3N2VA

Crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor n-hydroxy-2-(n-hydroxyethyl)biphenyl-4-ylsulfonamido)acetamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Structure-based approach to nanomolar, water soluble matrix metalloproteinases inhibitors (MMPIs).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 43
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2010-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3n2vA00
1K7GA 3HB2P 3E8RA 3ZVSA 5CUHA 4FU4A 3TVCA 3AYUA 4PKTA 4WKEA 2Y6CA 1Y0VA 1BSWA 2YB9A 1ND1A 1HY7A 1PWUA 1XUCA 1HOVA 1XFZA 4FXYP 3HDAP 1KUFA 1FBLA 4DF9A 4JIJA 3OHLA 4AXQA 4JA1A 4L6TA 4HX3A 2L0RA 2DDYA 2JSDA 1D8FA 4PKRA 2OW9A 5JMYA 1KUHA 3LEAA 3LK8A 1GO7P 2AIGP 4H49A 1O0QA 1XFUA 1IAEA 4PKSA 3CKIA 1AKLA 1UMSA 2I47A 1D8MA 2W12A 3LJZA 3N2UA 2HU6A 3VI1A 2OW0A 4XBHA 4ZR5A 4CTHA 1G4KA 1GKCA 1HTDA 2JT5A 3LQBA 2MLSA 1CXVA 5BOYA 3LIKA 4QKZA 2OW1A 3I7GA 3TT4A 4A3WA 3P1VA 2X3AA 3O2XA 3KEKA 3EDHA 2WO8A 1D7XA 3KMEA 1ATLA 3WV2A 2J0TA 2XS3A 3KRYA 2SRTA 2RJPA 1ZS0A 2OI0A 1YP1A 1OS9A 4PKQA 1DTHA 5D7WA 1B8YA 1FLSA 2X3BA 1GE5A 1DMTA 5D1TA 5H8XA 3UVCA 4WF6A 1QICA 1UTZA 1GO8P 1MMPA 5BPAA 3K7NA 966CA 1UEAA 3HBUP 1B3DA 2A8HA 2XS4A 3DWBA 1IABA 1SRPA 4GR3A 5D1SA 3GBOA 2QPJA 3HYGA 5I4OA 1Y93A 3B8ZA 2O3EA 1BKCI 3P24A 1I73A 2N8RA 1AF0A 2DW1A 1KUIA 2JIHA 1HV5A 4FXQA 4L63A 1IACA 1OM7A 1ZXVA 1EAKA 3LE9A 3DL1A 1Q3AA 1R1JA 3VTGA 1IAGA 2D1NA 1JIZA 3EWJA 2OVXA 3HY7A 3L0VA 2CKIA 3F18A 3KWVC 3K7LA 4JQGA 2WOAA 4L19A 2W13A 1JJ9A 1ZTQA 1K7IA 1KBCA 1CK7A 4I35A 3DPFA 3Q2HA 2RJQA 1ZP5A 2PJTA 1G49A 1H71P 1JKYA 1IAAA 3KHIA 2K2GA 2YIGA 3HBVP 4IJOA 1HFCA 1JANA 5CXAA 3ZXHA 2DDFA 2DW2A 1PWWA 2K9CA 1G9KA 2JNPA 3LUMA 1A86A 1XUDA 4AYKA 2Y6DA 1UTTA 1SATA 1BKCE 3AIGA 1PWPA 2E3XA 3V96B 2E2DA 2MZEA 4ILWD 3NX7A 2Z2DA 4XCTA 2MLRA 3Q2GA 1ASTA 3LIRA 1Z3JA 2ERPA 3EDGA 1JH1A 2OY2A 2X7MA 1ROSA 1BQQM 1OMJA 4DD8A 3MA2A 4GUYA 1IADA 3F15A 4GQLA 1R1IA 1EB6A 1CGEA 1YOUA 3LJTA 3O64A 5I2ZA 1S4BP 1BKCA 3EDZA 1QJIA 1XFWA 5LABA 1KUKA 1QIBA 2OXUA 3LKAA 2USNA 3LMCA 2W14A 3USNA 1UMTA 1SMPA 1YQYA 5I12A 3B92A 5BOTA 2OVZA 2TCLA 4XM6A 1YCMA 5L7FA 4JP4A 1JAPA 1A85A 4WKIA 1D5JA 2KRJA 4H84A 1L6JA 1CQRA 1R55A 4IUWA 3DNGA 1BUVM 1JAOA 3HY9A 3LQ0A 1XURA 3WV3A 2CLTA 1ZVXA 1BZSA 2FV5A 2MZHA 3SHIA 4GR0A 830CA 3L0TA 3HDBA 5I43A 3LJGA 3G42A 1GXDA 1KAPP 3TS4A 1G12A 1GE6A 2OXZA 1BM6A 4IN9A 2JT6A 4H30A 3BA0A 1QUAA 4AIGA 3RTSA 3TSKA 1GE7A 1HFSA 4A7BA 1R54A 1ZXCA 1CGFA 2W15A 1I1IP 4PKVA 1AYKA 5B5PA 4H3XA 1R1HA 3AYKA 3F17A 2EROA 1MMBA 1MNCA 3N2VA 2J83A 1EUBA 1OM6A 4XM7A 4FVLA 3G5CA 4GF1A 3I7IA 1JK3A 1RMZA 1I76A 4H76A 3LUNA 2OW2A 4H1QA 4HMAA 2X3CA 1XFVA 3F1AA 1FM1A 2FV9A 4H82A 2OZRA 3U1RA 1OS2A 1C8TA 2O36A 4EFSA 1MMRA 1QIAA 2DW0A 3F19A 4AUOA 3LGPA 1KUGA 3EHYA 1SLMA 1BUDA 1O0TA 1PWVA 1Y8JA 1CGLA 1C3IA 4GWNA 5D1UA 2D1OA 1XFXA 5D3CA 2AYKA 1JAQA 1BIWA 1BQOA 4JPAA 4R3VA 3LILA 1J7NA 1OO9A 4DV8A 1SLNA 3KEJA 2OXWA 3KECA 1K7QA 4PKUA 3EHXA 1XFYA 1GKDA 4DPEA 1RM8A 4G9LA 2V4BA 1JIWP 3ELMA 3B2ZA 1OM8A 4XM8A 5D2BA 5CZMA 3OHOA 4GWMA 3DSLA 2POJA 4H2EA 1MMQA 2ERQA 4PKWA 456CA 5I0LA 2W0DA 1USNA 1G05A 3DPEA 2OY4A 4WZVA 1C7KA 5L79A 2MZIA 1PWQA 3KMCA 1CIZA 4ON1A 5B5OA 4GR8A 2WO9A 1SU3A 4I03A 1QJJA 1CAQA 3F16A 3WV1A 3EDIA 5I3MA 4J4MA 3RTTA 3ZUKA 4WK7A 4Q1LA 4G0DA 1WNIA
chains in the Genus database with same CATH superfamily
1K7GA 3HB2P 3E8RA 3ZVSA 5CUHA 4FU4A 3TVCA 3AYUA 4PKTA 4WKEA 2Y6CA 1Y0VA 1BSWA 2YB9A 1ND1A 1HY7A 1PWUA 1XUCA 1HOVA 1XFZA 4FXYP 3HDAP 1KUFA 1FBLA 4DF9A 4JIJA 3OHLA 4AXQA 4JA1A 4L6TA 4HX3A 2L0RA 2DDYA 2JSDA 1D8FA 4PKRA 2OW9A 5JMYA 1KUHA 3LEAA 3LK8A 1GO7P 2AIGP 4H49A 1O0QA 1XFUA 1IAEA 4PKSA 3CKIA 1AKLA 1UMSA 2I47A 1D8MA 2W12A 3LJZA 3N2UA 2HU6A 3VI1A 2OW0A 4XBHA 4ZR5A 4CTHA 1G4KA 1GKCA 1HTDA 2JT5A 3LQBA 2MLSA 1CXVA 5BOYA 3LIKA 4QKZA 2OW1A 3I7GA 3TT4A 4A3WA 3P1VA 2X3AA 3O2XA 3KEKA 3EDHA 2WO8A 1D7XA 3KMEA 1ATLA 3WV2A 2J0TA 2XS3A 3KRYA 2SRTA 2RJPA 1ZS0A 2OI0A 1YP1A 1OS9A 4PKQA 1DTHA 5D7WA 1B8YA 1FLSA 2X3BA 1GE5A 1DMTA 5D1TA 5H8XA 3UVCA 4WF6A 1QICA 1UTZA 1GO8P 1MMPA 5BPAA 3K7NA 966CA 1UEAA 1XAXA 3HBUP 1B3DA 2A8HA 2XS4A 3DWBA 1IABA 1SRPA 4GR3A 5D1SA 3GBOA 2QPJA 3HYGA 5I4OA 1Y93A 3B8ZA 2O3EA 1BKCI 3P24A 1I73A 2N8RA 1AF0A 2DW1A 1KUIA 2JIHA 1HV5A 4FXQA 4L63A 1IACA 1OM7A 1ZXVA 1EAKA 3LE9A 3DL1A 1Q3AA 1R1JA 3VTGA 1IAGA 2D1NA 1JIZA 3EWJA 2OVXA 3HY7A 3L0VA 2CKIA 3F18A 3KWVC 3K7LA 4JQGA 2WOAA 4L19A 2W13A 1JJ9A 1ZTQA 1K7IA 1KBCA 1CK7A 4I35A 3DPFA 3Q2HA 2RJQA 1ZP5A 2PJTA 1G49A 1H71P 1JKYA 1IAAA 3KHIA 2K2GA 2YIGA 3HBVP 4IJOA 1HFCA 1JANA 5CXAA 3ZXHA 2DDFA 2DW2A 1PWWA 2K9CA 1G9KA 2JNPA 3LUMA 1A86A 1XUDA 4AYKA 2Y6DA 1UTTA 1SATA 1BKCE 3AIGA 1PWPA 2E3XA 3V96B 2E2DA 2MZEA 4ILWD 3NX7A 2Z2DA 4XCTA 2MLRA 3Q2GA 1ASTA 3LIRA 1Z3JA 2ERPA 3EDGA 1JH1A 2OY2A 2X7MA 1ROSA 1BQQM 1OMJA 4DD8A 3MA2A 4GUYA 1IADA 3F15A 4GQLA 1R1IA 1EB6A 1CGEA 1YOUA 3LJTA 3O64A 5I2ZA 1S4BP 1BKCA 3EDZA 1QJIA 1XFWA 5LABA 1KUKA 1QIBA 2OXUA 3LKAA 2USNA 3LMCA 2W14A 3USNA 1XM5A 1UMTA 1SMPA 1YQYA 5I12A 3B92A 5BOTA 2OVZA 2TCLA 4XM6A 1YCMA 5L7FA 4JP4A 1JAPA 1A85A 4WKIA 1D5JA 2KRJA 4H84A 1L6JA 1CQRA 1R55A 3DTIA 4IUWA 3DNGA 1BUVM 1JAOA 3HY9A 3LQ0A 1XURA 3WV3A 2CLTA 1ZVXA 1BZSA 2FV5A 2MZHA 3SHIA 4GR0A 830CA 3L0TA 3HDBA 5I43A 3LJGA 3G42A 1GXDA 1KAPP 3TS4A 1G12A 1GE6A 2OXZA 1BM6A 4IN9A 2JT6A 4H30A 3BA0A 1QUAA 4AIGA 3RTSA 3TSKA 1GE7A 1HFSA 4A7BA 1R54A 1ZXCA 1CGFA 2W15A 1I1IP 4PKVA 1AYKA 5B5PA 4H3XA 1R1HA 3AYKA 3F17A 2EROA 1MMBA 1MNCA 3N2VA 2J83A 3DTEA 1OM6A 4XM7A 1EUBA 4FVLA 3G5CA 4GF1A 3I7IA 1JK3A 1RMZA 1I76A 4H76A 3LUNA 2OW2A 4H1QA 4HMAA 2X3CA 1XFVA 3F1AA 1FM1A 2FV9A 4H82A 2OZRA 3U1RA 1OS2A 1C8TA 2O36A 4EFSA 1MMRA 1QIAA 2DW0A 3F19A 4AUOA 3LGPA 1KUGA 3EHYA 1SLMA 1BUDA 1O0TA 1PWVA 1Y8JA 1CGLA 1C3IA 4GWNA 5D1UA 2D1OA 1XFXA 5D3CA 2AYKA 1JAQA 1BIWA 1BQOA 4JPAA 4R3VA 3LILA 1J7NA 1OO9A 4L7AA 4DV8A 1SLNA 3KEJA 2OXWA 3KECA 1K7QA 4PKUA 3EHXA 1XFYA 1GKDA 4DPEA 1RM8A 4G9LA 2V4BA 1JIWP 3ELMA 1OZ9A 3B2ZA 1OM8A 4XM8A 1TVIA 5D2BA 5CZMA 3OHOA 4GWMA 3DSLA 2POJA 4H2EA 1MMQA 2ERQA 4PKWA 456CA 5I0LA 2W0DA 1USNA 1G05A 3DPEA 2OY4A 4WZVA 1C7KA 5L79A 3DTKA 2MZIA 1PWQA 3KMCA 1CIZA 4ON1A 5B5OA 4GR8A 2WO9A 1SU3A 2YUFA 4I03A 1QJJA 1CAQA 3F16A 3WV1A 3EDIA 5I3MA 4J4MA 3RTTA 3ZUKA 4WK7A 4Q1LA 4G0DA 1WNIA
chains in the Genus database with same CATH topology
1K7GA 3HB2P 3E8RA 3ZVSA 5CUHA 4FU4A 3TVCA 3AYUA 4PKTA 4WKEA 2Y6CA 1Y0VA 1BSWA 2YB9A 1ND1A 1HY7A 1PWUA 1XUCA 1HOVA 1XFZA 4FXYP 3HDAP 1KUFA 1FBLA 4DF9A 4JIJA 3OHLA 4AXQA 4JA1A 4L6TA 4HX3A 2L0RA 2DDYA 2JSDA 1D8FA 4PKRA 2OW9A 5JMYA 1KUHA 3LEAA 3LK8A 1GO7P 2AIGP 4H49A 1O0QA 1XFUA 1IAEA 4PKSA 3CKIA 1AKLA 1UMSA 2I47A 1D8MA 2W12A 3LJZA 3N2UA 2HU6A 3VI1A 2OW0A 4XBHA 4ZR5A 4CTHA 1G4KA 1GKCA 1HTDA 2JT5A 3LQBA 2MLSA 1CXVA 5BOYA 3LIKA 4QKZA 2OW1A 3I7GA 3TT4A 4A3WA 3P1VA 2X3AA 3O2XA 3KEKA 3EDHA 2WO8A 1D7XA 3KMEA 1ATLA 3WV2A 2J0TA 2XS3A 3KRYA 2SRTA 2RJPA 1ZS0A 2OI0A 1YP1A 1OS9A 4PKQA 1DTHA 5D7WA 1B8YA 1FLSA 2X3BA 1GE5A 1DMTA 5D1TA 5H8XA 3UVCA 4WF6A 1QICA 1UTZA 1GO8P 1MMPA 5BPAA 3K7NA 966CA 1UEAA 3HBUP 1B3DA 2A8HA 2XS4A 3DWBA 1IABA 1SRPA 4GR3A 5D1SA 3GBOA 2QPJA 3HYGA 5I4OA 1Y93A 3B8ZA 2O3EA 1BKCI 3P24A 1I73A 2N8RA 1AF0A 2DW1A 1KUIA 2JIHA 1HV5A 4FXQA 4L63A 1IACA 1OM7A 1ZXVA 1EAKA 3LE9A 3DL1A 1Q3AA 1R1JA 3VTGA 1IAGA 2D1NA 1JIZA 3EWJA 2OVXA 3HY7A 3L0VA 2CKIA 3F18A 3KWVC 3K7LA 4JQGA 2WOAA 4L19A 2W13A 1JJ9A 1ZTQA 1K7IA 1KBCA 1CK7A 4I35A 3DPFA 3Q2HA 2RJQA 1ZP5A 2PJTA 1G49A 1H71P 1JKYA 1IAAA 3KHIA 2K2GA 2YIGA 3HBVP 4IJOA 1HFCA 1JANA 5CXAA 3ZXHA 2DDFA 2DW2A 1PWWA 2K9CA 1G9KA 2JNPA 3LUMA 1A86A 1XUDA 4AYKA 2Y6DA 1UTTA 1SATA 1BKCE 3AIGA 1PWPA 2E3XA 3V96B 2E2DA 2MZEA 4ILWD 3NX7A 2Z2DA 4XCTA 2MLRA 3Q2GA 1ASTA 3LIRA 1Z3JA 2ERPA 3EDGA 1JH1A 2OY2A 2X7MA 1ROSA 1BQQM 1OMJA 4DD8A 3MA2A 4GUYA 1IADA 3F15A 4GQLA 1R1IA 1EB6A 1CGEA 1YOUA 3LJTA 3O64A 5I2ZA 1S4BP 1BKCA 3EDZA 1QJIA 1XFWA 5LABA 1KUKA 1QIBA 2OXUA 3LKAA 2USNA 3LMCA 2W14A 3USNA 1UMTA 1SMPA 1YQYA 5I12A 3B92A 5BOTA 2OVZA 2TCLA 4XM6A 1YCMA 5L7FA 4JP4A 1JAPA 1A85A 4WKIA 1D5JA 2KRJA 4H84A 1L6JA 1CQRA 1R55A 3DTIA 4IUWA 3DNGA 1BUVM 1JAOA 3HY9A 3LQ0A 1XURA 3WV3A 2CLTA 1ZVXA 1BZSA 2FV5A 2MZHA 3SHIA 4GR0A 830CA 3L0TA 3HDBA 5I43A 3LJGA 3G42A 1GXDA 1KAPP 3TS4A 1G12A 1GE6A 2OXZA 1BM6A 4IN9A 2JT6A 4H30A 3BA0A 1QUAA 4AIGA 3RTSA 3TSKA 1GE7A 1HFSA 4A7BA 1R54A 1ZXCA 1CGFA 2W15A 1I1IP 4PKVA 1AYKA 5B5PA 4H3XA 1R1HA 3AYKA 3F17A 2EROA 1MMBA 1MNCA 3N2VA 2J83A 3DTEA 1OM6A 4XM7A 1EUBA 4FVLA 3G5CA 4GF1A 3I7IA 1JK3A 1RMZA 1I76A 4H76A 3LUNA 2OW2A 4H1QA 4HMAA 2X3CA 1XFVA 3F1AA 1FM1A 2FV9A 4H82A 2OZRA 3U1RA 1OS2A 1C8TA 2O36A 4EFSA 1MMRA 1QIAA 2DW0A 3F19A 4AUOA 3LGPA 1KUGA 3EHYA 1SLMA 1BUDA 1O0TA 1PWVA 1Y8JA 1CGLA 1C3IA 4GWNA 5D1UA 2D1OA 1XFXA 5D3CA 2AYKA 1JAQA 1BIWA 1BQOA 4JPAA 4R3VA 3LILA 1J7NA 1OO9A 4L7AA 4DV8A 1SLNA 3KEJA 2OXWA 3KECA 1K7QA 4PKUA 3EHXA 1XFYA 1GKDA 4DPEA 1RM8A 4G9LA 2V4BA 1JIWP 3ELMA 3B2ZA 1OM8A 4XM8A 5D2BA 5CZMA 3OHOA 4GWMA 3DSLA 2POJA 4H2EA 1MMQA 2ERQA 4PKWA 456CA 5I0LA 2W0DA 1USNA 1G05A 3DPEA 2OY4A 4WZVA 1C7KA 5L79A 3DTKA 2MZIA 1PWQA 3KMCA 1CIZA 4ON1A 5B5OA 4GR8A 2WO9A 1SU3A 2YUFA 4I03A 1QJJA 1CAQA 3F16A 3WV1A 3EDIA 5I3MA 4J4MA 3RTTA 3ZUKA 4WK7A 4Q1LA 4G0DA 1WNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K7G A;  3HB2 P;  3E8R A;  3ZVS A;  5CUH A;  4FU4 A;  3TVC A;  3AYU A;  4PKT A;  4WKE A;  2Y6C A;  1Y0V A;  1BSW A;  2YB9 A;  1ND1 A;  1HY7 A;  1PWU A;  1XUC A;  1HOV A;  1XFZ A;  4FXY P;  3HDA P;  1KUF A;  1FBL A;  4DF9 A;  4JIJ A;  3OHL A;  4AXQ A;  4JA1 A;  4L6T A;  4HX3 A;  2L0R A;  2DDY A;  2JSD A;  1D8F A;  4PKR A;  2OW9 A;  5JMY A;  1KUH A;  3LEA A;  3LK8 A;  1GO7 P;  2AIG P;  4H49 A;  1O0Q A;  1XFU A;  1IAE A;  4PKS A;  3CKI A;  1AKL A;  1UMS A;  2I47 A;  1D8M A;  2W12 A;  3LJZ A;  3N2U A;  2HU6 A;  3VI1 A;  2OW0 A;  4XBH A;  4ZR5 A;  4CTH A;  1G4K A;  1GKC A;  1HTD A;  2JT5 A;  3LQB A;  2MLS A;  1CXV A;  5BOY A;  3LIK A;  4QKZ A;  2OW1 A;  3I7G A;  3TT4 A;  4A3W A;  3P1V A;  2X3A A;  3O2X A;  3KEK A;  3EDH A;  2WO8 A;  1D7X A;  3KME A;  1ATL A;  3WV2 A;  2J0T A;  2XS3 A;  3KRY A;  2SRT A;  2RJP A;  1ZS0 A;  2OI0 A;  1YP1 A;  1OS9 A;  4PKQ A;  1DTH A;  5D7W A;  1B8Y A;  1FLS A;  2X3B A;  1GE5 A;  1DMT A;  5D1T A;  5H8X A;  3UVC A;  4WF6 A;  1QIC A;  1UTZ A;  1GO8 P;  1MMP A;  5BPA A;  3K7N A;  966C A;  1UEA A;  3HBU P;  1B3D A;  2A8H A;  2XS4 A;  3DWB A;  1IAB A;  1SRP A;  4GR3 A;  5D1S A;  3GBO A;  2QPJ A;  3HYG A;  5I4O A;  1Y93 A;  3B8Z A;  2O3E A;  1BKC I;  3P24 A;  1I73 A;  2N8R A;  1AF0 A;  2DW1 A;  1KUI A;  2JIH A;  1HV5 A;  4FXQ A;  4L63 A;  1IAC A;  1OM7 A;  1ZXV A;  1EAK A;  3LE9 A;  3DL1 A;  1Q3A A;  1R1J A;  3VTG A;  1IAG A;  2D1N A;  1JIZ A;  3EWJ A;  2OVX A;  3HY7 A;  3L0V A;  2CKI A;  3F18 A;  3KWV C;  3K7L A;  4JQG A;  2WOA A;  4L19 A;  2W13 A;  1JJ9 A;  1ZTQ A;  1K7I A;  1KBC A;  1CK7 A;  4I35 A;  3DPF A;  3Q2H A;  2RJQ A;  1ZP5 A;  2PJT A;  1G49 A;  1H71 P;  1JKY A;  1IAA A;  3KHI A;  2K2G A;  2YIG A;  3HBV P;  4IJO A;  1HFC A;  1JAN A;  5CXA A;  3ZXH A;  2DDF A;  2DW2 A;  1PWW A;  2K9C A;  1G9K A;  2JNP A;  3LUM A;  1A86 A;  1XUD A;  4AYK A;  2Y6D A;  1UTT A;  1SAT A;  1BKC E;  3AIG A;  1PWP A;  2E3X A;  3V96 B;  2E2D A;  2MZE A;  4ILW D;  3NX7 A;  2Z2D A;  4XCT A;  2MLR A;  3Q2G A;  1AST A;  3LIR A;  1Z3J A;  2ERP A;  3EDG A;  1JH1 A;  2OY2 A;  2X7M A;  1ROS A;  1BQQ M;  1OMJ A;  4DD8 A;  3MA2 A;  4GUY A;  1IAD A;  3F15 A;  4GQL A;  1R1I A;  1EB6 A;  1CGE A;  1YOU A;  3LJT A;  3O64 A;  5I2Z A;  1S4B P;  1BKC A;  3EDZ A;  1QJI A;  1XFW A;  5LAB A;  1KUK A;  1QIB A;  2OXU A;  3LKA A;  2USN A;  3LMC A;  2W14 A;  3USN A;  1UMT A;  1SMP A;  1YQY A;  5I12 A;  3B92 A;  5BOT A;  2OVZ A;  2TCL A;  4XM6 A;  1YCM A;  5L7F A;  4JP4 A;  1JAP A;  1A85 A;  4WKI A;  1D5J A;  2KRJ A;  4H84 A;  1L6J A;  1CQR A;  1R55 A;  4IUW A;  3DNG A;  1BUV M;  1JAO A;  3HY9 A;  3LQ0 A;  1XUR A;  3WV3 A;  2CLT A;  1ZVX A;  1BZS A;  2FV5 A;  2MZH A;  3SHI A;  4GR0 A;  830C A;  3L0T A;  3HDB A;  5I43 A;  3LJG A;  3G42 A;  1GXD A;  1KAP P;  3TS4 A;  1G12 A;  1GE6 A;  2OXZ A;  1BM6 A;  4IN9 A;  2JT6 A;  4H30 A;  3BA0 A;  1QUA A;  4AIG A;  3RTS A;  3TSK A;  1GE7 A;  1HFS A;  4A7B A;  1R54 A;  1ZXC A;  1CGF A;  2W15 A;  1I1I P;  4PKV A;  1AYK A;  5B5P A;  4H3X A;  1R1H A;  3AYK A;  3F17 A;  2ERO A;  1MMB A;  1MNC A;  3N2V A;  2J83 A;  1EUB A;  1OM6 A;  4XM7 A;  4FVL A;  3G5C A;  4GF1 A;  3I7I A;  1JK3 A;  1RMZ A;  1I76 A;  4H76 A;  3LUN A;  2OW2 A;  4H1Q A;  4HMA A;  2X3C A;  1XFV A;  3F1A A;  1FM1 A;  2FV9 A;  4H82 A;  2OZR A;  3U1R A;  1OS2 A;  1C8T A;  2O36 A;  4EFS A;  1MMR A;  1QIA A;  2DW0 A;  3F19 A;  4AUO A;  3LGP A;  1KUG A;  3EHY A;  1SLM A;  1BUD A;  1O0T A;  1PWV A;  1Y8J A;  1CGL A;  1C3I A;  4GWN A;  5D1U A;  2D1O A;  1XFX A;  5D3C A;  2AYK A;  1JAQ A;  1BIW A;  1BQO A;  4JPA A;  4R3V A;  3LIL A;  1J7N A;  1OO9 A;  4DV8 A;  1SLN A;  3KEJ A;  2OXW A;  3KEC A;  1K7Q A;  4PKU A;  3EHX A;  1XFY A;  1GKD A;  4DPE A;  1RM8 A;  4G9L A;  2V4B A;  1JIW P;  3ELM A;  3B2Z A;  1OM8 A;  4XM8 A;  5D2B A;  5CZM A;  3OHO A;  4GWM A;  3DSL A;  2POJ A;  4H2E A;  1MMQ A;  2ERQ A;  4PKW A;  456C A;  5I0L A;  2W0D A;  1USN A;  1G05 A;  3DPE A;  2OY4 A;  4WZV A;  1C7K A;  5L79 A;  2MZI A;  1PWQ A;  3KMC A;  1CIZ A;  4ON1 A;  5B5O A;  4GR8 A;  2WO9 A;  1SU3 A;  4I03 A;  1QJJ A;  1CAQ A;  3F16 A;  3WV1 A;  3EDI A;  5I3M A;  4J4M A;  3RTT A;  3ZUK A;  4WK7 A;  4Q1L A;  4G0D A;  1WNI A; 
#chains in the Genus database with same CATH topology
 1K7G A;  3HB2 P;  3E8R A;  3ZVS A;  5CUH A;  4FU4 A;  3TVC A;  3AYU A;  4PKT A;  4WKE A;  2Y6C A;  1Y0V A;  1BSW A;  2YB9 A;  1ND1 A;  1HY7 A;  1PWU A;  1XUC A;  1HOV A;  1XFZ A;  4FXY P;  3HDA P;  1KUF A;  1FBL A;  4DF9 A;  4JIJ A;  3OHL A;  4AXQ A;  4JA1 A;  4L6T A;  4HX3 A;  2L0R A;  2DDY A;  2JSD A;  1D8F A;  4PKR A;  2OW9 A;  5JMY A;  1KUH A;  3LEA A;  3LK8 A;  1GO7 P;  2AIG P;  4H49 A;  1O0Q A;  1XFU A;  1IAE A;  4PKS A;  3CKI A;  1AKL A;  1UMS A;  2I47 A;  1D8M A;  2W12 A;  3LJZ A;  3N2U A;  2HU6 A;  3VI1 A;  2OW0 A;  4XBH A;  4ZR5 A;  4CTH A;  1G4K A;  1GKC A;  1HTD A;  2JT5 A;  3LQB A;  2MLS A;  1CXV A;  5BOY A;  3LIK A;  4QKZ A;  2OW1 A;  3I7G A;  3TT4 A;  4A3W A;  3P1V A;  2X3A A;  3O2X A;  3KEK A;  3EDH A;  2WO8 A;  1D7X A;  3KME A;  1ATL A;  3WV2 A;  2J0T A;  2XS3 A;  3KRY A;  2SRT A;  2RJP A;  1ZS0 A;  2OI0 A;  1YP1 A;  1OS9 A;  4PKQ A;  1DTH A;  5D7W A;  1B8Y A;  1FLS A;  2X3B A;  1GE5 A;  1DMT A;  5D1T A;  5H8X A;  3UVC A;  4WF6 A;  1QIC A;  1UTZ A;  1GO8 P;  1MMP A;  5BPA A;  3K7N A;  966C A;  1UEA A;  1XAX A;  3HBU P;  1B3D A;  2A8H A;  2XS4 A;  3DWB A;  1IAB A;  1SRP A;  4GR3 A;  5D1S A;  3GBO A;  2QPJ A;  3HYG A;  5I4O A;  1Y93 A;  3B8Z A;  2O3E A;  1BKC I;  3P24 A;  1I73 A;  2N8R A;  1AF0 A;  2DW1 A;  1KUI A;  2JIH A;  1HV5 A;  4FXQ A;  4L63 A;  1IAC A;  1OM7 A;  1ZXV A;  1EAK A;  3LE9 A;  3DL1 A;  1Q3A A;  1R1J A;  3VTG A;  1IAG A;  2D1N A;  1JIZ A;  3EWJ A;  2OVX A;  3HY7 A;  3L0V A;  2CKI A;  3F18 A;  3KWV C;  3K7L A;  4JQG A;  2WOA A;  4L19 A;  2W13 A;  1JJ9 A;  1ZTQ A;  1K7I A;  1KBC A;  1CK7 A;  4I35 A;  3DPF A;  3Q2H A;  2RJQ A;  1ZP5 A;  2PJT A;  1G49 A;  1H71 P;  1JKY A;  1IAA A;  3KHI A;  2K2G A;  2YIG A;  3HBV P;  4IJO A;  1HFC A;  1JAN A;  5CXA A;  3ZXH A;  2DDF A;  2DW2 A;  1PWW A;  2K9C A;  1G9K A;  2JNP A;  3LUM A;  1A86 A;  1XUD A;  4AYK A;  2Y6D A;  1UTT A;  1SAT A;  1BKC E;  3AIG A;  1PWP A;  2E3X A;  3V96 B;  2E2D A;  2MZE A;  4ILW D;  3NX7 A;  2Z2D A;  4XCT A;  2MLR A;  3Q2G A;  1AST A;  3LIR A;  1Z3J A;  2ERP A;  3EDG A;  1JH1 A;  2OY2 A;  2X7M A;  1ROS A;  1BQQ M;  1OMJ A;  4DD8 A;  3MA2 A;  4GUY A;  1IAD A;  3F15 A;  4GQL A;  1R1I A;  1EB6 A;  1CGE A;  1YOU A;  3LJT A;  3O64 A;  5I2Z A;  1S4B P;  1BKC A;  3EDZ A;  1QJI A;  1XFW A;  5LAB A;  1KUK A;  1QIB A;  2OXU A;  3LKA A;  2USN A;  3LMC A;  2W14 A;  3USN A;  1XM5 A;  1UMT A;  1SMP A;  1YQY A;  5I12 A;  3B92 A;  5BOT A;  2OVZ A;  2TCL A;  4XM6 A;  1YCM A;  5L7F A;  4JP4 A;  1JAP A;  1A85 A;  4WKI A;  1D5J A;  2KRJ A;  4H84 A;  1L6J A;  1CQR A;  1R55 A;  3DTI A;  4IUW A;  3DNG A;  1BUV M;  1JAO A;  3HY9 A;  3LQ0 A;  1XUR A;  3WV3 A;  2CLT A;  1ZVX A;  1BZS A;  2FV5 A;  2MZH A;  3SHI A;  4GR0 A;  830C A;  3L0T A;  3HDB A;  5I43 A;  3LJG A;  3G42 A;  1GXD A;  1KAP P;  3TS4 A;  1G12 A;  1GE6 A;  2OXZ A;  1BM6 A;  4IN9 A;  2JT6 A;  4H30 A;  3BA0 A;  1QUA A;  4AIG A;  3RTS A;  3TSK A;  1GE7 A;  1HFS A;  4A7B A;  1R54 A;  1ZXC A;  1CGF A;  2W15 A;  1I1I P;  4PKV A;  1AYK A;  5B5P A;  4H3X A;  1R1H A;  3AYK A;  3F17 A;  2ERO A;  1MMB A;  1MNC A;  3N2V A;  2J83 A;  3DTE A;  1OM6 A;  4XM7 A;  1EUB A;  4FVL A;  3G5C A;  4GF1 A;  3I7I A;  1JK3 A;  1RMZ A;  1I76 A;  4H76 A;  3LUN A;  2OW2 A;  4H1Q A;  4HMA A;  2X3C A;  1XFV A;  3F1A A;  1FM1 A;  2FV9 A;  4H82 A;  2OZR A;  3U1R A;  1OS2 A;  1C8T A;  2O36 A;  4EFS A;  1MMR A;  1QIA A;  2DW0 A;  3F19 A;  4AUO A;  3LGP A;  1KUG A;  3EHY A;  1SLM A;  1BUD A;  1O0T A;  1PWV A;  1Y8J A;  1CGL A;  1C3I A;  4GWN A;  5D1U A;  2D1O A;  1XFX A;  5D3C A;  2AYK A;  1JAQ A;  1BIW A;  1BQO A;  4JPA A;  4R3V A;  3LIL A;  1J7N A;  1OO9 A;  4L7A A;  4DV8 A;  1SLN A;  3KEJ A;  2OXW A;  3KEC A;  1K7Q A;  4PKU A;  3EHX A;  1XFY A;  1GKD A;  4DPE A;  1RM8 A;  4G9L A;  2V4B A;  1JIW P;  3ELM A;  1OZ9 A;  3B2Z A;  1OM8 A;  4XM8 A;  1TVI A;  5D2B A;  5CZM A;  3OHO A;  4GWM A;  3DSL A;  2POJ A;  4H2E A;  1MMQ A;  2ERQ A;  4PKW A;  456C A;  5I0L A;  2W0D A;  1USN A;  1G05 A;  3DPE A;  2OY4 A;  4WZV A;  1C7K A;  5L79 A;  3DTK A;  2MZI A;  1PWQ A;  3KMC A;  1CIZ A;  4ON1 A;  5B5O A;  4GR8 A;  2WO9 A;  1SU3 A;  2YUF A;  4I03 A;  1QJJ A;  1CAQ A;  3F16 A;  3WV1 A;  3EDI A;  5I3M A;  4J4M A;  3RTT A;  3ZUK A;  4WK7 A;  4Q1L A;  4G0D A;  1WNI A; 
#chains in the Genus database with same CATH homology
 1K7G A;  3HB2 P;  3E8R A;  3ZVS A;  5CUH A;  4FU4 A;  3TVC A;  3AYU A;  4PKT A;  4WKE A;  2Y6C A;  1Y0V A;  1BSW A;  2YB9 A;  1ND1 A;  1HY7 A;  1PWU A;  1XUC A;  1HOV A;  1XFZ A;  4FXY P;  3HDA P;  1KUF A;  1FBL A;  4DF9 A;  4JIJ A;  3OHL A;  4AXQ A;  4JA1 A;  4L6T A;  4HX3 A;  2L0R A;  2DDY A;  2JSD A;  1D8F A;  4PKR A;  2OW9 A;  5JMY A;  1KUH A;  3LEA A;  3LK8 A;  1GO7 P;  2AIG P;  4H49 A;  1O0Q A;  1XFU A;  1IAE A;  4PKS A;  3CKI A;  1AKL A;  1UMS A;  2I47 A;  1D8M A;  2W12 A;  3LJZ A;  3N2U A;  2HU6 A;  3VI1 A;  2OW0 A;  4XBH A;  4ZR5 A;  4CTH A;  1G4K A;  1GKC A;  1HTD A;  2JT5 A;  3LQB A;  2MLS A;  1CXV A;  5BOY A;  3LIK A;  4QKZ A;  2OW1 A;  3I7G A;  3TT4 A;  4A3W A;  3P1V A;  2X3A A;  3O2X A;  3KEK A;  3EDH A;  2WO8 A;  1D7X A;  3KME A;  1ATL A;  3WV2 A;  2J0T A;  2XS3 A;  3KRY A;  2SRT A;  2RJP A;  1ZS0 A;  2OI0 A;  1YP1 A;  1OS9 A;  4PKQ A;  1DTH A;  5D7W A;  1B8Y A;  1FLS A;  2X3B A;  1GE5 A;  1DMT A;  5D1T A;  5H8X A;  3UVC A;  4WF6 A;  1QIC A;  1UTZ A;  1GO8 P;  1MMP A;  5BPA A;  3K7N A;  966C A;  1UEA A;  3HBU P;  1B3D A;  2A8H A;  2XS4 A;  3DWB A;  1IAB A;  1SRP A;  4GR3 A;  5D1S A;  3GBO A;  2QPJ A;  3HYG A;  5I4O A;  1Y93 A;  3B8Z A;  2O3E A;  1BKC I;  3P24 A;  1I73 A;  2N8R A;  1AF0 A;  2DW1 A;  1KUI A;  2JIH A;  1HV5 A;  4FXQ A;  4L63 A;  1IAC A;  1OM7 A;  1ZXV A;  1EAK A;  3LE9 A;  3DL1 A;  1Q3A A;  1R1J A;  3VTG A;  1IAG A;  2D1N A;  1JIZ A;  3EWJ A;  2OVX A;  3HY7 A;  3L0V A;  2CKI A;  3F18 A;  3KWV C;  3K7L A;  4JQG A;  2WOA A;  4L19 A;  2W13 A;  1JJ9 A;  1ZTQ A;  1K7I A;  1KBC A;  1CK7 A;  4I35 A;  3DPF A;  3Q2H A;  2RJQ A;  1ZP5 A;  2PJT A;  1G49 A;  1H71 P;  1JKY A;  1IAA A;  3KHI A;  2K2G A;  2YIG A;  3HBV P;  4IJO A;  1HFC A;  1JAN A;  5CXA A;  3ZXH A;  2DDF A;  2DW2 A;  1PWW A;  2K9C A;  1G9K A;  2JNP A;  3LUM A;  1A86 A;  1XUD A;  4AYK A;  2Y6D A;  1UTT A;  1SAT A;  1BKC E;  3AIG A;  1PWP A;  2E3X A;  3V96 B;  2E2D A;  2MZE A;  4ILW D;  3NX7 A;  2Z2D A;  4XCT A;  2MLR A;  3Q2G A;  1AST A;  3LIR A;  1Z3J A;  2ERP A;  3EDG A;  1JH1 A;  2OY2 A;  2X7M A;  1ROS A;  1BQQ M;  1OMJ A;  4DD8 A;  3MA2 A;  4GUY A;  1IAD A;  3F15 A;  4GQL A;  1R1I A;  1EB6 A;  1CGE A;  1YOU A;  3LJT A;  3O64 A;  5I2Z A;  1S4B P;  1BKC A;  3EDZ A;  1QJI A;  1XFW A;  5LAB A;  1KUK A;  1QIB A;  2OXU A;  3LKA A;  2USN A;  3LMC A;  2W14 A;  3USN A;  1UMT A;  1SMP A;  1YQY A;  5I12 A;  3B92 A;  5BOT A;  2OVZ A;  2TCL A;  4XM6 A;  1YCM A;  5L7F A;  4JP4 A;  1JAP A;  1A85 A;  4WKI A;  1D5J A;  2KRJ A;  4H84 A;  1L6J A;  1CQR A;  1R55 A;  3DTI A;  4IUW A;  3DNG A;  1BUV M;  1JAO A;  3HY9 A;  3LQ0 A;  1XUR A;  3WV3 A;  2CLT A;  1ZVX A;  1BZS A;  2FV5 A;  2MZH A;  3SHI A;  4GR0 A;  830C A;  3L0T A;  3HDB A;  5I43 A;  3LJG A;  3G42 A;  1GXD A;  1KAP P;  3TS4 A;  1G12 A;  1GE6 A;  2OXZ A;  1BM6 A;  4IN9 A;  2JT6 A;  4H30 A;  3BA0 A;  1QUA A;  4AIG A;  3RTS A;  3TSK A;  1GE7 A;  1HFS A;  4A7B A;  1R54 A;  1ZXC A;  1CGF A;  2W15 A;  1I1I P;  4PKV A;  1AYK A;  5B5P A;  4H3X A;  1R1H A;  3AYK A;  3F17 A;  2ERO A;  1MMB A;  1MNC A;  3N2V A;  2J83 A;  3DTE A;  1OM6 A;  4XM7 A;  1EUB A;  4FVL A;  3G5C A;  4GF1 A;  3I7I A;  1JK3 A;  1RMZ A;  1I76 A;  4H76 A;  3LUN A;  2OW2 A;  4H1Q A;  4HMA A;  2X3C A;  1XFV A;  3F1A A;  1FM1 A;  2FV9 A;  4H82 A;  2OZR A;  3U1R A;  1OS2 A;  1C8T A;  2O36 A;  4EFS A;  1MMR A;  1QIA A;  2DW0 A;  3F19 A;  4AUO A;  3LGP A;  1KUG A;  3EHY A;  1SLM A;  1BUD A;  1O0T A;  1PWV A;  1Y8J A;  1CGL A;  1C3I A;  4GWN A;  5D1U A;  2D1O A;  1XFX A;  5D3C A;  2AYK A;  1JAQ A;  1BIW A;  1BQO A;  4JPA A;  4R3V A;  3LIL A;  1J7N A;  1OO9 A;  4L7A A;  4DV8 A;  1SLN A;  3KEJ A;  2OXW A;  3KEC A;  1K7Q A;  4PKU A;  3EHX A;  1XFY A;  1GKD A;  4DPE A;  1RM8 A;  4G9L A;  2V4B A;  1JIW P;  3ELM A;  3B2Z A;  1OM8 A;  4XM8 A;  5D2B A;  5CZM A;  3OHO A;  4GWM A;  3DSL A;  2POJ A;  4H2E A;  1MMQ A;  2ERQ A;  4PKW A;  456C A;  5I0L A;  2W0D A;  1USN A;  1G05 A;  3DPE A;  2OY4 A;  4WZV A;  1C7K A;  5L79 A;  3DTK A;  2MZI A;  1PWQ A;  3KMC A;  1CIZ A;  4ON1 A;  5B5O A;  4GR8 A;  2WO9 A;  1SU3 A;  2YUF A;  4I03 A;  1QJJ A;  1CAQ A;  3F16 A;  3WV1 A;  3EDI A;  5I3M A;  4J4M A;  3RTT A;  3ZUK A;  4WK7 A;  4Q1L A;  4G0D A;  1WNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...