3N2VA

Crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor n-hydroxy-2-(n-hydroxyethyl)biphenyl-4-ylsulfonamido)acetamide
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
158
structure length
158
Chain Sequence
b'GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Structure-based approach to nanomolar, water soluble matrix metalloproteinases inhibitors (MMPIs).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 43
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2010-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3n2vA00
1ATLA 1XFVA 2ERQA 4PKSA 2MLRA 1ZP5A 1IACA 1D8MA 3MA2A 5I0LA 1JAPA 3LJTA 4I35A 3LEAA 2YIGA 2CLTA 2OW9A 4XM7A 3Q2GA 1DTHA 1IADA 1BQOA 1HFCA 1ND1A 3EDIA 830CA 2OI0A 1JIZA 3F15A 1D7XA 1OMJA 5BOYA 4XM8A 3WV1A 4H30A 1ROSA 2FV9A 1Y93A 2DDFA 3VTGA 1G12A 3WV2A 2WOAA 4H2EA 1FBLA 3TS4A 456CA 1K7IA 1MNCA 1JKYA 2W12A 2XS3A 4ON1A 1GO8P 2MLSA 4WKIA 3EDGA 3KEKA 2ERPA 1QICA 1AF0A 2JNPA 1R1IA 2OVXA 1XFZA 2W13A 2EROA 2MZHA 2O3EA 2D1NA 1XFXA 4WK7A 3DPEA 2V4BA 3KEJA 1SRPA 1YOUA 5CUHA 5I2ZA 2Y6CA 3LUNA 5JMYA 2FV5A 3F16A 2OW1A 3DNGA 4GWMA 4GR8A 1I76A 1UMSA 1Y8JA 4FXYP 1SATA 3LQBA 1L6JA 1QIBA 2L0RA 3OHLA 3AYUA 3KRYA 1K7GA 4HMAA 4PKUA 1CGLA 2X7MA 1EAKA 3TSKA 3EWJA 4I03A 4L19A 1BQQM 1G4KA 1R1JA 3LMCA 1FM1A 4IUWA 1BUVM 5BOTA 1PWUA 3AYKA 3L0TA 1O0TA 4FXQA 1GKCA 2OVZA 5LABA 1AKLA 1JJ9A 3HDAP 1I73A 1SLMA 2CKIA 3EHXA 2POJA 4A7BA 3Q2HA 3WV3A 4JQGA 3E8RA 3NX7A 1ZS0A 5I4OA 3DWBA 1XUDA 1UTTA 1KBCA 1OS2A 1D5JA 3KMCA 2DDYA 1ASTA 1QIAA 3EHYA 1CIZA 4J4MA 5BPAA 3LJZA 2SRTA 1A86A 1BKCE 3B92A 3LKAA 1OM6A 4JP4A 3B2ZA 2N8RA 3O64A 2USNA 3LK8A 2OXUA 3N2UA 4CTHA 3ZXHA 1Q3AA 2MZIA 2PJTA 2OY2A 3HYGA 5D2BA 3GBOA 1KAPP 4DV8A 2K9CA 1PWVA 1CGFA 1KUFA 1HTDA 1KUIA 2TCLA 2OY4A 1R55A 3RTSA 1IAGA 1OS9A 1D8FA 4IN9A 3EDHA 1GXDA 3F19A 3LE9A 4H49A 1UMTA 2DW1A 3LGPA 2DW0A 2XS4A 4GQLA 1IABA 2OXWA 2W0DA 3AIGA 4H76A 4ILWD 2AIGP 1QUAA 1H71P 2I47A 4ZR5A 1XFWA 1YCMA 1A85A 3I7IA 1GE5A 1BKCA 2Y6DA 1ZVXA 3KHIA 3BA0A 2JIHA 5L7FA 1GO7P 2RJPA 5I3MA 3HY7A 1EUBA 966CA 4DD8A 1JIWP 1G05A 4GWNA 1C7KA 4FVLA 3ZVSA 2QPJA 1OO9A 4QKZA 1MMQA 1ZTQA 1GKDA 1HOVA 1S4BP 4JIJA 4GUYA 1IAAA 4AIGA 1UEAA 1C3IA 3F18A 1ZXVA 1MMPA 5CXAA 1USNA 1PWWA 1I1IP 4IJOA 3HBVP 4Q1LA 1IAEA 2X3AA 4GR0A 2X3CA 3KECA 1MMBA 1DMTA 1BM6A 4H1QA 1WNIA 1XFUA 4GF1A 1ZXCA 3K7NA 4PKTA 1HFSA 2JT6A 4PKQA 2DW2A 4WKEA 1BUDA 1GE7A 2O36A 1BKCI 3USNA 2J83A 5H8XA 1RMZA 2A8HA 3KWVC 3ZUKA 4AXQA 3DSLA 4AYKA 3N2VA 2OZRA 5D1UA 3KMEA 5D3CA 2WO8A 3EDZA 2J0TA 4PKVA 1SLNA 4PKWA 1J7NA 1QJJA 3OHOA 2D1OA 1B8YA 5CZMA 4FU4A 2OW2A 3G42A 3G5CA 1O0QA 4WF6A 3P1VA 2Z2DA 1PWPA 2JT5A 1CAQA 1R1HA 1CQRA 4R3VA 2KRJA 4XBHA 1R54A 3HBUP 1SU3A 4L6TA 1XUCA 5I43A 2MZEA 2K2GA 4HX3A 1MMRA 4H82A 4DF9A 1K7QA 2HU6A 4JA1A 1XURA 4PKRA 1KUKA 2E3XA 4H84A 3HDBA 1YP1A 3P24A 5I12A 1C8TA 3LJGA 3LILA 3TT4A 1G49A 2AYKA 2OXZA 4WZVA 3F17A 3SHIA 3LIRA 3CKIA 2W14A 4XM6A 3DL1A 5B5PA 1AYKA 2OW0A 3ELMA 3HY9A 4EFSA 1KUHA 1CGEA 4G0DA 3B8ZA 5D1TA 1QJIA 1RM8A 1HY7A 4JPAA 1EB6A 4G9LA 1JK3A 3TVCA 1FLSA 1G9KA 1JAOA 5B5OA 1SMPA 1B3DA 2E2DA 2WO9A 3HB2P 1OM7A 1Z3JA 2W15A 1CXVA 3RTTA 3I7GA 1JH1A 5D1SA 4A3WA 3LIKA 4GR3A 3UVCA 3VI1A 2X3BA 3O2XA 1Y0VA 1XFYA 4H3XA 4AUOA 3L0VA 4XCTA 1JANA 3LQ0A 4L63A 3V96B 3F1AA 5D7WA 2RJQA 2JSDA 1KUGA 3DPFA 3LUMA 1HV5A 3U1RA 1JAQA 1BZSA 4DPEA 1OM8A 5L79A 1UTZA 2YB9A 1BSWA 1GE6A 1YQYA 3K7LA 1BIWA 1CK7A 1PWQA
chains in the Genus database with same CATH superfamily
1ATLA 1XFVA 2ERQA 4PKSA 2MLRA 1ZP5A 1IACA 1D8MA 3MA2A 5I0LA 1JAPA 3LJTA 4I35A 3LEAA 2YIGA 2CLTA 2OW9A 4XM7A 3Q2GA 1DTHA 1IADA 1BQOA 1HFCA 1ND1A 3EDIA 830CA 2OI0A 1JIZA 3F15A 1D7XA 1OMJA 5BOYA 4XM8A 3WV1A 4H30A 1ROSA 2FV9A 1Y93A 2DDFA 3VTGA 1G12A 3WV2A 2WOAA 4H2EA 1FBLA 3TS4A 456CA 1K7IA 1MNCA 1JKYA 2W12A 2XS3A 4ON1A 1GO8P 2MLSA 4WKIA 3EDGA 2YUFA 3KEKA 2ERPA 1QICA 1AF0A 2JNPA 1R1IA 2OVXA 1XFZA 2W13A 2EROA 2MZHA 2O3EA 2D1NA 1XFXA 4WK7A 3DPEA 3DTKA 2V4BA 3KEJA 1SRPA 1YOUA 1XM5A 5CUHA 5I2ZA 2Y6CA 3LUNA 5JMYA 2FV5A 3F16A 2OW1A 3DNGA 4GWMA 4GR8A 1I76A 1UMSA 1Y8JA 4FXYP 1SATA 3LQBA 1L6JA 1QIBA 2L0RA 3OHLA 3AYUA 3KRYA 1K7GA 4HMAA 4PKUA 1CGLA 2X7MA 3DTEA 1EAKA 3TSKA 4L7AA 3EWJA 4I03A 4L19A 1BQQM 1G4KA 1R1JA 3LMCA 1FM1A 4IUWA 1BUVM 5BOTA 1PWUA 3AYKA 3L0TA 1O0TA 4FXQA 1GKCA 2OVZA 5LABA 1AKLA 1JJ9A 3HDAP 1I73A 3DTIA 1SLMA 2CKIA 3EHXA 2POJA 4A7BA 3Q2HA 3WV3A 4JQGA 3E8RA 3NX7A 1ZS0A 5I4OA 3DWBA 1XUDA 1UTTA 1KBCA 1OS2A 1D5JA 3KMCA 2DDYA 1ASTA 1QIAA 3EHYA 1CIZA 4J4MA 5BPAA 3LJZA 2SRTA 1XAXA 1A86A 1BKCE 3B92A 3LKAA 1OM6A 4JP4A 3B2ZA 2N8RA 3O64A 2USNA 3LK8A 2OXUA 3N2UA 4CTHA 3ZXHA 1Q3AA 2MZIA 2PJTA 2OY2A 3HYGA 5D2BA 3GBOA 1KAPP 4DV8A 2K9CA 1PWVA 1CGFA 1KUFA 1HTDA 1KUIA 2TCLA 2OY4A 1R55A 3RTSA 1IAGA 1OS9A 1D8FA 4IN9A 3EDHA 1GXDA 3F19A 3LE9A 4H49A 1UMTA 2DW1A 3LGPA 2DW0A 2XS4A 4GQLA 1IABA 2OXWA 2W0DA 3AIGA 4H76A 4ILWD 2AIGP 1QUAA 1H71P 2I47A 4ZR5A 1XFWA 1YCMA 1A85A 3I7IA 1GE5A 1BKCA 2Y6DA 1ZVXA 3KHIA 3BA0A 2JIHA 5L7FA 1GO7P 2RJPA 5I3MA 3HY7A 1EUBA 966CA 4DD8A 1JIWP 1G05A 4GWNA 1C7KA 4FVLA 3ZVSA 2QPJA 1OO9A 4QKZA 1MMQA 1ZTQA 1GKDA 1HOVA 1S4BP 4JIJA 4GUYA 1IAAA 4AIGA 1UEAA 1C3IA 3F18A 1ZXVA 1MMPA 5CXAA 1USNA 1PWWA 1I1IP 4IJOA 3HBVP 4Q1LA 1IAEA 2X3AA 4GR0A 2X3CA 3KECA 1MMBA 1DMTA 1BM6A 4H1QA 1WNIA 1XFUA 4GF1A 1ZXCA 3K7NA 4PKTA 1HFSA 2JT6A 4PKQA 2DW2A 4WKEA 1BUDA 1GE7A 2O36A 1BKCI 3USNA 2J83A 5H8XA 1RMZA 2A8HA 3KWVC 3ZUKA 4AXQA 1TVIA 3DSLA 4AYKA 3N2VA 2OZRA 5D1UA 3KMEA 5D3CA 2WO8A 3EDZA 2J0TA 4PKVA 1SLNA 4PKWA 1J7NA 1QJJA 3OHOA 2D1OA 1B8YA 5CZMA 4FU4A 2OW2A 3G42A 3G5CA 1O0QA 4WF6A 3P1VA 2Z2DA 1PWPA 2JT5A 1CAQA 1R1HA 1CQRA 4R3VA 2KRJA 4XBHA 1R54A 3HBUP 1SU3A 4L6TA 1XUCA 5I43A 2MZEA 2K2GA 4HX3A 1MMRA 4H82A 4DF9A 1K7QA 2HU6A 4JA1A 1XURA 4PKRA 1KUKA 2E3XA 4H84A 3HDBA 1YP1A 3P24A 5I12A 1C8TA 3LJGA 3LILA 3TT4A 1G49A 2AYKA 2OXZA 4WZVA 3F17A 3SHIA 3LIRA 3CKIA 2W14A 4XM6A 3DL1A 5B5PA 1AYKA 2OW0A 3ELMA 3HY9A 4EFSA 1KUHA 1CGEA 4G0DA 3B8ZA 5D1TA 1QJIA 1RM8A 1HY7A 4JPAA 1EB6A 4G9LA 1JK3A 3TVCA 1FLSA 1G9KA 1JAOA 5B5OA 1SMPA 1B3DA 2E2DA 2WO9A 3HB2P 1OM7A 1Z3JA 2W15A 1CXVA 3RTTA 3I7GA 1JH1A 5D1SA 4A3WA 3LIKA 4GR3A 3UVCA 3VI1A 2X3BA 3O2XA 1Y0VA 1XFYA 4H3XA 4AUOA 3L0VA 4XCTA 1JANA 1OZ9A 3LQ0A 4L63A 3V96B 3F1AA 5D7WA 2RJQA 2JSDA 1KUGA 3DPFA 3LUMA 1HV5A 3U1RA 1JAQA 1BZSA 4DPEA 1OM8A 5L79A 1UTZA 2YB9A 1BSWA 1GE6A 1YQYA 3K7LA 1BIWA 1CK7A 1PWQA
chains in the Genus database with same CATH topology
1ATLA 1XFVA 2ERQA 4PKSA 2MLRA 1ZP5A 1IACA 1D8MA 3MA2A 5I0LA 1JAPA 3LJTA 4I35A 3LEAA 2YIGA 2CLTA 2OW9A 4XM7A 3Q2GA 1DTHA 1IADA 1BQOA 1HFCA 1ND1A 3EDIA 830CA 2OI0A 1JIZA 3F15A 1D7XA 1OMJA 5BOYA 4XM8A 3WV1A 4H30A 1ROSA 2FV9A 1Y93A 2DDFA 3VTGA 1G12A 3WV2A 2WOAA 4H2EA 1FBLA 3TS4A 456CA 1K7IA 1MNCA 1JKYA 2W12A 2XS3A 4ON1A 1GO8P 2MLSA 4WKIA 3EDGA 2YUFA 3KEKA 2ERPA 1QICA 1AF0A 2JNPA 1R1IA 2OVXA 1XFZA 2W13A 2EROA 2MZHA 2O3EA 2D1NA 1XFXA 4WK7A 3DPEA 3DTKA 2V4BA 3KEJA 1SRPA 1YOUA 5CUHA 5I2ZA 2Y6CA 3LUNA 5JMYA 2FV5A 3F16A 2OW1A 3DNGA 4GWMA 4GR8A 1I76A 1UMSA 1Y8JA 4FXYP 1SATA 3LQBA 1L6JA 1QIBA 2L0RA 3OHLA 3AYUA 3KRYA 1K7GA 4HMAA 4PKUA 1CGLA 2X7MA 3DTEA 1EAKA 3TSKA 4L7AA 3EWJA 4I03A 4L19A 1BQQM 1G4KA 1R1JA 3LMCA 1FM1A 4IUWA 1BUVM 5BOTA 1PWUA 3AYKA 3L0TA 1O0TA 4FXQA 1GKCA 2OVZA 5LABA 1AKLA 1JJ9A 3HDAP 1I73A 3DTIA 1SLMA 2CKIA 3EHXA 2POJA 4A7BA 3Q2HA 3WV3A 4JQGA 3E8RA 3NX7A 1ZS0A 5I4OA 3DWBA 1XUDA 1UTTA 1KBCA 1OS2A 1D5JA 3KMCA 2DDYA 1ASTA 1QIAA 3EHYA 1CIZA 4J4MA 5BPAA 3LJZA 2SRTA 1A86A 1BKCE 3B92A 3LKAA 1OM6A 4JP4A 3B2ZA 2N8RA 3O64A 2USNA 3LK8A 2OXUA 3N2UA 4CTHA 3ZXHA 1Q3AA 2MZIA 2PJTA 2OY2A 3HYGA 5D2BA 3GBOA 1KAPP 4DV8A 2K9CA 1PWVA 1CGFA 1KUFA 1HTDA 1KUIA 2TCLA 2OY4A 1R55A 3RTSA 1IAGA 1OS9A 1D8FA 4IN9A 3EDHA 1GXDA 3F19A 3LE9A 4H49A 1UMTA 2DW1A 3LGPA 2DW0A 2XS4A 4GQLA 1IABA 2OXWA 2W0DA 3AIGA 4H76A 4ILWD 2AIGP 1QUAA 1H71P 2I47A 4ZR5A 1XFWA 1YCMA 1A85A 3I7IA 1GE5A 1BKCA 2Y6DA 1ZVXA 3KHIA 3BA0A 2JIHA 5L7FA 1GO7P 2RJPA 5I3MA 3HY7A 1EUBA 966CA 4DD8A 1JIWP 1G05A 4GWNA 1C7KA 4FVLA 3ZVSA 2QPJA 1OO9A 4QKZA 1MMQA 1ZTQA 1GKDA 1HOVA 1S4BP 4JIJA 4GUYA 1IAAA 4AIGA 1UEAA 1C3IA 3F18A 1ZXVA 1MMPA 5CXAA 1USNA 1PWWA 1I1IP 4IJOA 3HBVP 4Q1LA 1IAEA 2X3AA 4GR0A 2X3CA 3KECA 1MMBA 1DMTA 1BM6A 4H1QA 1WNIA 1XFUA 4GF1A 1ZXCA 3K7NA 4PKTA 1HFSA 2JT6A 4PKQA 2DW2A 4WKEA 1BUDA 1GE7A 2O36A 1BKCI 3USNA 2J83A 5H8XA 1RMZA 2A8HA 3KWVC 3ZUKA 4AXQA 3DSLA 4AYKA 3N2VA 2OZRA 5D1UA 3KMEA 5D3CA 2WO8A 3EDZA 2J0TA 4PKVA 1SLNA 4PKWA 1J7NA 1QJJA 3OHOA 2D1OA 1B8YA 5CZMA 4FU4A 2OW2A 3G42A 3G5CA 1O0QA 4WF6A 3P1VA 2Z2DA 1PWPA 2JT5A 1CAQA 1R1HA 1CQRA 4R3VA 2KRJA 4XBHA 1R54A 3HBUP 1SU3A 4L6TA 1XUCA 5I43A 2MZEA 2K2GA 4HX3A 1MMRA 4H82A 4DF9A 1K7QA 2HU6A 4JA1A 1XURA 4PKRA 1KUKA 2E3XA 4H84A 3HDBA 1YP1A 3P24A 5I12A 1C8TA 3LJGA 3LILA 3TT4A 1G49A 2AYKA 2OXZA 4WZVA 3F17A 3SHIA 3LIRA 3CKIA 2W14A 4XM6A 3DL1A 5B5PA 1AYKA 2OW0A 3ELMA 3HY9A 4EFSA 1KUHA 1CGEA 4G0DA 3B8ZA 5D1TA 1QJIA 1RM8A 1HY7A 4JPAA 1EB6A 4G9LA 1JK3A 3TVCA 1FLSA 1G9KA 1JAOA 5B5OA 1SMPA 1B3DA 2E2DA 2WO9A 3HB2P 1OM7A 1Z3JA 2W15A 1CXVA 3RTTA 3I7GA 1JH1A 5D1SA 4A3WA 3LIKA 4GR3A 3UVCA 3VI1A 2X3BA 3O2XA 1Y0VA 1XFYA 4H3XA 4AUOA 3L0VA 4XCTA 1JANA 3LQ0A 4L63A 3V96B 3F1AA 5D7WA 2RJQA 2JSDA 1KUGA 3DPFA 3LUMA 1HV5A 3U1RA 1JAQA 1BZSA 4DPEA 1OM8A 5L79A 1UTZA 2YB9A 1BSWA 1GE6A 1YQYA 3K7LA 1BIWA 1CK7A 1PWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ATL A;  1XFV A;  2ERQ A;  4PKS A;  2MLR A;  1ZP5 A;  1IAC A;  1D8M A;  3MA2 A;  5I0L A;  1JAP A;  3LJT A;  4I35 A;  3LEA A;  2YIG A;  2CLT A;  2OW9 A;  4XM7 A;  3Q2G A;  1DTH A;  1IAD A;  1BQO A;  1HFC A;  1ND1 A;  3EDI A;  830C A;  2OI0 A;  1JIZ A;  3F15 A;  1D7X A;  1OMJ A;  5BOY A;  4XM8 A;  3WV1 A;  4H30 A;  1ROS A;  2FV9 A;  1Y93 A;  2DDF A;  3VTG A;  1G12 A;  3WV2 A;  2WOA A;  4H2E A;  1FBL A;  3TS4 A;  456C A;  1K7I A;  1MNC A;  1JKY A;  2W12 A;  2XS3 A;  4ON1 A;  1GO8 P;  2MLS A;  4WKI A;  3EDG A;  3KEK A;  2ERP A;  1QIC A;  1AF0 A;  2JNP A;  1R1I A;  2OVX A;  1XFZ A;  2W13 A;  2ERO A;  2MZH A;  2O3E A;  2D1N A;  1XFX A;  4WK7 A;  3DPE A;  2V4B A;  3KEJ A;  1SRP A;  1YOU A;  5CUH A;  5I2Z A;  2Y6C A;  3LUN A;  5JMY A;  2FV5 A;  3F16 A;  2OW1 A;  3DNG A;  4GWM A;  4GR8 A;  1I76 A;  1UMS A;  1Y8J A;  4FXY P;  1SAT A;  3LQB A;  1L6J A;  1QIB A;  2L0R A;  3OHL A;  3AYU A;  3KRY A;  1K7G A;  4HMA A;  4PKU A;  1CGL A;  2X7M A;  1EAK A;  3TSK A;  3EWJ A;  4I03 A;  4L19 A;  1BQQ M;  1G4K A;  1R1J A;  3LMC A;  1FM1 A;  4IUW A;  1BUV M;  5BOT A;  1PWU A;  3AYK A;  3L0T A;  1O0T A;  4FXQ A;  1GKC A;  2OVZ A;  5LAB A;  1AKL A;  1JJ9 A;  3HDA P;  1I73 A;  1SLM A;  2CKI A;  3EHX A;  2POJ A;  4A7B A;  3Q2H A;  3WV3 A;  4JQG A;  3E8R A;  3NX7 A;  1ZS0 A;  5I4O A;  3DWB A;  1XUD A;  1UTT A;  1KBC A;  1OS2 A;  1D5J A;  3KMC A;  2DDY A;  1AST A;  1QIA A;  3EHY A;  1CIZ A;  4J4M A;  5BPA A;  3LJZ A;  2SRT A;  1A86 A;  1BKC E;  3B92 A;  3LKA A;  1OM6 A;  4JP4 A;  3B2Z A;  2N8R A;  3O64 A;  2USN A;  3LK8 A;  2OXU A;  3N2U A;  4CTH A;  3ZXH A;  1Q3A A;  2MZI A;  2PJT A;  2OY2 A;  3HYG A;  5D2B A;  3GBO A;  1KAP P;  4DV8 A;  2K9C A;  1PWV A;  1CGF A;  1KUF A;  1HTD A;  1KUI A;  2TCL A;  2OY4 A;  1R55 A;  3RTS A;  1IAG A;  1OS9 A;  1D8F A;  4IN9 A;  3EDH A;  1GXD A;  3F19 A;  3LE9 A;  4H49 A;  1UMT A;  2DW1 A;  3LGP A;  2DW0 A;  2XS4 A;  4GQL A;  1IAB A;  2OXW A;  2W0D A;  3AIG A;  4H76 A;  4ILW D;  2AIG P;  1QUA A;  1H71 P;  2I47 A;  4ZR5 A;  1XFW A;  1YCM A;  1A85 A;  3I7I A;  1GE5 A;  1BKC A;  2Y6D A;  1ZVX A;  3KHI A;  3BA0 A;  2JIH A;  5L7F A;  1GO7 P;  2RJP A;  5I3M A;  3HY7 A;  1EUB A;  966C A;  4DD8 A;  1JIW P;  1G05 A;  4GWN A;  1C7K A;  4FVL A;  3ZVS A;  2QPJ A;  1OO9 A;  4QKZ A;  1MMQ A;  1ZTQ A;  1GKD A;  1HOV A;  1S4B P;  4JIJ A;  4GUY A;  1IAA A;  4AIG A;  1UEA A;  1C3I A;  3F18 A;  1ZXV A;  1MMP A;  5CXA A;  1USN A;  1PWW A;  1I1I P;  4IJO A;  3HBV P;  4Q1L A;  1IAE A;  2X3A A;  4GR0 A;  2X3C A;  3KEC A;  1MMB A;  1DMT A;  1BM6 A;  4H1Q A;  1WNI A;  1XFU A;  4GF1 A;  1ZXC A;  3K7N A;  4PKT A;  1HFS A;  2JT6 A;  4PKQ A;  2DW2 A;  4WKE A;  1BUD A;  1GE7 A;  2O36 A;  1BKC I;  3USN A;  2J83 A;  5H8X A;  1RMZ A;  2A8H A;  3KWV C;  3ZUK A;  4AXQ A;  3DSL A;  4AYK A;  3N2V A;  2OZR A;  5D1U A;  3KME A;  5D3C A;  2WO8 A;  3EDZ A;  2J0T A;  4PKV A;  1SLN A;  4PKW A;  1J7N A;  1QJJ A;  3OHO A;  2D1O A;  1B8Y A;  5CZM A;  4FU4 A;  2OW2 A;  3G42 A;  3G5C A;  1O0Q A;  4WF6 A;  3P1V A;  2Z2D A;  1PWP A;  2JT5 A;  1CAQ A;  1R1H A;  1CQR A;  4R3V A;  2KRJ A;  4XBH A;  1R54 A;  3HBU P;  1SU3 A;  4L6T A;  1XUC A;  5I43 A;  2MZE A;  2K2G A;  4HX3 A;  1MMR A;  4H82 A;  4DF9 A;  1K7Q A;  2HU6 A;  4JA1 A;  1XUR A;  4PKR A;  1KUK A;  2E3X A;  4H84 A;  3HDB A;  1YP1 A;  3P24 A;  5I12 A;  1C8T A;  3LJG A;  3LIL A;  3TT4 A;  1G49 A;  2AYK A;  2OXZ A;  4WZV A;  3F17 A;  3SHI A;  3LIR A;  3CKI A;  2W14 A;  4XM6 A;  3DL1 A;  5B5P A;  1AYK A;  2OW0 A;  3ELM A;  3HY9 A;  4EFS A;  1KUH A;  1CGE A;  4G0D A;  3B8Z A;  5D1T A;  1QJI A;  1RM8 A;  1HY7 A;  4JPA A;  1EB6 A;  4G9L A;  1JK3 A;  3TVC A;  1FLS A;  1G9K A;  1JAO A;  5B5O A;  1SMP A;  1B3D A;  2E2D A;  2WO9 A;  3HB2 P;  1OM7 A;  1Z3J A;  2W15 A;  1CXV A;  3RTT A;  3I7G A;  1JH1 A;  5D1S A;  4A3W A;  3LIK A;  4GR3 A;  3UVC A;  3VI1 A;  2X3B A;  3O2X A;  1Y0V A;  1XFY A;  4H3X A;  4AUO A;  3L0V A;  4XCT A;  1JAN A;  3LQ0 A;  4L63 A;  3V96 B;  3F1A A;  5D7W A;  2RJQ A;  2JSD A;  1KUG A;  3DPF A;  3LUM A;  1HV5 A;  3U1R A;  1JAQ A;  1BZS A;  4DPE A;  1OM8 A;  5L79 A;  1UTZ A;  2YB9 A;  1BSW A;  1GE6 A;  1YQY A;  3K7L A;  1BIW A;  1CK7 A;  1PWQ A; 
#chains in the Genus database with same CATH topology
 1ATL A;  1XFV A;  2ERQ A;  4PKS A;  2MLR A;  1ZP5 A;  1IAC A;  1D8M A;  3MA2 A;  5I0L A;  1JAP A;  3LJT A;  4I35 A;  3LEA A;  2YIG A;  2CLT A;  2OW9 A;  4XM7 A;  3Q2G A;  1DTH A;  1IAD A;  1BQO A;  1HFC A;  1ND1 A;  3EDI A;  830C A;  2OI0 A;  1JIZ A;  3F15 A;  1D7X A;  1OMJ A;  5BOY A;  4XM8 A;  3WV1 A;  4H30 A;  1ROS A;  2FV9 A;  1Y93 A;  2DDF A;  3VTG A;  1G12 A;  3WV2 A;  2WOA A;  4H2E A;  1FBL A;  3TS4 A;  456C A;  1K7I A;  1MNC A;  1JKY A;  2W12 A;  2XS3 A;  4ON1 A;  1GO8 P;  2MLS A;  4WKI A;  3EDG A;  2YUF A;  3KEK A;  2ERP A;  1QIC A;  1AF0 A;  2JNP A;  1R1I A;  2OVX A;  1XFZ A;  2W13 A;  2ERO A;  2MZH A;  2O3E A;  2D1N A;  1XFX A;  4WK7 A;  3DPE A;  3DTK A;  2V4B A;  3KEJ A;  1SRP A;  1YOU A;  1XM5 A;  5CUH A;  5I2Z A;  2Y6C A;  3LUN A;  5JMY A;  2FV5 A;  3F16 A;  2OW1 A;  3DNG A;  4GWM A;  4GR8 A;  1I76 A;  1UMS A;  1Y8J A;  4FXY P;  1SAT A;  3LQB A;  1L6J A;  1QIB A;  2L0R A;  3OHL A;  3AYU A;  3KRY A;  1K7G A;  4HMA A;  4PKU A;  1CGL A;  2X7M A;  3DTE A;  1EAK A;  3TSK A;  4L7A A;  3EWJ A;  4I03 A;  4L19 A;  1BQQ M;  1G4K A;  1R1J A;  3LMC A;  1FM1 A;  4IUW A;  1BUV M;  5BOT A;  1PWU A;  3AYK A;  3L0T A;  1O0T A;  4FXQ A;  1GKC A;  2OVZ A;  5LAB A;  1AKL A;  1JJ9 A;  3HDA P;  1I73 A;  3DTI A;  1SLM A;  2CKI A;  3EHX A;  2POJ A;  4A7B A;  3Q2H A;  3WV3 A;  4JQG A;  3E8R A;  3NX7 A;  1ZS0 A;  5I4O A;  3DWB A;  1XUD A;  1UTT A;  1KBC A;  1OS2 A;  1D5J A;  3KMC A;  2DDY A;  1AST A;  1QIA A;  3EHY A;  1CIZ A;  4J4M A;  5BPA A;  3LJZ A;  2SRT A;  1XAX A;  1A86 A;  1BKC E;  3B92 A;  3LKA A;  1OM6 A;  4JP4 A;  3B2Z A;  2N8R A;  3O64 A;  2USN A;  3LK8 A;  2OXU A;  3N2U A;  4CTH A;  3ZXH A;  1Q3A A;  2MZI A;  2PJT A;  2OY2 A;  3HYG A;  5D2B A;  3GBO A;  1KAP P;  4DV8 A;  2K9C A;  1PWV A;  1CGF A;  1KUF A;  1HTD A;  1KUI A;  2TCL A;  2OY4 A;  1R55 A;  3RTS A;  1IAG A;  1OS9 A;  1D8F A;  4IN9 A;  3EDH A;  1GXD A;  3F19 A;  3LE9 A;  4H49 A;  1UMT A;  2DW1 A;  3LGP A;  2DW0 A;  2XS4 A;  4GQL A;  1IAB A;  2OXW A;  2W0D A;  3AIG A;  4H76 A;  4ILW D;  2AIG P;  1QUA A;  1H71 P;  2I47 A;  4ZR5 A;  1XFW A;  1YCM A;  1A85 A;  3I7I A;  1GE5 A;  1BKC A;  2Y6D A;  1ZVX A;  3KHI A;  3BA0 A;  2JIH A;  5L7F A;  1GO7 P;  2RJP A;  5I3M A;  3HY7 A;  1EUB A;  966C A;  4DD8 A;  1JIW P;  1G05 A;  4GWN A;  1C7K A;  4FVL A;  3ZVS A;  2QPJ A;  1OO9 A;  4QKZ A;  1MMQ A;  1ZTQ A;  1GKD A;  1HOV A;  1S4B P;  4JIJ A;  4GUY A;  1IAA A;  4AIG A;  1UEA A;  1C3I A;  3F18 A;  1ZXV A;  1MMP A;  5CXA A;  1USN A;  1PWW A;  1I1I P;  4IJO A;  3HBV P;  4Q1L A;  1IAE A;  2X3A A;  4GR0 A;  2X3C A;  3KEC A;  1MMB A;  1DMT A;  1BM6 A;  4H1Q A;  1WNI A;  1XFU A;  4GF1 A;  1ZXC A;  3K7N A;  4PKT A;  1HFS A;  2JT6 A;  4PKQ A;  2DW2 A;  4WKE A;  1BUD A;  1GE7 A;  2O36 A;  1BKC I;  3USN A;  2J83 A;  5H8X A;  1RMZ A;  2A8H A;  3KWV C;  3ZUK A;  4AXQ A;  1TVI A;  3DSL A;  4AYK A;  3N2V A;  2OZR A;  5D1U A;  3KME A;  5D3C A;  2WO8 A;  3EDZ A;  2J0T A;  4PKV A;  1SLN A;  4PKW A;  1J7N A;  1QJJ A;  3OHO A;  2D1O A;  1B8Y A;  5CZM A;  4FU4 A;  2OW2 A;  3G42 A;  3G5C A;  1O0Q A;  4WF6 A;  3P1V A;  2Z2D A;  1PWP A;  2JT5 A;  1CAQ A;  1R1H A;  1CQR A;  4R3V A;  2KRJ A;  4XBH A;  1R54 A;  3HBU P;  1SU3 A;  4L6T A;  1XUC A;  5I43 A;  2MZE A;  2K2G A;  4HX3 A;  1MMR A;  4H82 A;  4DF9 A;  1K7Q A;  2HU6 A;  4JA1 A;  1XUR A;  4PKR A;  1KUK A;  2E3X A;  4H84 A;  3HDB A;  1YP1 A;  3P24 A;  5I12 A;  1C8T A;  3LJG A;  3LIL A;  3TT4 A;  1G49 A;  2AYK A;  2OXZ A;  4WZV A;  3F17 A;  3SHI A;  3LIR A;  3CKI A;  2W14 A;  4XM6 A;  3DL1 A;  5B5P A;  1AYK A;  2OW0 A;  3ELM A;  3HY9 A;  4EFS A;  1KUH A;  1CGE A;  4G0D A;  3B8Z A;  5D1T A;  1QJI A;  1RM8 A;  1HY7 A;  4JPA A;  1EB6 A;  4G9L A;  1JK3 A;  3TVC A;  1FLS A;  1G9K A;  1JAO A;  5B5O A;  1SMP A;  1B3D A;  2E2D A;  2WO9 A;  3HB2 P;  1OM7 A;  1Z3J A;  2W15 A;  1CXV A;  3RTT A;  3I7G A;  1JH1 A;  5D1S A;  4A3W A;  3LIK A;  4GR3 A;  3UVC A;  3VI1 A;  2X3B A;  3O2X A;  1Y0V A;  1XFY A;  4H3X A;  4AUO A;  3L0V A;  4XCT A;  1JAN A;  1OZ9 A;  3LQ0 A;  4L63 A;  3V96 B;  3F1A A;  5D7W A;  2RJQ A;  2JSD A;  1KUG A;  3DPF A;  3LUM A;  1HV5 A;  3U1R A;  1JAQ A;  1BZS A;  4DPE A;  1OM8 A;  5L79 A;  1UTZ A;  2YB9 A;  1BSW A;  1GE6 A;  1YQY A;  3K7L A;  1BIW A;  1CK7 A;  1PWQ A; 
#chains in the Genus database with same CATH homology
 1ATL A;  1XFV A;  2ERQ A;  4PKS A;  2MLR A;  1ZP5 A;  1IAC A;  1D8M A;  3MA2 A;  5I0L A;  1JAP A;  3LJT A;  4I35 A;  3LEA A;  2YIG A;  2CLT A;  2OW9 A;  4XM7 A;  3Q2G A;  1DTH A;  1IAD A;  1BQO A;  1HFC A;  1ND1 A;  3EDI A;  830C A;  2OI0 A;  1JIZ A;  3F15 A;  1D7X A;  1OMJ A;  5BOY A;  4XM8 A;  3WV1 A;  4H30 A;  1ROS A;  2FV9 A;  1Y93 A;  2DDF A;  3VTG A;  1G12 A;  3WV2 A;  2WOA A;  4H2E A;  1FBL A;  3TS4 A;  456C A;  1K7I A;  1MNC A;  1JKY A;  2W12 A;  2XS3 A;  4ON1 A;  1GO8 P;  2MLS A;  4WKI A;  3EDG A;  2YUF A;  3KEK A;  2ERP A;  1QIC A;  1AF0 A;  2JNP A;  1R1I A;  2OVX A;  1XFZ A;  2W13 A;  2ERO A;  2MZH A;  2O3E A;  2D1N A;  1XFX A;  4WK7 A;  3DPE A;  3DTK A;  2V4B A;  3KEJ A;  1SRP A;  1YOU A;  5CUH A;  5I2Z A;  2Y6C A;  3LUN A;  5JMY A;  2FV5 A;  3F16 A;  2OW1 A;  3DNG A;  4GWM A;  4GR8 A;  1I76 A;  1UMS A;  1Y8J A;  4FXY P;  1SAT A;  3LQB A;  1L6J A;  1QIB A;  2L0R A;  3OHL A;  3AYU A;  3KRY A;  1K7G A;  4HMA A;  4PKU A;  1CGL A;  2X7M A;  3DTE A;  1EAK A;  3TSK A;  4L7A A;  3EWJ A;  4I03 A;  4L19 A;  1BQQ M;  1G4K A;  1R1J A;  3LMC A;  1FM1 A;  4IUW A;  1BUV M;  5BOT A;  1PWU A;  3AYK A;  3L0T A;  1O0T A;  4FXQ A;  1GKC A;  2OVZ A;  5LAB A;  1AKL A;  1JJ9 A;  3HDA P;  1I73 A;  3DTI A;  1SLM A;  2CKI A;  3EHX A;  2POJ A;  4A7B A;  3Q2H A;  3WV3 A;  4JQG A;  3E8R A;  3NX7 A;  1ZS0 A;  5I4O A;  3DWB A;  1XUD A;  1UTT A;  1KBC A;  1OS2 A;  1D5J A;  3KMC A;  2DDY A;  1AST A;  1QIA A;  3EHY A;  1CIZ A;  4J4M A;  5BPA A;  3LJZ A;  2SRT A;  1A86 A;  1BKC E;  3B92 A;  3LKA A;  1OM6 A;  4JP4 A;  3B2Z A;  2N8R A;  3O64 A;  2USN A;  3LK8 A;  2OXU A;  3N2U A;  4CTH A;  3ZXH A;  1Q3A A;  2MZI A;  2PJT A;  2OY2 A;  3HYG A;  5D2B A;  3GBO A;  1KAP P;  4DV8 A;  2K9C A;  1PWV A;  1CGF A;  1KUF A;  1HTD A;  1KUI A;  2TCL A;  2OY4 A;  1R55 A;  3RTS A;  1IAG A;  1OS9 A;  1D8F A;  4IN9 A;  3EDH A;  1GXD A;  3F19 A;  3LE9 A;  4H49 A;  1UMT A;  2DW1 A;  3LGP A;  2DW0 A;  2XS4 A;  4GQL A;  1IAB A;  2OXW A;  2W0D A;  3AIG A;  4H76 A;  4ILW D;  2AIG P;  1QUA A;  1H71 P;  2I47 A;  4ZR5 A;  1XFW A;  1YCM A;  1A85 A;  3I7I A;  1GE5 A;  1BKC A;  2Y6D A;  1ZVX A;  3KHI A;  3BA0 A;  2JIH A;  5L7F A;  1GO7 P;  2RJP A;  5I3M A;  3HY7 A;  1EUB A;  966C A;  4DD8 A;  1JIW P;  1G05 A;  4GWN A;  1C7K A;  4FVL A;  3ZVS A;  2QPJ A;  1OO9 A;  4QKZ A;  1MMQ A;  1ZTQ A;  1GKD A;  1HOV A;  1S4B P;  4JIJ A;  4GUY A;  1IAA A;  4AIG A;  1UEA A;  1C3I A;  3F18 A;  1ZXV A;  1MMP A;  5CXA A;  1USN A;  1PWW A;  1I1I P;  4IJO A;  3HBV P;  4Q1L A;  1IAE A;  2X3A A;  4GR0 A;  2X3C A;  3KEC A;  1MMB A;  1DMT A;  1BM6 A;  4H1Q A;  1WNI A;  1XFU A;  4GF1 A;  1ZXC A;  3K7N A;  4PKT A;  1HFS A;  2JT6 A;  4PKQ A;  2DW2 A;  4WKE A;  1BUD A;  1GE7 A;  2O36 A;  1BKC I;  3USN A;  2J83 A;  5H8X A;  1RMZ A;  2A8H A;  3KWV C;  3ZUK A;  4AXQ A;  3DSL A;  4AYK A;  3N2V A;  2OZR A;  5D1U A;  3KME A;  5D3C A;  2WO8 A;  3EDZ A;  2J0T A;  4PKV A;  1SLN A;  4PKW A;  1J7N A;  1QJJ A;  3OHO A;  2D1O A;  1B8Y A;  5CZM A;  4FU4 A;  2OW2 A;  3G42 A;  3G5C A;  1O0Q A;  4WF6 A;  3P1V A;  2Z2D A;  1PWP A;  2JT5 A;  1CAQ A;  1R1H A;  1CQR A;  4R3V A;  2KRJ A;  4XBH A;  1R54 A;  3HBU P;  1SU3 A;  4L6T A;  1XUC A;  5I43 A;  2MZE A;  2K2G A;  4HX3 A;  1MMR A;  4H82 A;  4DF9 A;  1K7Q A;  2HU6 A;  4JA1 A;  1XUR A;  4PKR A;  1KUK A;  2E3X A;  4H84 A;  3HDB A;  1YP1 A;  3P24 A;  5I12 A;  1C8T A;  3LJG A;  3LIL A;  3TT4 A;  1G49 A;  2AYK A;  2OXZ A;  4WZV A;  3F17 A;  3SHI A;  3LIR A;  3CKI A;  2W14 A;  4XM6 A;  3DL1 A;  5B5P A;  1AYK A;  2OW0 A;  3ELM A;  3HY9 A;  4EFS A;  1KUH A;  1CGE A;  4G0D A;  3B8Z A;  5D1T A;  1QJI A;  1RM8 A;  1HY7 A;  4JPA A;  1EB6 A;  4G9L A;  1JK3 A;  3TVC A;  1FLS A;  1G9K A;  1JAO A;  5B5O A;  1SMP A;  1B3D A;  2E2D A;  2WO9 A;  3HB2 P;  1OM7 A;  1Z3J A;  2W15 A;  1CXV A;  3RTT A;  3I7G A;  1JH1 A;  5D1S A;  4A3W A;  3LIK A;  4GR3 A;  3UVC A;  3VI1 A;  2X3B A;  3O2X A;  1Y0V A;  1XFY A;  4H3X A;  4AUO A;  3L0V A;  4XCT A;  1JAN A;  3LQ0 A;  4L63 A;  3V96 B;  3F1A A;  5D7W A;  2RJQ A;  2JSD A;  1KUG A;  3DPF A;  3LUM A;  1HV5 A;  3U1R A;  1JAQ A;  1BZS A;  4DPE A;  1OM8 A;  5L79 A;  1UTZ A;  2YB9 A;  1BSW A;  1GE6 A;  1YQY A;  3K7L A;  1BIW A;  1CK7 A;  1PWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...