3N2KB

Tubulin-nsc 613862: rb3 stathmin-like domain complex
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
428
structure length
420
Chain Sequence
REIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSLTVPELTQQMFDSKNMMAACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tubulin alpha chain
publication title Stathmin and interfacial microtubule inhibitors recognize a naturally curved conformation of tubulin dimers.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Cell cycle
total genus 113
structure length 420
sequence length 428
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
B PF03953 Tubulin_C Tubulin C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.600 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3n2kB03
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3n2kB02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3n2kB01
5FNVB 2BTOA 2VAMA 3JAWB 5KMGA 5LYJA 4I50B 3RYHB 5M7EA 4IHJB 5MN6A 5EYPA 3RYHA 5JQGB 2XKAA 1W5AA 4X20A 2BTQA 1RLUA 4EI7A 4B46A 3HKEB 4TV9B 4DXDA 3JATB 5JQGA 4YJ2A 4X1KB 4ZHQA 5IYZA 5LA6B 4X1IA 3UT5B 3ZBPA 5CA1A 3HKEA 3JASB 4I55A 4O2BA 1TVKB 4YJ3B 5KX5B 4O4JA 3VO9A 5J2UB 4LNUA 5GONB 4U3JA 1OFUA 5KMGB 5LYJB 2R6R1 5J2UA 3WGLA 3JALA 5EYPB 1W5BA 1W581 5LXTA 4X20B 2BTQB 3WGJA 5MN4A 3R4VA 5IYZB 4ZHQB 2R751 4X1IB 4O4HA 2RHOA 5CA1B 4I55B 4O2BB 3N2GB 1W5EA 3VPAA 4O4JB 5JH7B 4LNUB 4U3JB 5EZYB 2XKBA 3N2GA 3HKBA 4KWEA 5JVDA 5LP6A 1RQ2A 5JH7A 5IJ9B 4WBNB 4ZOLB 5BMVB 5EZYA 3RYIA 3JALB 5J2TA 5MN5A 4TV8B 2VXYA 5EIBD 5LP6C 1Z5VA 4M8IA 5IJ9A 4WBNA 2Q1XA 4ZOLA 5LXTB 5BMVA 3VOAA 3WGKA 4TV8A 4HNAA 4EI8A 3RYCA 3RYFB 4O2AA 4O4HB 3C8LA 3ZIDA 3V3TA 1W5FA 2RHHA 3RYFA 4ZI7A 4U39A 3HKBB 4B45A 5JVDB 3E22A 3N2KB 3JAKA 5ITZA 3CB2A 4F6RA 5LP6B 1JFFB 5C8YA 4IIJA 4O4LA 2RHJA 4XCQA 3HKCB 3RYIB 2VAPA 3RB8A 5J2TB 1Z5WA 3VO8A 3N2KA 4TUYB 1JFFA 5CB4B 4X1YA 4EB6B 3HKCA 4FFBA 1SA0B 3JARA 4I4TA 1FFXA 4TUYA 4HNAB 5LOVA 5FNVA 5CB4A 3RYCB 2Q1YA 4EB6A 3VOBA 4O2AB 3WGNA 5JCOA 3JAWA 1SA0A 4E6EA 3M8KA 4I50A 5JCOC 4IHJA 1TUBB 4ZI7B 2RHLA 1W59A 4O4IB 5EIBC 2VAWA 3E22B 4YJ2B 3JAKB 5IJ0B 5ITZB 4F6RB 5CA0A 5C8YB 1FSZA 3HKDB 4IIJB 4O4LB 1TUBA 2GVIA 3M89A 4TV9A 4DRXB 3ZBQA 4O4IA 3JATA 3WGMA 4X1KA 5IJ0A 5LA6A 1RQ7A 5CA0B 3UT5A 3HKDA 4X1YB 3JASA 4FFBB 4DRXA 3JARB 1TVKA 4I4TB 4YJ3A 5KX5A 1FFXB 4EI9A 5LOVB 5GONA
chains in the Genus database with same CATH superfamily
5LM3A 7YASA 4WLFA 1PVDA 2AN5A 4DR4O 2AW3A 1C0KA 4HWGA 2EZUA 5K03A 1KIAA 1T3SA 2FSHA 3ODPA 4MUAA 3QIAA 3IIJA 2ENWA 4NV3A 4UFOA 3E84A 1XN1A 3KJEA 4KCGA 2HP8A 3TD5A 5B3AA 3E4CA 4ZYYA 1UJNA 2PSHA 1FQKA 5KIAA 4UXNA 2Y6UA 2O0KA 4BVJA 1XREA 3UJHA 1ODJA 1KNQA 2JCGA 1E5VA 1QOZA 2ZAIA 2YS8A 4EGFA 1V9LA 1R4NA 2G04A 3DKRA 1CZOA 3I01A 2HZBA 4BJ6A 2I4MA 2WFAA 3SDZA 1PL7A 2H4HA 1AKRA 2FLKA 2BHLA 4PX9A 3UT5A 1PE0A 2C95A 3BKWA 2DT5A 3CURA 1XQ1A 4EELA 2J7PA 1KQGA 3HWRA 2DEUA 1FSGA 4BQFA 1T8WA 2BO1A 3CV3A 1OTYA 4TXNA 2D4AA 1SB8A 3TZQA 3REOA 3QFTA 3UMSA 1KC3A 4KVFA 3GBSA 1CUDA 4BB6A 1N0NA 3NETA 5ALMA 1V3TA 1JQ0A 1IHDA 2AX3A 3TW4A 4Y7CA 5EQFA 2DYYA 4F9TA 1RWKA 1CUUA 1VFPA 3E8BA 4KQ2A 4X8AA 4O4JF 2JGEA 2ZTLA 2ZSUA 4MRMA 2BEUA 3ML1A 3IA2A 4HLDA 621PA 3P4XA 2ID7A 5GJVC 4GZLA 3SS8A 2WM8A 4XCQA 3V48A 2ZROA 1C9JA 1V26A 1H8HD 2YWEA 1OY1A 3VV2A 3QVGA 2IYRA 4GP9A 4LECA 2PXCA 1CVLA 2AFIE 4GE3A 4R7ZA 5A9RA 5IZCC 3U56A 1ILEA 2ODEA 4D7AA 1L3BA 4JLOA 3AERB 3ME5A 1R74A 3MTJA 3NK7A 1RAEA 4XM0A 1M2HA 5DOZA 4RY2A 4UOEA 3A6HA 3KSAC 3C9RA 4CH6A 5EKSA 4DSUA 2MHCA 3CCRF 1GGVA 4D25A 3SMQA 2XCLA 1I36A 2N48A 4HAMA 3W7XA 4WVFA 3G71F 4GR4A 5K99A 1YXMA 2HM7A 4JQYA 5UKDA 2JLCA 5FIUA 1KYWA 2DPLA 3BCUA 3R3SA 3OTQA 2VHZA 4X64O 1EFPA 5LQCA 4YUWA 3E03A 4AJJA 4B3BA 1TQDA 4FZVA 1VJRA 1RABA 5AHWA 3SVLA 5LIRA 3FDXA 4DDKA 1I1QB 1Z34A 4ZC8A 1CJCA 3E23A 4G63A 3E9QA 4GOKA 1H5UA 2ILTA 3EISA 2QTHA 5KAFZ 2ZAGA 1XP8A 2W5UA 1VKNA 4AKIA 2PI4A 4B3GA 4CMCA 5J4LA 3AU9A 4HRYA 4GFDA 5IT9A 1TEXA 1KMIY 1T1GA 4TOIA 2HPAA 5KX5A 2X22A 5L40A 1KH3A 4ZOEA 3UG6A 2WJVA 4AO8A 3H7AA 3FFMA 4E11A 1LF5A 3H2YA 3WIEA 1XQYA 3VQXA 2FR1A 3VH3A 2UVPA 2ZJZA 4UE3S 4HYEA 4L74A 2BEVA 3UYKA 3TKYA 4ZJYA 2JK5C 4TTQA 4M0UA 2FMXA 5JH7A 4BW5A 2W8BC 3IBGA 3CC4V 2A0XA 5HHTA 5CIWA 2AYYA 4BC1A 2I6UA 2JAHA 2VN8A 3HU1A 3AP3A 2ADMA 4PG5A 4GT1A 2FW1A 1P33A 2GJSA 3JYQA 4XWAA 4BX0A 4J75A 1SUCA 3ZCQA 1C9MA 2H9YA 1DDGA 3C3MA 5BY1A 1U0HC 2H6LA 3I12A 5GZ6A 5SY4A 4I4TA 2P9TA 5I9NA 3T3IA 2IP2A 2ZUDA 4IXNA 3PRYA 4GWGA 3RS7A 2WPNA 5JD3A 4G56A 1XTRA 4RBNA 5G41A 4QGGA 4IDDA 1DQSA 3IKFA 4E5DA 4J2HA 5DNVA 1FZQA 2W6JG 1H2ZA 3FVQA 3TINA 3DKKA 1B42A 1SESA 4RTOA 3K9SA 3BAFA 3BA9A 2VGNA 1WXGA 3LC7O 3QF4B 1VQ5F 3EGDB 1Z8DA 2QE6A 3QEMA 1SHKA 4QVIA 3O94A 3DG9A 1HQDA 4ER3A 2HSWA 5P8WA 5GOZA 4PYJA 4PV1B 4QE3A 3VTAA 4ESOA 5A3RA 2VJMA 4RNCA 3B7WA 5SZHB 1PJTA 2B1IA 2QJTA 5KOHB 2BM1A 3V7UA 5BXYA 2QSYA 4DLZA 1V7CA 3E05A 1ULHA 7REQB 2DOSA 2OBXA 3LWNA 1O0CA 1XQXA 4ZVVA 4A8PA 1GGKA 5AVUA 2J9XB 4LFBO 2J5XA 3VHXB 1GO2A 2NZWA 2C9YA 4PTZA 1T91A 3RF7A 3ASNC 5A3JA 3GPLA 2H6EA 4ZVOA 2F48A 4Z9BA 2OM2A 3V1MA 5U1PA 3ZLVA 1GM7A 3ZS9A 4JASB 3PNMA 3FAVB 3OE7G 1ZRHA 4F1JA 3LWDA 3TXXA 2PJRA 5LYJF 4JI7B 4ADSG 4Y2XA 4RTRA 4L7QA 4B4VA 4K0KB 2IGTA 5JQGF 2X9QA 3I2KA 2R66A 4L2IA 3SLKA 1K92A 3QX7A 6ADHA 3KBOA 1OWLA 1VKZA 4NWOB 4MWCA 2QP4A 5H5NA 4RVUA 4EJSB 2BL4A 2GAOA 1JFFA 4X1YA 2EEZA 2ZR0A 2WLKA 3F71A 4K6GA 2F9FA 1VE5A 1T36B 1Q15A 4WN9B 4C2AA 5AW4A 2Q1WA 3U3XA 4M7PA 2C3UA 5EXPA 5KNDD 2QN2A 3HJCA 1ODIA 1PGOA 4MDEA 5F3WB 1B16A 1P77A 5I9IA 4EKIA 1JX9A 3SJZA 2E0IA 4MVJG 1XLVA 3INYA 2Q9UA 3C6ZA 3KFVA 5A4MS 2AOWA 3CCQF 1WY5A 1UCFA 1P74A 2DWEC 1J25A 2ZB4A 2WYHA 1RHKA 1PL0A 1IURA 4QWWA 4TQGA 1PQUA 3SC2A 4X1IB 1CT9A 2FTKE 1ZK3A 1AURA 1U2QA 2J1LA 3W4KA 3OE5A 2F1HA 4EUFA 5AKXA 5IVIA 1NA5A 3TOSA 4AURA 1WXQA 3MAJA 2EW1A 2UXBO 1E18A 4PLHA 4WBNF 2L69A 2F4VO 2X6RA 4MVJE 221PA 4NV0A 1QHNA 1RYBA 2J5KA 4B3FX 3K9FC 3FB8C 5ESXA 4I50A 1UXIA 2NVUB 4UOZA 3GA0A 2NACA 2JHCA 3HJAA 3ZE7A 3JATA 3U0ZA 1O95C 4EPYA 3HU5A 3MJFA 4LY0A 1JEQB 3JWPA 4DR6O 2CE7A 5KINB 1GM8A 1F17A 5CLFA 3ZQ6A 4FGLA 1CF9A 3EAGA 3SHVA 3PDJA 4MW7A 1U94A 2VQDA 1MSWD 1TRKA 1PD1A 1QYCA 3CIFA 3OTOB 1VA4A 1U40A 4LCEA 3ID6C 1ZNXA 3O4HA 3NP7A 4KO8A 1RLTA 2H0AA 4CM6A 2XX3A 4LIPD 1KUQA 5HIAA 4UPEA 5TMEA 4D43A 1UUFA 3WQQA 3T5GA 1U90A 5KYYA 3EMBA 3E61A 3S2UA 2I03A 2V7PA 1ZTEA 3FSRA 3P4UA 5GWXA 3W79A 3QJYA 3R20A 2QLBA 5FI3A 4PGAA 2PZJA 3MQFA 3TPFA 2FQQA 3D64A 1QQCA 4QULA 3OLXA 4RK7A 1Z88A 2AK3A 1BQZA 2I66A 4L9SA 2JEUA 5CDHA 1QF7A 2Q21A 4RZIA 3UICA 3HGQA 2JGFA 2B98A 1J39A 2C2GA 5DCVA 2C5LA 3T1VA 4GBGA 3ZRWA 2OD2A 3MBKA 2H1OA 4LF9B 2BFBB 5G0SA 1MA0A 1DKMA 4K3UA 2D62A 2B6NA 5AKHA 1FBTA 2R1UA 4Y1RA 1S01A 3D4LA 2IXDA 5SZJA 2XAFA 1NXQA 1XPRA 5A6SA 1BKYA 4F21A 4BIOA 4MITA 2WD7B 2IJHA 3O6VA 3ZW7A 3D4NA 1ZUQA 2J33A 4GEKA 2LCAA 1M5UA 1KY2A 1NGSA 1KSHA 1GV0A 3K1AA 5JD4A 4YI3A 3EHDA 3N2NA 2HKIA 4QWMA 2XVYA 1SXPA 1SIWA 4WESA 1AZLA 1KZGB 4E5MA 4E51A 4K05A 2EKBA 1EE2A 5TGZA 3BRWA 3STYA 1GPAA 4NG4A 1GNSA 1LVUA 3AB8A 1A7UA 1Q3HA 4YYZA 2GARA 2LP4Y 5T6MA 4PZEA 1K6IA 2AFIA 2I6TA 1LSSA 1XEWX 4M2LA 1OV4A 4DGQA 2QA4V 4PS1A 3VV3A 1T1EA 4X97A 1ZJ5A 4HZUA 5EJ4A 2YN2A 1RHQA 2C4MA 1NU8A 3WGUA 1I51A 3MW8A 5J2UB 4JAUA 1GM9A 2RGGA 3EJ6A 4CLOA 2QUKA 2A79B 5G4UC 2HJRA 3WFZA 3I32A 1WMAA 1FNBA 3OPNA 5A5GA 5FOUA 2WUVA 4YP0A 1V71A 3FYCA 3PC8A 2L35A 4RV5A 2QVLA 4G2TA 1OIVA 4RZXA 3KOWA 3UMFA 1FTYA 5J1TB 3PFKA 1AQUA 1Z37A 3ZHSA 4KXWA 1XZQA 4ZD6A 4UCTA 1ULUA 2WAMA 5AI0A 4R40A 4NOLA 1IIBA 3LHIA 3A0RB 1UWCA 3BMQB 2NWQA 5E79Z 3ZTTA 1LK5A 1X0XA 3HB5X 3REFA 4E70A 1N8NA 4B6FA 4G1VA 4HD8A 5BOVA 2H1HA 2Z5GA 4IQ4A 4AU1A 3PQFA 1F2UB 2EIMC 4BFWA 2O1EA 1H2XA 5HF9A 1W85A 1ISSA 2YXZA 1K75A 3RWBA 3F6YA 1P7ZA 3C9UA 1Z08A 2W6QA 4DCJA 2VYVA 1VBKA 3A0UA 1NXXA 4CQNA 5KYWB 1Q77A 1G2PA 2QSAA 3MJHA 2H08A 2QJOA 2GXSA 1ZDMA 5CX1B 3NFYA 2PM8A 2OZVA 3OJEA 3UH0A 3THYA 2X9LA 2F93B 4FB4A 4C4TA 1D2NA 1HNZB 1F8GA 2C84A 2JCBA 1NMQA 3PT9A 2WR8A 4ARUA 4PG7A 1MFPA 3SJCA 1AQJA 5K0EA 3PXBA 2YZKA 1EVEA 2UYKA 1YA8A 5CM9C 4FJCC 5JXHA 3L8EA 5ADHA 1GQYA 1ZCJA 2QG9A 4P2GA 2WTAA 1PYOA 3LOUA 1M73E 4YRRA 1K08A 4HJXA 3UC9A 2PXXA 2CL5A 4HN4B 2WY2D 4LF7B 3ML0A 5F64A 2UYCA 1SR8A 4FK8A 1JPJA 4BV9A 1J2RA 1KZHA 3EVEA 4KPFC 1K97A 1KDVA 1F20A 3UHAA 3GCZA 3IDFA 1I7LA 4RQAA 2HREA 1EJ2A 2RGDA 4JUDX 3EXEB 5A2QN 2HP0A 1DV2A 1AUVA 2J3LA 4B7CA 4NYMQ 5FA6A 4BY9D 3AEQB 3R5SA 4AZ0A 3E1GA 2OCCC 3WKEA 1FL9A 3L7OA 1U7ZA 3L8HA 4M0LA 4OQ4A 2IE8A 1F38A 4NWIA 1JIIA 1G8SA 4CEHB 2OUIA 1X1SA 3GQBA 1QKJA 1RXEA 2BDUA 4Z7JA 4LYDA 3NM4A 4MW2A 1P1JA 2C2XA 4JAVA 4KUEA 4MVOA 3A14A 3NT4A 1PKXA 1LDGA 1I4EB 5IJ9A 2ZRBA 1EYZA 2PT6A 2RMKB 3GJSA 1JLKA 5CX4A 1XZPA 2P6OA 1ABFA 2ENUA 4J76A 1EXWA 2I3ZA 3AIOA 5HUJA 3FCOA 1DAOA 4B71A 3SM3A 5KQLA 1OA1A 3HCWA 3PF9A 3R6TA 3FWHA 2QZZA 4MQ6A 4YJFA 2E55A 3C74A 4WXHA 2EG5A 1QWOA 1WKCA 3ASVA 2IPAB 1ZEMA 3JYPA 4BPRA 1GPDG 4MW9A 3H18A 1P19A 4MVJM 4JEHA 4M83A 4D9FA 5LIPA 4DR5B 4ZVSA 2IE0A 1PSDA 1O4WA 4R2HA 3ETGA 1ZJZA 3PN1A 2ZYTX 5KCZA 2ZUFA 1H8ED 1AM4D 3UUWA 4LF6O 1E0KA 2DZDA 3HJRA 5LDGA 2ZQ5A 2PL1A 3ISVA 2Z3WA 1A7AA 4ZOLA 3EGEA 4X71A 3S28A 3L1JA 4A0SA 3GGSA 3IVGA 3WISA 1AV6A 1X7DA 4D82A 4OXSA 4WY8A 5ELXA 2Q41A 2C3YA 4CYMA 4WI1A 4BVRA 3F6EX 5T4BA 1UJ2A 3GJQA 4PG4A 3Q98A 5LQRA 5FV4A 1RXUA 1YACA 4JLBA 3WKAA 1VBMA 1UMCB 5FTWA 2AUNA 1X7XA 1QTRA 3U40A 2XVXA 1PPJH 3CLTC 4F3TA 1Z6GA 1PL6A 1WUTA 2RH5A 5TRTA 5CDYA 3LHFA 1Q1EA 4ZJPA 1XRLA 4O25A 2O6HA 4LXUA 1BXGB 2PKQP 2HADA 3QMVA 1FMCA 2FCRA 3T1OA 5EESA 1VQLV 3L7IA 1BHSA 4HDNB 4YO8A 1PR3A 5YASA 4BBAA 4EL5A 3W7UA 2R0QC 4TX1A 2FTKA 3NGLA 3K70D 3EIWA 4XBFA 5FWYA 1WJGA 2B92A 5I7RA 4DJAA 1QIFA 2NO1A 1XNQB 2PTHA 1XHZA 1O96A 2ZR2A 3L8MA 5F1YA 1V1MA 3D8NA 2DHRA 1MKYA 3ZK8A 2M7WA 4Z1MD 2RFLA 2FZEA 1R9JA 1E1RD 3QFSA 3V1TC 4TMWA 5LOVB 1V3QE 4ZO6A 4HLQB 3R41A 1DL5A 2D2EA 5BXQC 1JHRA 5HUQA 1SKMA 1IQPA 3T2MA 5I7WA 4JL6A 4E2FA 4P0QB 3THOA 2J4FA 5AM4A 1KK1A 2I9KA 4UE2A 4HI0E 1XRMA 1M66A 2ID9A 4KPGA 3MELA 1WJZA 2ZI3A 4JI8B 2G40A 2BRUC 2HSEA 3QX9A 1IEWA 3TM5A 4H18A 2BHSA 1L4GA 2HFJA 3DAOA 2X42A 3STZC 3N0RA 4KNVA 1VDMA 1YH3A 3GB7C 1X77A 4XXHA 4KL8S 3SC4A 2IELA 1UAGA 1KORA 1PTKA 2Q1UA 1IWPB 1CXZA 3S5UA 4RCVA 1QOQB 3UAOA 2FKNA 3VOSA 2WIGA 5C5CA 2PH3A 4IBOA 3DWGA 2PL5A 3EORA 4DUZB 1ZSPA 2MQEA 3OPXA 4BR6A 1VQMV 1P72A 4KXYA 3OZXA 2FX3A 4QUJA 3HMKA 3ZHQA 3SQLA 2ZE5A 1SG0A 2RJNA 5KYKA 1I1HA 4EHJA 1RJ9B 1ZMBA 2AQ8A 3RYHA 4C30A 1GNTA 4KN6A 1FFEA 4ZKEA 2R00A 2AN3A 1XDZA 3DNPA 2OWOA 5T8KA 3M2PA 5KQSA 4BT6A 4H27A 1EK0A 4L6CA 3LL7A 3G2IA 1ECBA 2V4DA 3D2AA 3OZGA 2CMFA 3ZLBA 5DHPA 2UZ4A 1I6MA 2HMTA 3WLFA 3HYNA 4AJOA 3SNHA 5LB2A 1UBCA 4NZYA 1M67A 3THXB 4QZVA 2UU9O 1SZQA 5DBHX 1QIMA 1V25A 1ZVKA 1YXBA 1CLEA 3RFRA 2OHVA 1US8B 3JQPA 1HT1E 2CF6A 2VK4A 2E5LO 4US1R 1YIJV 3PQ4A 3OZ7A 3B5IA 4O33A 2ZIFA 1T0JB 2GRUA 2IEYA 3VU9A 4JB2A 5EE1A 4TLLB 3SYCA 3ZLTA 1JE1A 3H84A 1UKZA 3OKPA 3PRHA 4BC0A 5IT4A 1Y1TA 3VO1A 3K0FB 3LC1O 5B66Z 2ZKLA 1LPNA 3A0HZ 3OQHA 3UPDA 4FQ7A 2N3ZA 2WMNB 3EXG2 1HTBA 1QIKA 3OLZA 2AZXA 2XYRA 4QYIA 1Y1RA 1JMKC 3L1KA 4KR0A 2VUIB 2Q7HA 1ZR4A 4EZEA 3IULA 1DEAA 2WJJA 3MMPA 2UYGA 1D2CA 5IHXA 1VIDA 4J7UA 5ALEA 5ALDA 4D9CA 2H29A 4FQ5A 4RDCA 1WHTA 2O4UX 1BCCH 1F48A 1KZ6A 4RPIA 3A1CA 3FPJA 3ZZ1A 2XZTA 3BOSA 1IY2A 2ZI6A 1VLVA 4FLWA 2A6PA 3VPSA 2Y66A 3VISA 3A8TA 4NK4A 3UM7A 8OHMA 1L4NA 1T3HA 2E7ZA 2R48A 5IY5B 2CFSA 2V58A 3K9HA 1NRWA 1NW9B 1H3EA 5AKZA 2IX9A 5LJIA 2VUUA 4W7IA 4HX9A 1ZM9A 4WCDA 1D7OA 3OTGA 3TF5A 3VYTC 3OUFA 2FZLA 4LPSA 4FHCA 4PYMA 1E1DA 3DW1X 3WBBA 5FAXA 2F23A 2PUVA 4UCXA 1HYEA 3Q7IA 3PK0A 4LW8A 4JI4O 4K2AA 5HKOA 1XI2A 2YJ4A 4RHEA 5EHXA 2VGMA 5JUWA 3LBHA 2ZTSA 3MILA 2J59A 5JWHA 2QRUA 4WZAB 1NATA 4L27A 2XGOA 1U28C 3HCEA 4QECA 3RU3A 2FPUA 3T94A 2PTMA 2IV3A 3CVOA 5EKUA 2AE2A 3RUCA 1RP7A 2PKXA 1O57A 1Y6JA 4CG1A 4LJ6A 1BXZA 1PX0A 5FTJA 3EULA 4LXQA 3WGVA 3D8RA 2WUEA 3SM9A 1VPVA 2C4UA 5E4FA 1TIBA 4AG3A 2JASA 3NOXA 3VTKA 2LKCA 3KVNA 1TKRA 4WCFB 1NU1H 1YR9A 3CEMA 4YMVA 2MW2B 4JJFA 3T7SA 4OHXA 3C8UA 3HJFA 2B35A 1FLNA 4P36A 2J0VA 2Q49A 4DQ0A 4P32A 2NTEA 4P6VF 4WFBV 1NF8A 3G5AA 3EOAI 4G28B 2ZVJA 1RI1A 3SEQA 3KPUA 1TKBA 2QI2A 3V7QA 1NW5A 5FWXA 2WF9A 1TZKA 1KEZA 2Q1TA 4ZIRB 5IWAB 3RSHA 1GDDA 2BFEA 4LK2A 1I5YA 2QV7A 2VPQA 4OEHA 2Z6AA 3C6YA 1ZIPA 3DEHA 3FUVA 3UJBA 1ZLZA 3I7TA 1SCKA 1OROA 1Q7YW 1JS1X 2P90A 4NS4A 3EN0A 3T5BA 2IKQA 4IGFA 4QM7A 3I53A 1LBIA 5ILGA 2PH7A 3P9XA 5JMPA 4C21A 1D0VA 1Z0AA 4KWCA 4N5IX 4QBIA 1A7JA 2GD2A 2OBNA 3U61B 4RV9A 2PCLA 3KV3O 1ORWA 3IIKA 3OOWA 4RD0A 1T9DA 1NYLA 5I5EA 5KA6A 2VCEA 1K3EA 4FMDF 4X3LA 4QUBA 2HGSA 4BCCA 4J43A 1JHVA 2A5JA 3ZVKA 3ZCXA 5AFSA 2QORA 3VH2A 3E81A 4WFHA 1M2OA 1EXMA 4BASA 1J6UA 2OD9A 4Z9YA 3ZKAA 1DX6A 2XTMA 2WNIA 3G7UA 4NE7A 2N9UA 3ABZA 1NKVA 2ECPA 1LDEA 1Q3EA 1T2UA 5C46F 3Q4HA 3ZU6A 2PWPA 3MGAA 4YJKA 5F7OA 3SBDA 2DF8A 4DG5A 2HS3A 3BJMA 1T0KB 1WG8A 2ZXEA 5DXFA 1SS3A 3E20B 5LU8A 1DTWA 1L2TA 4HEJA 2DMRA 3KTAB 1RM5A 2H1SA 2QM4A 1CRQA 1QQ7A 4HYOA 1R5OA 4QTZA 5DECA 5A2QM 4PONA 4PWTA 4RDHA 2AHYA 3A2NA 3G71V 1U1IA 1L8DA 4ROSA 4TXLA 3GG9A 4M87A 3EA0A 4KQ6A 3T1HB 1EFUA 5EMMA 3QNMA 1T4MA 1W75A 3CJRA 3KOYA 3TWOA 4GBMA 1OVGA 4OHOA 3Q0IA 4HCJA 1GADO 7ABPA 2I29A 4H6PA 5DN9A 3UO3A 3W78A 5L4LA 1BWQA 4ZDWA 3SJQC 2GUWA 1WBJB 1CUAA 4B7AA 3MHTA 1R5NA 2WU3A 4Q02A 3ONFA 1SBIA 3ZRSA 1SD1A 3VMMA 2J0UB 3P9RA 5JJBA 1DKNA 4RJTA 1BYUA 3O83A 1FTGA 4OFWA 1NASA 1TLFA 1ZUNA 3O9ZA 1XEAA 3W5UA 3LT4A 4KQIA 2AA3A 3OZWA 1WP8A 4Q37A 2YTZA 5MN6A 3EUEA 4CCYA 5F2VO 2C07A 2R86A 4NTWA 3FPLA 3V7YA 3TAHA 5LHGA 3MXOA 3MCUA 3NJ4A 3NR7A 4TZ6A 2R8YA 3ENVA 1VKRA 3IL2A 4X63A 5GJWC 3WJAA 1ZZGA 2YNMC 4OSEA 4MWEA 4IILA 4I9WA 2QR3A 2AKYA 5GGYA 4F5WA 3L93A 5ADUS 1J9EA 1HE3A 2WJHA 1QYXA 1NVGA 4OMCA 3RAFC 3TH5A 3KETA 3R1IA 1ZS9A 2W2LA 3ORRA 1X8XA 1HNXB 3CG6A 1H4QA 2DYSC 4S1VA 1S5JA 1RMYA 3LCVB 1UBLS 5A2QA 4BLQA 3GC6A 4FCVA 2F1JA 1Q2XA 5KOJA 1OBOA 2CL7X 4UJ5A 4ALKA 5JVDF 3A4MA 5C8ZA 4PWZA 4BRZA 3U0BA 1BCRB 4OHWA 2O8BA 3EF0A 3QJGA 5EIEA 4MYTA 1N1DA 5ICEA 4QNMA 2RNBA 3IX7A 1FLAA 5DB4A 3QP9A 4AYXA 3HCNA 3KPVA 2DSTA 2OHWA 1J8VA 1G5PA 2W6IG 3M9XA 1C3VA 3LVBA 2Q4TA 3UFXB 3RRYA 2QKCA 4IWYA 1XRRA 3PXAA 3CO5A 1IXKA 1COWG 1XKQA 3RWOA 2MSNA 3TMYA 2Y9MB 4G0YA 2G9ZA 3AO0B 4L8JA 4AQ7A 2UKDA 4HLUC 4ZQEA 4C4AA 4ARVA 1SCIA 721PA 2L82A 4IQ8A 4Z0TA 3DVLA 2NXNA 1A4IA 2HKOA 5EP4A 3LQYA 1CLIA 4UD6A 1QE0A 3I9MA 3D54A 5KTTA 2VHEA 4JP2A 3IT2A 5HBGA 3EWAA 4LJAA 4LRXA 3QI2A 1UOEA 1J24A 3QLUA 2WABA 2JJ2D 4DIDA 2PPLA 4G4IA 3SWWA 1IRIA 1DEHA 2HFKA 1KYOF 3PEYA 4I9HA 3P3NA 5A2GA 3U7IA 1WD7A 2P5TB 1K0FA 4RFSB 1ODEA 4EB3A 3IAS6 3R0XA 1J07A 1RZRD 4C4WC 2IZOA 5DK4A 4O08A 4Q15A 4WXYB 2QY6A 1P2GA 3G89A 2VXCA 3MJTA 1UBOS 2BOVA 7MDHA 3K6SB 3EXHA 3FFQA 1EGMB 1UJBA 3KQWA 3IXLA 2C03A 2CFCA 5E1AC 2W6NA 2OO7A 4AF8A 2P2ZA 4OXXA 1K7SN 1S2MA 3R6DA 2ZM6B 3P97A 5IBCA 2XH8A 2OLEA 3HBJA 2E4UA 2R8XA 2BMFA 1YQDA 2HMAA 4E7PA 1UZAA 4ZKIA 4LF4O 4PN7A 3THWA 2FF7A 3CMAF 4DJJA 1NJ8A 1PG5A 4ERNA 4N3BA 3B1YA 1ZIOA 1P17A 3LNMB 3CCQV 2WHRA 1G8KA 5I4CA 1TAHA 2ZWAA 2X5KO 4JL8A 4MVUA 4YRKA 5BN4A 5C52B 4DZZA 1X1QA 1OIXA 1RPOA 4Y3UA 2B4QA 1NBMD 2CBZA 5ENDA 1PW5A 3WYAA 3USCS 4G5FA 4RTJA 3FRHA 5LP6A 2IH2A 5CJPA 4YAJA 3O3MB 3W9BA 4NNJA 5BZBA 1R5BA 4NB5A 2ERXA 1NC3A 4HTAA 5AHRA 5CYGA 1L4EA 1K5DA 2VPTA 1KMNA 1EVYA 5K7SA 3RAEC 1NQAO 4FIDA 1ULZA 1PJ2A 3EIQA 3M6MD 2GN0A 3JD3A 3Q9NA 4CDMA 1KNJA 3M84A 1BQ4A 5IM4F 1Z17A 3H5OA 1YJ9V 2JGNA 3MWYW 2XASA 2B1QA 1QVAA 3PF8A 4PNZA 1QRUA 4RE5A 5MF6A 3R0PA 2ACEA 4DVJA 1KF0A 3ZHCA 5LBUA 4YGYA 4MV6A 1AH2A 5IJAA 1GTOA 2XB6A 5HM8A 4DXWA 5EINA 1N1GA 3PX2A 1DKQA 4PLTA 2ON6A 5EE0A 2WA3A 4X54A 2RGUA 4UC0A 3NH9A 4Y2JA 3HVJA 1WXXA 2ZE7A 2COUA 5FLEX 3ONEA 3VUEA 3FDIA 3EFFK 5J2TF 1UM9B 3EG9B 3JAKB 3OCVA 1QGED 3PPWA 1LU9A 4PY2A 3NAGA 2ERCA 4UV8A 3DBHB 3E7WA 1N3LA 1T1JA 2C00A 1UPFA 1QMGA 2PWZA 3AVVA 3GFFA 3G6EF 4M1SA 1S9DA 1MPTA 1K4MA 4R8SA 3NWBA 4OPMA 4H7FA 1S5HC 1UANA 1O6BA 4GRDA 2MMGA 3QPWA 3R3WA 2PV7A 5TE9A 4RLSA 1PBNA 4ABMA 2NTYC 2OORC 4J7KA 2G9VA 4GM4A 2CLEB 1CETA 1HY3A 4YUAA 1T2FA 3F6RA 4UCSA 3IQGX 3HP1A 4G4ZA 5LXTB 3GOHA 3EPPA 4BVEA 3H8JA 5HK8A 4OXKA 2YYZA 4MYSA 1QLHA 5BSMA 2ZJFA 3BK2A 5FBLB 4M1QA 3VZDA 2RONA 2FPIA 3Q88A 5GAJA 3CFYA 3IJEB 2XNSA 5CB4A 1GA4A 3ABSB 3EXFA 4O29A 3VR4D 5J59A 5JAQA 5TS2A 2D0DA 4B32A 2ZIMA 1KWKA 4PNHA 5FLXM 1H9CA 3M1AA 4KO2S 3TMKA 3ZE2B 4I9NA 3LFTA 2PUWA 2Q28A 5D1HA 2FE1A 3A6JA 1GU0A 2HTFA 2DR0A 2CZQA 4MGZR 5IYZA 1Z07A 2D2CB 1TUIA 3QTTA 4PM4A 1EFHA 3UUFA 4TZKA 4RPHA 4A03A 2A59A 2HWKA 4M0EA 2BI8A 4U8HA 3T3PB 3VPAA 1C30A 5E1DA 4R3NA 1D03A 2BTEA 4M8IA 3RRMA 1NUAA 4I3HA 4JUAA 1JVMA 2ZQZA 3LY8A 4JYAB 4MLPA 3G5MA 4MX8A 5KWIA 5KTYA 4KV9A 4UXHA 3H11B 2F43B 1PJCA 4C20A 5JJCA 1IXSB 1RP1A 2ZYGA 1GAXA 3IHTA 1HRKA 5D3MA 5JYDA 3PC4A 3FF4A 2O59A 5AJXA 5BRAA 5FL7A 3LU1A 4P84A 4BXOA 3H3XA 3QUCA 1JRLA 4GC9A 4JJZA 4CTKA 1LS6A 3U9SA 2BJWA 2HZ7A 4Q3DA 2ZJ3A 3GFGA 1V5WA 1X7YA 3T1YB 1B74A 1NJSA 2OXIA 3JPWA 1XDGA 2D7CA 2H06A 3JQBA 3AOGA 3VO9A 4AKSA 1YQEA 4R6WA 2Z8YM 4ZYLA 2AUTA 1PJRA 1KP9A 3R40A 2Z30A 5H3HA 5EAIA 3YASA 2GEVA 2P3LA 3A70A 4C0JA 4FJ2A 4JOSA 3B4SA 3W7VA 4MPJA 1USVA 5H81A 4YHHB 1NTOA 2AZ4A 4FR0A 2JLRA 4HEA1 1SOWA 3E7PA 3Q8XB 4UEKA 3EARA 1YZQA 2XQFA 1EBOA 2M6RA 2BFWA 2VHWA 4DBLE 4RK0A 5HIIA 5I4BA 3JWHA 5HKLA 3UB4A 2G9QA 2GN1A 2VUSA 2HS4A 1IPFA 4I1YA 3BJZA 2VRZA 1ZIYA 5TT1A 3R7WA 3CSDA 5JRDS 3WYCA 3P96A 3SZMA 4R8RA 4JCCA 4MUBA 2WA4A 1GCOA 3NEYA 4HUQA 1TAGA 3RFTA 1Z47A 1SBTA 5IAKA 1J49A 1JZQA 4U2DA 3VNSA 4P83A 3RS4A 4FSDA 4R7TA 2OQVA 2YIDA 1MEEA 1NDQA 4MQ5A 4GMKA 4RY9A 4J4TA 2C92A 3IIIA 4II3A 4EG3A 3E7XA 2VC2B 4PR3A 4U3JB 4RPGA 3KYCA 5AM1A 4C8EA 4IMPA 2B4RO 1Z0JA 4QM6A 1WL8A 1OFTA 2QNBA 3RD5A 3PTZA 2OTJV 2R6ZA 2DQ3A 3EPHA 4J0CA 3W3AA 2AC7A 4DLRA 2OBFA 2ZYVX 1VPTA 2YWBA 4DDHA 4RMNA 3OECA 3NYWA 3TJZA 3W7TA 5TPZD 3MS4A 1Q84A 2W6IA 3LPLA 3RT3C 2QVXX 1SVUA 3ZJUA 3W06A 1BHBA 5JOQA 3K09C 1OJLA 2Z8YA 1AVTA 4FOOA 5AQEA 5BPHA 2QTAA 3RUPA 3TFOA 4J10A 4UU7A 1COWA 3W90A 4PYIA 3WR5A 5JJNB 2QX9A 5A9SA 4DFDA 4X20A 2LV8A 1HC7A 1ZCFA 4W4LA 4MVCA 2GSMB 3NBZC 4JS0A 2ODQA 2VF7A 3QZUA 1PNTA 1J97A 3T3NA 4OUKX 3AETA 1FY2A 4EYKA 3IR7A 3JD2A 4WH0A 4UHFA 3L0DA 4JYZA 3DFFA 3AKDA 3MGBA 3PJGA 4DM4A 1M8FA 1OZ0A 3AM4A 2B1JA 4Y2TA 4OK3A 5JALA 4V0QA 4PLCA 4O4HB 1Z56C 3GWKC 5DN6G 1XZHA 3EDCA 3U4HA 4DDUA 1LTQA 4M9RA 3QO7A 2V5AA 5HCUA 3WKCA 1HDXA 1CQWA 1GY8A 3QA9A 4TUYA 2FR0A 1T2DA 3AFHA 2GWRA 5DLQC 2F4NA 2JD2A 4WGGA 1B6SA 1QF9A 1Q0LA 3DGEC 4FFKA 1CE8A 2YXEA 5FI1B 3LPAA 1U9JA 5CFOA 4EQ6B 5CDTA 3IMPA 2A4MA 4IF4A 2YWGA 4IMJB 3ZZTA 2XUGA 1XQ6A 4GX1A 3JASB 2DSNA 1NLZA 3HL4A 4G41A 3I3SR 1RXVA 3T3HA 3CC2V 2JANA 4NFLA 1G42A 2IPXA 3C16C 1USIA 2HJVA 1JD1A 5F21A 4ETMA 4QNNA 2ZWIA 2JRIA 1FXKA 3REQA 2D5CA 3ANMA 1KJWA 4CCSA 3CVVA 4GL2A 3OUUA 2D7JA 3H13A 4C3ZA 4FMTA 2OKGA 2JLYA 2X5XA 5EE3A 1EJBA 3CKLA 4UHEA 3ESDA 3M8AA 1JWBB 1QU2A 2F95B 3ZXIA 1I7FA 9MHTA 3EIOA 3ZV4A 4J3NA 4EA9A 3T6KA 3K9LA 2Z2ZA 4LFAB 4QT4A 1U3DA 3BHMA 1JFLA 3BXGA 1F7UA 5IS2A 1H2BA 4BLOA 1LJUA 1CB7A 1XWIA 5EC8A 4CS4A 2H3EA 1DAPA 5DGTA 1JJVA 1J90A 1GTVA 4OQDA 2X0KA 4C3VA 3EMKA 4D8XA 5AI4A 1SQGA 1YB7A 5HIMA 2ZGVA 2QOEA 2QUBA 2JS5A 3SPHA 4E5UA 4M1ZA 2X5OA 3WLPA 1FRVA 1PJSA 3KPYA 5HUHA 3LY9A 1S2NA 2B0CA 4TQ9A 5HWSA 1W5FA 1PP9H 4RAOA 4JI3O 4UAGA 4YFVA 5EE5B 3VTIC 1ODCA 5DGXA 4ZOBA 3H17A 1GPBA 1L0BA 3IILA 1F5SA 4M8NE 1I2BA 2M1ZA 3PNPA 4YC7A 1AS2A 3LJKA 4JR1A 5K5EA 1MB3A 4GPTA 2ZULA 2QJRA 4HTFA 4FSHA 3WE7A 1DHTA 3K57A 1GAQA 1O6FA 4LCBA 1V5EA 4O2RA 3UT6A 4EFMA 4JI2B 1SQXH 4IG9A 4XPIA 3U16A 1NVVQ 4A36A 4R16A 2G28A 1HLPA 2NPIA 1W29A 5LHHA 1QHHB 3IT0A 3LUCA 2CJXA 5BR4A 3QO8A 5F76A 1RZ3A 2UAGA 2ZJ4A 3FUCA 4G0ZA 1JVBA 5KZMB 4A8JB 2PUEA 3H16A 5B30A 1WZEA 3D3WB 2G9UA 1NSFA 4MS1B 3QNUA 2GEDA 2EJRA 1ZNWA 2HW8A 1JILA 3ELYA 4IOJA 5F1OA 1KEPA 4O2AB 4Z2YA 4TMXA 1H4SA 3WFJA 1VJ5A 4UDOA 5JCXA 4PBRA 2YI8A 1DIAA 4K88A 9ATCA 2IBMA 3UANA 4W1PA 3L18A 3TBHA 2WJAA 4L5AA 2HHHO 2Q3LA 1W4CA 1G5FA 1UMKA 4B46A 2XB9A 4ZQHA 3EPJA 2BOBC 3ZDZB 3CE9A 4Y98A 2R6GA 1HE4A 2VF4X 3JQ8A 3A06A 3MHHC 5JS8A 2O6LA 5AOBA 2PF4E 1IOWA 3ZN2A 3TX2A 6CHYA 3L7CA 3OSZA 1JR6A 1HL3A 5DTJA 3QYAA 4NFSA 5A4JA 3GRPA 2Q1XA 4IQ0A 3VBCA 2ACWA 4AJHA 2RIRA 1IN7A 1XHLA 1BFKA 3CZRA 2B82A 2XYQA 3VO2A 3H1AA 2UYJA 4KIUA 4G0MA 4AWXA 1QAMA 3DO6A 3I9NA 2BF7A 3C8ZA 3CG4A 3RSFA 1GWNA 3MB8A 3DP9A 2D13A 2X1LA 4FZ1A 2E85A 5C37A 1XO1A 4KUHA 4QOFA 5IDWA 4FFBB 2Q4OA 3N2ZB 3DTUB 4RFLA 1QWSA 1NPYA 1P2FA 1YE8A 4GC5A 2BGLA 2BMEA 2D8MA 2FMIA 4ZJZA 2BFMA 2FUKA 1YVUA 3DVAA 5JPIA 3AKCA 4C7BA 2G25A 2OA0A 2J3KA 5CFNA 2MYPA 3BEOA 3U7HB 2MSKA 4PPFA 3EIEA 3CC8A 4HRAA 2JCXA 3UMVA 1ZONA 2CVPA 1K4DC 3GXOA 1IV2A 1JQDA 4OGKA 1O9GA 3T7IA 3ZDQA 4Q82A 1R0ZA 2OZPA 1Z7GA 2FWPA 4CM9D 3RRFA 4WXRA 1UFOA 3ZP4A 1YZVA 2CZCA 3QF7A 1SCDA 3V7NA 1O58A 3F3SA 5EPUA 4MQFB 2CV2A 1VDZA 2GCGA 5THXA 5CW2A 1DJMA 4D8WA 3APOA 2Q9LA 3K94A 5FUWA 3Q4GA 2O3RA 5FXMA 3AVYA 2ZJBA 3TLZA 3MB5A 3CTPA 3M5CA 4R1MA 5C1OA 4TWZA 4K9RA 2ZINA 3WNVA 4J16C 3N0XA 2AI3A 1N78A 3M9WA 1L5FA 2VZLA 3SSMA 4B7XA 1ENYA 4X8HA 5GINC 2OYRA 3FKQA 1TX4B 1O89A 3NBXX 1FXHA 2A5FA 4YHBA 3H1IH 2BKXA 1MX5A 2BH2A 3Q85A 4N5DA 3Q11A 5DW0A 1NN1A 1J56A 3M6UA 1CEYA 3NZEA 1OLXA 3LKDA 1EHIA 2Q8PA 1RSOB 3G5LA 2QVYX 4UUNA 4TQFA 3TPZA 1FMJA 2O23A 3TW6A 1EFVB 1C9EA 1DF5A 3T7TA 4Q4HB 1MN6A 4INOA 1R1MA 1DXYA 2JFWA 3MRXA 2ONJA 3HZHA 3PI7A 1MB2A 3TI7A 2J9YB 2KS6A 5C9ZA 3I2GA 4BB0A 4RK1A 3P9QA 2YS7A 5F1KA 4BWFB 5CA0B 3KAJA 3F5TA 3BFXA 2VAMA 5HDBB 4E14A 4PZZA 1PU2A 1KC8W 4NENB 2RIPA 4I7EA 2AMJA 3EOBI 4BJ1A 4G9GA 4TTIA 1DAHA 3G2LA 1KGDA 3MMNA 4F71A 2E6UX 4L5YA 3NHUA 1SC9A 4NV1A 2C3OA 3BULA 4KQ9A 2FSIA 2IYLD 5K01A 4CKCA 2CXSA 2ZJ1A 1SWVA 1U3UA 5IKXA 2XIJA 3IURA 4CQMA 3L74H 1N2XA 4HSEA 3MK31 1N3IA 1XPOA 1NUTA 2GAAA 1NW6A 1IH8A 5CUQA 5KAIZ 2GN2A 4EHHA 2ZRAA 2R72A 2N42A 3C39A 3MPOA 2O2DA 3KR2A 2WUWE 1OCCB 3PNLA 2V7BA 2VWQA 3ZCUA 4ZAVA 2DUNA 2JRLA 1JX6A 2ZCUA 5B1IA 3E48A 2A33A 4TM7A 1OGIA 4D7TA 3NTXA 2Z08A 4CC6A 2W4QA 1YCFA 3C5HA 4G4YA 4D1YA 2BTOA 4U2CA 4X91A 2ITCC 1GNRA 3SIXA 3W2FA 1JDTA 1SHZA 1GCUA 4Y2YA 4RZ2A 5C7YA 3UW1A 2WI8A 4H3KB 1MMMA 1DWOA 2EP8A 2OTMA 4WMLA 1U9IA 4UARA 3LTNC 2R9IA 5DN6A 4DMRA 1UQTA 5I48A 5ICCA 1NRIA 4RD6A 5IMBA 5E9JA 1XD8A 1H22A 2WU8A 1U1FA 2W6JA 3RHSA 2UYNB 3HSYA 3T9AA 2FE4A 3I73A 3ZCVA 2V5UA 1N92A 3J81k 4OH7A 3PC2A 4ZA2A 2QRQA 4I1RA 1FDVA 5CU7A 2B25A 5TGDA 4D9BA 3AGPA 4M7WA 3COWA 1MVNA 2XCQA 1A9SA 2C7BA 1AROP 4CG0A 1AXGA 1YB1A 4BAGA 3FB1A 3OUSA 2QL6A 1IAVA 4JHLA 4MVMA 3G23A 3GGPA 2QLMA 1IWBB 2P77A 2WLIA 2FSUA 3LUGA 4QHSA 3DC6A 1PWXA 4YJHB 1X1BA 3OGIB 1QDLB 2YIAA 1ACJA 4UCWA 5H80A 1VKJA 5B58C 3GUZA 3IQIX 1K9MH 4F4IA 3IHKA 5CMUA 3QOWA 2XUMA 2AUMA 1OWOA 4CEJA 3USES 1DO2A 1FUIA 1M6EX 4PXAA 2ZSFA 3T12A 1LW7A 2PX5A 3ASZA 3BB3A 3HWWA 2YEVA 5EC1C 2Z2YA 3OE7A 1UMDB 3WWOA 4HEA6 2FSGA 5HGJA 2J3EA 2X6TA 4OU4A 4LVCA 3OJOA 3HB7A 3QVVA 3SX4A 3HMQA 4IHJA 3I2JA 5F3RA 3ESBA 4BNMA 2GCOB 2DBVO 1M1ZA 5JARA 3C3YA 3UV6A 1QHGA 2XVZA 1ZC3A 2YC4C 1WB8A 3DCNA 2VQFB 2PKQO 2EYUA 4Z3DA 1ZHFA 3CBQA 4BVBA 5AKKA 1NR7A 3LXXA 4ENPA 4B76A 2WJ3A 1HLGA 3GJ4A 1NDHA 2R5FA 2A3QA 1VLQA 3ESJA 2TECE 3WGLA 1V39A 1SN7A 3OCXA 1ZMXA 5I3ZA 4TMTA 2HNBA 3WMEA 2HLDD 3WK9A 3DMTC 4LZNA 3QU2A 1QR8A 3ZK9A 3DMHA 4MVJA 2M98A 2I62A 3E2PA 5TX7A 3GDFA 4N48A 1ZWIC 3V3TA 1BC5A 1EP1B 1NRJB 4C0KA 2NAPA 2AN9A 1KC1A 5DPMA 2DWCA 1Y5IA 2YH2A 5F5LA 1QX4A 3IS3A 3G1TA 2WB4A 2WJ6A 1GN9A 3N6RA 1FJHA 3WIUA 4BNXA 3CYFA 1LBEA 3DPSA 1IULA 4DLKA 1Q1BA 4XGNA 5DMHA 4JI6B 3IKMB 2YC0A 2IDMA 2X3YA 2ZVPX 4GVLA 3PFNA 2I4TA 2ANCA 5HFNA 3CKMA 2EJUA 3TLCA 4JJEA 5CJJA 1YTFD 4WY5A 2BOCC 1R73A 2R4QA 2NV0A 1BCSA 2YYEA 2ECFA 4DA0A 4RK4A 3KXDA 4R50A 2DKNA 1A4UA 4YONB 3PFBA 1JAIA 3I30X 3H1JH 4HWOA 4B6RA 4R1SA 3WTBA 1U3FA 4BIZA 2CWDA 3E2EA 3OF2A 4GXNA 4MKXA 4YJGA 2MU1A 1JEDA 4L0QA 1SZCA 4A5UB 3V00A 2AIRA 4MWSA 1GITA 2ZR9A 1YQQA 2BSKA 4MW5A 3HUDA 2X0DA 3FWYA 2Q3MA 3P4YA 4V0SA 3V6MA 3CMAV 1IRXA 4L0MA 2F3QA 3BIWA 3D8TA 3E8SA 1IAQA 4BVAA 3HKDA 1K8YB 2EBWA 4JD5A 4K9KA 2X19A 4QUHA 4GOJA 1NTMH 1KXZA 4GPBA 1NNEA 4GKJB 3CCBA 1D1QA 4EL0A 4J07A 1W2GA 1I6KA 1AI4A 4HDSA 4PGFA 2OCGA 1SPBS 1JG1A 3T4EA 2JZNA 1NG1A 3V5NA 1NMUB 4PZ9A 2ZSIA 4OHRA 1N6IA 1XTIA 3QUWA 4RZSA 1IOZA 3LY7A 3UTDA 3PGLA 1XCJA 1SHLA 4EKEA 5CA1F 3GRVA 1LDMA 4R2JA 5AWFC 3X2EA 1KYVA 3IVMA 4DJDC 5DSXA 1IONA 5DEIA 2CNDA 1JDPA 2WILA 1N5DA 4JI0O 5JNUA 3PFIA 3INGA 4XTRA 3AMVA 3X1WA 5DLPA 2Z4TA 4AC9A 3MTQA 3QVOA 4RCYA 3FCCA 1FYXA 1VJ1A 2IYOA 5KBYA 5CFLA 2X23A 1XRGA 2GJ8A 3Q3JB 2AI2A 4HOYA 4PR0A 1Q7CA 5C7IO 4IIJF 2PH1A 1RAGA 5ILOA 3VPXA 3KZKA 3R9IA 2Z95A 4ER6A 2AOTB 1N2CB 1GDHA 2GGSA 4TL9A 1V11A 2G0TA 1BHAA 1BXRA 5LA6F 1N9ZA 3RC8A 3T80A 3KLNA 3X2QC 2C0PA 2WVJA 4QXQA 3TDKA 1GZ4A 3QLVC 5F12A 2HK8A 1IBRA 5JZBA 3C8DA 2GUGA 2DH5A 3AUJB 2ZBEA 4OOEA 4FCWA 3PEWA 3L2OB 3RFVA 1RHJA 1O6GA 4YRCA 1NX9A 2OO5A 4DDTA 3AR2A 4TTAA 3AILA 4JQZA 3UMBA 3OCJA 3BFJA 3BD9A 3U60B 1J2TA 4YRIA 5AKGA 5E1BA 4MVQA 1ZAYA 4UFPA 3G6EV 5FTNA 2HVYD 3O1IC 4RIFA 3L75H 3NG1A 3USZA 3W9UA 4FLUA 1NBWB 4F9EA 4ILEA 4TTPA 2J6BA 4HAIA 4Q6WA 3TUJC 3TO5A 2FQWA 3GNLA 1D04A 3ECAA 4WZBB 1N8KA 3W5CA 2QWQB 2UZ0A 5E6RA 5FWAA 1OXMA 1T2EA 1YONA 2R2GA 3AY6A 4HLNA 2A1TS 4S2EA 1W88B 3DV0B 3AG2C 2QR2A 3JQCA 4FDLA 4H1TA 2ZAMA 4HATA 2I6RA 1B3BA 3NHRA 1LGYA 2YMMA 2I1WA 2ZBDA 5A5VA 3UMCA 4LBYA 3WPXA 1KO8A 2PQ0A 4NDNE 3PJFA 1OKKD 3UMJA 2Q73A 3SJUA 1L5QA 3PB3A 1L0LH 3WLOA 2LDBA 2NU9B 4NPHA 3ES9A 2EQ5A 1O9BA 1WSDA 1LA2A 5FLXN 3GLSA 2Y92A 1FF9A 2V7WA 5IASA 3EG5A 1FNNA 3KJZA 3O8NA 1GRRA 2WU4A 5JCOC 2W22A 2YL2A 4EYSA 2YHIB 4S12A 1C9DB 4C7MA 2FUNB 2RDCA 5KVCA 1CY7A 2O07A 3K0HA 4CDNA 2D0OB 3OZRA 3Q72A 1EVIA 2NUPA 1KJQA 5AI5A 1Q3KA 1TZJA 3T7CA 1Y5NA 2A4KA 1M8JA 2VHJA 4XE5A 4TTRA 3KYDA 5I3CA 1LRJA 5FJ4C 4RIHA 4DLNA 1N9GB 2W48A 1RM0A 1TA4A 1QH0A 3GPDG 1PV0A 3FX7A 3C3JA 4ZEWA 2BWJA 4XYBA 4HGQA 5HTKA 2R1TB 2YHSA 5GGXA 1TUEB 2FN3A 3QUSA 1CJVC 2XKBA 2AKAB 5BMOA 3F0DA 1B1AA 2Q0OC 4DR1B 4BLWA 1L5SA 1RYZA 4HK4A 1WVIA 1V41E 2QM3A 3O0DA 1GVNB 1KOJA 1ZGCA 3GELA 4CLRB 4A7PA 3TGLA 2GAIA 2YUTA 1EFDN 4FYWA 4ZCPA 1TQ2A 3OM3B 1MBZA 1BEZA 1G2IA 4HGPA 4P0PB 1NT2A 3VR6H 2IDZA 2JKZA 3RU2A 5ALLA 5JLAA 4HQ6A 1AO3A 4K1LA 2H7VA 1SB9A 3W0LB 2H3OA 1T9GR 2UUAB 4PIPA 3O8OA 1EINA 2VVTA 2DTEA 2HJHA 4Q00A 4OQYA 2WWVD 2FWJA 1CEEA 3CNEA 1G21E 4DV0B 1ARZA 3G0DA 1RE0A 4QBKA 4XSVA 2PUBA 1QYWA 4YIKA 5HQ3A 4I55B 1DBRA 4DPLA 4GNKA 3ICXA 2TMGA 1R3IC 3DT8A 5JYBA 5AQ1A 5BWBA 5EZYA 5H6QA 1JKXA 2KBEA 3W5IA 4PAQA 3KQSA 4CKZA 1TEZA 4V3CA 2JLVA 3CW8X 2FX2A 3EDMA 3CCRV 4U0JA 2NU7A 3CYQA 1W30A 4L9RA 1YFZA 3DYIA 2IPNA 1YAJA 1FSFA 1MH1A 2XAJA 3DHNA 2PJUA 1LPMA 2K1SA 4NE9A 2F00A 2CXQA 3KDPA 3ZCRA 2BFPA 3ND9A 2RK4A 2MIIA 1Y6RA 1PM9A 2DFVA 2NUTA 2HK9A 3VJMA 3VMFA 1NAIA 3IE1A 4IIXA 4DMMA 4MVWA 3MF4A 3DH0A 3LQRA 4MXDA 1W49A 4OYYA 4YAUA 2VP3A 5B1AC 1WUJS 3BEDA 3WLMA 1NN3A 2V0GA 4AQDA 1YOBA 1K5HA 2CLFB 3X43A 2BJHA 2YCLA 2XCUA 3WWPA 3BORA 2IOYA 2P2SA 3BIOA 5HY0A 3JQQA 1ZOOA 3ABTA 3PUWA 3N5CA 3HSSA 4HN2A 4JITA 2O0JA 2ZIXB 3G2QA 2WWRA 3UWDA 4DQVA 4X3OA 1I6LA 5TQJA 3PHGA 3HB3B 2JLAA 3OIUA 4JYPA 3V1LA 4IMRA 5GAPK 1MAWA 5DBGA 1A82A 3TCNA 5TSDA 4TL6A 3PKZA 3COVA 4AZWA 5IJZA 3TXSA 3Q41A 5JCJA 1C1DA 2AZMA 2Z1FA 3SBOA 1NXTA 2G09A 5C5DA 5LMNB 2V8OA 4UAUA 3CS3A 1MHPA 2VJLA 1Y66A 1QB7A 4BBPA 1TCBA 3L6BA 1Q0RA 2OXFA 2ET6A 5KTRA 1OB5A 4GICA 3AG3C 2P3QA 3CXHF 4TM8A 1MQ9A 1ZIXA 2D8AA 4FR5A 1OI7A 1MV8A 1NMXA 2PHZA 4DWJA 3I62A 2XZPA 2VSOA 3T54A 3KNZA 2O06A 3KQUA 2E5WA 1KI6A 5DGDA 2Q4BA 4A3SA 1HE1C 1EP3B 1XZKA 3KO8A 4RVHA 4OJQA 1VQ5V 3QOFA 1BGYH 4YDQA 3K2XA 2WPDG 3M4XA 4XX0B 3TZLA 3SE0A 3ANSA 4FNMA 1E59A 3OICA 4EABA 1OE0A 2XCOA 2D6FA 1KEEB 3D5TA 4AKGA 1SRRA 1V8OA 4Y9UA 1LY1A 3C6KA 3P8ZA 4KWHA 2ZXUA 3JSLA 2GZAA 3K4QA 4ICGA 4HEQA 4UVHA 3SD7A 1Z4LA 3DL2A 3PXCX 2ZIAA 4LDPA 2H4ZA 1DIOB 4BVKA 3S02A 1FYFA 5JS7A 1RKXA 3WK8A 2NYRA 3SEZA 4JEMA 2JW5A 3DR3A 1O1YA 4L4RA 1I7PA 4KODA 3TIXB 1M74A 4L8GA 1KI4A 1V4BA 3PR2B 2A1IA 3MJ4A 2W6PA 3I39X 3QE3A 1PLKA 1O94A 4LYYA 4RAQA 4YS6A 3LNCA 3SBXA 3IESA 4EY4A 3Q6IA 1NLFA 4PCAA 3CXCU 1C4XA 1NDUA 1R64A 2UUCO 2OHHA 3TSYA 5EQDA 2D2FA 4RESA 1SQSA 2WLLB 4HP8A 1B8NA 4MGHA 1BDIA 4E94A 3K8QA 1GQFA 2QYSA 1LDYA 4FZJA 2CVOA 3HXPA 3A2LA 2C9OA 3MT8A 2XRYA 1VF7A 4W5HA 1LLDA 2R65A 2FGKA 5HPYB 3A1WA 4LWSB 3P19A 1CEZA 2C1EA 3I52A 3AW8A 4R9UC 2C5FA 3VR5D 2A2ZA 3JQ9C 1F2TA 4MLDA 2E1RA 5EXSA 2FFHA 5BUZA 5KJFA 2OAEA 1ONIA 5E8RA 3RRZA 3MQ4A 2J5BA 3MCAB 2Q29A 4DLYA 3INRA 2FSPA 5IVPA 3QU7A 1Y4ZA 2P6NA 4E13A 5A5DA 3ND8A 3KVYA 4OH1A 4GKKB 5HILA 3EW7A 3LFHA 4HS4A 1DZ3A 2AZTA 1K3FA 4BQSA 4YLYA 1NE7A 4RA9A 2Z9CA 1A9PA 2JB9A 1HM5A 5C8VA 3BL8A 2BMJA 1U81A 4AKTA 2IOFK 1IV3A 3FROA 2DFKB 3T5AA 1FTNA 3A1NA 2FY8A 4ISBA 3EZYA 1V1RA 4F7DA 4BAUA 1E1YA 1CZHA 4EJSC 4XB1A 1NI3A 3NDBB 2O19A 2BFDA 4KR6A 2XCSB 1LUWA 3TQQA 4TLMB 4ZYUA 1L8LA 3U3RA 1PIWA 3K9NA 2GHYA 1SXJD 3K0AA 4QDUA 1FFXB 2GPJA 1A8QA 4KQHA 4O4LF 1WZCA 4DXAA 1JDNA 5FBZA 4C08A 4P5EA 3FTPA 1FNDA 4EF5A 5TDHA 4ZHQA 3O82A 1KP2A 5B1EA 3QBJA 3SIPA 1E4VA 3R23A 2Z6QA 2PJDA 5JY1A 2EWVA 3UBTA 3BXZA 1JQLB 1E79D 2ONCA 4B6EA 4R8CA 1I94B 2FQYA 4LYEA 2R9VA 4XRGA 2FGYA 2XQVA 5EUBA 3NDJA 4J7XA 4E31A 1D9XA 3FPHA 1U2TA 5KAMA 1QM5A 3QRWA 3SVZA 2CUTA 5AJVB 3ASYA 3RGGA 3WG7B 1M1NA 4J1TC 2W8BA 2PSFA 1ZRSA 1QYDA 2Y77A 3CH4B 4UW9A 2HBRA 3HXOA 3HY6A 3ETQA 1XYGA 4PYNA 1T2AA 2CFRA 2PGNA 3D00A 2PXHA 4WINA 3EASA 2CC2A 2PLAA 2Y2UA 2V03A 4BLVA 4BN5A 3L0ZA 5DRTA 4QOSA 5K0CA 1XEXA 2W2MA 2FFRA 1Z7BA 3KOZA 5CBHA 2CW4A 5DX1A 3RDPA 1ORTA 2YIBA 3CS5A 2FYTA 5IJWA 4PHTA 4CV2A 4XLLA 4B6SA 1HH4A 3MWLA 4IUDS 1HYGA 4DV3O 3IEPA 3IT1A 4Z86A 5AK5A 2ZTVA 3T34A 3UOAB 5BW5A 3RW0A 1W2BF 2H8PC 1BE1A 1E6CA 4XIYA 4QE7A 3Q3GE 3ZXXA 1MA1A 4KZKA 1WM1A 3OPYI 4I0WB 3UAYA 2HMVA 5L7WA 5CBFA 4UEQA 3ECCA 5BW8A 2C20A 3O75A 4GF5A 4DV5B 3T5DA 1V6SA 2AHZA 2DERA 2ABWA 4Y30A 2QVCA 5JBQA 1KMHA 3WY9A 3D8HA 4JNCA 4G2NA 3I4CA 4FNGA 3ZE8A 3KT3A 3N4YA 2GZ3A 3IUPA 3WWEA 1MOZA 3H86A 4B09A 2PD4A 4M1TA 5ICFA 1DS6A 2R9RB 2OGWA 1A1SA 3TEJA 4DIEA 4BAYA 4P3XA 2JNBA 4UVGA 5I7OA 2JFXA 1RP3B 3VM6A 4HGOA 3B89A 2YJTD 3LX6A 5F35A 1G3RA 3RWMB 2H2GA 4CI0B 4F5EA 3ONNA 4P86A 1FSPA 1NJIW 4CV0A 4DUGD 4LMRA 4TKUB 1YEWA 1ADCA 1JEOA 1W0KG 1QFJA 1RWBA 2LBPA 2BUCA 4QRDA 3HP7A 4QJFB 2WBLC 4CODB 3A3KA 3HRHA 5KOIA 3QITA 1T9BA 2KYRA 2OO3A 1TYCA 2X9NA 5DI3B 1M10A 3ZVLA 1UH5A 4UEJA 3S2ZA 5I8ZA 1UF9A 5DBIA 4BKRA 1GN4A 3UMYA 3LFOA 4A6DA 3I58A 1HZJA 1J5XA 2PLFA 3DV2A 3SJAC 2SKEA 5K3BA 3ULKA 1GZUA 2P9QA 4DDMA 2K2WA 2ZB2A 1VMGA 1NVTA 3NHBA 3TETA 1VSUA 1R12A 1AK1A 3SZRA 3RVQA 1PT5A 1UPAA 3IEWA 2QSUA 3MG9A 4IH1A 2YHBA 1ZAKA 6NULA 1N8RH 3OFVA 1BMQA 1ZH2A 1M1UA 3RGBA 4IDNA 3M3DA 1VG9B 3UXYA 4IVRA 4FGKA 5GZ1A 1R4AA 4C87A 9GPBA 2G71A 5IVHA 2FC3A 1ZL8A 1QH1B 3VZPA 4LDQA 1PW7A 4CHTA 2OL4A 4K81B 2IEDA 4ZAXA 4QG3A 3OONA 3U6BA 3E83A 5B6PA 2W90A 4QGSA 1Z4MA 1IM5A 1E9EA 1YVEI 4JU9A 1LZKA 5TQ0A 2VDNB 5JCPA 3QVSA 4AECA 1HDOA 4GZ6A 5K3SA 1JKFA 2JAUA 5C8YF 3WC4A 3SDLA 1K4KA 3DNFA 4YAOA 3BDVA 1U63A 4A23A 4HH0A 1H93A 4RENA 3BXFA 5FLXA 5JNSA 3H5AA 3S8MA 4GM1A 3TVDA 2DHCA 1I5OA 2RAUA 5DSTA 2CY0A 3IOMA 1Y34E 2FN8A 3KZ1E 4WBNA 3WADA 2VDLB 2HXGA 3STWA 4BFLA 1XCBA 2KMLA 2GCEA 1Y9ZA 2IEBA 3PGMA 4DLSA 2PX4A 1OTHA 3TZEA 2UDPA 4Z4FA 5IBQA 3I92A 4LRYA 5KDOA 3EHBB 3TMAA 4KZPA 2DBQA 2GVNA 3IQFA 1T1SA 1VCOA 4RGQA 2QAGB 3OFND 3HC7A 1K9VF 1ZBDA 2R84A 1IBLB 4ZU6X 5IANA 1MNAA 3HKEB 4AP5A 2BIFA 4NJMA 3FHOA 4OJNA 5FJIA 3NASA 5C2JB 5TS3A 1PG0A 2D2VA 3GNTA 2P7HA 3ZNNA 4C0SA 4G5HA 1LTHR 1UK9A 3HYLA 5IEBA 4PEVA 2Z0MA 1OCZC 1XZDA 3TQTA 3CRQA 4FFDA 2XHEA 2NUAA 1NPTO 2ZWPA 5JDIA 1TDJA 1BQ0A 5JBIA 1D4FA 2G4CA 2ZETA 4QPDA 4XWOA 1JG3A 1C7EA 1T5OA 4YP1A 5GOTA 3OFKA 1T8PA 3D6MA 2WW8A 4LCUC 1E7YA 1SBYA 1OFVA 3C24A 1CQJB 4JJGA 2QTLA 3IP7A 1Y8QB 1S2OA 3NKVA 2QR4A 2PD6A 4HO1X 3M8KA 4HDAA 2F1RA 4EKNB 3CD6F 4NBSA 5T4FA 3BWBA 4B73A 3H8SA 5BN1A 1ST3A 1GUBA 4OK5A 4ZAFA 3DMYA 1XMJA 1MXHA 1ZJ6A 4IGGA 1GARA 3L7MA 4WDQA 2I87A 4K0RA 3PLAE 4KSBA 4IIGA 3P9IA 1YB6A 3RG8A 2QMUA 1U8YA 2AWNA 4HYQA 1QRAA 1DADA 2HX1A 5LWHA 2MINB 1BDHA 5L45A 2GN4A 3FIUA 3MWKA 1ZCAA 2AZDA 4RYLA 2QD5A 4K40A 4RH1A 4K6CA 4PFQA 3V7EA 1P3DA 1M75A 4JQCA 4IKOA 2ZRHA 2JVKA 1ABBA 1U99A 5SY9A 4BX3A 1CZRA 2J6CA 4TKVB 2UYOA 4TTJA 4KWEA 1KL7A 1RXIA 1U6IA 3CX4A 4F11A 4EPWA 3ZUGA 5KQMA 2OZEA 2CEAA 2XDYA 5L51A 1E2QA 5BSKA 3EEOA 2HU8A 1E69A 4WFIA 2VAVA 1TKCA 3W1VA 5E3IA 1UI9A 5B3JA 4CQJA 1TJ3A 3K1ZA 3LC0A 4F8EA 4D5GA 2GT1A 4PYLA 2H65A 1FX0B 2YJ3A 2C2BA 2Q5LA 1NN5A 2C94A 2BCCH 4AMVA 4D9HA 1P1BA 3AG5A 4NNOA 3IPAA 1XMXA 2EL9A 3LCMA 5EN4A 2XWQA 2DR3A 2G77B 3F4KA 2W6OA 4YT2A 1DKOA 1AA9A 4YJ3B 2BF4A 4MUGA 4F1KA 4E5YA 1YRHA 3H2IA 4OXIA 4UTVA 3OY7A 2WQ6A 4CBVA 1JU9A 4RKYA 2JIOA 1VCNA 2M32A 1KE1A 1U3CA 1ZVQA 4UHJA 4PNPA 5GMOA 2CJWA 1VSVA 3GG2A 1O3YA 2ZQMA 2Z58A 1I0HA 3F7TA 3D4OA 3OQNA 4YDSA 5KVAA 4JYCA 4P81A 4GCZA 2HSZA 4B4WA 4D41A 3O4FA 1E9BA 1JLSA 2G0NA 2JGDA 4BVSA 3SBEA 3FR8A 1SPXA 3KZVA 3L49A 1N32O 3GDHA 4IVPA 1KDRA 3Q5GA 3D6VA 4WFKA 4DYHA 3C3CA 3U6KA 3KQTA 3QE2A 2OCIA 3ZX6A 4PHFA 3A6DA 4BVGA 1HFJA 3C1TA 4IXTA 4ZODA 1JF8A 2PO5A 2QVGA 5LMUB 2DM6A 5HKKD 3K70B 2XWBF 1FFDA 4EECA 2QTCA 2XB2A 2XVAA 2GILA 2CXRA 3KKMA 4UCRA 1QFZA 2XR1A 3DOHA 3S2YA 1AC5A 1JMVA 2PUHA 3DMGA 2GBPA 2H48A 4RETA 3BHNA 3SY8A 4P7KA 4HAYA 3I1JA 4IUYA 5TR9A 4HNAA 2GBLA 4J49A 1II8B 4FLXA 1U0OC 1YS6A 2GHRA 2KI5A 1FXVA 4PCLA 3CLUD 3G2OA 2KKWA 3L72H 1BQ3A 5CA3A 4UZSA 3DF9A 1SQQH 3SHOA 1Y81A 2XMBA 2I54A 1C9NA 5DYYA 2WF7A 1V7PC 5TPWA 4R2XA 2QT1A 1DX9A 3H42B 3F6PA 5HS4A 3AEZA 1GEEA 3UF0A 1RQPA 2YVUA 1XP5A 1QHTA 1IVNA 2ZVDA 3MGKA 3HBLA 4IW3B 3UAVA 1AD2A 4A6PA 4KWIA 4YALA 5E7QA 2HSDA 1KBZA 4JT9A 1QH8B 1NLMA 3SSNA 1B0ZA 2XCIA 2JIMA 3BG5A 1ENOA 3OCUA 1AA6A 4MVSA 1FS6A 2EHDA 2PZGA 2RI6A 3MLBA 3O26A 5EOVA 4YMLA 1Y6FA 4S05A 3WJQA 2E1PA 3GCXA 2IU6A 1J7JA 1F8XA 4BNKA 5ECDA 2I1QA 3SJBC 3SLRA 1FW8A 4YXWD 3LF2A 4OPHA 2B7BA 4IO1A 4F4UA 3P0RA 3CKKA 6ABPA 3JVIA 1UBEA 5B1DA 3CMEF 3LOQA 5FWDA 3TIIA 3AKEA 2H11A 1G64A 5A7GA 1T8RA 3OZFA 5KNBD 4JAAA 3L6EA 4M7OA 4R2WA 1KRHA 4LGCA 4D9NA 1GHTA 5EJ7A 1Y3BE 3ZOPA 4INAA 1TTQB 2CLDX 4JZ2A 3AXSA 4Z53A 2B4YA 2CFTA 3WKBA 3IVCA 1CR1A 3HZZA 2PPVA 4KDEA 1WB6A 4DF3A 5CB6A 2RE8A 1XVAA 3KWFA 1WIWA 1ORIA 4YBRA 3CUKA 4J9UE 4FHZA 3SG0A 6Q21A 4R8LA 1JE0A 4LH7A 2FHPA 4URXR 1LFDB 3VYUB 3RLFA 5KQPA 3A1DA 1E5DA 1JQ3A 2B61A 1CQIB 1HK7A 4N18A 4X0EA 3AEIA 4CL0A 1Z38A 4OG2A 4DTCA 2YVAA 2EJBA 5IY5C 3VSCA 3W5BA 1EM8B 2C88A 3FPIA 4NBLA 4TKLA 4LGVA 1PFVA 3LPCA 1A5AB 2EZ8A 4FPPA 1KOFA 5AOCA 2V3WA 3FKSG 4XX1A 3DFIA 2K7ZA 4JROA 4IDFA 2GBIA 1JSCA 2E4YA 1N5LA 1I3CA 3N0VA 4EMBA 4BPBA 1YQ9A 4FFVA 2YXYA 3HS3A 2FDXA 3FLEA 4OLFA 1WO8A 5CDFE 5TMPA 3NT2A 3M4SA 5LR6A 1A8PA 5DBEX 4P53A 4B5CA 3F0TA 4P58A 1I24A 2BLNA 1EK6A 2HCRA 3HFRA 2XCTB 2IH3C 1I3OA 421PA 4W4TA 3T9CA 5AKLA 4L85A 2ZLBA 4MA0A 3GLTA 1UJMA 1UKYA 2JFNA 3E9NA 4ZK2A 3GLVA 5FO1A 3LWZA 3KRTA 5B4TA 1ULBA 3D6FA 1NY5A 3ROEA 3QUAA 3QVXA 1I5RA 1PQWA 5ADWA 2O8CB 3U1TA 2MK3A 3JSXA 5REQB 1AKWA 2JFFA 4RUKA 1ZD8A 4JDUA 1MF7A 4ECAA 1SIUA 4OV6B 1OREA 4G4SP 2ZPUA 4YRMA 2HJDA 2VH1A 3WGGA 4G65A 2WZCA 1E3SA 1ZM2A 3KTFA 3JSAA 2HCTA 5CFMA 4G4SO 1CR4A 2DXIA 2EL7A 2CMHA 4IIUA 3EB9A 1W93A 4NOJA 4ANFA 2Y1FA 4W1QA 3A2KA 3B6NA 2EWMA 3PBKA 1OX5A 4P5DA 1FP2A 2GLTA 3OTFA 4L73A 3IP1A 3MVEA 4EHFA 3ZVNA 1OPXA 4ZFNA 5BR8B 1XRJA 3T3EA 4F3RA 1YI8A 3ZQ4A 4PA9A 3HA2A 5KYVA 4Z0HO 3VO8A 4QRHA 1FXWA 5L3EA 2ST1A 1UAYA 3RBZA 3NOVA 5LL6P 1YI1A 1A8HA 5CURA 4LMAA 4MH0R 1WCWA 1TAQA 1A9ZA 3GMTA 1YQXA 4JP3A 3KVOA 4ZHYB 3PEFA 4ZCSA 3UNXA 4ABYA 1VXRA 3QLEA 1E3IA 6LDHA 2BSAA 1EFRG 1CUWA 1QDUA 2QG6A 3TQRA 3CM0A 1SQPH 2WD8A 3H4IA 3OMNB 3KHSA 2ATIA 3HP4A 2IUFA 1Q82H 2BEKA 4CU2A 1HFKA 4ZGGA 3ENQA 5L95A 3EUWA 3LUHA 4BNFA 3ZE6A 3OPVA 4RELA 2X8JB 3HUEA 4AUNA 1S2IA 4QBFA 2HX0A 3BQMB 4NCNA 3K2EA 2FRDC 3AHDA 2N1MA 1BDBA 4DSTA 3O9MA 4NP6A 4U63A 3M3HA 4KO1S 1Q6HA 3TAUA 1BMTA 4UUMA 3RS5A 4R05A 1UOQA 4QSMA 2G1UA 4O4IB 3GO4A 1FSZA 3JVEA 3AIKA 1DAGA 3F3MA 1EG2A 2QX8A 1RSZA 2DFPA 2NX2A 4EGAA 3Q0EA 4ETNA 3DLBA 2J31A 4RTLA 4NABA 4RMIA 3SE7A 1JU4A 4A2PA 4M3NA 1DQZA 3AOEC 1TVKB 4RZQA 2ZSEA 1QVGF 1LF0A 4URUR 4UXIA 2Y71A 5BUQA 2B1RA 2RHWA 1A1VA 3B6IA 5JPCA 5TISZ 5IW8A 3RU9A 1EP9A 3TNJA 2HA2A 3HCPA 1FYJA 1AZSC 3RC3A 1MABG 2I67A 3U09A 3PUVA 1R8SA 3PVCA 3JSNA 2Q7GA 2ZVYA 3LP8A 4J7ZA 3GLGB 4E2WA 2ZF8A 5CG2A 1Z4NA 2LO1A 3TLMA 2CT8A 4HQNA 3FBTA 1V8DA 4M38A 2DVMA 1T24A 3IC5A 1P9NA 3DHYA 1EZVH 1QX3A 4CF6A 4GI3A 3DM9B 3RS8A 3KC2A 2P6JA 1Q7RA 3EAQA 3OQBA 4AWBA 4W6QA 4Q7MB 3VA7A 4MPPA 1CTQA 3U2QA 4U0KA 3QVJA 3LUBA 4ASUD 5CDGA 2H2FA 2JJ8A 2ODBA 4MSUA 5K6AC 3WKDA 2I34A 1MQ8B 3GJRA 1NM5C 1D2RA 5TY0A 5FNVF 2XCRB 1VGRA 1WDLA 4RD1A 2IYEA 4Z7QB 1XNRB 5LWQA 1E1LA 2AD1A 1G8FA 1YS2X 1RPJA 3JQAA 5DSZA 3FYUB 4EB8A 1P0FA 3QPVA 2GD6A 4QLOA 1JG7A 2OQ2A 4YA6A 4HB4A 3KB8A 3MOIA 3AFIA 3D3IA 3Q2KA 1R18A 1YF2A 3A05A 4CW7A 3RUFA 2VDWA 3ZI7A 4BIMA 2XEDA 5J9FA 3QSGA 4M9XA 4U7PB 1XMPA 1QVFU 1DWPA 4DCUA 3OU6A 1UXOA 5BO5A 1Q91A 2ETNA 2NV6A 3A6LA 4UASA 1IYZA 2YRXA 1FDIA 2FJUA 2GK3A 5B1BB 3VAZA 4TMYA 5FEUA 4QHYA 3SQOA 2QROA 3R3UA 1G1MA 2F2TA 2QRVB 3VX3A 3HZOA 4FW8A 2G72A 2QDXA 1Q14A 3GRZA 2D1QA 2O52A 3MHSC 4FONA 4HDKA 5FOSA 5I7EA 4NF2A 1SCQA 3GWGA 1IUOA 1R6XA 2R6R1 1JA8A 1MOSA 3VR3D 5CBPA 2VXOA 4AX4A 5FDFA 2FK8A 3FW1A 4Y0AA 1XTSA 4L4UA 3K9WA 1G0OA 3VSBA 1JBQA 1E6UA 4OI2A 2I7VA 5HOEA 1DINA 4C6TA 4IEFB 4YP6A 5AIAA 1C3EA 5KYGA 5CFZA 1L5KA 3C6BA 5KI6A 4J41A 1XRQA 3KDSE 1UIRA 1NSTA 4KRXA 1DCKA 3BYQA 1BN6A 1QXSA 3HR4A 5DMXA 3UGKA 1H6CA 3ERCA 1YBMA 4L7VA 4ZO7A 4X66B 2PT9A 1W36C 3UK2A 1E0DA 1ECJA 2FGJA 4UHKA 2K1EA 1RE1A 1NI8A 4CKBB 3GMSA 2HVKC 3U4IA 5IU6A 2JLQA 2CXOA 4JOCA 4F3CA 2IEGA 3K12A 1USGA 2R7NA 1KVTA 1VL1A 1A5BB 4PLYA 4HPWA 3T1TA 2I4LA 2ZDQA 4MTCA 1E2KA 4M21A 4CFZA 4N6GA 3W7AA 3CCFA 1SEPA 2AMYA 4GIBA 2H4JA 4OUDA 4NMXB 2FZKA 2VCYA 2ZI7A 2G83A 1QHFA 4PS0A 1YT5A 4YAKA 1VF5B 3NBMA 2NXWA 2A06H 4EA8A 5IT0A 3MAAC 3I5DA 1B6QA 1X1EA 4AJKA 1H1TA 2WWWA 1JQBA 3KDAA 4YIOA 1W0JD 5DXAA 1R3KC 1DJQA 4BP3A 1D6MA 1RLGA 1NTZH 5FFFA 4B7KA 1YULA 1JIVA 5ITZB 2O3TA 4UAJA 3B51X 4NFYA 4JTDB 3SU8A 4PGMA 1VPEA 4FN4A 3G0HA 4QQ8A 2ZRKA 2VJKA 4UBMA 4R1UA 3HVKA 4R5MA 1G5RA 4Z4EA 1MIOA 3TZKA 3BBLA 1EH5A 2JA2A 5HXUA 4ARIA 4GI2A 4N3GA 3OJWA 3ADDA 4HXYA 3RVZA 4G0QA 5AXAA 3PFHA 2X0EA 4HYYA 2LGJA 2WK1A 3GN2A 1QU7A 3ZCPA 1YJCA 4QFDA 5ULLA 1ID8A 1TVMA 1X14A 2X13A 4RANA 5JNWA 2Z3ZA 5H4HA 2O3SA 1PUIA 3WLRA 4W1RA 3BM5A 4EY3A 2AE1A 2DFNA 2OCKA 4CMGA 1EUQA 3ABKB 5T5QA 5CBGA 1ESDA 4CQLA 4MA4A 2H92A 4OFBA 4V2IA 5CDFA 4GMXA 4AXXA 3E8HA 3QVMA 4IZHA 2BGWA 1GZ6A 1SXJB 3L7QA 4RWUA 2IYAA 2P1ZA 3OE4A 1L5YA 4OGWA 3KQNA 2FWIA 1Y5MA 1U0FA 3FKSA 1B3RA 1U6JA 4EG6A 1TGVA 2UXCO 4B7UA 4KB5A 1GPH1 1WUKS 4J9VA 2DCMA 1Z5ZA 1MT3A 1SVWA 1ROPA 5F33A 4G0WA 3HFGA 3C48A 2E48A 1ES9A 2P35A 4L76A 4WPGA 1RRKA 1X9GA 2D0PB 1ODSA 5EWRA 2WALA 3R7AA 2ZUTA 4D8VA 2Q0HA 3EMVA 1XTTA 1ZP6A 3PPIA 1Y76B 5L3QA 2BGJA 4ACAA 5CFQA 3DDCA 3S40A 5ISMA 1D7AA 1TMYA 1W5SA 2JJ1G 1ADFA 3ZK7A 1A5SB 5DE3A 3AG6A 3KHTA 3QNWA 3QVNA 4ZI7A 1EK1A 2B8JA 1VQ1A 1OA0A 4IXDA 4BFCA 2XRFA 3T1QA 1U0TA 2D5AA 3VYSC 1IEVA 3RT1A 1GGJA 2DCUA 1L1QA 1HBJA 5FADA 1N0JA 1L5MA 1G9SA 1S4MA 2RB4A 5L3SA 2VYFA 5J3JA 2DC1A 3AX6A 1CK4A 4BUJA 2FFAA 5TQVA 1Z4QA 2IY7A 3NPAA 1MORA 3SHFA 4OB8A 3JRNA 4D92A 3DBLB 3ABMB 1QZXA 4ZEXA 4KDCA 2PZKA 1Q0PA 5GADl 4XASA 1Z9BA 4MVJP 2DX7A 4OFZA 5A4AA 4V1CI 4DV4O 2CMGA 4MCJA 1YJNF 1TZBA 2ATXA 3UXHA 2GJKA 3HDHA 4HNGA 1XN4A 1G5IA 2Z5VA 5ETJA 4WOCA 2X6BA 3A6EA 5AMXA 3ICCA 1T4BA 3K08A 4ZOCA 4F3NA 2ZRQA 1P49A 2Y67A 4UBIA 3PNKA 1OCEA 4YIPA 3LT1A 4YRQA 5AW1A 4INJA 4ZVTA 1IG0A 2WHPB 2F62A 5SV2A 1J0EA 3B3GA 1HP8A 2WA2A 5KKCA 5LDHA 3W3ZB 3HG7A 2A0FA 1UWKA 3AUTA 3UJPA 3MOGA 1C80A 4HWPA 3DLIA 2P1DA 1A96A 1PP4A 4DUYB 3DCIA 3L8GA 3K6KA 1OU4A 2ZW9A 4N0MA 2H8GA 3C3SA 5DP1A 3ZWPA 4B6OA 3TD9A 3DDWA 4UBKA 3Q1KA 3JALA 4OATA 1S5LZ 4MK4A 2CV1A 3SICE 4XUDA 2FVYA 2QTGA 3PHHA 3DFUA 4DNOA 4K8RB 4D44A 1XI1A 2HRCA 2HWYA 2PGXA 1JIUA 2NM0A 2J0EA 3TW0A 2PR7A 1MLDA 3RE1A 3FUTA 3TX6A 2EOAA 3OAAD 3NHLA 2NVOA 1B00A 3QMMA 2W2OA 1P31A 3C9SA 3S0YA 4PSUA 3M4ZA 5F2OA 3TAXA 1EZ4A 3ABQB 5EQTA 1AU9A 4DV7B 3DHVA 2BBWA 3T5TA 3AG1B 2WDZA 3VU0A 2ZWVA 1RKQA 1I1NA 5JZMA 1FYWA 1P2BA 2P6RA 1PFKA 2RGNA 5F2EA 3IAXA 5BW6B 5H02A 1NVMB 1MABA 2WYIA 3EH1A 1KAHA 1JBKA 3JTMA 3NTLA 5DT9A 5H68A 3I6BA 3TQCA 1PQPA 5LGTA 3DONA 1KH1A 2MSDB 1NF3A 3S4YA 4Q21A 1X3LA 2OB2A 5C81A 4G4JA 1TZ2A 4D4KA 4MS3A 3ACDA 2J8ZA 4M0CA 1OI2A 4BNLA 1F4VA 2IHYA 2UUPA 4JJKA 4NCKA 4PFSA 3D8CA 1R0XA 2BAGA 1XTKA 5E9QA 1EFAA 1XF1A 2Z56A 5JMTA 2QP3A 2IK8A 4FM1A 1DIRA 4EFNA 1HDYA 1CUBA 1ZVVA 4AQYB 1GEGA 3U39A 4EMTA 1NXSA 3UW3A 1X80A 3ZGOA 2X2EA 3WDKA 2C29D 1EIZA 2RHDA 2PZ8A 2YCBA 1YRQA 1SU4A 4AKHA 3E5MA 2B33A 3BDIA 4UNPA 3DSRA 4Q9NA 3OSUA 4DMUB 5GONA 4B62A 3ZKWB 4NHOA 1MENA 1WU7A 2TSYB 3PICA 3KBBA 1FP1D 2X6QA 2IJGX 4X7MA 4XOIA 2PBZA 2QNRA 3TSCA 3SEAA 1HDRA 3ONWA 4NATA 4FFNA 1YGYA 5T3YA 1DQNA 1W52X 2G9IA 2QIPA 4GBED 1XHXA 3C43A 1O4VA 3NC0C 3DMFA 4I5GA 2BTQB 2B4KA 5J63A 1THTA 3HY3A 1YHNA 5E4YA 4DEXA 1VTKA 3OT1B 4H6WA 1RYMA 4KBGA 4AN4A 1KZ7B 1EBFA 4UCUA 1SDSA 2BSQA 1ZJWA 4JELA 3QVUA 1DPFA 5U4QA</