A 4NH4A 1OT3A 4MQ6A 2OD9A 1PYGA 3BZBA 3DAHA 5AOVA 4NL4H 3GAFA 4RNCA 2J3LA 1D9XA 3BRWD 5KEIA 5LXTA 5M29A 3C8HA 1WS6A 3KCNA 3S1AB 4EVRA 5GZ3A 5FA6A 3M1LA 2PKEA 3WK5A 1NDHA 3QLEA 2PYIA 3ZH9B 4GKKO 1E1QG 1NKVA 4B80A 1TVKA 4XX0A 4LXTA 3N6RA 2ARKA 1Y9AA 1PI3A 2IEBA 4XYBA 3CE9A 1DAIA 4ND3A 4PA3A 1FFEA 3ZDCA 1Q0HA 4TS1A 3W5HA 3QF7A 1OBFO 3AVQA 2MWMA 1D07A 4TRRA 2O3RA 3AKEA 2CXQA 1VSTA 4AIRA 2VYVA 5COQA 3TD9A 1QPBA 3QZUA 4FSDA 3NB0A 2BV3A 3VYUC 1DBPA 2QJTA 3TQSA 4PPFA 1VBFA 1IMJA 4DSNA 2QWQB 4K88A 4WOCA 2WU4A 3ZN2A 4LTDA 3A3NA 4Z1OA 5ER6A 2H4WA 5GADl 3BEOA 4BE7B 3EZ7A 1EN6A 4YO8A 3N58A 3X43A 4EFNA 1UPCA 3N05A 4PPNA 4G37A 3H9EO 2IY7A 5IVKA 4Q15A 5ERXA 3Q10A 4PAMA 1DCTA 2P27A 2PD6A 5D6NA 4MIYA 4D3FA 1QV7A 2AG5A 4Z9XA 3BK2A 2BZSA 4F3CA 1QR9A 1NVDA 1KI1A 1BKSB 4MMYB 5FI3A 4G97A 1DAGA 2VGMA 4HSGA 1R7RA 1Y5NA 1YQ9A 3FY4A 1TYBE 3KXLA 2J6CA 1O03A 5EJ6A 1AKRA 2FPOA 1B06A 4L51A 3A2KA 1L5LA 5EE1A 2FSVC 3I09A 2GARA 2DBYA 3D7RA 3QKTA 2NOAA 5FUXA 3F78A 3ZMUA 2C88A 1V45E 2J3MA 4RK6A 5BSMA 4HNUA 1W2HA 2G9UA 1KWGA 4J0KA 2J5RA 4IJWA 2C58A 4NTZA 1YL7A 1HR0O 1BMFA 2W6OA 1HWYA 1BC5A 4DMUB 3SFTA 2VPZA 3B3JA 1JFFA 5JW6A 4DV6O 1Z3CA 1L8XA 4K2AA 5IT9A 2HFKA 3TIVA 4HDSB 4RSGA 3HCEA 5DEIA 4RHUA 4PO9A 3U62A 4DQ0A 2RQ6A 5I9IA 3OONA 4EI7A 5T7BA 5ABPA 3SYRA 3L5KA 1JSZA 2C8VA 2JLXA 2V7XA 3A27A 3VIUA 4R7CA 1C7FA 1D4AA 2PVCA 3O8QB 4M76B 2XDQA 1M0WA 4TKUB 2J31A 3EGXA 1RHUA 2Y77A 1S2DA 3NKVA 1NF2A 3G2NA 2NVOA 2ODAA 3D3KA 2VH1A 4JTAB 3QF4A 1NQUA 3H5AA 3WDMA 5CA0A 5EJ2A 1SG9A 2D0PB 3K8YA 4OI1A 3LX4A 4JLUA 3AUXA 3OJ0A 5DNEA 5TQ0A 1P5ZB 2XYRA 2CMGA 3WK6A 3OEEA 2XNHA 1RYEA 1P9LA 2BOBC 5EUCA 1BCRA 2FTKA 2XDQB 2XUDA 2GXSA 3EGXB 4JWTA 3FIUA 3PUYA 3NIWA 2NSLA 3IP6A 3VTFA 4EB6A 3BXXA 1EB8A 1JQBA 3JRNA 2Y1WA 3BX1A 1WCIB 2PUCA 2HS0A 2FN9A 3DVAB 4ZDKA 2VZ0A 1N5JA 3PZRA 4QXQA 3USES 1ISRA 3UO2A 1DWUA 2L42A 5TQ0B 4YRSA 1AXRA 2PAFA 3K8OE 1SCJA 5CFMA 3DXYA 3OZ7A 1I5EA 3I5YA 4FMTA 1BCRB 4HX9A 3DQPA 4KJZA 2AFIA 3ONNA 4FOSA 4ZI7A 2ZNIA 3DGEC 1Q2XA 2JFOA 2WINI 2Y76A 2WD9A 3F2VA 3BFJA 5AW5A 2LCIA 4P7JA 3LW7A 5FF9A 3A1DA 3QFSA 4MYCA 1YQXA 2FGJA 5KINB 2BW0A 3N2IA 4BO3A 2I7VA 4YRQA 1W87A 4ZZ3A 4BO0A 4I6EA 3PKIA 3FOAA 3IMGA 2Q5LA 1ZZEA 2GERA 1F9AA 4AG5A 1XZAA 2C77A 2ZUUA 3LP8A 4N01A 1L7XA 5JYDA 1KJIA 2IYFA 4HBZA 5B1AC 4BLOA 3F6CA 4CI0B 2DPHA 5CBFA 1FJGB 1ULHA 2PFGA 2P9FA 4HFJA 4GMFA 4KE8A 2ZJOA 1V55C 4C3UA 3MTDA 1D7AA 1XPOA 3WFZA 1NP3A 3D01A 4ZJPA 4OIMA 5C34B 1VCNA 1HNXB 3PQ7A 1S96A 1KDOA 2A5JA 4EAAA 2FVXA 4MUAA 3D5EA 2HC9A 4GRDA 4GLLA 4CM9A 5BYJA 2PZKA 1UKBA 2ZJ3A 3TRJA 1SKUA 5B4VA 4QXMA 2H3OA 4EW2A 2OG1A 2VYCA 2HLPA 3ILVA 1FBTA 2P6PA 1KEZA 3PEEA 5AI4A 4C5AA 3HU5A 3RE1A 4AMGA 2CE7A 4KXFB 3DT6A 4ZQIA 4LOKA 4MRMA 4OQXA 1OCOC 1I2AA 1XTSA 3ZDRA 4DSTA 2WMDA 1U8CB 2F6RA 4F5WA 3W8DA 3OQNA 3A6HA 3VHLB 1PBNA 1BQZA 4PC7A 4Q9DA 1V5IA 3MTGA 4EY8A 1E77A 3PIRA 3CO0S 3T9FA 2DEUA 4GKJO 1P2GA 3LUHA 2XECA 2Y6UA 1GLVA 2QKSA 1QZXA 1HFEL 4OA8A 2PUVA 2YMMA 2ABWA 1ENPA 2N74A 4H3VA 4HXFB 3WV5A 2Q4PA 3O38A 3C7CB 3I7TA 4D0RA 1QU2A 4YAEA 2V96A 4QTUB 5JCJD 1P5RA 3T5AA 1QG2A 1H2MA 3C8ZA 1H42A 1MX9A 1ZH8A 3CEPB 3HB9A 1W4RA 4H7JA 4ARVA 5KVQA 1NURA 3D00A 4Q3KA 2RKWA 1KMNA 1XZNA 4XWKA 3KSZO 3QPVA 3AG4B 2CHFA 5JZSA 1P2UA 1SVMA 1Y8RA 2CF5A 4MB0A 3BSWA 3OHSX 4PRZA 1J9ZA 4UOEA 1CY2A 2J8ZA 3G49A 4QQ8A 4UJ5A 5A71A 1JIQA 2B21A 3ZX5A 2WP0A 2EZPA 4OXRA 2JH8A 4W1QA 3PSAA 5C0OE 4KXQA 4B4KA 1IEQA 2Q28A 2EL9A 1NTKH 3NDIA 4YI5A 5AKIA 4YQEA 4LY6A 3E03A 1WVGA 2OYQA 5KQGA 1R4AA 3H2YA 4J2HA 1M6WA 1OYVA 3HDGA 3SQDA 4J1SA 3RVQA 4HZUA 4YAKA 3CNLA 1PSZA 5AM2A 2PCJA 4ZREA 1GNLA 1Y8RB 2FG5A 3R7DA 4EH1A 3FTDA 5IRCD 5ENDA 1G8GA 4J16C 2FEAA 1UK7A 5JHGB 3L75H 3KPJA 3M7IA 2J67A 1U0OC 2OXIA 3E5MA 2Q2NA 1X1TA 3N3BC 2PDAA 4JNCA 4NZNA 1BDBA 1R6XA 3UBMA 1U2QA 3FD8A 1AA6A 2OZBA 1OLXA 4TL9A 5LIPA 1PQYA 3W04A 4B5CA 2G4VA 3NHYA 1YIJF 4Y6RA 1GNSA 4MDYA 2P5YA 3GEGA 2F8SA 2G71A 2R8RA 2Z09A 3V1UA 2WALA 4E22A 3I56F 3GR6A 4TTVA 2AD5A 4BU0A 3M4SA 1SKQA 1XELA 2GXUA 1ZUIA 1NG1A 3A6GA 1DRWA 2VJMA 4BNKA 4B0PA 3SBXA 5A5EA 5ALJA 4ZVRA 4ES6A 3TMKA 3ENZA 1QH9A 2Q4OA 4XIJA 4ZVKA 4N7JA 5DP2A 3BMQB 4KXLA 4RZUA 2O2JA 4QUHA 3FAVB 2IE0A 3CNHA 3FOCA 3ZWOA 3P26A 3QUSA 1QHHA 1RQGA 1V96A 4FIDA 4BCCA 2WUFA 2Q73A 2NXWA 2YN2A 4EQ6B 4WPGA 3RSHA 2H9AA 2ZULA 4Z54A 4CMIB 5FXMA 1VGVA 4NTXA 5BQ5A 1RCTE 1NH2D 1HOXA 4CH5A 3M4NA 2VJMB 1U43A 5D86A 4W5TA 3ZZNA 2ZVPX 1JLHA 1VI5A 5U4XA 2FN3A 4MQ4A 4U9UA 5B58C 4L3VA 4FDAA 3HGQA 4RHAA 1OX4B 1MG5A 3IUSA 2K1SA 3O95A 2PY6A 1FS5A 1QHHB 9GPBA 4KWCA 4LSMA 4YX9A 3FWNA 4I3FA 1H65A 3ZK9A 2OQVA 1USKA 5B1BB 4BNUA 5T6BA 3RVMA 2O48X 4FQ5A 1JEYA 3U56A 5F5NA 2K2QB 2RARA 4B6SA 3SY8A 2RGWA 3OPXA 1F60A 1MCZA 5IT9N 4DEYA 2ID7A 4FI3F 2IHBA 2W2PA 4E7OA 1FSZA 4MQ5A 3JWHA 1N7IA 4C0AC 4IHAA 1NKDA 2ONZA 4NULA 5IYBO 3FD5A 4RJKA 4ZQEA 3APQA 1A8QA 2GTIA 3T7KA 1K7XB 1JEYB 4G5OA 1Y1KE 1ZXBA 1B73A 1NUPA 1KK0A 3PDIA 1JT2A 1Y42X 4PDVA 2DR2A 1ZJ5A 2DWQA 4S1OA 4RJLA 2JJ2A 3AT1A 3MUEA 5DK6A 2Q62A 2Z8XA 2Z56A 3FWYA 2ZYSA 4YRFA 1JLMA 3Q9SA 8ATCA 3JAMM 1YRBA 2GEVA 1Z5UA 5HGJA 2CZCA 1Z37A 5I9NA 5ESXA 5BWMA 3AK3A 1D2MA 1H6AA 2LDBA 5L45A 5EHIA 1BJKA 1DKLA 4YY3O 3I55V 3LYUA 2IZ1A 2NUPB 5EWRA 3F0EA 3ETEA 1LI4A 3FZEA 4P98A 2O54A 4JLWA 1KAGA 3ICCA 3CUWA 5JXIA 5TF0A 2NU9B 3C1AA 5D5QA 1J8VA 2CJWA 2UYNA 1OI3A 1ZA2A 2YS6A 5TMDA 2ANBA 2F67A 5IXJA 1XQVA 1M1YA 3A6DA 2N1BA 5JC8A 2Z43A 4X94A 2DR3A 2ZAOA 1NR5A 3MTIA 2FUG1 3L7OA 2VSQA 3L46A 1K8RA 5HZHA 5TT0A 4BBPA 4G65A 4H7PA 4WY2A 2IDZA 4HMOA 1KFEB 3PFFA 4HMQA 1NVMB 1CFJA 3SPGA 4P84A 2DUJA 1C8LA 2YIJA 2ZT6A 1ZGZA 5EEGA 5K2MA 2CJWB 3W9BA 1GK9A 3SX4A 1WVIA 2R72A 1GOTA 3F7OA 5DIZA 1U3PA 4OPHA 1XWFA 5DK4A 1UC9A 1M1YB 1YIDA 3MB5A 3R40A 4BW0B 2BH2A 1R9JA 1RM0A 3QWFA 4M54A 5J1SB 2XZTA 2GA9A 4O4IA 3DSRA 4J94A 3LKZA 3IIJA 4DLXA 1U63A 2AV6A 2AR7A 5T41A 3CRAA 4K6HA 1SA0A 3GFTA 2FN8A 1KK2A 4BY9E 3NHMA 4QDTA 4FOTA 1FRFS 2UUBO 2DQYA 3MWDA 4MS4B 5L6MB 3K59A 5CG2A 3G85A 2BMVA 5J2TA 4FFOA 1JLSA 1DAHA 3EA5A 1JHAA 4MPTA 1ENVA 1NX6A 2P5TB 2N9UA 2BT4A 3TLBA 1U0TA 1VQKV 3JQPA 3DE2X 3BL8A 3EXG1 4EQZA 3P10A 4Z8XA 3VQYA 2ITDC 3NIBA 4JI2O 4EMUA 4LHSA 1US8A 5F64A 4BFUA 1V3TA 1JIXA 1IAQA 4P35A 1FLVA 2YWGA 1W88B 5LN1A 1SA0B 5BSGA 1A72A 2HF7A 1JXOA 2WF7A 1VTKA 1MNAA 2KG4A 3MWDB 2A8YA 4GAEA 1T9KA 3OJOA 2DQZA 2O8BA 1H47A 5AO9A 3NHBA 4C5BA 1FFGA 3GBSA 1QRDA 5JT1A 2V4ZA 6ABPA 5B66Z 3WDKA 3L1JA 2OBFA 3P0ZA 4NDZA 4G1FA 1US8B 1RRCA 4RK0A 1GTVA 2HOQA 3SCZA 1CQJB 2QP3A 5AK3A 3UAOA 1UXKA 4GYYA 2NG1A 1XNRB 3L06A 5HXAA 4U3FH 3SQLA 1PWYE 3LNMB 3KL4A 4IIBA 5CAEB 2O8BB 1W1WA 5F4ZA 1CNEA 2VPXA 1G2IA 5FTLA 3HEBA 3MVEA 3BXHA 2HLHA 1F6WA 3VMFA 4R6ZA 3BHNA 1E2NA 4EA9A 3IT2A 1XLVA 4QSMA 5LHIA 5EJFA 4ZIRB 1K5GA 1XBLA 4XM2A 2J3JA 2PY5A 1XG5A 4E15A 1NZJA 5JWRA 3EY4A 2D8AA 4WCFA 1NNUA 1U0GA 5ECWA 4XWGA 3JY6A 5BW6B 2O14A 4IJMA 2IUEA 2N47A 4K9KA 1WZUA 1E7YA 2XVAA 1DOZA 2VP6A 4YRRA 4C1NA 4K5QA 5LDGA 1LR1A 4JVNA 2IUUA 2XVMA 4AK9A 3IL2A 3AVYA 1IVNA 3WYFA 3GEPA 3S2GA 1LDEA 2V8BA 2QM7A 2X8AA 3HZZA 4YGXB 1PS9A 3F71A 1YJ8A 3VPCA 1RQ2A 3D6AA 4O2LA 3WGTA 4Q82A 4EUHA 3ZYZA 1QS0A 2Z08A 1WULS 2R6CA 1XMQO 2DHEA 4GOXA 3D7SA 1Z4LA 5A0VA 3I37X 3CRNA 1K97A 1DELA 4B6FA 4NXMB 1EUZA 4LZJA 2IT1A 1SHJA 1I51A 2VEDA 4I36A 3ISTA 2H4JA 1CN7A 2C20A 2KPOA 1INLA 1YJ9F 4CIYA 4PZPA 3E05A 4RTLA 2DYRB 1JF8A 4AHCA 2EFEB 5J5VA 1R18A 1WEKA 2C99A 3ACDA 4ZHQB 3VHQA 1E6EA 4MAFA 2HEPA 3FHJA 1VECA 4IF6A 3MS4A 4BMVA 3FCSB 5HZMA 4EARA 4D79A 2WF8A 4IDQA 3EASA 4LFBB 1H38A 4O33A 2CHVA 1F51E 1BHBA 3RW9A 1F2DA 2NPIA 1SKYE 4LUCA 1CLUA 3P97A 1F48A 1O58A 1RYBA 3GXBA 3MMXA 4EW6A 4AF8A 4DWWA 3RYHB 1SUEA 1DV2A 2IV7A 4Z7QB 2NYVA 3C3WA 1NKTA 2D7CA 3T7DA 4MJLA 1FXKC 1Z2CA 1VQ5V 1SVNA 4YV1A 4G1MB 5EKXA 1W0JD 3NU1A 3CHXA 2JGFA 3THWB 4X9XA 4GYJA 5BWOA 1L4LA 2A94A 4ZAYA 3CZCA 3WJAA 2CTRA 3DC2A 4OHZA 4EJ2A 1JG1A 2YOFA 3HV0A 4INJA 1NSYA 1YJBA 2KB1A 1KFCB 2XWSA 4EB8A 4WXYB 1A5AB 3DE3X 1UBOS 1PZHA 1IYZA 3ESJA 5BQXA 2J3EA 4AY3A 2QNRA 1IN5A 1E6WA 4ATNA 2NTJA 2BGNA 3GJSA 1FP1D 3L84A 4G2TA 3DP9A 1E6KA 4G9EA 2QXYA 2DBRA 3KYCA 2W0MA 1NX9A 3S3WA 4X61A 1BMQA 2JGMA 4JBHA 3GDGA 2GFHA 2JIMA 3OPVA 1XRSB 4LJLA 3IT1A 4WFGA 3IC9A 4X3MA 2H7VA 3EMVA 4PA4A 1SC4A 4PGHA 1T1GA 4WN3A 1JDBB 3EBLA 2RHWA 2GGSA 2ZR9A 3L18A 4NKRA 3K1TA 4H59A 4Z86A 1ZM2A 3KYCB 5FJ4C 5JCOA 3BGIA 2AZXA 4PQGA 1E9EA 4QKQA 1Z35A 3BXFA 3DEYX 1J42A 2Z4RA 2PF4E 3WLTA 5F12A 2RFLA 3A2NA 1XHXA 1E2JA 1QX4A 2PXCA 3R09A 1AK9A 3U10A 1EWRA 4I55A 4WFIA 3R5TA 1DGQA 1OU0A 4ZPXA 4BVTA 1DUIA 2ACKA 3U4QA 4NENB 2OOKA 1ZJWA 4JR1A 4N48A 3ZIAA 5C8YA 4JI4B 3UMVA 4KLCA 2W2LA 2XTMA 4ENSA 4GE0A 3ABMC 1O6CA 1MB9A 3GPLA 2OK7A 2EKLA 1QRTA 4U00A 1CDOA 2NU6A 1PX2A 2I65A 1JDVA 4LRWA 2C5SA 1IOWA 3K73O 4XUCA 2EJWA 3P2KA 1ZHOA 3T4EA 4I55B 4GZ6A 2P3SA 3K8QA 4BT7A 2B8WA 4CN9A 1BCCH 1X7WB 2I1VB 2I2BA 3MM4A 4P9OA 1XEWX 3U4QB 1BH2A 5HE8A 5A3SA 4W5NA 2N3ZA 5AHRA 1SXQA 1P5HA 3ZC3A 3AI1A 2HEGA 3E2MA 3QLUA 1DSSG 2AF4C 5HBRA 1HO3A 3UMMA 4YAGA 2D5IA 1U0SY 5B7NA 1DL5A 3HO1A 2NU6B 2XLBA 4I0WB 1A9QA 4L1KA 3JWJA 1M76A 2ZJ7A 4GF5A 1ZA1A 3JPWA 3KYIB 1G2OA 4HH1A 2OZPA 1YZBA 2IELA 3QVOA 2LFSA 3WL3A 1XHOA 4P34A 3HCFA 1VQ1A 2XA2A 4YWHA 5DLQC 1XZCA 3QFCA 2XUOA 3LMEA 1DLJA 1HDZA 1HQDA 1RW4A 5IJXA 3QIVA 3UAXA 4L57A 1DKOA 4RCZA 3IOEA 3VQXA 1V4VA 3AUKA 3IBSA 5BPHA 1WXHA 5AJWA 1IVSA 3OU6A 1S5JA 3QVGB 4AM8A 4ZHYB 2EKZA 1PSDA 3IJRA 2PZ8A 4D9FA 1L7QA 3AJEA 4W1SA 2OXFA 2QENA 4C0QC 4L2IA 3MWJA 1GKKA 5F1OA 1QHXA 3PR1A 4ERNA 1JGTA 721PA 1W96A 1V11A 3OURA 4II2A 1D2AA 4AN1A 1SVIA 4XKJA 3OQMA 3D8HA 3FI0A 3T3DA 3U7JA 4RSRA 1FMFA 1N78A 4XM0A 1QYDA 4C43A 4PX3A 2C9OA 4A6EA 3QUBA 4XWAA 1CV2A 5ALOA 2X40A 4YQYA 2WJPA 1L1FA 3ZQ4A 4UULA 2AG0A 3W2EA 1BQ4A 4HL6A 4V0NA 3VYUB 1GXSA 4L2IB 3T4UA 3CXHF 2QPLA 4L87A 3DOUA 1PU2A 3HAXD 2DHDA 2XNKA 1S9HA 4RGVA 5C93A 3KOYA 1EM8A 4NZ9A 4KLZA 4U7HA 4IR7A 3TD2A 3T5PA 4ZAGA 5GOTA 1I4OA 2QTGA 1N0UA 4PS1A 1X1SA 3IERA 3VOSA 2FSVA 1DKUA 3HC7A 1G9TA 2NX2A 3UAVA 2APJA 2R68A 2NO5A 1YBMA 4JU8A 1RQRA 2P9YA 3CH5A 1VQMV 3G59A 4I2NA 4FZJA 2A2ZA 4DG8A 3HPLC 1EM8B 1MPTA 3ZXSA 3GUZA 1EEHA 4PTYA 4C07A 2AN3A 5GINE 1J5XA 4JQYA 5EE5B 2FUKA 2QDXA 5CFRA 2JEXA 1ZN2A 4B8YA 1HNZO 1TGYA 3D4NA 3DVQX 3IPAA 1AB6A 2CVHA 3GW8A 1P33A 3EOBI 3N3AC 4CLDA 1GPMA 3ZDFA 3W2TA 4EHAA 5IWCA 1N57A 2AN5A 4Y6PA 3RVYA 3K71B 5FDFA 2GDSA 2EL7A 4PS0A 3FLAA 3RYFA 3LZCA 4CLRA 1A9RA 3V4SA 4LFAB 1RM3A 4IH1A 1MHTA 4BEVA 2MYPA 2X8JB 3IRVA 3V1KA 3OUUA 2IC5A 2ODEA 1ZHHA 1Z5WA 4KGZA 2OGTA 1E4EB 2I6DA 1OQAA 4X6YA 3KD2A 5ALSA 2EQAA 3SR0A 1DEHA 3INGA 4TMFA 2C9ZA 3WGUA 1BW9A 3GLRA 5DFAA 2CHQA 4E2FA 3RU2A 2JAOA 4FLEA 2IYRA 3R1IA 3L0SA 2G0TA 2ZSAA 5KKAA 3G0HA 4JY7A 1N7GA 3NHPA 3K12A 1N4CA 2FW0A 3E3AA 3KVOA 4RGQA 2W9XA 3PGXA 3T1TA 2G4LA 2XE7A 4F0JA 2NVBA 2F1KA 5IANA 1GO2A 3PRYA 5B7GA 1V8FA 1NVPD 3JXEA 4NECA 2LZ0A 3Q4HA 4IQ8A 1L7BA 3E35A 1MN6A 4HOYA 4PLWA 3RADC 4PSDA 3QBEA 4LC9A 3DFIA 5H9VA 1EK0A 3L8HA 2EV9A 2X3FA 4C76A 4CEIA 5JDCC 3SLKA 2XMZA 3MJCA 4TQAA 3MRTA 2V7TA 4XSGA 3DGEA 3OUZA 5DYIA 2QZSA 4PG8A 1VPVA 2GB4A 4P08A 4EMSA 4RIIA 4BFTA 1APBA 1Z83A 2HQSA 4X1IA 1SUIA 1EWYA 4XUEA 3EFFK 3MCUA 3ROMA 3HXPA 4EMBA 3SNHA 3O90A 1RXUA 3DB1A 5LPNA 3FCOA 3JD0A 3SYOA 2ZTHA 3OOSA 1ADFA 3IPYA 5JMOA 4F4HA 1J0EA 5K8IA 3MFYA 4CEIB 4JYZA 3FTQA 3I6YA 3KYBA 4MWZA 3DR5A 4K2HA 2VQFB 2HZBA 4RD1A 4GLXA 1FCJA 4RVSA 1FMTA 1OF1A 4Z3KA 2QTNA 3KKLA 4XYGA 1XL6A 1ATIA 4X1IB 2J1LA 3U7EB 4ZHWA 1Z7WA 1TUEA 3R3UA 2QAJA 1N2OA 1OV9A 1WA8A 2P9EA 3I6QA 4IJQA 3UB4A 2ZXUA 2VJLA 1JILA 2XMCA 2O3QA 4P0QB 4CH4A 2R1ZA 1KSHA 3K6KA 3A32A 2WA2A 4EYQA 3IP5A 3VISA 3M99B 4CH6A 3K0FA 2VJOA 3RWBA 1T3GA 3RKUA 1USGA 1QH0A 4B6QA 5DHRA 1TM1E 4NU0A 1C0PA 3T5DA 5B1AB 4WCFC 3ZX6A 1HG0A 1TUEB 4CQMA 1I2CA 1AM4D 1B74A 1G20E 2P35A 1T5LA 2B30A 1V55B 3TDMA 4F2HA 2IKQA 3ZDQA 3O94A 3C0KA 2HFEC 3UKDA 4AWAA 1U31A 4OGFA 3NH9A 3O2NA 3GV0A 3W7XA 1JJ2U 3U60B 3I6MA 4JT8A 1EA7A 3P2OA 3LLCA 2EIMC 4KQ2A 1ND6A 2WIKA 4TYPA 2CE4A 2QMHA 2R8OA 3VZRA 3G9ZA 3S68A 4DEVA 4OHMA 1IXSB 3MHHC 1P2VA 1ZL8A 3ROGA 1K7SN 3PR3A 1K2VN 1BDHA 3T1VA 4LJ9A 3BK7A 1NLZA 5DBIA 3K2EA 1EVYA 4EA7A 3ZRVA 2ZWAA 4Q02A 1ICIA 2O52A 1OCOB 3VV2A 1DAPA 3FUWA 3ZWXA 4QPZA 1UZLA 3SVLA 1PJ2A 4HH0A 4WUVA 2E4XA 3JYNA 4I3HA 4E5SA 4BW9A 1RQXA 1ACLA 2R9AA 4QBIA 3S2UA 2UUCO 1YR1A 4MWBA 3B6MA 5JOQA 1TT5A 5IBCA 1WZIA 1M54A 5AI0A 3ESXA 4W4KA 2WMOB 3EVDA 2CXTA 2XX3A 1ZL8B 3G80A 4UCVA 3TLGB 5CA1A 2EKDA 5D6OA 1XV5A 4DR4B 5KYKA 1EVKA 1N1MA 3KLMX 2GXAA 3UICA 2AKAB 3KPUA 1A8UA 5HP4A 2WTXA 3IAM6 2CYAA 3RDPA 4IJ5A 3RIMA 3HQ4O 3Q3EA 4OO3A 3TF5A 4QT0A 4RS4A 1DRJA 2XYQA 3W4KA 4JA0A 2Q41A 1D03A 3HZOA 4IKEA 3TGWA 5IT9M 1FFAA 5JPCA 1QP4A 3HP1A 2LVBA 1NUSA 4RIFA 5CA1B 2WSSG 1NHGA 1S8FA 1V25A 3RIGA 1PGOA 1T9HA 2XKBA 3H1IH 4FLZA 3KZCA 3NRJA 5CVVA 3B6NA 4LGYA 2F3UA 2PRYA 2ERCA 4LXHA 2ILMA 5JWHA 3TI9A 4FJCC 3EG9A 4IFEA 3N74A 2BIFA 5CN0A 4N5NA 2D1QA 1AHNA 3GDOA 2OLKA 2GF2A 1OA1A 3I6ZA 5CVEA 1U8ZA 4C0BA 2F62A 1Z15A 4U7TB 3L7QA 2P9TA 4BMSA 4KDRA 1U8XX 3H5IA 3D2CA 3C8UA 1G8PA 1FTWA 1VYVA 5K0CA 1SQGA 4FWIB 1W5BA 2C4UA 1VHAA 1A9OA 3C3DA 4CR6A 3EARA 4B2PA 3EG9B 1TA4A 4ZK6A 4DV4O 4B8WA 3UJ9A 5L3VA 2QWXA 3L74H 1IOLA 1ONSA 2WIDA 4N12A 2VRZA 1G0NA 3CA8A 3D4LA 4F3NA 1V0JA 2ZK7A 4HNHA 5A3QA 3DXRB 1V54C 3RS7A 3UV3A 1KHTA 3NAGA 3BGVA 1U4OA 4RULA 5LQKA 2MDTA 3H11A 1YQGA 3CX5F 3BB4A 2PQMA 5LC1A 4S1VA 3KWJA 5CNJA 2DUWA 1KQPA 4DM4A 1N3YA 1W8DA 3KX2A 5D01A 5HDBB 3SJUA 3H9VA 3GFVA 5D87A 2Q9BA 3FD9A 4MKZA 1JDSA 3OWHA 5DT9A 3UWSA 5CBPA 2WHEA 5HJ2A 3L7BA 5HS4A 1SKVA 5ICCA 1E60A 1GADO 5JCOC 4KIJA 1CE8A 4G9BA 4TVSA 4BEBA 2X76A 2ZT9B 2I22A 3FVQA 2PUBA 4G0OA 1LLUA 4Z7JA 2H1SA 1PQWA 3PI7A 5IDQA 4JUBA 4H31A 1OKKD 2IYXA 3PHGA 5EERA 1K33A 3TKAA 1KMIZ 3U0BA 4I8IA 4QGBA 5B3SC 5DLYA 3KR1A 3SSNA 4QPCA 1L4MA 1VRVA 1J8QA 3AGQA 3NWBA 4LF9B 2P2CA 1DARA 4RKQA 1NF8A 2QVZX 4KU4A 7YASA 4RE6A 6PFKA 2WYIA 3FYUA 1GZUA 3C9TA 4JBNA 1AQNA 1S72V 3JQ6A 2XYGA 1KBQA 1P91A 2PX8A 4OPMA 4AUEA 1GPAA 3CHYA 2YICA 4BFWA 4F1KA 1IWPB 3IEIA 2WD7A 5M04A 2UZAA 4KXRA 2Y1OA 2QP9X 4EL0A 1V43A 4L78A 2DUUA 3BIOA 5JBNA 2W22A 4G25A 1DO0A 4KO2S 3RTDA 3ZXUB 4UUOA 1WB4A 1G7CA 4IIEA 1SUAA 4JH0A 4AULA 1PNQA 4XQEA 1BGVA 3VAAA 4JLMA 3E82A 1DDOA 4BYGA 2O8EA 5EUMA 1EIZA 2JCXA 2VXOA 2HP0B 4BLPA 3THOA 1LX6A 1UPTA 1Z34A 4NBKA 1ZN7A 3A04A 3TCXB 3ESZA 2GH1A 3A4VA 1CUAA 3AUJB 1PZMA 1C29B 3AQIA 3I0ZA 3I64A 1Z22A 3M49A 3V8EA 3DE6X 3CC4F 4DZRA 2YHIA 4DBLC 3IAFA 3KOUA 3FOZA 4MTOA 4KGVA 5EZYA 4JI8O 3DTTA 4TSRA 2PBFA 1VM6A 1SK8A 4PQFA 2ONCA 5LLTA 1SS3A 2LGQA 2O8EB 1S7GA 4NYJQ 2WVHA 4TYMA 2WSSA 1W4LA 1S0UA 2R84A 5B36A 1PR0A 4HAOA 4N49A 2I03A 4LNUA 1KO1A 3EULA 1VMGA 4FCWA 4HJXA 1YR8A 1ZK3A 621PA 4CV0A 5LXTB 4WZAE 1PZGA 4ETNA 2YHIB 4JLPA 3MTEA 1CUXA 4DABA 2I3GA 2C61A 1N8SA 3NM6B 3AEIA 2M98A 4TTAA 1C9YA 4EATA 1TVKB 4XX0B 2XWQA 3JD1A 4P3XA 1Z17A 1Y0BA 1XDCA 5EHZA 4YS6A 2QRNA 1IZ0A 1B2RA 2FMUA 2BGJA 3RO7A 2XB8A 3RIEA 3E7XA 1V6AA 2E1PA 3ZZ1A 4NTWA 5C53B 2BEJA 4RZHA 3I61A 3BJZA 2JCYA 2J3HA 3OQIA 3LXRA 1OMOA 5F23A 3MCZA 1AKYA 4BN4A 3NZEA 2BJWA 2WLNA 5U4QA 2ODNA 3LC1O 1FNDA 3UK6A 5TQ2A 5IJAA 1J70A 2R6FA 1O1YA 4FP9A 3MBKA 4D82A 1F0PA 1VLHA 1F51A 1D2DA 1XNJA 3SZOA 4QNNA 3LXUX 3RABA 2FEWB 4PLYA 4QA9A 3IIKA 4Y2XA 3M34A 4KQFA 1MZVA 1EWQA 1I7QB 5FA5A 3TIXB 2QLLA 1AKMA 1XQ1A 2R87A 1C1XA 3A9SA 1G18A 1JSCA 1QYIA 2QJRA 2OHFA 4JOQA 4K6KA 3TIFA 3H5RA 5TQ2B 2OHJA 2JC3A 4Z9FA 4CCYA 5JANA 2QD5A 2XTNA 1H8HD 3N59A 1GTJ1 1AF7A 4M0UA 1RHMA 3AJAA 4YGYA 4BECA 2EBHX 1SKYB 5IAAA 4JOSA 3OEYA 1X1EA 3QWAA 4FOLA 2QZ4A 4QBTA 2X0DA 1MR3F 3E9YA 3WGJA 1WLEA 3GCGA 3DS8A 3U3DA 4BVLA 1QTRA 3HCOA 1AS0A 4LX0A 3SYAA 4KIGA 4EHJA 4H4CA 4QODA 2XRZA 4J1NA 1J97A 4NOKA 4GZMA 5JZOA 2WILA 5H3LA 1SVSA 4IV0A 4FIPC 3SF0A 4JLAA 1JFFB 4K8XA 4TTPA 3BDAA 1GA6A 4NF2A 1I6KA 4XPIA 2C2GA 3Q1LA 4S04A 4X6UA 4GGMX 3I2IA 5BNFA 4BVSA 3UXYA 3U6KA 3CW9A 3K94A 3LUPA 2FDCA 4QU0A 4NIMA 3E7DA 1FYEA 4I7EA 2QIPA 4CM4A 4AQYO 1OY1A 2R2AA 2A0UA 5LBUA 1KRWA 1FPOA 1ST3A 3R3YA 4Q48A 4DBLE 1G4UR 3SSMA 2KBFA 3DULA 4NMLA 1A5BB 1GPH1 4DCNA 5KYXA 1NI3A 2ZS7A 1OX6A 4X90A 1ZL2A 1AQYA 2P1DA 2P5UA 5CH5A 5K1ZA 3QF4B 2PUEA 2PL1A 4BP3A 3LIIA 5EHQA 3WC4A 5LL6Y 5CA0B 2Z2KA 3A9WA 4GZ5A 1Q2UA 4P4LA 1YASA 4JEHA 3GBVA 3WB2A 4CM4B 1E1QA 1VKHA 5EQTA 1RYDA 1DIRA 1CHDA 1Z0FA 5CITA 2IXGA 2QZJA 4MLZA 2P2ZA 3U4CA 5IYCO 3M7MX 2HHAA 1WMEA 3DOIA 4MTXA 1ABFA 2R65A 2BFEA 2P2YA 4EB6B 3GUUA 3BE6A 1EM6A 3L0YA 5AVWA 2HQSC 2HVKC 1H85A 3A26A 4U0KA 3JQQA 3NBZC 5D3QA 4L85A 2GUZA 1CSEE 2NT3A 2RDCA 2Z0AA 2ZE7A 3NBQA 3U40A 3ICQB 1BAPA 1NN1A 1PNRA 2CBGA 2I76A 2VWHA 3UOWA 1RBMA 1ACMA 1N9ZA 1UKZA 4GNKA 1UBUS 2E7ZA 2ILTA 4HS9A 1PX0A 4E5VA 4LH6A 4BV3A 2PUDA 2KB0A 3PNSA 3NNNA 1LLCA 2AFIB 5KYVA 4ZI7B 5KWJA 3GCWA 1P1IA 3ENNA 2RH9B 1Q44A 2F9LA 4PCVA 4F4UA 4AJPA 1K4MA 1T9GS 1LTKA 1LUVA 2XUIA 1BRMA 3PNLA 3VVBA 3ZEDA 2KKWA 2GUZB 1T0HB 2JIOA 1NZFA 3LBFA 1XTPA 4RABA 4X0EA 3I30X 1JSLA 9LDTA 4FWBA 2RI1A 4L27A 3SXUA 4D9EA 5C8VA 4GL2A 2PEZA 1EDOA 1H9CA 1Q84A 1ETUA 1KIFA 4Z99A 3STUA 3LTEA 3B4SA 1FXKA 5BSEA 3GJTA 4XFJA 3A3KA 4NQRA 1JXQA 3Q41A 2PSSA 1E61A 2BMDA 1UC4B 3ERCA 1JJAA 1X77A 4YACA 2C04A 2UZ3A 3OKFA 4DLSA 5IARA 4QJBA 4I9HA 3QFFA 2ZW9A 1NMSA 2FMFA 2M32A 2SKDA 3PX7A 3HWX1 3JWIA 4M86A 4YK7A 5DHTA 4TMZA 3GU3A 1P7VA 2ZYWX 4KGDA 3A6EA 5EC1C 4PLFA 4W99A 1MNQA 3WAJA 2MINA 1G0OA 1RU3A 4NZOA 5CLFA 1FXKB 3ZV5A 1I2ZA 4FM9A 4HAMA 1KKDA 3PUKA 3E53A 5BVGA 3H1TA 3MHTA 4F9GA 4GBED 1TJ5A 4LJYA 4MRMB 5HPYB 3LF2A 4RVDA 4YAOA 4N6OA 2EWWA 1FFSA 2QVCA 1V37A 2IS4A 1MVLA 3MWKA 3Q6MA 1W59A 3CMCO 1WAMA 2XQKA 5FWDA 1NQXA 1ULUA 4AKSA 1DX9A 4CETA 1GPBA 2ZSEA 3NHLA 4IYIA 2BR5A 3AEQA 4TV9A 2B7LA 3K6RA 3QIAA 2Z3YA 2ZP1A 5JCPA 1AI7A 3WJPA 4EG7A 3HMKA 5CW1A 2JNWA 2GWHA 2GAOA 2O2HA 5DTEA 4KE6A 1Z74A 3DM9B 1U99A 1VE5A 2A3RA 5ECDA 4JI0O 1QONA 2C2BA 5EPOA 1ESNA 2BKUA 5I3CA 2Z58A 3CKKA 4ECEA 2YUIA 5C1IA 3KUUA 3ETNA 4R54A 2WHYA 1V9PA 4DR6O 2MSEB 3BM5A 4TV9B 4I46A 1NBHA 4J42A 5KQSA 3GLUA 1CBUA 3EEFA 4BFZA 3CPEA 2R5NA 2FZLA 1VSQA 1WXEA 1GIAA 3WHLA 4QT4A 4RVOA 5K4GA 5AJXA 1ECFA 4A73A 2UUAB 2V65A 3KU1A 4HZUB 1JPUA 1LRLA 2M6KA 3ZD9A 1FLNA 4JB8A 5MDHA 4A26A 3OLVA 1P72A 3NTQA 3ABMB 4US0R 3G13A 4CI9A 5H59A 2QLFA 5EN4A 3PWTA 1RADA 2O50A 1UT8A 2VDQB 1JU4A 1H2ZA 3KOMA 1BOOA 5CPBA 3WIDA 1I4DD 5CMUA 2ZYRA 5CB6A 1N2JA 3NGLA 1OLXB 1E9AA 2QI9C 5LQJA 1MA3A 1QH8A 4KXVA 4MZDA 4EFLA 4QATA 2WMYA 4DMCA 3VU9A 4HH4A 4JI1B 3IP1A 3ZE7A 1Q7TA 4K1LA 3O2JA 4FK8A 2HT6A 3G9QA 3OIDA 3LLUA 3NVAA 4EGJA 1SOMA 4IEFB 1IHXA 1G291 3GUYA 3GUHA 3PNBA 8ADHA 4LK3A 3PTAA 4HGRA 2JIPA 3LSSA 4KIUA 2I34A 3EC1A 3EDYA 4KQWA 2Q5FA 3G0GA 5JQGF 4OU5A 2B1GA 4DR1O 4XE5A 1FTSA 2Y48A 4KXXA 4XH9B 4ECAA 3R2JA 4EKNB 4RM2A 3KWMA 2LKCA 2ORIA 3TZEA 3ROPA 4FFVA 1PTKA 1U0FA 4CIXA 2C4WA 5JNVA 3X2FA 3ML1A 3IEVA 4BBZA 1VPEA 4QICA 4F96A 4BWVA 1C80A 3IJ5A 4JN6B 4TSFD 1A8IA 3VGJA 5THKA 3E7WA 3D6MA 2RCYA 3TTUA 2YYZA 2PYLA 2PZBA 2O05A 1BE0A 3B1VA 3HR4A 3AY7A 1JY8A 1WLSA 3NV9A 3FYUC 1ODLA 1X2EA 3C6KA 2OVFA 3VGPA 2OSVA 1J24A 3KJXA 4HPXB 4HWPA 3FFWA 4ZOLF 3MJHA 2JFNA 3TLKA 2ZRJA 5EO3A 2XXJA 1OW3B 2BMAA 4I66A 4L9RA 1BVYF 3LYHA 3GPCA 3R5HA 4C7XA 1GGMA 2F4NA 3SC6A 1H4SA 3FPFA 1VSBA 3VOUA 1L7OA 3CNEA 1Z56C 4H44B 2JJ8A 5KZMB 1GL9B 5KREA 4NZZA 1WDMA 1TD1A 3G7UA 1Q5PA 1BGXT 2IBMA 5IK2D 4BZZA 4URYR 3SDZA 2EJUA 5FWYA 3NDJA 3L7YA 2COEA 4L4ZA 2HR3A 1E2HA 2IEGA 3H83A 1T91A 1G20A 3FLBA 2H1IA 1Q1QA 2C4KA 3MUFA 5HW0A 1KDZA 2V7BA 3NAMA 1ZOLA 2PLAA 3PDIB 4UMEA 3BHIA 3RRZA 1GFWA 4DG9A 3K5NA 3CC7V 3ZCXA 5TS3A 3W8NA 3WMXA 1B41A 4MKGA 5ECYA 2WHRA 4F46A 2CDYA 1XJ0A 3BYZA 2Y4UA 1J21A 1JDZA 1Q0SA 3HRIA 1KMHA 3B53X 2L69A 2AQKA 1E0DA 1PL8A 3ZMSA 5JAHA 2ZB7A 2L17A 1AJQA 1CUDA 4CU2A 4MKIA 3W8FA 1H3NA 3L7CA 1VQLV 4GI5A 1WDLA 4WADA 3PDHA 5CB8A 1YZUA 4I1SA 2FPPA 3V34A 2ZQMA 5BMVF 1JQLB 3BH0A 3KHUA 3MD9A 4RORA 5AVZA 1FA9A 2UYNB 2OFWA 4GLFA 4IWXA 2ZJ5A 1FYDA 1IV4A 1I7FA 1KMHB 2XYHA 2RHOA 3DM5A 2OENG 3USCS 3QSYA 1W4BA 1TA8A 1UP6A 5A9RA 2OEPA 3TX6A 2A7WA 1Y9ZA 5B4UA 5K0LA 2PTGA 4TWBA 4YJ2A 1NVGA 4FYPA 3JAWA 3GJ0A 2J46A 4QE9A 4NR1A 1PJTA 5IEBA 3TLJA 5BUSA 4QFBA 2FPPB 4XR9A 1U90A 4J7KA 1E3DA 1WX1A 3AJDA 4JUFA 1ZO8A 3WKAA 1IE3A 4NABA 3GLGE 1PDWA 1DINA 5JSUA 4BUJA 1A77A 2INGX 3CWQA 1RKQA 4MUJA 4RFSA 5FNVA 4V38A 1KJ9A 1P75A 4X9QA 1E0AA 4O4IB 4JT9A 5JDCA 5E0OA 4YJ2B 1I7SB 4FHEA 3CW2A 4D0GA 2ARHA 2AIFA 1H2YA 4P7KA 2X8LA 3I1IA 2OGWA 1M0TA 1W94A 2O8DA 2RD2A 2XQVA 4BOYA 1XDSA 2FMHA 3FMVA 3JWGA 2P6MA 1IXRC 2NLOA 4GUAA 3LM8A 5G0WA 5J2TB 3QEJA 1OXMA 2X6BA 3DTNA 5C32A 3K16A 4PDMA 4IZIA 2OTLV 3CC2F 2PI4A 4Q7EA 3WL8A 1CNMA 2DWPA 1LWOA 4J0CA 3HA5A 3NTRA 1LRJA 1X1BA 3OR6C 1K0FA 2WTBA 3DJFA 4OCZA 1Z2AA 1PV4A 1U40A 2H8GA 5T8KC 1JMVA 4TX1A 3TW4A 4N23A 2QYTA 1YVDA 2VT3A 3RSCA 4UFZA 4ESOA 5CRIA 1I1HA 3EWSA 5DHFA 1YI0A 3RB8A 5JV5A 4B3RB 2IYLD 1QP0A 2A9KA 2YZMA 1O5TA 5CFZA 1DFHA 1UK9A 3AG1C 1FUEA 1YBFA 5CP8A 5JCXA 3FTFA 5H80A 1XQWA 1C4XA 3HDJA 1L2TA 1S1CA 3TRHA 5CNMA 4AYTA 4OK3A 3HCAA 4G07A 4QUJA 1J2YA 2YQ5A 2Y1KA 3TSCA 3HZHA 4BS9A 3RG8A 5GIPC 4KVFA 4XYLA 4ZAFA 2P9BA 4D8TA 1LDMA 3INYA 4IQ4A 3QVWA 2KTUA 3T0FA 4RTQA 1A04A 1PW5A 2H52A 1Q19A 2C8KA 4EABA 3VMFB 4LF7O 2BGLA 3ZUGA 4F3TA 1PR6A 4GI2A 1SZXA 1PEDA 2HHCA 4LE1A 4DV3B 3HMQA 4LWSA 1R6AA 4XLLA 1L4KA 4WCFB 4HAIA 1L3CA 3LQFA 3IDOA 5C3MA 1WPXA 3Q40A 1CZNA 2GTHA 4PRYA 2Y0BA 3F49S 3ASNC 1S3JA 4LMBA 5JJBA 4HAUA 3WKDA 3T35A 1KJQA 2VJDA 4CXMA 1XLWA 4OEHA 2QW0X 2EIMB 2IITA 2HX0A 2DFTA 2WJGA 4LWSB 4LVOA 3UMYA 1QS0B 5B58T 1IN6A 2G83A 5CM8B 4EW1A 2OP0A 1KXZA 4I0XA 3DOHA 1N0HA 2ODBA 3SQWA 2PANA 2FX5A 2KMLA 2JI9A 4DKXA 2Q7GA 4P0TA 1LSUA 5B55A 3A1SA 4MRAA 1CR1A 2BBOA 5ALVA 3ASYA 3DT8A 3HB0A 1DV1A 4LAFA 4S2UA 2QSZA 2G40A 1ONNA 1AT1A 1DNPA 1PS8A 2NAPA 1U1EA 3S2SA 3HKDA 3AKDA 1G19A 1L4BA 1U97A 2JH3A 3UPUA 3NBFA 4NU6A 3ETGA 4I0XB 5JJNB 1U7DA 4YHHB 4JI5O 3OOWA 3LUJA 5H02A 1FYJA 3DDNA 2ORYA 2PI5A 1M6YA 1HRDA 2YOHA 3LUAA 2CLCX 4WGGA 2A9OA 4V0SA 3OJWA 5AI8A 1C81A 2BLLA 1WU7A 1MSDA 5KNCA 3CEAA 1USUA 2CUNA 4TZKA 2J3QA 5L4LA 2NV2B 1HEYA 4P7GA 3VU0A 2G5GX 4IW3B 5HY0A 1VMAA 4XA8A 3H1HH 3I83A 1Q22A 5E6SA 5HBGA 4LI3X 2W8BC 1FRVA 3OMIB 4UVHA 4WZAA 5CX4A 3B12A 1A4UA 4BNJA 2I91A 3I9OA 3H5NA 3U26A 4WLFA 5CBHA 1VP9A 2PRSA 4DLNA 2HIAA 3A9UA 1KERA 1RM4A 2MSLA 1G6UA 1ZD4A 3G7NA 4P4GA 2WTMA 2VAXA 4LYHA 1J1ZA 3VKWA 3U9LA 5IY5C 3P0EA 4GC5A 1E2BA 3EA0A 5ICSA 1P4AA 4EEKA 3MYYA 3IE1A 5E9JA 5KSPA 3E9CA 3IH5A 4GI1A 2L35A 4M22A 5HF6A 2LBPA 2NVUA 4XIYA 1XAIA 1I5OA 2DR0A 4HAZA 3LP5A 5JCZA 1WY5A 2HGZA 3EZ6A 3K72B 1VHWA 3NVDA 4F97A 1E4YA 2I6GA 5GIPE 2O4CA 4AMZA 2Z1TA 2GBFA 5TQJA 4MV6A 1AO3A 1DT3A 3CJQA 3DEHA 4M0EA 1OWMA 2VPWA 1P6XA 2FCRA 4JJ8A 3K4PA 3GD7A 3SJQC 3G1TA 1V54B 4ND5A 4OX9O 2QLMA 1H2KA 3TFQA 1XD8A 1YO6A 1S2LA 2XH8A 3F9IA 2NVUB 4DREA 2DHQA 1N1DA 1WVMA 5CJ2A 2ISCA 3DR3A 3TJMA 1W5EA 3NDPA 2PV0A 2X9QA 1G66A 4RFVA 2AK3A 3KLBA 4H7IA 5DSTA 2NQTA 2NN3C 4O63O 1XRLA 3A1CA 1S4MA 4ANFA 2GJKA 1M93A 2WT8A 2I4NA 3TECE 1RAHA 5DCUA 3W7TA 3GDFA 4ZT3A 1V6SA 2H2WA 5GINC 1CR0A 1OZHA 1TA9A 1XNGA 1XNHA 3HL4A 2B9VA 3CR7A 3HVIA 4QREA 1FUIA 3I32A 2QSJA 2HSJA 4JCCA 4D7TA 3R0XA 4RCYA 3EZGA 1NLUA 1TRKA 3STZC 3H05A 3OTFA 3JZAA 3EIWA 3MSXA 3VR5A 2VI5A 2HRZA 3QOFA 4OD0A 3OZFA 5B3SB 3KFVA 3CTPA 1M1ZA 5ED4A 1FLDA 4JENA 5BRAA 3BH7A 3AI7A 3WLEA 1SM4A 4JKIA 5C8YB 3G6KA 3FNIA 2A0XA 4CUKA 3FPKA 2C2MA 5GQSA 1LI5A 1U8FO 3R8CA 2Q6TA 3G68A 4Q3CA 4CV3A 3A6PC 3JALA 1WDTA 3RRNA 5AOCA 4Q93A 4UPDA 5T67A 1R1DA 5I7WA 5DM6V 3RA5A 1W2WB 4XD7D 3WSWA 3CVYA 4WF9V 1QOZA 2J6HA 2ZRCA 5L9AA 3KJZA 4PZLA 5J58A 1NJ1A 2VPYA 4O08A 1Q83A 1QQ5A 1VQ4V 2K7ZA 3VKGA 3F7YC 1VC2A 4ND1A 4PW0A 3HCBA 4RKEA 2FZCA 1E2FA 2BFAA 4HKTA 3G2LA 4ZGWA 3AUFA 3IPRA 2CWJA 1TD9A 3GHZA 3DKKA 1ELOA 2LKDA 1LDNA 1U7PA 5LBIA 2V3VA 4XEUA 5F3DA 3IOMA 1J5EO 4KWIA 4X1YA 3KJEA 5CYFA 1Z88A 1CEZA 4YP6A 3W3AD 4CM1A 1ISSA 4BP9A 1YONA 1WXGA 1OC4A 3E5NA 1GITA 2AFVA 2SNIE 3CT4A 1BDMA 1HFKA 4C08A 3J7AC 1PR5A 2D59A 2HPZA 1T3SA 2BPOA 1E2QA 3CVXA 2DOKA 5NLLA 3PXCX 1VBKA 2G9NA 4IINA 4PIVA 3PX2A 2R6ZA 3KWFA 4X1YB 3H2IA 4XWYA 4HXEB 3ZNNA 1X92A 2XB9A 4TL6A 4NICA 2E4ZA 4O8CA 3O9OA 4Z49A 1Y34E 2JS3A 3BA8A 2Q5ZA 5L4SA 2JFXA 1IB0A 4OJNA 1JJOA 1EGAA 2H59A 4DCSA 1MSWD 1J22A 2VWGA 4B3IA 4MUKA 5E9AA 4GBJA 1Z0AA 3VDQA 4G4XA 1AG9A 2Q4TA 3UUEA 5KYUA 4RKFA 3DO8A 1NVVR 1UIRA 2ESRA 1V11B 4GPIB 1SIOA 3ZHQA 1GX1A 2QBYA 3GN2A 4R8LA 2CZQA 1WLYA 1AD2A 1PGNA 3L8DA 5DZSA 5EKDA 3VSDA 5TF4A 1Z18A 5AK0A 2P2DA 3GZJA 3G7SA 3HVJA 4MWOA 1E3WA 3OT1A 1QDLB 3HXLA 4I4NA 3PPIA 5FFFA 3ORSA 4GOMD 4LVNA 4GL4A 1GXSB 5KYUB 2CGEA 4MPPA 3K14A 1LW6E 4UDYX 3IUJA 5K3SA 4FC6A 1N4DA 3WA6A 3OD4A 4PHGA 4A2WA 5MFPA 3R0PA 4WY8A 5CB4F 1WXQA 2EZ9A 1SF9A 1QNMA 1N5KA 4A36A 1BVHA 3C6XA 1YJQA 1E3WB 3OT1B 1QOQB 3G1WA 1XRNA 3KQOA 4NJMA 1E5VA 2YRWA 4JR0A 4JI6O 4D2IA 1CY0A 3PNOA 3JRXA 5DYNA 1PZEA 4ZCPA 5B1IA 2QDOA 3EB9A 5GV8A 4UNIA 2O0LA 4M7PA 3VNUA 4Z3DA 1D04A 3T3OA 3RVPA 3ZJTA 2QB5A 1EU1A 5A06A 3RS5A 1TADA 1P5FA 4UAUA 5EWMA 4OKIA 4B2LA 1MLDA 3RWOA 1VCHA 1D1SA 1ZUWA 4R2MA 5LP6F 1GO3F 5AFSA 1JJIA 4OGLA 1LY1A 4LFCO 2G8LA 4L7VA 3D5QA 1QKIA 3LA8A 3IQFA 3RC7A 2XGJA 1IM2A 5DMXA 1SB8A 3I04A 3FPIA 1NU6A 4OAOA 1IN4A 1DPFA 3K57A 1NXTA 5EGSA 4XFKA 3DD1A 3RYFB 3PFBA 4CLRB 4KLNA 3B6JA 4LDZA 4QBKA 3RQSA 2ZGVA 3QHQA 2QRPA 2FETA 3AFGA 4ZQHA 3BXOA 5DBEX 1EWVA 2Y99A 2OIGA 2HJSA 2WUVA 1UDCA 1MFZA 4TLEA 2GN0A 3RFCA 2OCHA 3KKYA 1YHQV 4KACA 1BW9B 1DUVG 1RZVA 5HKOA 1F1JA 1DIGA 1YTUA 3H9JA 4HNVA 4LXUA 3LDCA 2WLHA 2YW9A 3FA2A 3R7FA 2AQIA 5KDOA 1BS1A 1NZ6A 3PRJA 2JKVA 2MT9A 4Q37A 1SCDA 2XAUA 5EWJA 5K0BA 3CCJF 1GP2A 4F8EA 1JA8A 3N7AA 3Q4HB 3OAAD 4MRSA 1Y9EA 3ZN0A 3PL1A 5JD6A 1X0XA 1NVKA 3PQCA 2MQEA 4BKQA 5E95A 3KSAC 3JD4A 2QYHA 3Q8KA 1EUYA 4EVIA 4ZDIA 3CU5A 2GF9A 2A5LA 4DBVO 5K1PA 4PCLA 2ZBEA 3GJ5A 3C16C 4L95C 4E21A 4OGQB 4RLSA 2ZT5A 4GVXA 3TDKA 1E3MA 1XPUA 4TMYA 1WL8A 3VU1A 4MMXB 2HADA 2ES4A 5HK9A 4DUYO 4C4WC 1MQSA 4PHFA 2P8SA 2X41A 5C2JB 1ZD1A 5B2FA 1LSJA 5K45A 1QFSA 1T2DA 4YWJA 2VBCA 1ENYA 2HQBA 1DBWA 2JLRA 4TMTA 2YJ3A 3QBDA 1MAHA 3TL2A 2OC9A 1I33A 1AI5A 3Q7SA 3PFKA 5LMZA 2Z4SA 4JF3A 2FWAA 1IEXA 3ZEIA 4LCJA 2OBLA 3R8FA 4B6EA 3K5IA 2XCQA 1U6JA 3RU3A 4OUDA 4PO3X 1WA8B 1T8PA 3CCVV 2CFTA 3MJ4A 1U2TA 3COVA 3F5FA 1GG9A 1Z16A 3AONB 2RHGB 1QF6A 1QAMA 1BX0A 3NWPA 1C9JA 2NIPA 2J0EA 4M49A 1JAXA 2CB0A 4H6VA 4ABTA 4IL5A 5K0SA 3AF4A 3W5IA 1SKAA 5FPRA 3K0AA 4EDHA 3K0FB 2O5VA 3CF4G 4HBNA 2OXCA 4AT1A 4RMHA 4OKNA 1P1KA 4MVJD 1IBRA 4CQMB 4FZ5A 1KE1A 4WJLA 4QGGA 2BEVA 3V2UA 3GMSA 5EPEA 3QMWA 4OUDB 4XSHA 3OOEA 1XT6A 3F67A 4IGEA 1VF6A 1J0BA 4BWFB 4F5DA 3TTXA 4G4YA 3ER6A 1PL4A 1I5RA 4I9FA 5PGMA 3CE6A 5LMNB 4YLYA 4RD3A 1SRQA 3K0AB 1GLGA 2XQGA 1P7BA 1CIVA 3C97A 2POQX 3EDRA 1XDBA 4QU9A 4OQMA 2JGLA 2HXYA 1FTNA 1LPNA 4NOLA 3KQLA 4MI6A 1M33A 3R7SA 1TGOA 3FNEA 1JE0A 1XAJA 3C5EA 1T2VA 5FR1A 4REMA 2G09A 1VQNV 3NMUF 3GPIA 1NTOA 1E20A 3R7LA 3Q11A 1E1RG 4ZCSA 4PICA 1Z25A 1TT5B 5EJ5A 4P33A 4XJTA 5M5BA 3FVTA 2ZUVA 2XJ4A 1OWOA 5K0NA 5DBGA 2A4MA 4K7JA 4L75A 3NX4A 3FNQA 4N3NA 1LH0A 4HGNA 5IMBA 3H16A 2YIDA 2QI2A 4ITRC 3TD4A 1NVXQ 1HDGO 1RQLA 4GWLA 4ARUA 1K9SA 1T1JA 5F2VO 3WBFA 4JUAA 2FMLA 2WFMA 1P2TA 1OJ7A 3FNHA 1Z5PA 4LF8O 2D1RA 2DT5A 5A2QA 2N75A 2X5JO 3K9WA 1BS2A 3F8SA 3QXGA 4KFCA 3U80A 3KSBC 5IU6A 4BTVA 1V5GA 3ZUPA 4EY4A 1VB5A 3AXSA 2OY0A 1ML3A 4J90A 3IEXA 3HEMA 1KEWA 1D0VA 1FKAO 2HIHA 2BCCH 5LMUO 3WNDA 2BAGA 2XMSA 5DXFA 1YHZA 2HXGA 4ZVQA 3QG1A 3HE3A 4HGPA 2OTCA 5B1DA 3FYEB 2JARA 4G0QA 3U1TA 2AXQA 3KFXA 4GP7A 1JSXA 4U7NA 3L0CA 4D42A 5CMLA 3P71T 5CDYA 4HPWA 1NKSA 1UBGA 3DCYA 1CY1A 4B2IA 2Y1XA 3GFSA 4BV9A 4EY7A 4OIFA 1U1IA 3ZNQA 4M0MA 1LKZA 1MT3A 4JUCA 1BYUA 1Z7YA 2CXHA 1UAAA 3GLGA 2OM6A 4YJKA 1G4YB 2AZTA 3PGMA 1VMDA 2OHGA 4KPUA 1R8QA 3P0IA 2J32A 2ZIXA 3WFJA 1Q81H 5JVDF 1A7KA 2E85A 2RC6A 2GEJA 2PZFA 4R3WA 1P0MA 1CZOA 5JPIA 4QGSA 1LJLA 1N8NA 3H11B 1TVMA 2EZOA 1QFZA 4G2NA 2BOCC 4MV0A 4YECA 1LA2A 5BY1A 4FLWA 1KXJA 3FDZA 3KBOA 3KS9A 1ZD2P 5G0TA 2G17A 4RL6A 5JHHB 4M53A 1NP6A 1IHUA 1ISMA 2OAEA 5FOTA 3EVGA 3PFNA 1QCZA 3CF4A 5CBPB 2BFMA 4IIXA 1GPDG 3P1JA 2Z01A 4XTRA 4L6IA 1CE8B 3HI4A 4D96A 2UXDB 4X3PA 4D44A 3JYCA 4YMVA 4DV7O 3P52A 4GT1A 4RBNA 3R77A 1J4AA 4NESA 3L0IB 4TT3D 2XAQA 3FDZB 3KUDA 1ESEA 1GYQA 3E5HA 2YN0A 1P0QA 5F78A 3TPZA 3OZDA 2L6LA 1SQ5A 3V48A 3ELUA 3FYUB 3DBHA 4D9GA 4BT5A 2PT6A 4HNQA 2K6G