3N2KB

Tubulin-nsc 613862: rb3 stathmin-like domain complex
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
428
structure length
420
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Stathmin and interfacial microtubule inhibitors recognize a naturally curved conformation of tubulin dimers.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 113
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3n2kB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3n2kB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3n2kB01
3JARB 3RYCB 4TV9B 5MN4A 5JCOC 2VAMA 3E22B 3UT5B 1TVKA 5LXTB 3JALA 3JAKB 2RHLA 5JH7B 4IIJB 4B45A 3VO8A 5JQGB 4EI8A 4O4JB 4ZHQA 4O2AA 3WGJA 5GONA 5IJ0B 3WGLA 3N2GA 3JASA 1FSZA 3VOAA 4O4HB 3HKDA 4ZOLA 4O4LB 5ITZB 4I4TA 1TUBA 5EZYB 3WGKA 3WGNA 5EIBD 4TUYB 3ZBQA 2RHJA 4DRXA 3JATA 3R4VA 4X1KB 3VO9A 2R6R1 5EZYA 4YJ2B 4O4IA 5CB4A 5CA1A 3RYIB 4U3JB 5EYPB 5FNVB 4YJ2A 4X20B 5JCOA 3M89A 5J2TA 3RYFB 4O2BB 4TV8B 4X1IB 4YJ3A 4IHJB 1W59A 3HKBA 1FFXB 3JARA 3RYCA 4TV9A 2VAWA 3VOBA 2BTOA 3E22A 4EB6B 1W5FA 3UT5A 4I55B 5JVDB 3JAKA 5J2UB 5LXTA 5JH7A 1OFUA 4IIJA 5IJ9B 3WGMA 5LP6B 5JQGA 4O4JA 4HNAB 2R751 3ZIDA 1JFFB 2Q1XA 5LYJB 5MN5A 5KMGB 1RQ2A 3M8KA 4U39A 5IJ0A 5LP6C 5EIBC 4E6EA 3JAWB 4O4HA 5ITZA 4O4LA 4FFBB 5CA0B 4TUYA 3HKCB 3RYHB 1W5AA 2BTQB 4EI9A 3N2KB 5LA6B 4XCQA 4X1KA 5BMVB 1Z5WA 3RYIA 4U3JA 1RQ7A 5EYPA 5FNVA 4LNUB 4X20A 1W5BA 2RHOA 4WBNB 3RYFA 4O2BA 4TV8A 1SA0B 4X1IA 4IHJA 4F6RB 5C8YB 1FFXA 5LOVB 5IYZB 5KX5B 4I50B 4X1YB 4ZI7B 3HKEB 4X1YA 4EB6A 4I55A 5JVDA 5J2UA 4B46A 5IJ9A 4DXDA 5LP6A 1TVKB 4HNAA 5M7EA 3JALB 2RHHA 1JFFA 4KWEA 5LYJA 1RLUA 5KMGA 4M8IA 3ZBPA 4ZHQB 4O2AB 1W5EA 3VPAA 3JAWA 5GONB 3N2GB 3JASB 4FFBA 2Q1YA 5CA0A 3CB2A 3HKCA 3RYHA 3HKDB 4ZOLB 2BTQA 4I4TB 1TUBB 3N2KA 5LA6A 5BMVA 4DRXB 3JATB 2VXYA 3V3TA 4ZI7A 2XKAA 4O4IB 5CB4B 2GVIA 5MN6A 5CA1B 1W581 2XKBA 4LNUA 2VAPA 3RB8A 4WBNA 1Z5VA 1SA0A 4F6RA 5J2TB 5C8YA 5LOVA 4YJ3B 5IYZA 5KX5A 3C8LA 4I50A 3HKBB 3HKEA 4EI7A
chains in the Genus database with same CATH superfamily
1J8MF 2AI3A 1GNRA 4ML3A 4PA3A 1SVMA 3DFFA 3EDMA 2IS6A 3QG5A 4CBCA 2AI1A 3KKOA 2NW6A 4CH3A 1AY0A 2WSSA 2O07A 3TRHA 3BA8A 3V5NA 4LRUA 2H54A 3JVDA 2E4YA 2VXBA 1AIPA 1P7ZA 3CLUC 2GWRA 1SZXA 2N1MA 1FMLA 3ZJ4A 4CTNA 1ENZA 4N0PA 3D7NA 1WSBA 1O2DA 2P0YA 4EA9A 3S7TA 1VQ5F 3LXUX 1W8DA 3L1JA 4FGKA 1L4FA 4UPVA 1NL3A 3FNGA 1GTRA 2DFPA 2XR1A 4A5OA 4CTMA 4J7XA 4TYWA 2VPXA 4KDEA 3NHAA 2QBYB 2ZJ8A 1SBQA 1IE3A 2HA4A 3LPLA 1KBOA 4HGYA 5KHHA 1T4DA 3EY4A 5G02A 1V9LA 4B17A 3IDQA 3ABZA 2QD1A 3DGFC 5AUOB 1RE1A 3OQ6A 3A58B 1VB5A 1CIPA 3EGCA 5BWMA 1TYCA 2CY0A 2AV6A 1ZAYA 4NPCA 2DPGA 3RCBA 2C97A 2NLJC 1C30B 5J4KA 2V7PA 3RLIA 1U11A 4A8JA 2CJWA 2UYYA 1PL0A 1OPXA 4LWOA 1NVXQ 3TW6A 2JD0A 1JQKA 5EPEA 4ZO6A 2BKXA 2DWPA 4E30A 1IN7A 2GHQA 5ALIA 5HMLA 2XMRA 3T9DA 3DOOA 4MVCA 2XD9A 1B74A 2QUAA 4EF5A 1NZJA 1YXBA 4UTNA 1S3GA 1SQ0A 4GMFA 4B6EA 1K0UA 1XD2B 3CNQS 4IZIA 4PA4A 4B3TO 2J41A 2FFAA 4II2A 4E7OA 4XH9B 3AKCA 1YIOA 2HDWA 1HTBA 4TSFD 4HPWA 3OX2A 5E8JA 5E2AA 2C1ZA 3B4SA 5KREA 5BUCA 5FLXA 2RAUA 4CV0A 3GP3A 4XVHA 5IYZF 2JHCA 5E1MA 3ST7A 1EX1A 5KVQA 1Z83A 1E5VA 4G9EA 3M99B 4NQRA 4D6PA 1DBQA 4TRMA 4WN9A 4BU1A 1HT0A 1RQ2A 4AJJA 4MI6A 1E0AA 1Z88A 3S6JA 1WX1A 2FKAA 3H1EA 3WDKA 5BMVB 1KE2A 1FYDA 1CTQA 4GW3A 2Q41A 4O2BA 3TUZC 3EIEA 1OOEA 2IU0A 4YB8A 1MCZA 3AHHA 4AJNA 1D2MA 2F7SA 3OPMA 5CB8A 1Z12A 1R6NA 2P4UA 5JI2E 4FLVA 4EY8A 1ZH8A 3T4ZA 2W2QA 3D01A 1QVGF 3CW2A 2H1RA 5HQ3A 4FLZA 4B6SA 3ON5A 1BGWA 4C01A 1JXOA 2FTKA 1EVZA 1D5AA 3UNXA 3U4DA 3KXIA 2Y77A 1Y48E 3VYUC 2JEYA 3HCRA 1RQNA 5JSHA 4W5JA 5E4FA 1KI8A 1T1RA 3R0VA 1Z7YA 4BP1A 4EARA 1XPRA 3IPLA 1XJ5A 2H2IA 2WP8J 4CUJA 3MWGA 3ERNA 2XNDA 2CK3G 4DUZB 2ZUCA 2G1UA 2XCRB 3AEQA 4JI0B 4WFBV 2ZRJA 1QFZA 3OIUA 3EUWA 4DM4A 1Y34E 3BWXA 4D3DA 3WB9A 2DPYA 2C7VA 4LYFA 3FB4A 2F64A 1RQGA 4RQFA 2Z08A 4IMRA 2V6BA 13PKA 4GPD1 1F4NA 4BZZA 1P33A 4EGFA 2DMRA 3TZCA 3MCQA 1BOOA 4L4RA 4AJHA 2W83A 1I5RA 3C8LA 3NXSA 2P5SA 3BE4A 4TM7A 3J7AU 3NEJA 2NUAA 5JHHB 3MCWA 2B2NA 3IEMA 3EG9A 2GEUA 1LC0A 1PYOA 2JIZD 4QG3A 4O1HA 3KUKA 3KELA 5FB3A 1JB1A 3SN6A 3MT9A 4GE0A 3PZBA 1LDBA 4Z6KA 1RFGE 3JARA 3ZD8A 3HU5A 4P9OA 4N5LA 4EB6B 4LDNA 3MBIA 2OHXA 3ONDA 4XGRA 4IHKA 4X65B 2CJPA 1VQNF 3U7FB 5K0JA 4IDFA 3HP4A 3UKJA 3NHMA 1SUAA 3P27A 4ZYUA 4RXMA 5EXXA 1QE5A 4JNCA 1T8YA 3CNBA 2ZBEA 5JAOA 1ZINA 1UF9A 3SBDA 1M1YA 2IG8A 2OGZA 4IH9A 4NMMA 4ACAA 2OB1A 2UV8A 3PNVA 4F9GA 2CLHB 4ARIA 2IXEA 2H06A 3FKSD 1JHQA 1I5EA 5F21A 4RIHA 5JAMA 2GJKA 4OQLA 1RSOB 2C2AA 4PO9A 5HS6A 4LVUA 4DV5B 1DKMA 4WCEV 1NUUA 3V32A 4K88A 3M5PA 3WGTA 1JKJB 5CJJA 1K6EA 1JJ2F 5BSFA 4RANA 2D0DA 3DTNA 1WP9A 4JBNA 1YZ3A 3UIEA 3IO3A 4NDAA 3W5CA 1NVEA 2YNMD 1ZJZA 2EIHA 1EBUA 2BEWB 5A5GA 4MROA 1PW5A 2Z01A 3I9KA 5B1DA 3TD5A 1P2VA 2NUPA 2P11A 3A1VA 4GPTA 2DCMA 4LOLA 1J07A 4FFNA 2EYQA 4QU0A 2JH3A 1GPLA 3SX4A 4CQMD 1XVAA 1P62B 4W63A 3MN1A 4QXAA 1IG0A 4HGZA 4C7OA 4NVRA 3VYSC 3U6BA 3D00A 4NB5A 1GNSA 1G4YB 3WSVA 1A2OA 3UG7A 3LD9A 3FPHA 1VIDA 2YN4A 3PUHA 3UCEA 1JXAA 4PG7A 4DMMA 4ZOLB 5LZ8A 2PWAA 5EMJA 3QY9A 2WJIA 2B5WA 1U5BA 5EY5B 4EHKA 2Y0DA 5EXSA 1CJCA 1MR3F 3ODPA 1ZXLA 2V03A 2ZSKA 1YL6A 4ZODA 1NBME 1CZHA 4GHWA 4DEVA 1JCHA 4FS8A 3DDWA 2QRUA 5KU7A 4JEIA 4ZKIA 3IMFA 4AMZA 4MSWC 1QHHB 5DXJA 5D85A 2JVJA 1V5GA 2GKOA 3UK0A 3RFVA 1W2WB 3FNHA 3RS2A 4H17A 3C0KA 5J4YA 3TOZA 2FETA 3EQZA 1OI4A 5EHXA 1BHSA 4BRUA 3JVIA 1A71A 3AL0C 1GP2A 2AWOA 4JL6A 4RKFA 1H47A 4ZDIA 2X2EA 1HMPA 4KWCA 3NJRA 1SFRA 5D6NA 2QAIA 3ZMVA 3ILXA 3RDPA 2QUKA 2IUSA 3SQWA 3TW8A 1AXGA 1TQDA 4J0FA 1IN1A 2IYNA 1PTJC 2O1SA 3FFWA 3M6MD 1RE0A 2Y99A 2EBHX 2XIJA 3AVVA 1Y7LA 4D0GA 4PX5A 4A3SA 2VG8A 1DT3A 4MPRA 3RAPR 2W58A 3BSYA 4BHTA 4I6EA 1HNXO 4UUBA 2FSSA 4XW2A 3UV6A 4RSHA 5BYBA 5J58A 4ZO4A 2MK3A 4B76A 1NNSA 4R2MA 4RTMA 1P6QA 1UWVA 2J67A 3RAEC 4K5QA 1XK7A 4BPRA 3IJ5A 2A9VA 2NNLD 5E6SA 4ETNA 2XPCA 2Y1DA 3CJQA 1N8RW 1P39A 2G5TA 3VBCA 3H1AA 4F93B 4AMVA 2J0QA 4C6TB 5KTYA 5B6JA 4C4XA 4O2AB 1NXXA 1XQ6A 4Y2PA 5FL3A 3EIXA 4P92A 4OXSA 2QY6A 3ZGNA 3WWCA 1SQXH 3AVQA 3DPIA 3HP1A 3RG8A 5F2OA 4I7ZB 2H31A 4Q1AA 3DTYA 4MLPA 1WKBA 3P2YA 2WD9A 3ZG6A 2DLCX 1GYQA 2CWJA 1NDHA 4PSUA 3NX4A 1PR4A 2IT1A 3ZHYA 3OIVA 5CG1A 4M38A 3SYLA 4X5OA 4ZOEA 1XOUA 5AKZA 1UJ5A 1I5OA 1WW3A 1BVHA 4RHYA 4FDVA 3KG2A 1IK6A 3RIXA 5BVGA 1YJ9F 4YLEA 5KQLA 4RVOA 3AGKA 3AYXB 3MJSA 2GAOA 1CK4A 1GA1A 2ZT9B 1QIIA 4GBED 4GUDA 1T1IA 4BBPA 3ASVA 3R1IA 3TFOA 4ZIRA 3LIIA 2GTHA 1YCIA 4HNUA 4I08A 4G1UC 1IZ3A 1RBZA 4ZV4A 3BAZA 4J80A 2X6RA 2VVTA 1KO7A 3DF7A 4CH5A 4TN1A 3GMSA 4Z4EA 2NZJA 2B98A 4V2IA 2R7KA 3QUAA 5BQOA 4OMUA 4F5DA 2YXNA 3T5PA 3HI6A 4HYEA 3TD2A 4UXJA 5FWDA 2B0JA 4AN0A 3U9TA 3SLRA 3CLHA 5K3FA 1Z25A 1MABA 1VF7A 3BL5A 2R6DA 3E9DA 4W1SA 4RDIA 1ZVQA 4E33A 4IQ4A 4QGPA 2OBLA 5CMLA 1K8AH 5BSVA 3Q10A 4OJTA 1U2QA 3LNNA 2KJQA 1WUHS 1KS2A 2BMEA 1J9GA 3C3JA 5JNRA 3PA8A 4YCDA 4C3OB 2BYTA 1MKYA 4D44A 2YXYA 2Z6QA 3C87A 3E0QA 2KG7B 1UUFA 4KE9A 1B6TA 2H94A 2C31A 1F9EA 3FPKA 5HBGA 2CLFB 3C2QA 5CHYA 4ZO7A 5KVVA 1PX0A 4EJMA 4CMIB 3CLRD 2OWDA 1I3LA 3U7JA 4ZI7F 3EIHA 2X0KA 3U80A 1YCHA 3LSSA 5FNVB 1QFYA 3QMMA 3C5EA 5BR1A 4RACA 3OEEG 1E2PA 2WABA 3DUFA 2HVKC 2XDYA 5AR1A 3MYYA 1M7BA 4TUYA 3I58A 2PGJA 4B4WA 4NVPA 1YVEI 3VPHA 3O1JC 1K5SA 1VBKA 2GVNA 5FLYA 1J22A 4B84A 1TCBA 3P4YA 2P9BA 4M21A 5FULA 3RVJA 1WS6A 1GPAA 4GM0A 1QOZA 4KQ6A 2GYUA 4RTSA 3NZEA 1H66A 4J76A 2AF4C 2BZSA 5ARCA 3V9AA 2CMFA 1K2VN 4MUGA 3K09C 4Z1VA 3EVBA 4GKAA 4TT3A 3GGDA 1YJBA 1QV6A 3KXPA 3DM5A 2ZDIA 2Q9LA 5DBEX 4TLMB 2EBFX 1R6TA 1D8AA 3B38A 3OCWA 3ABOB 1JJ7A 4LGVA 4GQBA 3NBMA 2F3UA 3KUDA 1I6LA 2IYSA 1A9PA 3KEOA 5DMHA 1U0TA 4TQ9A 1P1IA 3KL2A 2XYGA 3HBMA 4FKMA 4HHEA 2ZJYA 5C1PA 3U7QB 1N6RA 3IALA 1WBBA 4ZYZA 4CDGA 1KKCA 2F1IA 3BRWA 2P40A 2PX3A 3CVJA 5H83A 2ZCUA 4FOTA 5GOZA 1WUYA 3AINA 2BDEA 3OZBA 3QLUA 1J56A 3U17A 1UQRA 1TA8A 3FAVA 2CE2X 5HRUA 1A77A 2ZBVA 4MUIA 3KUCA 4YS6A 2BRUA 5F1OA 3T7EA 1LVHA 4E2ZA 4XTRA 4P38A 3N4YA 3OFKA 2QMHA 5FAKA 1SBHA 2HF2A 1NBMA 1VDMA 4KBFA 4LF8O 2A33A 3GEDA 2WE8A 3E23A 2Y71A 3WJ7A 2F8MA 5K20A 1ZJ6A 4RHAA 2CNBA 1QWSA 3NHJA 4DXAA 1E79D 1KI6B 5HZMA 4BIZA 4J1TA 4J10A 3CCVV 3TTVA 5F9HA 2IUTA 1Y8QA 1TJPB 2CKDA 1NRJB 3KPWA 5J43A 1PLLA 1Q7CA 4ZVKA 1CY2A 3VTKA 2VQFO 3GDHA 4WXYB 2B9EA 2HTFA 3P4UA 1H2SB 3SD7A 1X70A 4XIGS 3RSFA 1TVKB 5C0OE 3IXLA 4CQLB 1MNQA 5LU9A 2CNOA 3UHPA 3K5HA 1WVIA 4J75A 3TINA 5BW5A 5A2QN 1T1JA 2JPDA 4QDKA 3SDLA 3HDGA 4BNMA 2I8LA 4WXRA 3QEOA 1ZIOA 1KARA 1DAMA 3N4ZA 2PUEA 3FB1A 1NDUA 2CLCX 4ZEVA 1LDMA 2HREA 3MIIA 2F9MA 5AVOA 3BFKA 3K0DA 4AJ4A 1CP2A 2Z1FA 4P82A 1YA8A 5G4KA 1B42A 1GU0A 4F21A 2YFQA 3WBKA 3KX2A 2CCGA 1HTTA 5ALLA 5EIHA 4ANFA 1P19A 3PKJA 1U8ZA 6LDHA 1QNMA 3O92A 3RKRA 5H8WA 3CC7V 4YECA 1Y1RA 1EP9A 3VQWA 4JBGA 4JK3A 1FDSA 1DT5A 4I7EA 4LMRA 4HEA1 4CEHB 3PNYA 2ZJ6A 4LJRA 4ZCMA 1EAYA 1K06A 3OTQA 2YZGA 5CLLA 1E2JA 3D8UA 4GL2A 4TX1A 5AW4A 2EFGA 5L3EA 3RASA 3OBBA 2XNCA 1ZK1A 4BMDA 3D7KA 4CM4A 4FZ3A 1VQ6F 4B6GA 3RUCA 2RGUA 4JHLA 4Q15A 3O4VA 4XPIB 2RMKA 5LNK1 5E95A 3EZ6A 2B0CA 1U7HA 2ODMA 2WU1A 3RREA 2VT2A 3VNQA 3RVQA 2D3OW 1NH2D 1W75A 3TRFA 1ONSA 1ISSA 1I08A 3U81A 4XYGA 2JGEA 2QKCA 3OPYI 3FD6A 2ZFUA 1QB8A 3GDGA 2ONKA 3HGQA 4TWBA 1EDEA 4Q3EA 3EGWA 2PFSA 1G1XB 4EHFA 1AP5A 4L85A 1AH2A 2G8LA 3A2MA 8AT1A 3VR6A 4MV0A 4XCQA 1DWUA 2EW8A 3CMMA 4AZ3B 3UICA 2BUBA 4QJFB 3OTGA 3GFQA 1VIAA 1TIKA 1GTL1 1V16B 2OFXA 4DA0A 3I2GA 1AS0A 4E2FA 3KT3A 4HZUB 3S2SA 2XKJE 1A82A 2OLEA 1XQVA 1O1YA 4B8ZA 4D4IA 1UT6A 3O0TA 3RVNA 3HCBA 5BMOA 2F66C 4C6RA 2HRUA 1FIUA 1IN4A 1WZCA 3JZAA 1SC4A 1GNTA 3Q8HA 4D8XA 2OWEA 1P3DA 1PNTA 5CA0F 1N78A 3L3BA 1X9GA 3TEFA 4OYHA 3HA2A 4NBVA 3QZUA 2XBLA 1VQKV 3HYNA 3SR0A 2IVZA 2CLOB 3S2ZA 3RWOA 3BUSA 2IHKA 4V0OA 1HQKA 2NT3A 2PRZA 2O8FA 1I4WA 1VQLV 3ZJVA 4FDAA 2JEOA 4RQUA 3CHYA 2QTWB 2AI2A 4QDTA 4R6WA 1OAOC 5KYGA 3ZUGA 3M2TA 2ZDGA 1WP8A 1E3WA 1HNWB 3LA8A 3FOFC 1QLHA 2Z2IA 2XKKA 4PX2A 1TIBA 3FZNA 3K9BA 4IGFA 4R9SA 1DGQA 3SIVA 3K9SA 2JJ1D 3IKEA 2DCUA 3KPYA 3LW7A 5L3GA 1F2TB 4E46A 3GJRA 3KAJA 3SSMA 4C8GA 3F6SA 3BD9A 4NFSA 5CB6A 3NHZA 4ARSA 1K0FA 2B5OA 2GUZB 3FPIA 5B1EA 3E9YA 4AP5A 1RM1C 4EYEA 3JQFA 3L8FA 3SZGA 1BEZA 3KVRA 3B1YA 1X6VA 2QRMA 3MGBA 5TXGA 2J07A 1WN7A 4KMOA 2QR2A 3RYCB 3ECSA 3A32A 1VE3A 5HBRA 4WKGA 3I5MA 3I64A 2GD1O 3QNUA 4F8YA 2ZNIA 3AUYA 4CTJA 4KPUB 1RXIA 3WBBA 3WOHA 2Q6IA 2EIKC 3C45A 1LH0A 3WLHA 3WNBA 2I7CA 5DLEA 3IKTA 2CJXA 3OMNB 4B09A 1YI1A 3X2FA 1UPXA 5KQRA 2LVBA 1VIBA 2C4MA 2HLHA 4TUYF 1DKLA 3FD5A 4HD8A 3KQQA 1Y5LA 4OP1A 3KFXA 3NR2A 3NRJA 1CG6A 4CUZA 1PR5A 2OD9A 1GL3A 1MNGA 3E8MA 5F23A 3H9UA 3FYCA 2WWGA 4YMTA 3F3MA 3HR8A 1T0IA 4OX9Y 5FO0A 1RABA 2IY8A 4DAEA 1BD3A 2Q7DA 3B9QA 5EC1C 3DBRB 2PZFA 3DMPA 5AM2A 3JZIA 1ZVJA 3S8MA 1A9SA 3VPGA 1NTKH 3CPWU 2GBPA 1JJAA 4OHXA 3E70C 4X62O 4EB8A 2OBYA 1W1WA 1ZUQA 4V0LA 1YQTA 3WK6A 3C5CA 2O05A 1YI2V 2X9VA 1G291 1JU3A 3QO8A 3ETGA 4EX7A 2QD2A 3DWIA 3P30A 3CD6V 1D5CA 5TEWA 3CS3A 3RW9A 1VLQA 4IHJB 3N1UA 2QLJA 3L8DA 2GPWA 1GRRA 1E4YA 4IDHA 3D1LA 5L95A 2ZAOA 1GZ4A 3MQ4A 4F5EA 3BIFA 3K8OE 4WLNA 5D00A 2OBMA 3FFXA 3PQCA 3QVUA 4FMTA 2YZMA 3N0WA 1H69A 2NTEA 5DYTA 1D04A 1B41A 4RY0A 4PZAA 4TN5A 4E0BA 1Q1QA 3H16A 2RHWA 3ZY6A 4IMJB 3QU5A 3U3XA 1OX4A 3AG3C 4FEEA 5LHGA 1RHKA 3HB7A 3CIOA 4JC8A 4PFQA 1U0HC 1XAHA 1D3AA 4K6OA 3K8YA 3CINA 3KO8A 1BSVA 3LYLA 1T9DA 3APQA 3Q7RA 4RK0A 1L5FA 3FOWA 1VEWA 1L4UA 2YL2A 4KXRA 2NTVA 3VDXA 4L4UA 2JIZG 1FB5A 3FPBA 3I4FA 1R8QA 4EKWA 4GNKA 1Y1TA 5KNBD 3KQVA 4RUKA 1AZSC 1E96A 4LRWA 1RCTE 3V4RA 5CBHA 4MR9B 2X22A 3PDIA 2B69A 2LNDA 2JGDB 4ZVPA 2J87A 3ASNC 3OM9A 1S2DA 4Q7LA 1QG0A 3KQMA 3PSAA 1WLSA 2EBUA 3CMEV 2PMCA 4CKCB 2WV9A 5K0BA 3ZBTA 2V3VA 1JV2B 1VMKA 2DECA 3ZK7A 4M49A 4F06A 4UHHA 5IM4A 4KNWA 2HUNA 3I6QA 4GP7A 2EX3A 1ISRA 2IEGA 2Q46A 3TAXA 2I7TA 3E4CA 2AG8A 2N42A 5U1PA 2C5EA 1UJWB 3EIWA 2FPIA 1FPMA 1GY8A 1YIDA 1DQPA 3H4VA 5JPIA 3ZCSA 3HCOA 4TWJA 3C4JA 2ISQA 1HE4A 4GPZA 3PQDA 2R3SA 2CH7B 3KKPA 3U16A 2HHJA 4H0FA 3FR8A 3IHKA 1BTOA 4QRDA 3NGXA 5EAIA 3BHJA 1XPJA 2CNNA 4BUZA 4PX9A 2QL7A 4ENVA 5D51S 2EJTA 3JX9A 5FJJA 3H2SA 4K81B 2X9GA 2BISA 4NAUA 5SICE 1PR9A 2DT8A 1H2YA 4K9OA 2EL7A 3AR5A 1CEXA 4BP9A 1FSGA 2OESA 3L49A 1CERA 2OM6A 2IDMA 2XASA 4MRMA 2JZOA 3BYQA 3QLVC 5JZBA 4DXWA 4J1QA 1Q82W 2G9QA 2VK1A 1H2FA 3A04A 2W9XA 5SYNA 1O95D 3RWBA 4JA0A 3DLTA 1YB1A 3OMLA 4RE5A 3BXGA 2FWPA 4GEGA 4PQYA 4N49A 3TWOA 1DCMA 3MLAA 2QE7D 5A6SB 4KN6A 1KYTA 3WG7B 4EEQA 4LS3A 1M1KW 2C4NA 3MELA 4ROSA 1XP8A 3NKLA 1CUGA 3PEWA 3T9FA 2ODTX 3ZWQA 4TKMA 3TSWA 5FBKA 3LLUA 3M8KA 1XXHA 3ENZA 2IEAA 2GZAA 2HG5C 2ZLBA 3FN4A 1Z2CA 1RJ9B 1NXWA 3DEKA 1YDWA 1KDVA 3OY2A 5ALUA 3I39X 1ZXXA 2C3YA 4HAXA 4WXHA 4W7HA 1PI3A 1W4ZA 5B6PA 1TEZA 2Q69A 4OXXA 4FWBA 1Q22A 3IT2A 3M5DA 1I4LD 1Z29A 2V7XA 4WNAB 5F77A 3WLRA 1A7JA 4DCUA 3ESRA 3BIOA 3LUJA 4IHQA 3FTEA 2X8LA 3ORRA 2Z56A 3ZLJA 4TWZA 1OCZC 5KWEA 1RXCA 1KNJA 4R1MA 4LY6A 3NYIA 4EUEA 2OOSA 1QFJA 3M7IA 5ICGA 1NATA 4FPXA 5A4MS 1IHDA 1FS6A 3THSA 2P1DA 1JDZA 2QT9A 1EZVH 2VRWA 3R3XA 4D9NA 3HWX1 2A78A 1MPTA 4ZVQA 1YMVA 2IQQA 1WR8A 1G2PA 3QE4A 2PYIA 3W3AA 1U98A 3OBIA 2FOLA 3F5SA 4MR7A 2IZ1A 5A3SA 1A8QA 4Z86A 2DYSB 2NMUA 1X7ZA 5HCUA 2AQHA 3IEUA 3QP9A 1U8FO 2RGXA 5JYEA 4DVJA 1MJNA 2P6JA 4GOKA 2QM0A 3LMEA 4LF6B 3WYCA 3F0FA 2ZJBA 2F9FA 2P7IA 4GI7A 3T99A 3T7DA 4LC0A 3V7NA 5ILOA 1V7QA 4ZV7A 2BBOA 1NW9B 3REOA 3G5LA 4V0ME 3AWIA 1ZI6A 4JFAA 5GWXA 3WP1B 4C0KA 5LL6Y 1ZIDA 4ZVVA 4G4IA 5AHKA 3KTAA 4LWPA 1NVDA 3R23A 5PNTA 3HU3A 3K0SA 1NVMB 1JKFA 5CLJA 1GSIA 5HR5A 1NN1A 3H1TA 3RTCA 1X0VA 2RJ3A 1ECLA 2J8ZA 1NV9A 1N1MA 2GBIA 3GFGA 4F9TA 2B6NA 3BFXA 3BULA 2I8CA 3UO3A 1FSPA 1BWPA 4F3KA 5C9ZA 2FZCA 3HU1A 4RKQA 4H08A 1S7GA 4HLDA 3F97A 5LDHA 2XCIA 5FJIA 4I5EA 1AI6A 5DGTA 3WKEA 1ZWZA 4KXVA 4L7VA 2W6OA 2DPLA 4LJ7A 1H22A 3GELA 3DGEC 1N5LA 2OCIA 1A8PA 3W5DA 3SJAC 5IYZA 1NNEA 1SY7A 3WYEA 3GDFA 5B3SC 5DEIA 3U26A 1B6GA 1OXSC 2B9ZA 3EWIA 4PS0A 1HNNA 2OMKA 5AVRA 3WMGA 1VQ1A 4FIPC 3NBUA 5BT8A 2IH5A 2BFDB 3I1FA 4HRXA 3FLEA 1S01A 2PMKA 2AQ8A 4YJGA 4UVBA 1KAMA 4XDYA 1B43A 1F38A 5ITZA 2O8EB 1J2TA 2W2TA 4BKPA 1CZOA 1B8UA 1UANA 3FAKA 5GIOC 4MW2A 4RA9B 1RQRA 3U31A 3K73O 3SC3A 4NTZA 4CMHA 1PJ3A 4Z4HA 4C6HA 3UKMA 4YPVA 4RX1A 3AQ4A 2G8NA 2VLBA 2DUMA 2P27A 2QYSA 3JYCA 4M7RA 4M8IA 2D3WA 3TGUH 4CVNA 4QGBA 3LWPC 3MOSA 2DHRA 4NCKA 2M1XA 4LJ9A 3CJHB 2BP7B 3JQ9C 2DHCA 4LDJA 3KRTA 4C4RA 5IAKA 5MGBA 2QKSA 4B9AA 4E5YA 2I4NA 6GPBA 5IC4A 2L6LA 2AXNA 2J09A 3A3PA 1VG9B 3K5WA 1I32A 3OTWA 6REQA 4B3GA 3UJDA 3ZHTA 1T0HB 3ORFA 1L7RA 3A6HA 3I9NA 4OAPA 4H1VA 1TEXA 4NBLA 4DXHA 1OXTA 1USKA 3AU8A 3H11A 4TTQA 1JR2A 1OJ7A 1K89A 4PDMA 1COZA 1JR3E 2OHIA 3BKWA 3AFNA 5AK6A 4DM3A 2BGIA 4EEZA 4AUKA 4XARA 2CNWA 4Y6PA 3PFGA 4NX2A 4O4HF 3GD5A 3H13A 2A9FA 2MU1A 3BMCB 4RZIA 1OX5A 3ZQ4A 1CF4A 5IC5A 1QK5A 1GTJ1 2E89A 4ZARA 2LZ0A 5ER6A 1WAZA 2ZYHA 9GPBA 1CP9A 2BZ1A 1M66A 4KQ1A 5IASA 2QTVA 4AJEA 2O48X 2JHFA 1TGOA 5D5HA 2B30A 4OMDA 1OGIA 1BKSB 3P9CA 1KD1H 5B36A 3W5BA 4E15A 1JDNA 1U8UA 4W8HA 4CL3A 3MS7A 3DOIA 1W9MA 1M2HA 4B44A 3CWQA 5JJIA 3ZOZA 4OYLA 3N7TA 5IJ9B 2PMDA 4DFDA 4P58A 4AKSA 1SHZA 3CIFA 4J07A 3FD8A 5JCXA 3SKXA 2XWJI 5HXUA 3RUAA 3GDWA 2JRCA 3TRKA 1K6IA 3WWOA 3N05A 1OHHG 3JQQA 4DWJA 4B40A 3A0RB 1N2OA 3BG5A 4DT1A 4A73A 3SVTA 4YIHA 1KPGA 2ZS8A 1KAGA 1ZPDA 4OEHA 2RGNC 3GJTA 2O2IA 1QIDA 2E55A 3T5DA 4ZGGA 2ILTA 2VLIA 2YWJA 1MC4A 4DIKA 2FUNB 2I65A 3IUYA 3EH2A 2DQ4A 4DR3O 1UPAA 3F67A 3ESBA 9LDBA 2DPXA 2W93A 1KHTA 5HTKA 3VDMA 1XMQO 4FKZA 3QKSB 3E22B 1BW9A 2Z5UA 4MXDA 2GILA 4P4UA 2V1DA 3BJEA 2V8OA 5B1NA 5B1HA 2JGRA 1FTQA 5IAJA 1E79G 3Q5EA 1JHUA 4FM1A 4UREA 4WINA 1TK3A 5GINC 3THXA 1Y3DE 2L35A 4FCWA 3EWNA 3JVUA 1VG8A 1MRZA 2FZEA 4YJ3F 4OXNA 2R00A 4HGPA 2XJ9A 3WJPA 1JLSA 3RW0A 1GVNB 2P77A 1FFAA 4KWTA 3JD4A 3K5PA 4XEHA 4WJKB 4K6GA 1NN0A 3ZGVA 1EJ6A 2HR3A 3ZBUA 1G63A 3LDHA 1H4VB 3SMQA 4R31A 5F35A 1KU6A 2QD5A 2GUGA 1Z6ZA 1G17A 2AMJA 2FVYA 4IIEA 4NJEB 3D8CA 1MZVA 1XU9A 3ML1A 3SZ3A 4IRMA 1Q5PA 5JCZA 3OG9A 2I67A 2HTEA 4YGXB 3PL1A 5GV7A 1KO4A 2ADPA 3P45A 5BORA 3Q6NA 3WIEA 3H99A 3VXKA 1RHJA 3R5XA 1Y6GA 1E9AA 3RFFA 1KMCA 3ZY4A 1ESNA 1FFXB 2DOSA 2MW2B 4XLZA 3EWSA 1QVVA 1W1UA 3VJLA 3ZE7A 1R0XA 2CUNA 4RY8A 3U4QB 3Q7IA 2Z5FA 2OXFA 5AK0A 3HHPA 2QI2A 1XTQA 4GNRA 3F1LA 3QPWA 1C14A 2RHGB 1N36B 4ESHA 2C77A 5EWJB 1X2EA 4BXOA 2XMCA 3HTNA 4ECEA 1TZJA 1ULHA 2Z3YA 2GM3A 5IDQA 3JATB 1SKQA 1Y3HA 1WM1A 4NXMB 1MG0A 3DZHA 4HQRA 3MSXA 3FX7A 3N6RA 3L73H 2X7RB 2O5RA 1GDTA 3BA1A 3HNOA 3L4JA 5DK6A 3B36A 1XMIA 5D3MB 1I2ZA 3HJFA 2NACA 3SYQA 4XWGA 5DT9A 1HURA 3ENWA 1NX9A 4FHFA 1PK8A 1OR8A 2BKEA 621PA 1FF9A 4OGFA 3W1WA 5E3IA 5EIFA 4QJ5A 2UUCB 4HQNA 3FDFA 2ZZKA 4DCJA 3M9XA 2PX6A 2XOEA 4QPKA 2QRHA 4UVHA 1BVYF 4EHBA 1CRLA 4B5CA 4AYXA 3L6RA 2ATKC 2FDRA 4WFHA 1Z56C 1QHIA 3G1UA 2IH2A 1YR7A 3VV3A 3BSFA 3ROMA 1DG9A 5DW0A 2ZI7A 1GZDA 2IS1A 2YXHA 2P3LA 4FOSA 1YS9A 4NFYA 1Y76A 4X61A 2OKCA 4NG5A 3DZKA 1NTOA 4Y7CA 3VYTB 2RSLA 1SCQA 1JA1A 1Z6XA 3HNRA 4PA7A 1M6WA 1H3EA 2FEMA 3K15A 4MQEB 2IYOA 1NBHA 3DBHA 1BNCA 2ZJ0A 4JUCA 2JJYA 5CEFA 5L3DA 3AUFA 1E5XA 5CT8A 1K9MH 3U62A 1VMEA 2QP4A 1FMTA 4JJIA 2C7OA 1UPBA 1PSDA 2XUFA 2GAAA 5FUVA 2QZPA 2GV9A 3LL7A 4R2WA 1QKIA 4UHDA 1U7OA 1HH4A 1PZFA 4EQ6A 4DSTA 1MO4A 1Y4AE 1B3QA 4HK4A 4EGJA 2GSWA 1R15A 1L7PA 3ABKB 3SXUB 1ZJ4A 1ZWKA 1ORRA 2PA0A 1HNZB 3NBQA 2VOJA 1U7DA 1E1QA 2XUMA 4YAOA 3LVFO 3H9VA 1KKMA 2G71A 3FX2A 4DXDA 5ILQA 5BSKA 4NYKA 2KMLA 1W9HA 2PX0A 1D2EA 5ALJA 1GGNA 2K1SA 2FUG6 3NC0C 3ZW7A 3EGDB 2J6HA 1NUSA 3K6KA 1VJ1A 1MAAA 3ZV6A 5EWMA 3SYTA 4TQUS 2Z2JA 1EWQA 2V6JA 2CUKA 4EFBA 2GSMB 2HCJB 1O9GA 1Z18A 3S06A 2MJLA 4LXGA 4MB6A 4PC7A 4IX1A 1XA0A 2LFSA 4DR5B 5JOQA 4V1CB 2ZRKA 1R4AA 2A0LA 2E5WA 2Y76A 4MCAA 5G40A 4R3NA 2JS5A 1EFLA 1OXXK 3P9QA 4YIOA 3R5KA 2WZCA 2G9VA 4IWYA 4O08A 2COUA 4XIJA 3CCVF 4Q3CA 2GCPA 4B5LA 2R8BA 1IG3A 2IH1C 4IEFB 2FN9A 3OZEA 5IAGA 1XQ8A 1JR3A 2ZP1A 2PGDA 1E3MA 3HVHA 1CULC 4ZTUB 3ER8A 4WDQA 1RHMA 1DBSA 1G1MA 2GHRA 3DMYA 2KX7A 5A03A 2CNKA 1G5RA 2CXTA 3QVLA 4LV8B 3UB2A 5KTSA 3TETA 2WG1A 5KB3A 4BZQA 1NYRA 2Q2OA 2OO5C 2Y9MB 3LBNA 5IP5A 1WE2A 1XHLA 2ZTVA 1K7EB 3UUWA 4JI3B 1Z6YA 5FBHA 1YQDA 4URZR 3K0TA 1K88A 4RPIA 1ZU5A 1UBOS 5KX5A 4KO8A 4ZI7A 3UMFA 4UUNA 4ZI5A 3E3LA 5JMPA 3MWDA 1TUGA 5HIAA 2WAAA 4XDGA 4ZZ0A 3DSRA 5JBQA 5F98A 3FIUA 1MMMA 4KKXB 5FWXB 2HJGA 4ESEA 5LOVF 2Z5LA 2IYEA 3CF6R 1CW2B 2HA5A 3FW1A 5B7GA 2QYHA 3D9QX 4KQIA 4DLRA 3UMYA 2TMGA 2PBLA 3LZDA 1VLHA 4G0XA 1YRWA 4FMDB 3CC7F 3L46A 1YHYA 1VE1A 1J5PA 2B37A 4Z1OA 3REQB 2HI0A 3VTZA 4B31A 3WTCA 1X1CA 1GNPA 2FEXA 1DEXA 1L7MA 4CM7A 1YBVA 5LZ9A 3EBOA 4TLEA 1WBDA 3OT1B 1ULUA 3ND6A 1QLEC 3PGJA 4R9RA 4JGGA 5CXUA 1FP4A 1DVRA 4HN4B 2B1IA 1PWYE 2P6RA 3AFMA 1TDJA 4D6TH 2W2NA 1S2IA 1FFTB 2W11A 2L26A 3EVNA 1W42A 2HZBA 1M8JA 1KIAA 1MPXA 3AXTA 3GLFB 2QW1A 4KG7A 4XIFA 1EMDA 3RVBA 3M1LA 2QLBA 1SXJC 3KETA 1V47A 3D8SA 5D1NA 3K5OA 2FSUA 2MCFA 5BWLA 4ENWA 5H2FZ 3HUFA 4AQYO 2HBRA 4M54A 3X1KA 4YDHB 4CV3A 3TR5A 4UM8B 3PFIA 3K9WA 3OUFA 4IRUB 2J6BA 4ND4A 3ZXUB 3S0HA 4GP6A 3EDRA 4KOEC 2ZM6O 1K9SA 1P18A 1ROPA 3QWFA 3R0XA 2ORYA 4C04A 1RPRA 2L17A 4ZHQB 3EXIA 2D4HA 3TSZA 2XGMA 5AKLA 1NR7A 2D5CA 3IEQA 4X45A 1WMDA 1A04A 1IQUA 3JAMN 3AEZA 3F96A 1HEUA 3P3NA 3W77A 1ZR2A 1J8YF 4BFSA 1L5KA 1TYBE 2GPJA 2OFWA 3G59A 1P5FA 1HGXA 5HZGA 1G20B 3THYB 3GLGB 2BN4A 2FOXA 3EVDA 1VQKF 2YHIA 4NATA 2PUSA 1E61A 3H4TA 4XJVA 5A7HA 1XTVA 1AK1A 1E7YA 3C24A 1DFGA 3Q8KA 1XZ8A 4KSBA 1VQLF 5AKKA 2HXGA 1MO5A 2Y2VA 1H2NA 1SC1A 4PYOA 1SUWA 1TAGA 1ABEA 2PLAA 1TADA 1P84F 4G8CA 2BR3A 4P9PA 3AIOA 4B3MO 4U2BA 5CB0A 5CNMA 3OONA 2AKAB 5H1YA 2Y93A 2A67A 2YV4A 3D6MA 3V8MA 1VFPA 3T1CA 4BLUA 3AI7A 1Q21A 3I73A 2RHHA 4Q4AB 4KVGA 2G83A 3W1VA 5DE3A 3OO1A 1AOXA 5K3AA 3PPWA 2ZS7A 1C3EA 2WYOA 3FGNA 4HH4A 4QU9A 3ELCA 1MB4A 1BMDA 4MW9A 5K0SA 3IIKA 1C0KA 5B1BC 2ZCVA 5F7OA 2GVZC 1BXRA 4DVGA 3TEMA 2QE7G 2BMVA 3DAGA 5ALOA 1OLOA 5J63A 2I03A 2VHXA 3BRWD 3IP3A 3HXQA 2O14A 1I9GA 3QHQA 2JK0A 1T5OA 2FRDA 3W8NA 1RIIA 4ICIA 5G4LA 4MPPA 4PLPA 4PZYA 4UUMA 1KI9A 4FHEA 3BS4A 4B34A 3E5RA 2P2SA 3B6IA 4HH0A 3O3OB 5EIWA 2PD4A 5IVPA 1JHZA 3DMGA 2IS2A 4CEJB 5I7WA 1F3OA 3FWPA 1CLUA 2ZR7A 1TCCA 4GI3A 3O8DA 3ZRVA 3Q9SA 5T67A 2IOFA 1BGYH 4PG8A 1YI2F 2GCOA 1VHQA 4G36A 1RRCA 4YRCA 3IPYA 4JUIA 2PNJA 3CD6F 3KM0A 4U0JA 2Q8QA 1A9ZA 3BH0A 3KWFA 5B58C 3BTVA 2DY0A 4D96A 4IV5A 3HL4A 4HPXB 5JEEA 2XEXA 1SU7A 1V3VA 1MDBA 1PTKA 3K0GA 3CMCO 2EZ4A 1SB9A 4FCVA 5KNBH 5JXJA 4EJSB 2YBEA 3AIKA 2XAQA 1FUYB 4TTIA 3L8MA 1IJEA 3TPFA 4HX2A 5JNVA 3GFTA 1U3GA 4U63A 1E0KA 1R6VA 3CUVA 5BWCA 3SZRA 5ESXA 5CA0A 1P2DA 3E9EA 1XRQA 4DDKA 2CE7A 1A4XA 2VK4A 1QR9A 3T4DA 5TQVA 4AKHA 1DE0A 2BEKA 1XL4A 5IG2A 5DYYA 3WGYA 3KQUA 3P9RA 1DXQA 1IWBB 3NAQA 4M9CA 1W0KA 3PX2A 1TCVA 2ERXA 3WHKA 3V1YA 5IVDA 2I3DA 4QU5A 3QKRA 1XNJA 1IY9A 3FPSA 5KYXB 2DB3A 4W4TA 4KXLA 4JVOA 1RI1A 4GVPA 2IZ5A 4HPJB 4LDPA 1W2BF 1UQTA 3CMEF 4OXKA 2FN3A 4C5BA 1UJCA 4ZCQA 1M6VA 4N12A 1R4ZA 3K57A 3GO4A 3EUEA 2I6QA 4G5QA 2WKPA 4F11A 1C50A 1E64A 3TN7A 5KX5F 4IRXA 2FPRA 1IBSA 2WVHA 1LI7A 2JBAA 5MN4A 4HG2A 4WEQA 3AIIA 3I6IA 2F62A 4W7SA 2CZGA 1ADBA 3WWEA 3PUKA 3FYSA 3STTA 2W2OA 1ZM3A 2ZE5A 3S68A 2QP3A 4DF3A 3VR6D 1L5GB 4B3JA 4TWKA 4Y6LA 1CE8A 2XQGA 1EQAA 3LV8A 4YWJA 1ES9A 2C5BA 2NT4A 1LZKA 2Q5EA 3D8TA 3O9MA 4D3XA 4E3WA 1ZH2A 3L0YA 1NJGA 3HY3A 4OD0A 4NZZA 1IZ0A 1M7HA 4X3MA 4M98A 1M1XB 3LNCA 3FNEA 1PWEA 3VNVA 4RM3A 3Q0TA 3NT4A 4NEGA 4NTWA 4ZXPA 2AFIB 3KOUA 1RLIA 4X9QA 2WTXA 4TKZA 3N2KA 1PFGA 1PNQA 3ZWBA 4MITA 5MN6A 3N8NA 2WF7A 4ZYLA 1KMHA 3ABQB 2YMPA 2A9KA 2RJZA 3TTWA 3DBLA 3B89A 1C0PA 1JQEA 4CM8B 3VR5D 4KMRA 3SIWA 4QEDA 2EWMA 3ELUA 3Q2OA 3PB3A 2VHJA 3HDHA 3PIRA 2PV7A 4LJ5A 2UUBO 3ITEA 1K5DA 2PT7A 3NAZA 1II8B 3OM8A 2R6FA 4LXHA 4IF4A 2XW6A 3DOHA 1GM9A 2QD4A 4TYQA 2OCBA 4XOIA 5DFAA 1R6AA 4U39A 1HEIA 4P3KA 4B7UA 2OV6A 4HB3A 2O7QA 3N75A 4GZRB 3OZ7A 5JG7A 2GXAA 2XLCA 4TKVB 1H8EA 5FLXM 4JGBA 1QS0B 3STVA 4KN8A 3HP7A 4L0MA 4YO7A 1A97A 2A1IA 3USZA 2YDYA 3RHTA 3MT7A 2O2XA 4L9SA 5CX1A 1W581 4I55F 4X97A 4RPKA 1JLLB 4G2KA 1E6MA 5TQ2B 5KDOA 1QD9A 4CR8A 4AIIA 3D6TB 3TX2A 4LE1A 3UTCA 5AJWA 3PCRB 5KNDA 2XRMA 2Z0MA 4KQWA 3P0HA 4CZZA 3E2IA 2Z0AA 3B6JA 3U11A 4MB2A 3ZE8A 1TF2A 2ZUWA 2ZWVA 1F0PA 5ALVA 5HS4A 3RVDA 4LBYA 1E2UA 4UEQA 1I7NA 3Q3GE 1KGSA 1KYZA 4DC1A 1V8ZA 2EP5A 5J1TB 5ADUS 1SOVA 3K2IA 2BFWA 2XXAB 1O5OA 3BREA 4PPYA 1U2GA 1EQ2A 1Z0UA 1LTQA 3KLNA 2Q6KA 3M6UA 4HB0A 4UD2A 1ORQC 3WNZA 1PL6A 1H38A 1P1RA 4AF7A 3HXKA 4G1EB 2YVAA 3G0CA 4MZXA 2PG3A 4HVCA 4JP3A 1BIFA 1XJWA 3W4JA 3UAGA 3Q8LA 2PRJA 1FBNA 1WBJB 1ZMBA 4PZZA 1GLVA 3O1HB 3AWDA 1V55B 4GYYA 3I4CA 2UU9O 1SC6A 1OVGA 4KGZA 1JDJA 3FDZA 3GZJA 1P8JA 4PLFA 3GFVA 1OF1A 3KQHA 5IUNC 1S9DA 3EC1A 3HPLC 1U97A 1EWRA 3K03A 4HO1X 5EKXA 4MGHA 2AK2A 1WUTA 2NXJA 3LC1O 4IKEA 1X8JA 2MSNA 1RAEA 4OM8A 4I3HA 1HF3A 4IIXA 2Z1NA 4MRAA 2XA2A 5KWJA 1L7BA 5KNCD 1KK0A 5MHTA 2WT8A 1J9EA 2CNDA 1G16A 4ZO9A 3UMSA 3UWDA 3V97A 2OP1A 2EC5A 1R9JA 3FRIA 4EUKA 3ROEA 1RRMA 3I2HA 3OZSA 4LNAA 3PRYA 4ETWA 2VRCA 5DK4A 2J30A 4PF1A 2HJVA 1QUEA 1C2YA 3ZN0A 4MJ7A 4UTPA 4AZSA 4ALJA 2BGTA 4MWTA 2C7RA 2H2HA 2HEGA 1L5MA 2B4QA 1C3OA 1P4GA 4RJ2A 2Q0QA 1N6NA 1CB0A 3L06A 3JALA 1UI9A 5I9IA 4OXIA 4DJAA 4Z9BA 3Q7TA 4ILEA 4EG7A 4QBIA 3PTLA 1EVLA 4O8ZA 4DCOA 3ELBA 5CFOA 5FTNA 3DB2A 4YQYA 4HAWA 3EIOA 1XEWY 2BGUA 1MTZA 3VOBA 1SIWA 5A9SB 1TNDA 2IYWA 5TT0A 4FYIA 2XCLA 1G66A 5A5FA 4BYMA 5M04A 2EL9A 3FDXA 1RC1A 2R6HA 3L8CA 3TOVA 3GMIA 4F60A 2Q1SA 4YXWA 2A2ZA 5LQMA 2C1EA 3GUUA 2EKQA 1OJHA 4OAQA 2JBWA 4RAQA 4HX9A 5TV2A 3HZOA 3HEMA 1ADYA 2FGJA 1VCNA 4LAFA 3H86A 2JCSA 4MW6A 1AKRA 2WYWA 3WK5A 4UEWA 1Q7RA 3AHJA 3W8FA 1EDDA 2W6ID 3Q7SA 4PWZA 5G2OA 4D9IA 3OQMA 4RH1A 3DE2X 1L4BA 4DLYA 2RGRA 2PN1A 2RHDA 3QPBA 1N2ZA 3UK6A 1OFUX 2ILVA 5BNTA 4FOOA 1SOMA 2AN3A 3GLUA 2XGGA 4H0LB 3MMZA 4DCPA 3EXHB 4JROA 4Q9AA 3U56A 5KHIA 4J1SA 3AG2C 4MTGA 5DX8A 1WRBA 2DSTA 2A9QA 4F3YA 4K7JA 2ASEA 4P3XA 2WWTA 5NLLA 4D99A 4WLOA 3OMAB 4XB1A 2N04A 3LK7A 5BOVA 3LDAA 5C7YA 2WU3A 3NBKA 4MQ6A 1SXGA 2IEDA 1XSEA 2GRJA 1T13A 3UA4A 1W76A 4R40A 2NO7A 4K9MA 3TSYA 2VSOA 2SICE 3MHPA 5DNDA 5A4FS 3O4HA 2YWGA 5EJMA 3TEJA 5IBQA 2A1UB 3NFRA 4DE5A 4GXNA 4TSFG 2R6ZA 2HGSA 3FETA 4KN5A 4DEYA 2E4WA 2VBGA 2GLUA 1DJQA 3A05A 5EJIA 4FK8A 3IP1A 1DX6A 4OMFG 1EZJA 4D3SA 5I7HA 2AG5A 1N2XA 2P4KA 3BRSA 4JUDX 4BVAA 4QLBA 3O2QB 2FPGB 2RHRA 1V3QE 2ARHA 3MK31 4WFIA 4R81A 5DT2A 1B6QA 4UB6Z 2OCPA 2PD6A 2GXQA 3WE7A 4YAWA 3CUEF 1YBMA 2ZT7A 2I66A 3NMUF 1TYAE 3Q11A 3TJZA 3TZLA 1HYBA 4EJFA 1GSOA 4GYKA 1VL5A 1AHHA 2XE6A 3JZFA 4DC0A 1FYXA 5SYAA 1J90A 2PLWA 2QUZA 2V9YA 1UC5B 2B1QA 1TJYA 3K6JA 2P3SA 2QPOA 3ANMA 3BE6A 1BHO1 3DMDA 1X15A 5JNLA 2NZUG 1GARA 4J7KA 1ZOOA 4A0HA 2WA1A 3MVEA 3RU3A 5CB4B 3EEFA 4BT6A 1LQUA 4POOA 4KAXA 1DB3A 1PIWA 3C14C 1OAAA 3IUPA 1R0CA 4JBIA 3BWBA 2IXFA 3ORHA 4QT0A 2LFRA 2I4IA 1UMDA 2BWJA 1R8XA 4EKIA 2DT5A 4ZHSA 5TSDA 1QK4A 4B48A 4EMUA 1M2OB 3AF2A 2GTAA 3LDTA 4TLCA 4H3VA 4ZQGA 2PM8A 1F6BA 2C3PA 3GLTA 3BKXA 1IAQA 5LGUA 2WICA 2V59A 5ARBA 3RRZA 4F4DA 3THRA 2BT4A 3H87A 1M1NB 4DR6B 1L9XA 1BCSA 2RAVA 3BFRA 3NWOA 4YCCA 3LKDA 4GVXA 3GJYA 3BDVA 4CMBA 1IY2A 4Q1BA 2VNKA 5HJ5A 2QG9A 1KOGA 5DYNA 2EP7A 1TRKA 2FK8A 3E9NA 2JNBA 2GESA 1W34A 3FGPA 1Z33A 3MDOA 4EY3A 3R0JA 3UAZA 3R5TA 4UBMA 3QI7A 3ICOA 1M5IA 2VHZA 4Q7KA 2Y69C 5E6RB 3UQZA 4E88A 1PNKA 4OYRA 1WETA 3K14A 2JDIA 4X3PA 4B9EA 1RKUA 1GZHB 1N5DA 4MA4A 3ICXA 3ID6C 5K5EA 4OX9B 4KKVA 4WNYA 4ZPJA 3E3AA 3BXHA 3VPCA 2IW5A 5T6BA 2HNKA 2LXNA 1I4EB 4Y1RA 4EO4A 4O4HA 3DMHA 2FSIA 1T24A 1PGQA 1ZXBA 4KUEA 4C4AA 3FKSG 1CY4A 9ATCA 3U60B 1HK7A 2DWUA 4HQOA 5FEUA 3CRMA 1LSUA 1YIJV 3QX9A 4WACA 4EVRA 3U3RA 4OOEA 3HWRA 4DR2B 2KQXA 1Q0TA 3AEXA 4B6RA 4R8CA 3HXOA 4MUBA 4OOFA 1DWQA 2L0XA 1FDVA 1WU7A 5EUQB 1Z5PA 1X7WB 3CZ9A 3GZNB 4DR4B 3WB1A 4AX8A 2C88A 3DFKA 4XDLA 2M7WA 2C2XA 3FVWA 4DDTA 3STUA 3BQNB 3I2KA 1PR3A 3SEQA 3OLWA 1A9QA 2QAGC 2ODEA 5T6MA 4C0HA 1XMPA 5IFLA 2OE2A 4Y18A 4BNUA 2X3FA 2BMFA 2TS1A 1JKIA 2ZIXA 4DA8A 1NR5A 5FI0B 4B6PA 3G5AA 2F59A 2CSUA 1NIPA 3CCSV 5BYJA 2XUIA 4QUDA 2UZIR 2QJ1A 3WJ1A 3G9TA 5M2QA 3C4QA 4MW7A 3O8OA 5E7IA 4Z5XA 3MMPA 2A5FA 3HJCA 3KZ1E 1ZJJA 4B2YA 4Q00A 5IDVA 4E2XA 2RFLA 3L9WA 3E58A 1A76A 3IODA 3OPYB 3PJFA 4D98A 1QIKA 4W4LA 1E7SA 3H5WA 3PEUA 2V0GA 1FYFA 2ID7A 3KAPA 4DCMA 2IOFK 1RPZA 3EDYA 1RHQA 3AZOA 4FGSA 4HDCA 3EUFA 3AGQA 1X42A 2RG7A 3C41J 3E2MA 4ZANA 4X7BA 5HIJA 5DNEA 1Z4MA 1HC7A 4UC0A 3GN1A 4EG3A 2SKEA 1H0SA 3OCXA 3ZGOA 7AT1A 3IJEB 2IYYA 4BFXA 1WL8A 3S5UA 3CRQA 2B6HA 3S1AB 1LW7A 1J9ZA 5KTPA 3KV1A 1PTJA 3ON1A 1J97A 3GR6A 1Z63A 2AMTA 4Y2QA 3LPDA 1U8TA 3SIPA 4YJ3A 1HT3A 2CNWD 2GBGA 4BJ5A 5IH7A 4QA9A 3MB5A 1PRYA 3TLZA 1NVPD 2GR9A 2TMYA 4FJ2A 1F48A 2HQSC 2I34A 2A58A 1YB2A 1W52X 3HNPA 4I14A 4GYWA 2CV2A 2Q68A 4PLZA 1M0WA 4MYUA 4QEKA 4I9FA 1I0ZA 2QNBA 4L5BA 3KIZA 4GMDA 4KLZA 4YCBA 3DR3A 1ZSNA 1KBZA 1YE8A 4NOMA 5EIOA 2O8CB 3EZGA 4ZU6X 3W7TA 2QT0A 3J80N 5K03A 3F1KA 1NJ5A 4OP2A 5FTLA 5CVEA 2FLKA 3KZKA 5EE5B 4PI2A 4Y1GA 2D8MA 2YQZA 2W0SA 1JS1X 2AN1A 1K4DC 3I42A 3I6MA 2R79A 2ZI6A 4LSGA 3BQ9A 3RJMA 5DP1A 1YR3A 3QLEA 2IJKA 1JN1A 5KPDA 3KOOA 1JDTA 1G64A 4RLHA 1F06A 1VG0B 3W2FA 3M6IA 3TBHA 1AK9A 4PXAA 3HDTA 4GLFA 3BMQB 4FGZA 4OSEA 1WQ4A 5A7GA 3N86A 5GAJA 4KIGA 4RGYA 2ZEJA 1XZAA 1QRUA 1IPHA 1XLTC 1VJ0A 3BYZA 4LV5B 4BWFB 5JLAA 3CJTA 3VUEA 1A27A 5LBIA 2OZBA 1QX4A 5L7WA 4D41A 2WLLB 4KW7A 1EKXA 1C3VA 3A3OA 2QM8A 3I8XA 4OHWA 3K5LA 5KTMA 1KIFA 1N0JA 5TPWB 4FPPA 4OHYA 2ZDHA 3JVVA 3QUWA 3VU1A 3B12A 5KKCA 1M10A 3VMFB 2AH5A 3ETNA 3GGJA 2VTDA 5KPJA 2F43G 3A4YA 4C0JA 1XZQA 3QFSA 2O57A 5EE3A 3AM4A 3CVUA 1NJ1A 2HF8A 4ISBA 4XM2A 2AGAA 1P45A 3G02A 3ZJUA 4DOMA 1OYVA 1OREA 2WAXA 4CFZA 5AW6A 2PUDA 4CFYA 4US1R 1DU4A 1JLMA 3I37X 2ZNJA 1KZHA 3ZO8A 1G3QA 3G8CA 4IKPA 2BTEA 5JJLA 4NRDA 2WJHA 1LC3A 2B20A 4QOSA 1JH9A 2VWPA 2Q9UA 4RGBA 4R69A 1KY2A 2GDJA 3EVKA 5ALSA 2HSZA 4OKNA 5K6TA 2VF7A 4RD2A 3A2FA 4KR2A 1SXHA 1NZFA 1T1SA 3WYGA 1UFRA 1YOVA 2WSSD 5D5QA 1MVOA 1IV4A 4G4SP 4K9LA 3A10A 2EHDA 3T3IA 3TDNA 1M75A 3WKAA 4XVQA 3U1VA 4FR2A 4L8LA 1GTOA 3GQBA 1VB3A 1EUCA 4HGQA 3N2YA 5SZJA 1O94C 1S96A 4HDRB 2W2MA 4LJAA 2CDBA 1YZGA 5IY5C 4UDOA 4X0EA 4US2R 4XEUA 2IXBA 3UKOA 5LJIA 1L4MA 3VGJA 3RSOA 4RJTA 2WLKA 3ZHUA 1EK2A 2H18A 3VYWA 1JLRA 4NK4A 4F6CA 4IYHA 2DYRC 5EUMA 3HPRA 3VCZA 1ULAA 1KJYA 4KXFB 3EPHA 4E6EA 1E3IA 2YI8A 1FOEB 1V45E 4D9HA 4HXGA 2MSDB 4X1KA 1QQAA 1Q8RA 3OP1A 5FQNA 1GL9B 4RHEA 1KETA 2WWVD 5CA3A 4Q3LA 4S1OA 2SCUA 1RR6A 2PT5A 2TMKA 2GN2A 3H2YA 1W0CA 3CXUA 4F9FA 3KSZO 1T0AA 2P8JA 1QGAA 3Q6IA 4ON9A 1R27A 1XZIA 1ESDA 1ODLA 3MJTA 1IQ0A 4GSKA 5JY6A 1FP7A 1UKYA 4M60A 2PL1A 3GWKC 2FQYA 1BT8A 1KORA 3G1WA 5EVCA 4YJHA 1XWWA 3VU3A 3A1TA 2UZ1B 5IHXA 4J2HA 4KP7A 2PTHA 2Y4UA 3L9DA 4J7JA 1JG6A 3WKDA 3SFZA 5DBIA 3MTIA 3WHPA 3K09A 5EN4A 4FYMA 1XHFA 3X44A 2NLOA 4RCYA 4HWOA 1RXSA 2ZREA 2GTIA 4MVJE 1QH0A 1JXMA 3CYFA 1J21A 7MDHA 2VGNA 2R44A 1HO3A 3F3KA 1XZPA 1YDXA 1VQOV 2VZEA 4N8SA 3RYFA 4BZWA 3OCZA 1DKQA 1IV1A 3MUNA 4JJFA 3VJMA 4DV3B 4G4JA 3DHYA 4CI0B 2B3DA 2O06A 1YJCA 3ABLC 5TR9A 1XALA 4R6XA 4KGXA 4RYLA 5TMDA 4F4HA 2HL6A 4AJ9A 3BCSA 5KCMA 1QZ3A 4TZ6A 3BPZA 5LOVA 5D5PA 4AJLA 4D8YA 4FC6A 1GSAA 1QH1A 5I7FA 4M0UA 5FYQA 4LVOA 2Q3JA 1XILA 2ZWPA 1B14A 3M81A 4JP2A 3AY0A 3DYBA 1OT5A 2JARA 3SZUA 1AJEA 3HS3A 1X7DA 1YDMA 2JLSA 5KA5A 1GKFA 2ZSFA 2EKZA 4QM6A 1E1QD 3ZU6A 2F4NA 1EK5A 3GF4A 4TTPA 1C80A 5L3QB 1G21E 1E2HA 3W06A 1SRQA 4LJ8A 1K6MA 2PSDA 2WTAA 1ZAKA 5CYFA 4V2UA 3ZE9A 5DRTA 4UPEA 2C5LA 3CF4G 3R0PA 4HQ0A 4W8GA 3MUEA 3ET4A 1U2SA 4WK2B 2HP8A 4ENSA 1D1SA 5CEEA 2B4YA 3RJ5A 1AQYA 2FWIA 3CSXA 4Y2GA 1MF7A 2XKAA 1KIMA 3GZ4A 4EFMA 2XNDD 3UK1A 2ON6A 3U3JA 1OLSA 4D57A 4X64B 7REQB 4LWSB 2H57A 3IOBA 5F73A 4H18A 2I3GA 4D43A 5BNZA 5FA5A 1T0PA 3GNQA 1M2WA 2N48A 2GCNA 1IC6A 4NZOA 1I36A 3PX3A 4BIUA 4BNZA 5MGNA 5BN4B 4MQBA 3UJAA 1MQ9A 3SHTA 5ELMA 2P90A 3L5OA 5ALPA 3HCEA 3A0HZ 4J16C 3LY7A 5F33A 3BH6A 1EQUA 2UXCB 4HB2A 5J5VA 3PUIA 2GPTA 3UC9A 3GLKA 5F12A 4QHTA 1P8AA 4R9VA 1H2LA 2W2KA 5GGYA 4BO0A 1SH7A 3IHTA 2IH3C 1LWOA 4RWEA 3N2GB 3O38A 5KINB 5IT9N 2WLHA 4GKBA 1KA9H 4D9GA 4U0KA 1ANKA 2ZRFA 3AY6A 3VSDA 2GPAA 2A9HA 1Q57A 5H5JA 1MU0A 2GBCA 4W1RA 4XI9A 1WOYA 1F8GA 4LVCA 3T7CA 4EJ0A 5C8YF 2C3UA 4BT2A 2Y1LA 5JV5A 4UNPA 3FWNA 2ZXWB 3DZJA 3SR3A 4XUDA 2HNAA 3IRUA 2BCJQ 3KEGA 1QE0A 3AF5A 3FBTA 4RVCA 4W5HA 3LOUA 1NG9A 4UE6A 3GYBA 3SJZA 2VDWB 3LLCA 1YV9A 4Q1EA 1W96A 1F2UA 4J0DA 1PLKA 3MWEB 2A7XA 3WQBA 2PGXA 1Y7PA 1UJ6A 3DVQX 1PV0A 2KLBA 2XT6A 4PZ0A 3V7QA 2X8JB 4XJSA 3MAGA 4V0MA 4PICA 3I0NA 4MJLA 4DW1A 3HEAA 1Y1QA 2H5LA 3L0ZA 2IY7A 3ZWPA 1Z6QA 2H5EA 4CMAA 4JLWA 2PBFA 2BDTA 2IS4A 3OFJA 5EUBA 1AO0A 4C7KA 1Z4NA 5DX0A 1KQGA 1IHPA 1N5IA 2VOEA 5ALMA 4CTOA 4XOUA 1HORA 2VUHB 1R7RA 3VR5H 2W2VA 4E5SA 3Q9LA 4QPPA 3K16A 1S2OA 3UGJA 3IDAA 3LCCA 3KYIB 1SUSA 3P26A 3AJDA 4ABYA 4GOMD 2YMQA 4C4TA 2AUNA 3MD0A 3IKVA 4UULA 2NMVA 2PHZA 2Q3CA 1BDJA 3T1HB 4J2TA 1OAOA 4RTOA 1YONA 2JJMA 3G8AA 4NHEA 2FRVA 3DFIA 4CIAA 4WCDA 1V8OA 1URFA 4HDAA 1TM3E 1OXKB 2WC1A 1ZCJA 2YXPX 3GRRA 3MHHC 4XBFA 1HM5A 1SVIA 1CD5A 4ND2A 3V3KA 5CT5A 3ZLUA 4XVUA 5JJKA 5F5LA 4CS2A 4QJBA 3AYZB 1TAHA 4LH7A 3HYSA 3CZQA 2R4TA 1Q3HA 3KKQA 4J0HA 1JEQA 2QWNB 1WD7A 4PRKA 1Y42X 4KNVA 3IT1A 2R65A 2AZDA 3EOZA 1H1DA 3LT5A 4FR5A 5LVAA 3PE6A 3R6WA 2JJ1G 3OTFA 3LKVA 4NECA 5ETJA 2QTHA 3JSNA 2X4IA 2HMSA 3ACBA 3AJ9A 4X85A 3GEPA 3NP7A 5L3SB 4B3HA 2YQ4A 5HGXA 1UP4A 3O31A 3QXCA 2VJMB 3EVZA 4M9XA 1XTRA 2E82A 1YVPA 4DLAA 4NUTA 2Q3DA 5JUWA 2JLAA 5G1PA 4Z53A 3ASZA 4MLZA 5JCJA 4FD3A 1I5XA 1DC5A 2IHBA 4KTVE 1ST2A 3V8PA 4NJMA 2BLNA 3AR8A 1I2CA 1UOQA 5AXAA 1RQPA 2OYRA 4ND1A 4OLHA 4FQ5A 1RKQA 3MMSA 1DXHA 3WKCA 4WLVA 5JBIA 4Z4IA 3DMRA 3HXPA 3USES 1G8SA 3LU1A 4XIIA 2A84A 3ZXIA 4FOLA 1S7CA 4IIVA 1PKXA 5TT1A 2C5HA 3LX5A 2YTZA 4DLKA 4IIDA 5F51A 1Y66A 5LQAA 5FP0A 1RPNA 4EVSA 1UMCB 5IW8A 1UMBA 4L72A 5L7YA 2UVQA 4TLLB 4AYWA 2HV8A 1G0OA 2ZOSA 3HN2A 3B78A 2ONYA 4X24A 7MHTA 5GJWC 2RDCA 1WG8A 4HZIA 4KV7A 4Q02A 3PA6A 3S28A 4RGVA 3R9IA 1YJWV 4HEQA 5FCDA 1JQLB 4ZT4A 2WUFA 1R00A 1U1FA 5KNCH 2C2MA 3NEAA 4OUKX 2GFQA 2GZLA 1FFWA 4IVQA 3RVSA 4JTDB 4EUNA 4RENA 2I1QA 5JC1A 3JASB 1W85B 1W5SA 5GIOE 4FINA 3RRFA 1SA0A 2Q8VA 1Q17A 1QU3A 4ZVLA 4X8HA 1M72A 5ALGA 1NPYA 5A06A 4PO8A 7ABPA 5LGNA 1EP2B 4MUKA 4C82A 5CTJA 1YB5A 2D7CA 2VJOA 2ZCEA 3D5EA 1QONA 5FPHA 2YI9A 3VFDA 2ZAGA 3ILSA 2P4HX 3WL8A 4LG1A 1LPNA 4IILA 2R1TB 2HHCA 2EEPA 3U7GA 4MP8A 1G21A 1HDOA 3A6KA 1MP0A 2IH4A 5HE8A 1RAGA 2WALA 2EX0A 4H27A 4IQ8A 1W30A 3JAWB 5M3BA 3FOAA 4CL8A 1KQOA 3Q3IA 4IXWA 2AMYA 4YTEA 5E0KB 3R65A 4PSVA 1XQXA 3UGKA 5AM5A 4G5RA 3K3WA 4DA6A 3SE7A 3IUSA 4MV4A 1VGQA 6Q21A 1W5EA 3H7AA 4ZVMA 2QA4V 4UNIA 4ZU1X 3L1IA 3NG1A 1NMSA 3C7CB 4YRSA 2B33A 3Q7EA 1T36A 1KI1A 2ADQB 1JW9B 1UPUA 4TL6A 1AKEA 2BZ0A 3S29A 2FW7A 1G5FA 3TM4A 3OZIA 3LT1A 3A6EA 4RPHA 1TEVA 3CZCA 1PNLA 1LSJA 1EA5A 1JKMA 1GSHA 3FPEA 2QTBA 3KBBA 1ZUNA 4MVJP 4PR3A 3ZE1B 1ZH4A 3FYUB 3CX5F 2FP3A 3WYFA 1BS2A 1FFYA 4EBBA 1NYQA 3VHXA 2YFHA 5IKMA 1HDRA 1JYEA 4O4IF 2IY9A 1JHRA 4WA8A 1Y8ZA 1VQMV 2CHVA 3NVAA 1XEAA 3Q88A 1RC0A 4LPSA 1L6IA 1D09A 4G0QA 3BWVA 4TZ0A 1OSNA 2CUTA 4Q9LA 4I55A 2AZMA 1D4ZA 2XE8A 1ONNA 1QRDA 5B1IA 3GWZA 1TW3A 1M3SA 5C7LO 3DZBA 4J49A 3FDJA 3QV2A 2FW8A 4PRYA 4BMPB 4YRLA 2H9IA 2JA2A 4QQRA 3IYLW 3CVYA 3GLIE 1U3CA 1GU7A 4JI2O 3D31A 5ITVA 1FJXA 2K4MA 4P3PA 2A14A 3WAKA 4BGVA 1NMUB 3EEIA 1RYNA 3QLVA 1Q1ZA 4ZKDA 4R3WA 4LY0A 1SZQA 3A27A 4FM2A 5EC2C 5CITA 4DZZA 2ODWA 4U9IS 3Q3HA 4WFJA 5CU7A 4FDMA 3CVXA 4D0NA 1TKCA 3E5HA 5IANA 1MEOA 3LCJA 5K01A 4TT3D 4WE3A 2YY5A 3NAMA 2WG0A 2VHUA 3P19A 1DWOA 1E9DA 3G0DA 2Y6VA 2OA0A 2NSLA 4FGJA 3QUQA 1IBLO 3S2IA 2H5JA 1N7GA 5BR4A 1P5ZB 5GINE 2G9NA 4X88A 4BKQA 2REQB 4TVBA 1S5JA 1RI2A 2RC5A 4Y9SA 4MI1A 3RJ9A 2J6IA 1LF0A 2FF7A 4U3FH 5GONB 2UXBO 4XFDA 2FG6C 4MKHA 4F1KA 3BRCA 1C0IA 4RSMA 1FP6A 4F4IA 1TO2E 1COMA 2OG1A 1UJ4A 3QVOA 1KJWA 3ZP4A 2YWFA 2VKQA 4ITRC 1KMMA 1JFVA 2ACVA 3PGKA 5EJGA 4H9GA 4RFSB 3ZTWA 4HF7A 1JAHA 2TECE 3Q87B 1G8JA 4QDJA 3WG9A 1H8ED 3OT5A 4PYRA 2ZROA 3P2OA 5DTEA 5H3HA 3GY0A 4FGUA 1NBMD 4W4KA 2HS4A 1O54A 4X6UA 4H4EA 4FONA 4LXUA 3EEOA 1H8HA 5I9LA 1S89A 3RC3A 2JAPA 2YW2A 1E89A 2IF0A 2CB9A 5KNDD 4QYIB 1U7WA 1NRIA 2OD2A 2VDNB 1B0PA 4YRGA 3GW8A 4PS1A 2PD3A 3T41A 3GJ6A 1P7PA 2ZTMA 4X66B 3U4GA 1TX4B 1YE5A 1O03A 4G5YA 3ZXXA 2ZF8A 3TZQA 2D62A 3VA7A 4QUHA 3ZHSA 1OYWA 2QZZA 3K1AA 4AICA 2DPMA 1NY5A 4G4ZA 2ATIA 3UV7A 3UT5A 2VNJA 1O0CA 4BV2A 4JTAB 4MS1B 4D9JA 5KQSA 4HTFB 3FPGA 3OU6A 3ANTA 1QGUA 2GZ2A 1VZ2A 4FT2A 2O3JA 1T5HX 2HSEA 4CNBA 3V7WA 1MSWD 1U4NA 2IYRA 3A0BZ 2WPNA 4UARA 2AQIA 4ZGWA 1P9NA 2PKWA 3PQEA 3R7BA 4L4XA 1G5TA 2PKQP 3LHDA 1KE1A 3TTXA 2C9YA 1M2GA 1SIOA 3AKDA 2V7TA 1TFUA 4UCWA 1E7MA 3AF0A 4BEBA 2VQEO 1PP4A 2W6MA 2G1KA 5HDBB 4UXHA 3IEWA 5AVJA 4TXHA 3K0HA 4UBKA 1XVIA 3DGEA 3R7NA 2YS6A 3M4YA 5K4AA 1YB6A 3SJAA 1F23A 1PGOA 1TZCA 1ZBQA 4ZHWA 5GVSA 3R7WA 1JD1A 4CGZA 1YASA 2AYXA 4OL9A 2CNLA 2HO4A 3UAOA 1S5LZ 3R6GA 4MVJF 2LW1A 1L5HB 3FTCA 4JAVC 1JYSA 4KLRA 4EJ6A 3EUAA 2HKOA 1P72A 1Z5GA 3NYQA 4DCNA 1USVA 2OGSA 2GXSA 1BA3A 1N1GA 4Q16A 1YIJF 4AKIA 1UBHS 2NO4A 3EEBA 3F9RA 1ZOLA 1GAEO 1SCUB 1Z0KA 5L53A 2P8SA 2JK5C 3SEAA 1GAWA 4BX9A 4LZPA 4QYWA 4D25A 4IOJA 3TCNA 4HDNA 2O19A 1XZBA 4A0RA 3H9GA 1W57A 4EJ2A 2ORVA 3EAQA 5KVAA 1OZ0A 4JYZA 2QQFA 2VUIB 1EM8B 4NL4H 3JQ9A 1QYRA 1T9CA 1TA0A 3DZDA 1OC2A 1P9LA 3KUUA 3CCSF 3OMXA 4H3KB 2FI1A 4LSWA 1QFSA 2ADOA 4JI4O 3I9V1 1WNSA 3MXOA 2RBEA 4JODA 3C9SA 4Q0MA 4MWEA 5CXSA 1ITZA 4XCXA 1T91A 2XAFA 4Q34A 3MFYA 1G6UA 1RP3B 1B0ZA 3CCEV 5LB2A 2VH2A 5BQPA 1ATZA 6AT1A 5A0TA 4PCUA 3VOSA 3DP9A 1JEYA 1ZX1A 1Y3AA 1RDFA 4LFCB 3ZCUA 3NJ4A 3JV7A 4M0CA 2GCGA 2D0PB 1CXZB 3IMEA 2O4UX 2QHXA 1WW2A 4YAEA 5JQGB 4R51A 4G5GA 1MOSA 1VC2A 4ERXA 3Q2KA 4XX0B 1OXBB 4QX6A 4MRNA 2DTXA 5E9WA 2V98A 2YS8A 3NPMA 3OE5A 2JCVA 5FPSA 3GMTA 2P75A 2OCLA 4F86A 2B5UA 2MYNA 3TKAA 2QRLA 4P8RA 5DM60 2GF2A 3NT2A 3KYCB 1L4EA 2CW4A 3UOAB 4LMAA 3ZZNA 1DTSA 1QV7A 4OPHA 3CXCU 1AB5A 1FXKB 3KB8A 2Q50A 3S2GA 2MWMA 2NPOA 1GTVA 4Y0NA 1NE7A 3KJGA 3JD1A 1K8XB 2KW5A 4EPWA 3QBDA 5KJ1A 3FMPB 2A9PA 1EDZA 3K04A 3GLIA 3JQBC 1RMTA 4JLAA 1LKZA 2CVQA 2RGNA 1VCHA 2B3TA 4AL4A 2DULA 1HFJA 1WMBA 5ICSA 2OORC 1M8GA 4Q4DA 2HFKA 1L6RA 2I1LA 5BOSB 2WJVA 3WGNA 1NYTA 1OH7A 2IC5A 2E4XA 3GIDA 3JQ7A 1VQ8V 4J9VA 5KYUA 4C7XA 1KOJA 4DW8A 4QTTB 1F7YA 5THKA 3HHEA 3ZGZA 4NP6A 5EKSA 4C2UA 5HY2A 2HU2A 1R4MA 1SG6A 1Z17A 2HPHA 3OVMA 1K3EA 5EI5A 4N0EA 3W6PA 2AXQA 4HRAA 1SXJE 4E94A 2NAPA 1Y6XA 1IXSB 4DUPA 1N2GA 4OHMA 4DWWA 2AZTA 1UEJA 2P6NA 5LWQA 3L5KA 3QIAA 4XWYA 5JDIC 1SUEA 3A6DA 4FYPA 1J7KA 4NOJA 3JQPA 4EGQA 4EF4A 1J25A 5J4HA 3DWGA 1IUPA 1HYEA 1XQYA 4KODA 1C8VB 2J59A 2V54A 3NUGA 2PKCA 4LXIA 3HC7A 1ZEMA 1JPNA 4DV7B 1HOXA 4A6XA 1YBHA 4QM7A 2XNDG 3FCXA 1R88A 4E3ZA 1T4GA 3S4YA 4HMOA 5FPPA 5B6IA 4BR6A 4KNYA 2HRDA 1AR5A 1O97C 2B4KA 3BILA 1FFSA 3FLBA 5B1OA 2GZSA 1FMJA 4JVMA 2J08A 4GX0A 1KVTA 3CURA 4H15A 4B3TB 4NYIR 1LDNA 5LUAA 2H6EA 4M86A 5EZYF 1NAHA 2HRCA 5IDWA 1Y3BE 1KJ8A 4XTCS 3GRFA 2A79B 3L72H 3E1YA 4S1NA 3PXBA 2X2OA 4AO7A 1P1CA 1HQDA 3X2SA 5LB4A 4P84A 2HRYA 1QVFF 4JI8O 1R18A 1B23P 5DCLA 3X3HA 1HDXA 4EKNB 2IJJA 4PGMA 5GVRA 4EZEA 3N0VA 3KYBA 1P1KA 3C74A 3WYAA 4RH0A 2JDID 2JASA 5J2TB 5T7BA 2VI5A 4EI7A 3AKZA 3ILHA 4YDQA 1YQEA 2KKWA 3OZTA 1X80B 3EA5A 3G1TA 4KZPA 2X42A 1U3LA 4Q48A 1FLDA 4RJIA 3CA8A 1G8MA 2FSGA 4WBNF 4GAEA 3ZNQA 3NLLA 1N0UA 1SD2A 5LBTA 3KNZA 4IGIA 4DBLC 3EQ9A 4R1UA 3FNRA 1S4MA 5IJZA 4FFRA 4WJLA 1CLIA 2IHZA 1V6AA 2ZATA 4JSRA 2G04A 3S3XA 1P0PA 2AF3C 1Q86H 1J2YA 2IHJA 3GP5A 3GT7A 1TKRA 4RK1A 1TB4A 4HNHA 5BWBA 3AR7A 1D2RA 4IY1A 4GKKO 3B2NA 3AB3A 2RD2A 2VEDA 2AMFA 4RTPA 2D5LA 4COOA 2AB0A 2X8AA 5TS2A 1JAXA 3EN0A 3KHSA 3HB9A 1CLEA 5JROA 1UXIA 3JWJA 4OBEA 3FVQA 2ODNA 3MAAC 4XB6B 3IP8A 2XTZA 4REQB 5KC8A 2BI4A 5L9AA 1UM8A 3ORYA 1R5JA 4JXJA 1KQSF 2XVZA 4K1XA 3I3SR 3DHEA 3B5EA 1M0SA 4ZI3A 4R7CA 3K71B 1NKDA 3H6KA 3B40A 3OQIA 1O6GA 1Q90D 5CXQA 1II0A 3C15C 3H8SA 1L4GA 3SJ7A 2GBLC 1GA6A 2QRQA 5FYDA 4PINA 1RW4A 1ZD4A 1VQOF 4N47A 3HXMA 1FX0B 1VLMA 2YHUA 3AZPA 4CGYA 1NVBA 3NTQA 2GWHA 1F8FA 1T29A 4EW6A 4X91A 1EFHA 2H6LA 5CBPB 3SPCA 4RZHA 2H5IA 1O58A 3WGQA 3OURA 2JGMA 4BJ6A 3CW9A 3NHWA 5LZ7A 4TYNA 3LMKA 3ZWAA 2IPMA 2WIGA 1TZ2A 5F5XA 3CISA 4JCCA 2BPOA 4PRLA 5JARA 3KOZA 1TPZA 3RS4A 3FCAA 4YFVA 2GSDA 3OQHA 4TTSA 2W4MA 1KSGA 2UZAA 4IDDA 1B1AA 2YS7A 2O8BB 4HDMA 3CUTA 4FSDA 4O4LB 4U2FA 5CA1A 1Y9EA 2HA7A 2ZJ2A 1S5PA 2R11A 4AI8A 3R9XB 3L0SA 1X1EA 1R6KA 3LWOC 1XKQA 1SUDA 1QHXA 3PXXA 1E5DA 4K9PA 1JJFA 1PZMA 3LY8A 2JGUA 1NX6A 3QPVA 3BFJA 2Z9CA 4YJ2F 3LDGA 1T4CA 3RRNA 2CC2A 4J3FA 4GCZA 3IAM6 4Z49A 4P5EA 3TIXB 3EXFA 2YWHA 3QO7A 4IKOA 3E8XA 3IVCA 2QYTA 2HJRA 2PUGA 2JJ2A 3CZ5A 4IJQA 4YLGA 1HL3A 1GO0A 3W79A 4CKBB 1TO6A 3BJZA 4XYEA 5DSXA 1JP7A 1WZUA 2QDOA 3SQOA 3BD8A 2XQIA 3WMFA 4W5OA 3JSXA 3B1WA 4H37A 1K08A 2EBOA 3UO8B 2WJGA 3NM6B 2RKWA 3PKIA 4KUGA 4ZHVA 1KBHA 2ZE8A 3UW1A 3W3AD 5IT0A 3V4FA 4WH0A 3UHOA 3WYNA 1AM4D 3SS8A 3RVPA 4URUR 4EGAA 2OO5A 2I0FA 4ZEOA 4C6SA 4GP9A 3EMVA 4TMYA 4UM9B 2E4ZA 2NSYA 2R6R1 4M4SA 4MQFA 1U90A 3JYPA 1TOAA 1R9MA 1DARA 2R7AA 3UQYS 3QOYA 3UHJA 1WPBA 3LT2A 3AETB 2BGRA 1GGMA 5EP4A 3IE0A 2ETVA 3K1TA 1ZNWA 1VG1A 2VC2B 4GM1A 1JF8A 2MR5A 1NXPA 1E1DA 5G0VA 3NASA 4DV1O 4F5ZA 3IKFA 3GJZA 3ZDDA 1QX3A 2FW0A 1QLWA 4AUNA 4QXOA 2VJPA 5LMUO 1U9ZA 1F8UA 5FX2A 3OLVA 1LDGA 3AUKA 4JQOA 3ZWXA 1C81A 2OZLB 2B4RO 3WR5A 1R12A 1DO2A 4U00A 4Y2RA 1OGYA 4K8RB 3U3KA 3PGVA 1QV9A 1SUBA 4KPFC 4OQ4A 5EBWC 4INZA 5F2KA 3EJ6A 4W7IA 4PY2A 3QITA 4R50A 1NVVR 3QUCA 1QVWA 2PFGA 1Y3CE 1T1EA 4BQRA 3WG7C 4X8AA 4WIAA 1JJ2U 4G84A 4R5HA 1FDRA 1H65A 3LVRE 3WHIA 3HKCB 2YWBA 1XDGA 1M54A 1SXJA 3RG2A 1CVIA 2B61A 5IU6A 1Q3TA 3RVOA 3WB2A 3G3EA 1A1VA 2E1RA 2NYRA 5CFRA 1SHTX 1F4VA 1C3LA 3HJUA 1YL7A 3O5AA 4AJKA 1MHPA 5D87A 2RHTA 4YP9A 4F4UA 3R3HA 1VJGA 1MABG 2XRZA 1AJNA 1I94O 1WHTA 4DJDC 1P5RA 5IK2A 3QXGA 2JD1A 4LFBO 3FHJA 4B5KA 4YV1A 5TF4A 4QGFA 1JE0A 1L5OA 3EFHA 3WWDA 2QTAA 3UZUA 4RSRA 1YF3A 2DR0A 4ODIA 4IJWA 5ALQA 2OAP1 4E2WA 5L45A 1V9PA 4FUTA 4GM4A 1O9HA 1GVHA 3SZMA 5HOEA 4UVEA 1C9MA 3MJRA 4NU0A 3ZVNA 4I1PA 2AW3A 1ARZA 1DEHA 1L4HA 1C1XA 2XMBA 3ZD7A 1NBEA 1MD9A 1Y3IA 1JJOA 3FPFA 1GGFA 5A1JA 1B6SA 2I62A 3TLGB 4MRRA 3KOYA 2DYSC 1X1BA 3K5MA 5GOTA 4CKWA 1LUWA 4D81A 1YTFD 2BFFA 1PZHA 3GJ5A 3WFZA 1H9AA 3T35A 3NTRA 4ER5A 4KN9S 1JEDA 2RK3A 3DG9A 3OCUA 4BT7A 2VP6A 2H3HA 3MJFA 3O4FA 3SCZA 4B7KA 3TKYA 3HR0A 3O83A 4E51A 5E3JA 5BMVF 3DWFA 1FUUA 4IW3B 3AU9A 2IITA 3CR8A 5IJ0B 1V8DA 3RSLA 5KOHA 3SE0A 3TE7A 2HIGA 2AUMA 2IXTA 1XMOB 3ZKWB 2B1JA 2FU5C 1DDGA 4WADA 2DKNA 5DHPA 3KJQA 2A5GA 3RQSA 4XRGA 1QIEA 3VNBA 3LF2A 3SQXA 2J46A 4I1OA 4WFFA 3PNKA 4YUVA 3WK8A 4G86A 3TNDA 3OZRA 1GFWA 1AN9A 4TT3G 1CC1S 3E6AA 1DQSA 1C4KA 4ZDJA 2EQAA 5I4CA 2C5AA 3I1YA 4WZBB 1CQJA 2A5DA 1R8YA 2VP4A 1N9GB 1FVFA 4NARA 1GX1A 1DC6A 4ER3A 3O8QA 3L2OB 3G2HA 3L0DA 1E6CA</