3N2XA

Crystal structure of yage, a prophage protein belonging to the dihydrodipicolinic acid synthase family from e. coli k12 in complex with pyruvate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
298
structure length
297
Chain Sequence
b'ALFTGIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKAIARFAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRYFEQVADSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIDTIDSVAHLRSMIHTVKGAHPHFTVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKAAGYHQTLLQIPQMYQLDTPFVNVIKEAIVLCGRPVSTHVLPPASPLDEPRKAQLKTLLQQLKLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein yagE
publication title Identification of biochemical and putative biological role of a xenolog from Escherichia coli using structural analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 110
structure length 297
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.28: 2-dehydro-3-deoxy-D-pentonate aldolase.
pdb deposition date 2010-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3n2xA00
2F7FA 2NV2A 1F76A 4AWSA 3NPXA 4JTUA 3HPZA 3TQ0A 1OVDA 4LVDA 4DBEA 1KM1A 1Q6OA 4NX5A 3W86A 2QCGA 3DFNA 3PC0A 2GOUA 2ZYFA 3L0GA 5AN7A 4MJZA 3O15A 2PURA 4U28A 1NEYA 1P0NA 2PC4A 2Z6JA 3U6WA 3NXFA 4AF0B 1JCNA 1CI1A 2RH9A 3QSRA 4TO8A 4HSNA 3N2MA 4FO4A 5F4XA 1TRIA 2GJLA 2ZRVA 5K9XA 2GQAA 4ONVA 2FB3A 1OFDA 3W75A 4JGDA 3ZFHA 5AHNA 4TU1A 1LDCA 5AHFA 2E5BA 4EOUA 2YZRA 1EX5A 3IGUA 3N73A 4GRSA 2Z1BA 3W1MA 4IX2A 4K36A 2Y70A 3LXAA 4QITA 3PAJA 3GK0A 1YLVA 3NPVA 4LRTA 3UWWA 4Z1BA 1Q45A 3CWNA 4MY1A 3L0NA 3O8AA 1A5AA 1JCMP 2CLLA 3LRMA 1OFRA 3UZJA 3F03K 1V7YA 1JULA 1VGAA 4O10A 3TA6A 1SZEA 1WX0A 1C9DA 1GVQA 4OE7A 4WD0A 2VFHA 3DU0A 3NL2A 4JR5A 3QMTA 5FF7A 2CW6A 3WFAA 5DXYA 3E12A 4XTDA 3W7RA 4Y8FA 2YCEA 5FEWA 3ANYA 2BXVA 3TE9A 3CT7A 4FX7A 3QW3A 1K8XA 1MZHA 2V82A 3EXSA 4UR7A 2DJXA 3ELFA 1UCWA 2A0NA 4S1FA 4WQ6A 5K4XA 1VLIA 5GVJA 5AC6A 3LGEA 2YYUA 4PL2A 2QUUA 3SW6A 4Z0JA 3EWUA 4WOZA 5LHEA 5HNRA 2OZ0A 3PR2A 2Q3RA 3RU6A 4RXGA 4YCOA 4H3DA 3C2RA 2P10A 1FWTA 1GVSA 3PY2A 3HGSA 2YX0A 1NF0A 4QNWA 4JX6A 4BI6A 3W83A 3UWUA 1P1XA 3QQ1A 1JRCA 1KM3A 3P8IA 4JEQA 3VE7A 1OF6A 3L0KA 4ADTA 2YYTA 2E68A 3LLDA 3TAKA 2FPVA 3QZEA 4HPXA 1LLWA 2DORA 4QQ3A 3USBA 4CNNA 1S3HA 4DPQA 2QDGA 5I3KA 1H7RA 1IGSA 3CM4A 5SWUA 4S2BA 1TQXA 5LHFA 1XBZA 1KFEA 1YTEA 2ISSA 5G1YA 4GNJA 2H8ZA 4RZ4A 2YXGA 5H91A 4QM1A 1QWGA 1TJPA 2DU2A 4A29A 1NF7A 4NJKA 3W70A 1GQNA 1TV7A 1TPB1 5D05A 2TRSA 3BV4A 2VFFA 2F84A 4LC8A 4R33A 3CTLA 1O5XA 3PWAA 4N2YA 2JK2A 4MVAA 1W31A 2D73A 1OJXA 1SZGA 3LRLA 2TPSA 2JGYA 4O54A 4O0KA 3S1UA 3TSBA 1NVMA 2J9YA 1GTEA 3RLVA 1XFBA 1YXYA 5CGQA 4Z08A 1H7OA 5D33A 1TB3A 2FJKA 3SR7A 1EP2A 1AL8A 1VYPX 4EF9A 2UV8G 2EHHA 4O1BA 3IRDA 4Z1AA 3IVSA 3DHFA 1L6WA 3EXTA 3S5ZA 5E1QA 3W7MA 3GXPA 4JTEA 3PG8A 2J88A 1W5MA 2RDWA 1T8XA 4O50A 3BO9A 3HMJG 1XM3A 3LCLA 1PVNA 5F4WA 4NXKA 4MYAA 1FDYA 4GJ1A 2QCHA 1DJQA 2FB2A 4Q4KA 4LTSA 5DBTA 3MHGA 2X1SA 1I2RA 2DZSA 3C61A 5AYZA 1TMHA 2V81A 1OFAA 3W7CA 5FESA 4JTGA 4P2VA 1G7VA 3TR2A 5HR6A 2DZTA 4JY9A 1X7FA 2Z6IA 3GLCA 4MY9A 3UPBA 3E49A 3G1VA 1XBVA 5EMUA 1OF8A 3FKRA 2DZUA 1YXDA 8TIMA 2B0MA 3L5LA 4EF8A 3GDLA 4O17A 2A7RA 1O94A 3STCA 2GQ8A 2QAFA 1LM1A 1W5PA 4AHOA 4KFPA 4MIMA 5BMWA 3P67A 3STFA 4JDBA 3G0SA 1VYRA 4UMBA 5CG7A 5HR7A 3W1XA 5DCDA 1A50A 2OT1A 1LYXA 2J9XA 4Z0SA 1WAUA 3GX9A 7TIMA 2QJGA 3V1PA 3PBWA 3P8JA 5AHEA 3W2NA 4IPJA 1A5SA 4O8RA 1H62A 3DKLA 1OFOA 2ZFAA 3KAOA 4WJEA 2AAMA 3CEUA 3THQA 2RDUA 5G4EA 3D0CA 3H55A 4BFAA 4FNPA 3M0ZA 3M47A 4ZQRA 3IIPA 4PC8A 3LCFA 2X2GA 3UWZA 2Y89A 2A6LA 3FLUA 1TPWA 4LVAA 4WXZA 3W7EA 3NQDA 5ABTA 4UC5A 3ABRA 1GZGA 1XDLA 1YPFA 3G22A 5HQEA 3LM7A 4NJHA 4ML9A 3MI3A 2J27A 1SQ7A 2ZZ3A 1G69A 3SJ3A 1KM0A 2NLIA 5D03A 4ZQCA 2QCNA 3DAQA 3IV3A 1GTHA 2QJIA 3N2XA 2NUWA 1VQTA 5KZEA 4JX5A 3L67A 3U2OA 1IXPA 2WOQA 4O11A 3QQ0A 3W2LA 3QSTA 2GUUA 3DH7A 1VCFA 3P81A 5TIMA 4UFHA 3ZR4A 1J5TA 4HIBA 2V2CA 4DO5A 5CZJA 3BW3A 4JX4A 4UFIA 2E6AA 3LHVA 3G0XA 5AC7A 3B06A 1ICSA 1GVOA 5IBXA 1QFEA 1TRDA 5KZDA 3LV5A 4MPQA 2DJLA 4ZZ9A 1F2JA 4QJ1A 2ATMA 5BW6A 4A2RA 4FX6M 4IMEA 1SO3A 1RVGA 1UBSA 4LU0A 4JDYA 3IIOA 3DENA 3WJWA 1SFJA 1WOBA 3NDOA 3NNTA 3C6CA 4M7TA 3MW7A 5KSWA 4LWWA 3EX6A 4RLIA 3PUOA 4IXHA 1IXQA 2VFIA 1OX4B 3WK3A 4MKNA 2HMCA 3U8GA 2VXNA 3S1XA 4X3ZA 4NJGA 4GBUA 4DBDA 1Y0EA 4LW7A 1W5NA 3MBFA 4N6FA 3PBYA 2E1DA 1K7FA 3HG2A 4JXCA 3TFXA 1Q6RA 5IBXC 1LLZA 5G4WA 1KTBA 2CZFA 3ABQA 3TNOA 2C3ZA 3HG5A 3G8EA 1A53A 4WY0B 1I2QA 3S6DA 2YSWA 3OVQA 5LGZA 1F74A 2A21A 3G1DA 1EUAA 2C13A 3G1XA 1QO2A 1Q6QA 3EX4A 4M19A 4UTTA 2WV8A 4XQ6A 4NZFA 2TMDA 2WJZA 3L9CA 2ZTKA 4NJIA 4MZ1A 2VFEA 2VEMA 3C56A 1G67A 5IM51 4MYXA 3UD6A 4S2CA 4ORIA 3LI0A 4HNVA 1LORA 3S1VA 3R12A 4JYEA 4FX8A 4JIPA 3TSMA 4RR4A 3KRUA 2V5BA 1SSGA 4LV9A 1GT8A 4M7SA 3VKJA 2QCDB 3HPXA 3LX9A 2DP3A 5C55A 3W1QA 1W5OA 4QAIA 4W9TA 3R13A 3O63A 1G4SA 3YPIA 3M5ZA 1PV8A 1TV5A 3G3MA 5BMXA 3M1ZA 4O1AA 4ADSA 3B03A 4UTTC 3NR0A 1LOLA 3ABSA 3EX3A 4DPPA 3NQFA 2ISVA 4JTJA 3TSDA 5D37A 3TW7A 3VNDA 3W1NA 4Q33A 3NPWA 4LVGA 4I7WA 3TAOA 5FF2A 5C54A 3UWQA 3SY5A 1HG3A 3IIVA 4OBTA 3T4CA 2YGYA 3TXVA 3GXTA 3PVFA 4K38A 3UPWA 4UTUA 2B7PA 3NQAA 3G1YA 5LZLA 4UNLA 3E9AA 2V5LA 3TQVA 1TTJA 1ONRA 3W6YA 4HNTA 2Y88A 1D3HA 3BK0A 3W74A 2EGZA 1SPQA 3I6RA 3W1AA 5F2IA 4PEKA 4R53A 4DEFA 5G1TA 2TYSA 3HG4A 1YTDA 2WPBA 2E5CA 4FF7A 4H6KA 1PCKA 3M9YA 1R30A 4AB4A 2A7PA 3S1WA 1KV8A 1X1OA 2ZZ2A 3MP5A 3A21A 1OG0A 4RKAA 1KV5A 4AF0A 3W88A 3C3NA 1JCYA 2V2DA 4LT9A 5E0KA 5DY2A 1ICQA 5G2WA 4UFJA 3FFSA 4WUIA 2ABBA 2ISWA 3THAA 1H1ZA 4BI5A 3MJYA 2JKEA 5CPOA 5AB3A 1PHWA 3LERA 1UASA 3EX1A 1BTMA 2C14A 3I7RA 3NGJA 2FFCA 4O28A 4M6PA 2Y7EA 3ABOA 3KVJA 1HFBA 1VCVA 3CU2A 5DCEA 3M43A 2R14A 3SGZA 2A5HA 5D2VA 4LVFA 1TSIA 4WY0F 1OABA 1DORA 3A5FA 3TJXA 1EEPA 1SSDA 4BR1A 2ABAA 2J24A 1G7UA 2X1UA 3GAKA 2ZZ1A 4NNAA 3M41A 1HUVA 2HS8A 1F6KA 4OHQA 4JTSA 4Y9AA 3S42A 5AHIA 3NM3A 1EP3A 3BG5A 1UUMA 3CLMA 1QPOA 3OVPA 3QJAA 4BF9A 3S0CA 4CCEA 3BGGA 4MJMA 4UNKA 1KBIA 1OHLA 3QFEA 1UJPA 1W37A 1LBLA 5L9FA 1OYAA 2G95A 3E96A 1P5BA 1RD5A 5CZ0A 3MYOA 5FF4A 3NQ6A 3LTYA 5DN1A 3O6DA 4UTWA 3LHZA 3EKLA 2CLMA 1QR7A 3FS2A 1H51A 3HIJA 3O07A 2R8WA 3QRHA 1LOQA 2ZZ6A 3NQGA 2Q3OA 3QC3A 3MI6A 3DI1A 3Q37A 3V75A 3LV6A 4Q32A 1HTIA 2ZZ4A 5HWMA 1RPXA 4C1KA 1I4NA 1SO5A 1XUZA 3DI0A 2X1TA 3MUXA 3W7LA 3W84A 3C0JA 2GVJA 3FEMA 4FIRA 1U83A 3LXCA 3GB6A 2VOMA 1L9WA 1WV2A 3HF3A 3O6YX 3C8FA 5CKSA 3IVTA 1H7NA 2ATSA 4IMDA 4A21A 4GFSA 3HQ1A 3BW2A 1KFCA 4I7VA 4XKYA 4GUJA 4LUIA 2WSQA 2YW4A 2J6XA 4A2SA 4Z1DA 1I2OA 3CWOX 5K7JA 3UXDA 3WJXA 1LROA 1QPNA 3TDFA 1PIIA 4XKYB 1T96A 1OK4A 3MHUA 5G2IA 3NZRA 5D30A 2YR1A 1ZNNA 4IQLA 1WYIA 4ZVJA 3AJXA 1LBFA 1JCXA 4GUGA 3MHFA 1C8VA 3W7GA 6TIMA 1JUBA 2FPYA 3G8RA 1B57A 1ME7A 2E5DA 4NT0A 1EWDA 3BG9A 3IIZA 5D2TA 3PUDA 5F2MA 4LV4A 1ZFJA 2B4GA 4L4MA 3DFSA 3PSVA 4XTIA 1GG0A 3LCXA 3C2EA 3GR8A 3OHIA 2ZRZA 4UR8A 2E6DA 1K7EA 2BWGA 1ME8A 1EB3A 4K8EA 5TBOA 2ZZ7A 1AW1A 4FB7A 1ZAHA 1SZFA 3NPUA 2HSAA 2QCFA 2QKFA 1K8YA 2ZTJA 4UFMA 2W6RA 3EWBX 4GUHA 4AHPA 2AQWA 1GVRA 4LS1A 3HO8A 1ZENA 4MLJA 3P80A 3HPSA 4JIQA 4Y6GA 4NQ1A 4MUZA 4BK9A 1JQVA 1TO3A 5EPDA 3HGOA 1KTNA 2GPTA 1KM6A 3W71A 2H3BA 3E0IA 4CQ9A 5E93A 3NVTA 1ME9A 3B8DA 1JQXA 1R2SA 1SW0A 2Y7GA 4UTHA 1DHPA 2V9DA 1SU5A 1F73A 3W7KA 4PL1A 5G2HA 2C0AA 3IGXA 4WOQA 3S5NA 5HWNA 1TPH1 3W2JA 4RZ5A 1EPXA 2H6RA 1D9EA 3QH2A 4U4MA 1GOXA 2ZDRA 3B05A 3O16A 4ZQMA 2CZEA 3EWXA 4UCGA 5AYXA 5LKYA 3H53A 2YPIA 4QISA 3LXBA 3QF0A 3STEA 1VPXA 3I68A 1TQJA 2NXHA 3RF9A 3SI9A 4IMGA 1CX9A 1L6YA 4FHAA 1MEHA 1FY6A 4XUGA 4GXMA 4DF1A 4YL2A 2G96A 1JCJA 4FXRA 1KLZA 4YXGA 1W3IA 2V0TA 3MMTA 3P7YA 5LNSA 1OX5A 1FWWA 2G97A 4JTLA 5D32A 4YCPA 2QR6A 4A3UA 4PODA 3QW4B 4AXKA 3KRZA 3NQ8A 4O15A 2FPTA 3B4UA 1AG1O 1RQEA 2ZBTA 3MP4A 4AWUA 1X6UA 4IUOA 1XC4A 2QEZA 5HWJA 3WJYA 4FEZA 2FQIA 3JR2A 1EIXA 3LHTA 5LNWA 3BVJA 1ADOA 3FKKA 2C18A 2ZA2A 3LI1A 4GUIA 3LCIA 4MLRA 4IJBA 3NQ7A 3MYPA 1WDWA 1XL9A 2DZPA 3W9ZA 4ORMA 2VEPA 2CLEA 1JJKA 1PS9A 2WSYA 5CSSA 4AH7A 1H61A 3TXZA 3OEXA 3IIXA 1FUYA 3TMQA 4OGZA 4A22A 3GVGA 1TPC1 3QPYA 2GQ9A 4N6EA 3O6CA 1ZCOA 5AHMA 2QAPA 4DF0A 1M7PA 1K03A 2C16A 5K3VA 4O57A 3B0UX 3SIZA 3PBVA 3PB0A 4N4QA 1WOAA 4NNCA 4R34A 4N9CA 4E0CA 1XXXA 4GE8A 3FOKA 2BZNA 2QCMA 2RHGA 3MWAA 1B9BA 3G1SA 1H7PA 1KW1A 1FWNA 3DFOA 5HMSA 2QUVA 1Z48A 2WNQA 5I3IA 4UTLA 1N55A 3FA5A 2NZLA 2PCQA 3BARA 3N9SA 2OJPA 3W7HA 3GAYA 3DGRA 1BKSA 2YFOA 5CPLA 3NA8A 4J9JA 1DKWA 3EEGA 4Y90A 5CZTA 5K2ZA 5L6UA 3S5OA 3L21A 4OV9A 4XZ9A 1FCVA 5DBUA 3T78A 1YYAA 2Z0IA 3Q94A 4K8HA 2DZWA 3FYOA 4RCXA 2XN0A 4ZMGA 3LDVA 1OX4A 1W54A 1AK5A 1MO0A 1ZAJA 1KM4A 1QPRA 5D2WA 3IVUA 4JY8A 3PF3A 1H60A 2QJHA 3UNDA 5I3HA 1A5BA 4OU1A 1FDJA 1H50A 2PE4A 3TUUA 4O18A 4WY0A 4HNUA 5AOUA 1TTQA 5K4ZA 1W0MA 1SR9A 4DQWA 4O1CA 2ZRUA 4UUIA 2CLIA 3NL5A 2NX1A 5DXXA 3W1TA 1FDZA 1W1ZA 2G5WA 4BWLA 3OG3A 4K6AA 4FIQA 3O06A 4O12A 3FYPA 2A6NA 1ZHAA 1R47A 3G0UA 4JTFA 5I3FA 3Q58A 2WKJA 3GDKA 5LGXA 3CHVA 1JR1A 1X1ZA 2EF9A 2PRHA 4KFNA 1PCWA 4X2RA 1U5JA 3W85A 1JUKA 1VYSX 1HL2A 2ZRXA 4JYFA 3L2IA 4D2JA 2OMAA 2RKXA 3N3MA 4GUFA 1B4KA 3C4UA 3P84A 5DY3A 3PUEA 3GNNA 3QMRA 2QCDA 3LBCA 1NFBA 3AO0A 4YWIA 3VFLA 5EL1A 3S8HA 3BLEA 1S5TA 5FI8A 4OWGA 3EWZA 1W56A 1IF2A 3W1UA 3TJLA 1KFKA 4RJEA 3WK2A 1I8JA 4CQAA 2BTMA 2VC6A 5KITA 5CSRA 4HN4A 2WNNA 3OBKA 3W2MA 1B3OA 1FCQA 4BWLC 1AW2A 1CW2A 3OIXA 4DO4A 2NUXA 5K9DA 1F05A 4E2BA 2QF7A 5A5WA 3M5VA 1V5XA 1SZNA 2CLFA 3W2UA 3T40A 4NX0A 4O0ZA 4DELA 1JRBA 2V2HA 3BW4A 3P5YA 1O60A 2PRMA 2VENA 3F4WA 4MZYA 1R46A 4O14A 2BX7A 4AWTA 5J5DA 4RXFA 3UYCA 1DV7A 2ZRWA 3IGSA 1DQWA 1Q6LA 5EYWA 5HULA 1VHCA 1W5QA 2VELA 2Y61A 4JD4A 2X30A 4UFLA 3FIGA 1OFBA 1VHNA 3W76A 3HB9A 3TMLA 3OA3A 3N19B 4JTIA 1TPEA 2Z2UA 1G4EA 6ALDA 1FXPA 1D3GA 1EWEA 3PSWA 5HUOA 2Y6ZA 3TIMA 2A7NA 5F1UA 4LRSA 3HGRA 5EY5A 3NM1A 4OQVA 1NSJA 2VFDA 3HOJA 2GVGA 3W22A 1K7XA 3TH6A 1I2NA 3R89A 4N4PA 3BLIA 4HT3A 3TQKA 2DZVA 1TTIA 1SW3A 1ZALA 2B7QA 4KFOA 3L5MA 3NQVA 1Z44A 2E6YA 3WJSA 1FCUA 3DKJA 1TIMA 1H5YA 1X8FA 2ZZ5A 5J5RA 4DXVA 5KMYA 4RZ6A 1NAL1 1KA9F 1VLWA 3E02A 2H3DA 3PM6A 4O13A 2Y7DA 2B7OA 3GYEA 4K7VA 2C1HA 2NX3A 3O05A 1KFBA 3N34A 3A24A 1LOSA 3M16A 3GIYA 3TK7A 1TPFA 4IX0A 4LS0A 2VKZG 4CLMA 1UB3A 3MP3A 2FTPA 3C2OA 3GDTA 2R91A 3GDMA 3LRKA 3S5YA 1Q3NA 4X22A 2WSRA 3O1NA 2Q8LA 5D02A 3NYZA 4NJJA 5LSMA 4LS2A 1K8ZA 5CPMA 2NWRA 4GC4A 2FLIA 3TC6A 3W23A 3NQCA 1GEQA 1PL9A 3LHYA 3RFAA 4CQ8A 1THFD 4KWVA 3M5YA 3DFPA 2PRLA 5EBUA 2Y62A 3TC7A 3EKZA 1GWJA 3GXNA 3UY7A 5T26A 1LZOA 2BSLA 4NXSA 1LRTA 1WQ5A 3GR7A 1QNVA 3KVKA 3Q2DA 3CIXA 2AGKA 1OX6A 3PULA 5CZSA 3EB2A 1I2PA 4O52A 3DFQA 1N7KA 2H90A 2YW3A 1KM2A 3L66A 4ICNA 1TCDA 3ZWTA 4M5PA 2Y85A 3M5XA 4CCDA 4XBSA 2QUTA 3G18A 3GZ3A 1VR6A 4O4VA 1T0OA 3W7JA 4K39A 4MY8A 4QSHA 1EUNA 1K3UA 3JS3A 4FNQA 1C29A 1R2TA 1QPQA 3JRKA 3TU9A 4O4WA 1FBAA 1N8FA 3K30A 3H54A 1XDMA 3TX9A 1T99A 2CZDA 5F1VA 3MBDA 2CWNA 4UXDA 1DBTA 2VFGA 3M6YA 3I65A 1TJRA 5HINA 4UTWC 1F6PA 3EWWA 2BLEA 4JICA 4IWWA 4NVTA 2I9EA 2IQTA 1ZY9A 3I7SA 3RK8A 4R7JA 3ZS4A 1BWKA 1G4TA 1XCFA 2W0UA 2QCEA 3B0PA 4KKXA 1GG1A 1RV8A 4FXSA 5HUPA 2WNZA 1P0KA 3FJ6A 5A8GA 4LNYA 1YXCA 2OX1A 1F5ZA 4UMCA 4EVZA 1WXJA 3CPRA 3P60A 4ZQNA 3NG3A 2Y7FA 3W7DA 3DZ1A 5EKYA 4YLWA 3LBMA 1FWSA 4N02A 2NUYA 1XBYA 1OK6A 3L65A 3KVLA 2OT0A 2JGQA 1Z41A 1XUUA 3VCRA 1H7XA 1YTKA 3BLFA 2C15A 1YDVA 3LB0A 1OFEA 1F7BA 2ALDA 4LY8A 1SUXA 1AMKA 1DVJA 1QAPA 1MEWA 1MEIA 1MXSA 5D38A 2QCCA 3UY8A 3BPWA 4EIVA 2JKAA 4TR9A 2ZQ0A 1TYGA 2RFGA 4KWWA 1UUOA 3W72A 4RX0A 4LVBA 2YDAA 3NAVA 1TTPA 4XWUA 2HTMA 1S5VA 3A22A 4N9EA 1ZJIA 3NL6A 5AC8A 1S5WA 5DCBA 3P5ZA 4N9DA 4K37A 3W2KA 1QO5A 4AMAA 2QCLA 4WX2A 2WQPA 4UMAA 3W7PA 4H4IA 3G1HA 4G1KA 1ICPA 1YDNA 4AHQA 1ZAIA 1EA0A 5FEPA 3T55A 1DL3A 5EA9A 3KFTA 1KFLA 4RV8A 1IXNA 1O5KA 4YMZA 4ZQPA 4JYDA 5AYYA 3TKFA 4HHPA 4B5NA 4P61A 1KBJA 1LCOA 2A4AA 2H8XA 2I14A 2EPHA 2CLOA 2C19A 5BOOA 3GDRA 2A1YA 1TPVA 1YDOA 2B7NA 1RQBA 4O53A 3WK1A 3UZ5A 2GVLA 5BRBA 4PCFA 3T7VA 1O4UA 1GYLA 1LRNA 4O1DA 4L4LA 1VC4A 4XBKA 1SW7A 5KZMA 4ADUA 3W1RA 1WA3A 2CLKA 4DF2A 2P0OA 3PB2A 4QIUA 3CQ0A 3G3DA 1QDSA 3TFCA 4NU7A 4NUWA 3EWYA 3BGJA 1Z42A 3KVMA 4OV4A 3W7OA 1SO4A 1RR2A 5D09A 3A5VA 2A2IA 1KFJA 5AHLA 5HJLA 4ZQOA 4BI7A 3G24A 4PFMA 5D04C 1TPUA 4O19A 5K9CA 2X1RA 3HJZA 4PH6A 1L6SA 3CEPA 1FXQA 1FCBA 5G5IA 1FWRA 4JTHA 3LCWA 1YADA 2HS6A 3G1AA 4UIOA 3R5EA 4UFKA 1VS1A 2LLEA 3PS7A 4JTTA 3GKAA 3NQMA 5LNUA 1VCGA 3RNDA 2DZXA 2NWSA 1AL7A 2P1FA 1KTCA 3LCHA 5F4SA 3SECA 1QOQA 1PHQA 2JBMA 4MFEA 3P82A 1SO6A 5U7SA 1MSSA 2ZCGA 1G4PA 1M7OA 3TROA 3G1FA 5LNVA 3STGA 1QMLA 4IXXA 2GJNA 2CU0A 3INPA 3N9RA 1QOPA 4ZL1A 2V8ZA 5FEXA 3TW6A 1DJNA 4JN6A 3QMSA 1EP1A 4UTKA 4IMFA 2EAWA 2NV1A 3C2FA 3TCEA 2FDSA 1XI3A 1YPIA 3KX6A 3RMJA 5BNKA 3L68A 2O7SA 3PBUA 5C2XA 3NQEA 3W87A 1LRQA 1E51A 4TMCA 1K02A 2O7QA 1LBMA 4HNNA 5AFDA 1RQHA 4OT7A 3EX2A 2JKPA 1OFPA 2QDHA 3KXQA 4JNMA 2NX9A 1ML1A 3RLUA 3SZ8A 4M6VA 3NOEA 3DXIA 4UTMA 3SFKA 3W07A 3MO7A 3GKFA 4LC6A 1FQ0A 1GYNA 4FNSA 3QYQA 1VH7A 2WO5A 1OFQA 3B0VC 1LP6A 2RDTA 3L5AA 1GJPA 5F2LA 3P74A 3W1PA 1QCWA 3R2GA 4AVFA 2W79A 3LHUA 1DQXA 2E77A 1VJIA 3M44A 5D2XA 3WJZA 3TV8A 4IPIA 2J9ZA 1KM5A 3W3OA 2ZA1A 3NEVA 3NQ2A 3S9YA 4PA8A 5FF3A 1BEUA 1JVNA 3HG3A 4UTJA 5FF0A 2R94A 3GNDA 3CB8A 1HO4A 3NZ1A 4RK8A 3ATYA 1WBJA 5C6MA 3LOTA 4TX9A 3WK0A 1TV8A 1G6CA 4MOZA 4JTKA 4FNTA 3F1QA 3C52A 4WZHA 3W7IA 3I7QA 3VE9A 3EXRA 4Z1CA 2TSYA 4NNBA 5MHBA 4HPJA 4CCCA 4AAJA 3UXAA 1I45A 3A9IA 4I7UA 1ALDA 2V30A 3MI2A 5D2YA 3DFTA 1XKYA 2VEKA 1J2WA 3SSJA 2FIQA 1FX6A 4EWND 4PTNA 3UWVA 4E38A 4FNUA 3W73A 4O16A 1AW5A 1W8SA 5DELA 3ATZA 2XN2A 2KZHA 3A23A 4FNRA 3KRSA 3B04A 3NO5A 5U4NA 4E2DA 3LTSA 1VRDA 1B4EA 4CNPA 1TREA 4HSOA 3W7NA 3ZWSA 1JUEA 3M7WA 3CIWA 3DHDA 3LTPA 3QEZA 2XN1A 3LLFA 4POCA 4X9SA 4CNOA 4MFDA 3NL3A 5TQLA 3N14A 1W3NA 4TMBA 1GVFA 1JCLA 3P61A 1H63A 3W7QA 3W1LA 5DLCA 4IGHA 3DBPA 3VI2A 3UQNA 3IEBA 1XBXA 4JS3A 2XFWA 4Y96A 2E09A 1KLYA 3P62A 4HKPA 1WBHA 1O95A 1SFLA 3LHWA 4GWEA 4C1LA 4N9BA 5F2GA 2Q8ZA 3HGJA 3QM3A 5I3JA 3CC1A 1OYBA 1M6JA 1L2UA 4TIMA 1J4EA 4DO6A 2YFNA 4IMCA 1RZMA 4IOTA 1GPWA 1DOSA 2ZA3A 1W3TA 3T44A 3SGUA 4AEOA 5FEZA 2CLHA 5LNRA 1IIHA 3F4NA 5KINA 1P4CA 5CPNA 3FJLA 1M5WA 5KTLA 5H2ZA 3BG3A 1IXOA 2OCZA 4MZ8A 5C5YA 1OYCA 2NXGA 1A5CA 4I9AA 4NZJA 4WXYA 3KHJA 1PE1A 2CZ5A 3R8RA 3QPZA 2NXIA 1TPDA 2E6FA 1H7WA 2X16A 1IIGA 1H1YA 2A85A 2Y63A 4ALDA 3UWYA 2EKCA 4LUJA 2C6QA 4K7YA 3KOFA 2ZRYA 3OVRA 3LCGA 3PG9A 2CFFA 3C2VA 5I3GA 4M6QA 1BWLA 4UTIA 3HBLA 1VZWA 4QNEA 2I1OA 1LTDA 4LOCA 1R2RA 1HO1A 2VEIA
chains in the Genus database with same CATH superfamily
3PPCA 2F7FA 4NAEB 1E71M 2BP1A 3NPXA 4PUWA 4S3EA 3HPZA 3TQ0A 2WC4A 1GKPA 4BJHA 3UVAA 3BDKA 2XVPA 1MYRA 1Q6OA 2DZBA 5CH9A 3LPPA 3W86A 4WDWA 2QCGA 3PZQA 5E6YA 3PC0A 2GOUA 5CLWA 1NEYA 1NQ6A 2XIIA 4AF0B 3ES7A 4AIEA 1CI1A 3QSRA 4TO8A 4HSNA 2I17A 1UC5A 3N2MA 3AYRA 4DRSA 2ZRVA 3TEVA 1S2VA 4RDYA 4HU0A 2GQAA 4ONVA 1OFDA 2P50A 3W75A 2XGZA 4OTKA 2VMFA 2E7FA 4AZ7A 3ZQ9A 4DXXA 4GVFA 1RJQA 3T05A 2Z1BA 4IG2B 3LXAA 2OTDA 3GK0A 4EX4A 3PPHA 3UJRA 3UWWA 4Z1BA 4R3UA 5G1MA 4D8ZA 3VDCA 4AC1X 1JCMP 1OFRA 3CV1A 3M0KA 4JL2A 2PDJA 1WX0A 2Z25A 2PEVA 2NQJA 3NL2A 3GZAA 3VD3A 3DHPA 1QHOA 3MCNA 5DXYA 3E12A 2YCEA 3QHMA 5FEWA 3V4BA 4FP1A 3CT7A 3DYMA 2INEA 5DT5A 1BQGA 2GVYA 4MNJA 4EXQA 1PJ9A 5CAHA 2V82A 3WQFA 4UR7A 2OODA 3CLWA 3ELFA 1VLIA 3AXIA 4PL2A 1Q6FA 3MUIA 3SW6A 3AICA 3WD2A 4LPCA 2ZUVA 5HNRA 4YCOA 1FH9A 1GVSA 1QATA 1RK5A 3URAA 1JAEA 4H00A 4GQRA 4BI6A 3N18A 3UWUA 1S5NA 1P1XA 1JRCA 1ISYA 2WHJA 2UZ9A 3VKKA 4ATLA 4I9TA 2E68A 3T0CA 2FPVA 3G77A 3SN0A 3N2CA 3QZEA 2J7HA 2P88A 4AW7A 1VEPA 4GHRA 3BAJA 1QTWA 3LU2A 3UGVA 2ZUNA 3REQB 4QS6A 1E1CB 2EEXA 2ZUWA 1TQXA 1XBZA 3CUJA 4AZCA 1KFEA 3SJNA 5G1YA 3PWGA 3WH5A 4L6DA 3E5BA 4QM1A 1Q8JA 4GINA 3W0KA 2VURA 3BQ5A 3WN6A 2R6OA 4B9YA 5C9RA 4Y9MA 2F84A 1O5XA 3CTLA 3PWAA 4N2YA 3LZ5A 2JK2A 2TPSA 4WGHA 1B2YA 1I60A 3UEQA 3RLVA 1XFBA 2OOGA 1E40A 1YXYA 3ICJA 3SUWA 1TUFA 3EA3A 2VGFA 3UJSA 1H7OA 5D33A 1TB3A 1VJSA 2XG9A 2OKOA 3BCJA 1AL8A 3EOEA 4QBXA 1R7AA 1DE5A 4JPGA 1XIFA 2EHHA 3UZZA 2QDEA 3OIHA 2NQZA 4O1BA 5TD4A 4LAMA 3IVSA 3MUZ1 1L6WA 5JBFA 3UESA 5A6SA 4PRTA 1UMYA 3EPNA 5F4WA 3VOGA 1LUCA 4NXKA 4GPNA 1E1FA 1QW7A 3GBDA 3ZM8A 2QCHA 1IZCA 3LYEA 4J3ZA 4BQ5A 5EB8A 4LTSA 1D7KA 2WMJA 4ACYA 2DZSA 5AYZA 1TWSA 1TMHA 2ZC8A 1OFAA 2ZXAA 1XJBA 4P2VA 4TX8A 5HR6A 5F7UA 3H2EA 4JY9A 3KHDA 3DX5A 1X7FA 3VVGA 2HPMA 3B8WA 1V3IA 2WPGA 3GLCA 1KBBA 3WENA 4MY9A 3UPBA 5T8GA 1EXPA 1AZ2A 1V3HA 3T6CA 2QMKA 8TIMA 2PLCA 4EF8A 3GDLA 4AZIA 3GBEA 5CC6A 3STCA 2PGFA 3CL8A 4AHOA 3MKKA 3HA1A 1CGXA 1B30A 3STFA 4JDBA 1VFOA 5CC7A 1XFCA 3G0SA 1VYRA 1RJRA 1ZZMA 5CG7A 3W1XA 3H7UA 3B9AA 2OT1A 1FH7A 3HPAA 2G3MA 3SCRA 4QQUA 1T7LA 2W91A 4EK7A 1A0CA 1S2AA 4BCEA 4WJEA 2DT2A 2AAMA 3CEUA 1HKIA 2C1GA 4BFAA 2O9TA 1HL8A 2ISFA 3UWZA 1TPWA 4LVAA 2OLHA 4F0MA 4CNUA 4LJ3A 4YNGA 1GZGA 1J2BA 4QEEA 4F9DA 1YPFA 3LM7A 4NJHA 1JI2A 2J27A 1SQ7A 3ONBA 2ZZ3A 4FLOA 1I9CB 2NLIA 4W5UA 7TAAA 5D03A 3W24A 2PWDA 5DO8A 2QJIA 8A3HA 3H2NA 3L67A 3U2OA 4O11A 4CD5A 1ODZA 3QQ0A 4OVXA 1XD1A 2HEJA 1KBKA 1V6UA 3P81A 1CBGA 4NL1A 3ZYZA 1IE7C 3OO2A 4JX4A 4UFIA 5BRPA 4RNIA 4Q8OA 1XLDA 3LK6A 3B06A 5HBFA 2VQTA 1O1HA 2CETA 1K9TA 4A8RA 3LV5A 4MPQA 4HGXA 3AROA 4W86A 4LU0A 4JDYA 3IIOA 3EB3A 3DENA 3NDOA 3NNTA 3C6CA 4M7TA 2ZX9A 5KSWA 4BQ2A 1Q5MA 1P6WA 1QXLA 4RLIA 1FRBA 3O9NA 1E3XA 2W4XA 3KWXA 1F07A 3WK3A 4GYFA 1SJAA 1KCKA 5DF0A 2HRWA 2VXNA 2BXZA 4XAGA 4GBUA 4GVGA 4N6FA 2R1KA 1P48A 1OADA 1Q6RA 4Q4MA 1LLZA 3GD6A 2V3FA 4XBJA 1MUWA 2CZFA 3NFUA 2WMKA 1NQKA 3UXKA 4JKKA 4IPPA 1F74A 3KOWA 4CNTA 5DMNA 2C13A 2GFTA 3IJ7A 1QO2A 4DAIA 3ITTA 4M1RA 3EX4A 4XQ6A 4NZFA 4H2HA 1XD0A 4XD5A 2TMDA 5FL0A 4ZOAA 2WSKA 4NP7A 2VFEA 2PWGA 3DEQA 3I4KA 4L9ZA 4V27A 4GGHA 3H23A 4GLEA 4PSPA 2VI0A 3R12A 2P8BA 2I7GA 5REQB 1YW1A 3PUGA 4LYKA 3KRUA 3S2LA 1S39A 1GT8A 1C91A 3HPXA 4M3PA 5CG0A 3HZ3A 5BYWA 3QR3A 4H9XA 3BSMA 1VF8A 3VD9A 4W9TA 4QSFA 2VWTA 3M5ZA 2FDMA 3B03A 1JD7A 4U3AA 3U2EA 1NARA 3UVIA 3NQFA 3WMBA 4CQBA 2J74A 3QV9A 5D37A 3TW7A 1A80A 1NU5A 2Q71A 4LVGA 5C54A 1EH9A 3SY5A 3GC4A 1NWUA 3VUPA 1WPCA 2YCKX 3UG4A 3ARPA 2F38A 3OBAA 2CBIA 3MQTA 1JPHA 1WXYA 4GXWA 3VOJA 4D6CA 3KBVA 4C6PA 3VKAA 2GDQA 4U33A 5F2IA 4B16A 2X41A 2XIMA 4PUEA 2TYSA 5B7YA 4HNLA 5DMLA 3VOCA 2D0HA 4AB4A 2QS8A 3MP5A 1WKYA 1KV5A 3W88A 4QFUA 2DVUA 1GOOA 3A13A 3WBWA 1CGYA 5G2WA 3AQUA 4C7DA 3THAA 3V5OA 4U31A 3MJYA 4YVPA 3RILA 1W9UA 1IEQA 1KRCC 4L5ZA 4EXAA 3I7RA 1IR1A 2A3CA 4DJEC 2FFCA 4O28A 3VNZA 3NZGA 2FZNA 3ABOA 4W8AA 1VCVA 2WWCA 3CU2A 4TV6A 4LVFA 5BU6A 4U2ZA 1TSIA 1FHLA 1OABA 3A5FA 3FCPA 3TJXA 1SSDA 2ABAA 4WF7A 2X1UA 3M41A 4GZJA 1F6KA 2PBGA 4JTSA 4Y9AA 1V7AA 3RMEA 2Q02A 3AIEA 3RR1A 2VGIA 3V7PA 4RE3A 3OVPA 2MUCA 4GY1A 4W84A 4CCEA 3BGGA 4JQ2A 1KBIA 3QFEA 1W37A 2HPIA 4PB4A 5AYBA 3LGDA 2A3HA 3GU1A 2EPNA 2IPGA 3KZSA 1XLBA 3O6DA 1I0DA 1SJCA 2HVNA 2CLMA 2MANA 2DT0A 3FS2A 3O07A 3VIKA 1MRQA 1Y8BA 1K8CA 1NOUA 3G1RA 3ES8A 1NDYA 4IICA 3BLOA 2JE8A 1RPXA 4C1KA 1TX2A 1GUVA 1HJSA 1SO5A 1IEVA 1UP2A 1GHRA 3W84A 3NWRA 2VUNA 2GVJA 2C8NA 1U83A 4H9VA 1UKPA 4Y8EA 1BG4A 3GB6A 4C6QA 5CKSA 1VBUA 3T4WA 4A21A 2ATSA 4IMDA 4PUNA 3CHFA 1OGGA 1UIOA 1EHAA 4PMVA 2PD9A 5G4HC 4Q4QA 4Z1DA 1I2OA 3W4RA 4F3HA 3H7VA 2DZAA 4JTAA 3ZT6A 4DJFD 2GUBA 4D6HA 1LROA 1QPNA 2FH8A 1PIIA 4XSLA 1ZP4A 3NZRA 1ZS2A 4D6EA 1JCXA 4XUYA 4EANA 3V16A 1C8VA 2X0HA 3A4WA 2BOFX 3AZTA 3L4ZA 5MKGA 3PUDA 3MZ2A 4H19A 1C7TA 2DUZA 4XZNX 2NQHA 2INZA 3D3AA 1GQIA 1EB3A 1Y7VA 2IPFA 3M46A 4NASA 1SZFA 2DT1A 3T0BA 2G50A 1K8YA 1FWGC 2XJ7A 2WB5A 1P0BA 3VFCA 4RPPA 3P80A 1RA0A 5DRIA 2AAAA 1F4HA 4FR6A 4JIQA 4Y6GA 1JQVA 2WCGA 2VZUA 4LNCA 3CNYA 3E3HA 4JHMA 4M81A 2GPTA 4CGTA 2YBTA 3IK4A 1R2SA 2OQHA 1SW0A 1EXBA 4Q4RA 3W7KA 1A3XA 3IUIA 4NYYA 5HWNA 3W2JA 3R4IA 4RZ5A 2H6RA 1D9EA 2ZDRA 3B05A 1MZRA 3EWXA 4UCGA 3ZSSA 3KP0A 1KCZA 4AZBA 1HIZA 4IL0A 3SI9A 4QG6A 4V33A 1CX9A 3S83A 1L6YA 3ITXA 4JN8A 1FY6A 2P3ZA 4YL2A 1PZ0A 4CD8A 1JCJA 2WW5A 3UZYA 1KLZA 4D6IA 2V69A 3WUBA 1ZPTA 3MMTA 1XLFA 2JF7A 4AZ5A 2G97A 2QR6A 5I07A 4PODA 1XSJA 5IHRA 4AIOA 4R5EA 3E0FA 1RQEA 1RCQA 1X6UA 5GNXA 2QEZA 4D9PA 1EIXA 3LGGA 4LYQA 1OIFA 2UY2A 3BAIA 3GRIA 3MYPA 1C7SA 3BXWA 1J6OA 3BLPX 1FKXA 2VEPA 2ZKMX 4YTTA 3SGGA 4AH7A 2CBJA 1M1BA 4NAFB 2FH6A 3OEXA 3K8LA 4OGZA 3GVGA 1TPC1 5I78A 5LXEA 4KRUA 1KKOA 1ZCOA 3MSDA 1K03A 2BODX 3B0UX 3PBVA 3CUXA 1M3UA 3K2GA 3ALGA 2WCSA 4US5A 4IGMA 1UZDA 1ADDA 1B9BA 2HJPA 2BDQA 1Q6GA 3AMKA 3VZZA 1QNOA 4FMVA 5HMSA 2QUVA 4B5VA 4ATDA 2DEPA 3UCQA 1XINA 3CYJA 3N9SA 3KOXA 2FGBA 4I5UA 4F2BA 2YFOA 1C93A 2DT3A 1DKWA 5CZTA 1O7AA 3L21A 2YZ5A 2EPLX 3PFMA 4OV9A 4XZ9A 5E9AA 5DBUA 3T78A 1YYAA 2Z0IA 2DZWA 4RCXA 4NZ3A 1OX4A 1AK5A 1KQZA 1V6YA 1ZAJA 2OLAA 2R9RA 1QPRA 3PTDA 2I5QA 3HM7A 3AYTA 1Q8AA 1PUDA 3UR7A 1EC8A 5IHSA 2R1LA 2D0FA 1JZ2A 1QNQA 4WY0A 1X39A 5FJRA 3BV7A 3UJ2A 5BRQA 5K4ZA 1W0MA 4F40A 1SR9A 5HPOA 4JTDA 4HTBA 4DQWA 4O1CA 2ZRUA 3WDQA 3APYA 4C6EA 4HOZA 4UUIA 3WLPA 4ZTXA 2P3EA 4O12A 3O06A 3FYPA 2A6NA 4QLKA 2XM2A 1R47A 3G0UA 4JTFA 3Q58A 3BICA 1REQA 3CASA 1JR1A 4L9YA 3WDJA 3BH4A 1LG2A 4X2RA 3W85A 4REQB 1JUKA 3KCLA 1VYSX 4GA8A 3KS6A 1V6TA 3L2IA 3WLJA 3N3MA 5DY3A 3C4UA 1E0TA 3L12A 5JUVA 3PUEA 2FGZA 3LBCA 1NFBA 2V5CA 3WH8A 1Z7AA 1JPDX 3W1UA 1R85A 1I8JA 1MUCA 4CQAA 3WQ5A 4K3ZA 5KITA 2WNNA 3NTYA 4RL3A 1HJXA 3KBWA 3U5YA 4BY3A 1J0ZA 4BWLC 3SRKA 1CW2A 4A6GA 4KMQA 2X7WA 4DO4A 1F05A 1M41A 1N8WA 4E2BA 1B3WA 3B9OA 5A5WA 3DUGA 1KGWA 4LFYA 1GQLA 3NDZA 3T40A 1O60A 1AQ0A 3GNXA 4ZODA 4MZYA 4ROPA 1R46A 2BX7A 4XAYA 3TTQA 2I9UA 2Y8UA 1W5QA 3RLHA 2X30A 1OFBA 1VHNA 4AX7A 3HB9A 3RO6A 3QR1A 1EWEA 3WQDA 2WC3A 3AHXA 3TCSA 4RUBA 3ZXWA 3WNKA 4Q6JA 5F1UA 3HQNA 4F4RA 3JUGA 2HXUA 2WZMA 3HGRA 3KBJA 4LB4A 1XWYA 4ZENA 1NSJA 3HOJA 1HT6A 3WLQA 3AZRA 4TOQA 4HT3A 1SW3A 1ZALA 1OIMA 2ZE3A 1UWUA 4BZYA 2I5IA 3WJSA 1FCUA 3DKJA 4NILA 1TIMA 4PUMA 2PGEA 2ZZ5A 1EL3A 4DXVA 4M8UA 5KMYA 1NJJA 2H3DA 4J7RA 5C9XA 3PM6A 3ZVIA 3T0TA 4BEUA 4EP8C 3O05A 1Z8AA 4E8CA 3RCYA 1TVNA 2ZOXA 3TK7A 2DIJA 3G5EA 4OOUA 1MXDA 2ZWYA 5HXMA 4CLMA 1UB3A 2CKRA 1R3YA 1XV8A 3TLLA 1GOKA 3GWQA 3EDEA 1TR9A 2WBGA 1VAHA 1Q3NA 1MI3A 5HNNA 4C6NA 2PP1A 3UETA 5D02A 3NYZA 3CH0A 1X1NA 1OEPA 4JNYA 5KETA 5LSMA 1EJVC 5CPMA 4CEXC 2NWRA 3VUSA 3W23A 2XPKA 4PE8A 4CQ8A 1THFD 2OB3A 3GW3A 3M5YA 3BAXA 2Y24A 3OB8A 5EBUA 5ECVA 3WL1A 4D6GA 2Y62A 4I9JA 3TC7A 3CHEA 1LZOA 1LRTA 3CIXA 1OX6A 1MXGA 1I2PA 3DFQA 2QMJA 5HATA 3GUWA 1KM2A 3ZWTA 1SFSA 4CCDA 1VR6A 1M04A 1T0OA 4FNQA 1C29A 1R2TA 3JRKA 1JAKA 3IUHA 1UA3A 4Q8WA 5GPRA 4HQVA 3TX9A 1T99A 5A2BA 5F1VA 1TWDA 3TR9A 2YA1A 1E72M 1GJWA 3M6YA 4B5TA 4IIDA 2WMFA 5HINA 1F3XA 1N8IA 4JFTA 2Y8VA 1EA9C 3E5PA 4JICA 3AJ7A 3GR4A 2I9EA 4Q8VA 1QI3A 3I7SA 6REQB 3ZR6A 4KQNA 3BOFA 4ZE5A 2V67A 4R7JA 1TJ2A 4S39A 3TTEA 2BFGA 2PU0A 1XCFA 2G3FA 3IJ8A 3ARUA 1ZQ5A 3B0PA 2A3AA 3IJQA 3BZJA 5D9NA 4B2DA 5A8GA 4LNYA 1SMDA 4DX3A 2OZTA 3P60A 2DUXA 3W7DA 3DZ1A 4JFSA 4H41A 1ISVA 1FP9A 4YLWA 5CGTA 2NUYA 3QFWA 3BOXA 3NGFA 3QHOA 3UG3A 3OVGA 4PMJA 1GPFA 3HURA 1E4MM 2JGQA 2Z29A 2QGYA 3LB0A 2ALDA 2GWGA 2PP3A 1DVJA 1EJWC 4GYKA 1MEIA 3BZGA 1XS2A 3HV9A 3BPWA 2VRQA 4EIVA 3N17A 4JOMA 3TC3A 2R1PA 2G3JA 4KESA 5FACA 4KWWA 3W72A 3S2JA 4PMDA 4BHYA 1S5VA 2GYIA 4Q3MA 5CPQA 1ZJIA 5LA2A 1DXIA 3NL6A 3WEOA 4N9DA 2WVUA 1QO5A 4AMAA 2TODA 1BAGA 3J7HA 1ZAIA 1FHDA 3IV8A 4XIAA 1JF5A 1QU4A 1ITUA 4E4UA 1KFLA 4RV8A 1O5KA 3RRXA 1JNEA 4DWSD 4AZ6A 5HA7A 2X0SA 2EPHA 2C19A 1XX1A 3HQOA 3GDRA 1V02A 4DBWA 2SFPA 4AX6A 1E3ZA 3V0TA 3MV01 2OWCA 1YDOA 2B7NA 3EB4A 4AD5A 1RQBA 4PMQA 2J7EA 5I06A 4MWAD 2GVLA 1EPVA 2PLMA 3ARWA 2VX4A 3T7VA 3SN1A 3VKDA 2QV5A 3GH7A 4XBKA 2E28A 1SW7A 4DUWA 3W1RA 2D1ZA 4E6MA 4QIUA 1QDSA 4NUWA 3EWYA 3MUCA 1W9XA 1RR2A 1XYBA 3BOLA 3NQBA 5A6BA 3ZIZA 5HJLA 1L2QA 3IGHX 4HZ8A 3USZA 1TPUA 4O19A 5K9CA 3HJZA 3WNLA 4CN1A 3CEPA 1FXQA 1X97A 4XK2A 2ZUMA 1YADA 3G1AA 4ACZA 4AG0A 1VS1A 1R3SA 3PS7A 5HQLA 1TZ7A 4CCZA 3JU2A 2G4FA 2OGJA 4DWSB 4P7OA 3CUFA 1CXHA 1XKJA 2P1FA 2PZ0A 3SECA 2ACQA 4S3DA 1SO6A 5U7SA 1FHUA 3TROA 1SFTA 3NUKA 4IXXA 3DG7A 1X8CA 1JFHA 3N9RA 4A3QA 1OBAA 3LEPA 1YE4A 4MWAB 3TW6A 4JN6A 2BVYA 1EP1A 1QHZA 3GXDA 3GUGA 4QXIA 1K6WA 1P43A 3T81A 1IZJA 3DC8A 5C2XA 3N12A 3NQEA 3W87A 2PDXA 1LRQA 5AFDA 1VJZA 1JL8A 1RQHA 1BLIA 1OFPA 2QDHA 3KXQA 1HN1A 3B8VA 1ML1A 3SZ8A 4KBXA 4M6VA 1XLCA 4HZ6A 3WLSA 3WDPP 1M65A 4INFA 3VINA 3GKFA 1A3WA 4LC6A 4Y9PA 1A5KC 4S3CA 3VGBA 1CLKA 3QYQA 1OFQA 1G0CA 3AHVA 1ELSA 2RDTA 3TWBA 1LQAA 5EMKA 1V3LA 4LX4A 3T0DA 3W1PA 3D5HA 3JZUA 1YE6A 4H7ZA 4K8GA 3MKVA 4DVOA 1UUQA 1FFRA 4GMEA 4C6BA 4Y7EA 3TV8A 4IPIA 3OQ8A 5CZKA 4HMDA 4DYJA 3NQ2A 1JVNA 4G6CA 2J4GA 4UTJA 4H7VA 2R94A 3GNDA 4ZXOA 2REQA 1HO4A 1NWSA 4RK8A 3GM8A 2CWXA 1VEMA 2AQOA 2OYLA 3SURA 1I6NA 3LOTA 3ITYA 4TX9A 2PBOA 3BLKA 4QCEA 3SCNA 1TV8A 4Z42C 1JFXA 4JN7A 1IT8A 4LAKA 3WLOA 2V63A 5FJOA 2E9MA 2TSYA 4UZSA 2V5DA 2VZOA 3UXAA 3V0SA 3E1F1 1I45A 4MHBA 3SFWA 1XIGA 2FIQA 2YOCA 4EWND 3CZ8A 4PTNA 4E38A 1NELA 2FVMA 4FNUA 2O56A 4KEMA 1AW5A 5DELA 3WL0A 3ATZA 3KRSA 4DJDA 1NM9A 4GX8A 3FV9A 4E2DA 1K9EA 2PLKA 2XFFA 1IEXA 4CNPA 4HSOA 2Z1KA 2D2JA 3N4AA 2XN1A 3LLFA 3AUOA 1XRTA 3NL3A 2DFAA 1X38A 1KXVA 1W3NA 4TMBA 1JPMA 1W1VA 2OYKA 4Q7NA 3UQNA 5FCZA 3VMNA 3H4XA 4E4PA 1KLYA 3P62A 2I56A 4HKPA 1EHNA 3VNIA 2A3EA 4IQEA 1WBHA 4PMRA 3LHWA 4C1LA 4AZGA 3VA8A 3TVAA 1L8PA 3QM3A 2VX6A 4YTQA 3CC1A 4UZUA 4AVOA 2YFNA 3PANA 4BQ3A 4S38A 2C79A 1GPWA 1DOSA 2R1MA 3ID7A 4HMCA 3VX1A 4J27A 2VDGA 5LNRA 3CH9A 3GFXA 3BG3A 5HMDA 1UBPC 2DH3A 1JDFA 3QPZA 3WY1A 3N15A 3GXIA 4HYRA 5GNYA 2E6FA 3SBFA 2Y63A 1H1YA 3B8UA 4ALDA 2IKGA 3UWYA 3UXLA 1EGMA 3KOFA 4IJRA 4FS9A 4A8IA 1U2YA 1R2RA 2ZVRA 4AWSA 2V5KA 2WHKA 4JTUA 4KF1A 1XLLA 1D3CA 1QHPA 3QKEA 3RRAA 4DBEA 1PPIA 1E0VA 3DFNA 3L0GA 2ZYFA 5JXQA 3O15A 2PURA 4U28A 4LEQA 1P0NA 3NOYA 3NXFA 4X0NA 1SJDA 4JTRA 3PJUA 4NI8A 5F4XA 2GJLA 3RX4A 5K9XA 3SRFA 2XVLA 3MVTA 3GNRA 3F4CA 3QYSA 4TU1A 5AHFA 4EOUA 3IGUA 1GW9A 3N73A 4K36A 4QITA 3PAJA 3CQKA 3NPVA 4LRTA 1AUSL 4HP5A 4IHCA 3CWNA 3O8AA 1KC7A 3M4HA 3F03K 1J0HA 1V7YA 1JULA 2XHYA 4WJXA 1GVQA 2VFHA 2PDWA 3AUJA 4JCLA 4JR5A 2CW6A 2VQUA 4XTDA 3W7RA 4Y8FA 3CV6A 4F79A 4MADA 5H1WA 4FX7A 1GQKA 2Z2AA 5I7GA 3F5LA 1K8XA 1PZ3A 2BS9A 3EXSA 3AOFA 4Q6XA 1UCWA 5DX7A 4S1FA 3T1GA 3FHAA 3R0DA 3GG8A 3LGEA 2YYUA 1EBGA 1UR1A 3M0VA 3KLLA 4Q22A 2OZ0A 3WLRA 3WNNA 3RU6A 2BHYA 5I03A 2BVTA 2FVKA 4UB9A 1G5AA 3SO7A 3UA4A 2YX0A 4QE5A 1NF0A 4QNWA 2PUZA 3W83A 2XTKA 3IUDA 1KM3A 4ZOEA 5I24A 4JEQA 4ADTA 3TW9A 3LLDA 3CGTA 2YL9A 3AS3A 3ZT5A 1U5VA 1LLWA 1Q2RA 2FYMA 1W1A1 3WKZA 4CNNA 3F2BA 1RPKA 2VR4A 4DPQA 3BLLA 3IK2A 4ZBCA 1IGSA 3CM4A 4S2BA 4FOJA 5LHFA 1LQ0A 2O9RA 1YTEA 4HA0A 4GNJA 2H8ZA 3TYCA 5H91A 1J93A 1H1NA 2XIJA 4IQDA 1GVEA 1QWGA 4YWSA 2PDBA 1NF7A 4NJKA 3W70A 3A3HA 1TV7A 3QLDA 4RW5A 1EX1A 5D05A 2TRSA 1UWTA 2YLLA 4H6RA 3WUFA 3DECA 2NV9A 5A69A 4MVAA 2D73A 4J3WA 2JGYA 4O54A 4KW2A 1WZKA 3ZO9A 2RUSA 5ECUA 3KP1A 1V0KA 2QNEA 5CGQA 1XRFA 4IIHA 5D9PA 1EP2A 4GCAA 4EF9A 2UV8G 4IFRA 3DERA 1GJUA 3MJMA 3NIYA 4DLMA 4EPDC 2HBVA 3OTRA 2OVLA 5E1QA 1W3HA 1DWAM 1W5MA 1XYAA 1XM3A 1Y5WA 3RCNA 1AQFA 4S3JA 1SGJA 3FW6A 1R3TA 1Q7ZA 4GJ1A 4PUJA 1KWKA 3WO8A 1DJQA 4Q4KA 3MHGA 3VDAA 3HFTA 3CBWA 3C61A 3BURA 1R3VA 3OP2A 1LL7A 4E3VA 2VL4A 4W7VA 3LENA 1OC6A 3B9EA 4ZO7A 4AD0A 1G7VA 3TR2A 3LY0A 1Q4WA 3E38A 1VBGA 4US6A 2VDHA 2POTA 3P0WA 3R6IA 2EXOA 4LUTA 3MANA 3H4GA 1OF8A 3FKRA 1E4NA 2ACSA 1YXDA 2RDXA 4GYPA 3SCPA 3VOFA 2GQ8A 4LY4A 2QAFA 3A3XA 1I0BA 4MIMA 2EPOA 5BMWA 3P67A 3CZEA 3DFYA 1XIIA 3P0XA 4ZFCA 1A50A 1GW1A 2WCAA 4Z0SA 3VO0A 1KRAC 1WAUA 3GX9A 3VIGA 1KGXA 2C0HA 3N2OA 4XKMA 2UY4A 3W2NA 1H62A 1JXKA 4QE1A 4OIFA 1EO7A 2VM8A 4YIWA 3OW1A 5M1TA 3OYXA 3AIUA 4FNPA 2QJNA 3K1GA 1P6CA 2XM1A 2X2GA 2QYGA 3TA9A 2CBVA 3FLUA 4NG3A 2A6LA 3W7EA 4C6KA 3G2GA 1YHTA 4UC5A 1KXQA 3D3FA 3BUVA 3CTTA 4HPNA 1C8YA 4DWSC 3ARXA 3MI3A 5GNZA 4B3KA 5LA1A 3KW3A 1KM0A 1WO2A 4ZQCA 5TF0A 1YQ2A 3N2XA 1VQTA 1JD9A 2WOQA 1TFVA 3F4VA 2Z1VA 3DH7A 3FSUA 1VCFA 2BASA 1TIWA 5TIMA 4UFHA 1J5TA 1TZZA 4H04A 2E6AA 2OQLA 4GKTA 1ZBKA 3G0XA 1Q4NX 1ICSA 4XV0A 1VFTA 4MM1A 1QFEA 4C5YA 3NO1A 2IPJA 3EOSA 3GHRA 2WJEA 5KZDA 1O12A 4W89A 4PTWA 4HN8A 4FX6M 1BPLB 9XIMA 1QW8A 1RVGA 1UBSA 1LQ2A 2HVMA 2VC5A 2RAGA 5FJIA 1A0DA 2NVAA 3WLLA 2O9PA 3MW7A 3GC5A 3CAKA 3EX6A 2CPUA 3ARZA 3UNTA 3PUOA 4PBEA 1W9PA 4MKNA 3GTXA 4KEUA 5A6MA 4NJGA 3ZJ7A 3RAOA 1CXLA 1W5NA 5BROA 5ENLA 4HK6A 3WH7A 2E1DA 1K7FA 3HG2A 1W2VA 3WQ8A 3LMZA 3QZ6A 3GY1A 3HG5A 3CQJA 1A53A 1XF0A 5B80A 3S6DA 1R9YA 3HU7A 5LGZA 4A3YA 1O6IA 2ZWZA 2A21A 1EUAA 1QT1A 4UQCA 4ZEPA 1A3HA 4A35A 1Q6QA 3GTIA 1VFHA 4C1NB 3RJYA 3QC0A 3WDIA 2ZTKA 4WRHA 4MZ1A 3XISA 1JZ3A 3BJTA 5DRCA 4XO6A 3C56A 2INFA 3VNJA 1J8VA 4S2CA 3R11A 2QVHA 4ORIA 4GISA 1L6GA 1LORA 1PYFA 3VX0A 3V0UA 3GE7A 3FVMA 4LV9A 1B9ZA 3VKJA 5C55A 1W5OA 4F9JA 4QAIA 1G4SA 3YPIA 2Y8KA 1RCOB 4ADSA 3EX3A 4J3SA 4XAPA 4JTJA 3TSDA 1JYVA 1F9CA 3LZ3A 1FWEC 3NPWA 3UCCA 5FF2A 1M7JA 1Q6CA 3IIVA 4OBTA 3T4CA 2YGYA 3AYVA 3GXTA 4WSJA 3BTNA 4UTUA 4PZVA 4HU8A 3NQAA 3TLQA 4A8LA 4DNHA 2QPUA 4UNLA 3E9AA 1ISZA 1EJ7L 3T8LA 2Y88A 3W74A 1KQYA 6TAAA 1SPQA 5GJPA 4NAEA 1RCXB 4UQ9A 5G1TA 3HG4A 1YTDA 1A5NC 2E5CA 4CD6A 3RUBL 1PCKA 1R30A 4D1JA 1KV8A 3AHTA 2F2KA 2XSXA 3BMXA 4RKAA 4AF0A 1C3FA 3C3NA 1M9HA 2V2DA 3FA4A 3K8KA 4LT9A 2ZX8A 2BY0A 3FFSA 2ISWA 4C60A 2JKEA 3VM7A 5CPOA 1PHWA 4KCWA 4M82A 3EX1A 2C14A 2VGBA 3FJ4A 1Z9AA 3NGJA 3AMGA 2ZADA 4L1WA 5CBBA 4PRWA 4QDWA 3MV11 3PHAA 1GOWA 4HK5A 5DCEA 2R14A 4LGXA 4HU3A 2A5HA 3MSYA 3GU9A 2P76A 1HP5A 3BMVA 4GACA 4WY0F 3VCCA 4BR1A 3NZPA 1FHVA 4G5DA 1PSCA 1G7UA 4V28A 4P8VA 1KBLA 1E1EA 4OHQA 4HA4A 3S42A 3M7SA 3JVAA 1CLXA 3BG5A 4L6OA 1UUMA 3CLMA 4ERIA 1QPOA 1CTNA 3S0CA 1NH6A 1F6YA 2TAAA 2I5GA 1EDGA 4QJ3B 5XINA 4P8XA 1DTUA 1UROA 1LBLA 1XYCA 5L9FA 3QV7A 5CJMA 3MYOA 4DY1A 5I2UA 4UTWA 1QR7A 1H51A 3QRHA 2BOGX 2R8WA 1V79A 3O6AA 4KEVA 3PNUA 2PA6A 4YHEA 3Q37A 3V75A 4JTCA 3LV6A 3TJIA 5HWMA 3RM9A 3M0LA 5FAJA 3DI0A 4ZFMA 1YIXA 1T5AA 1E56A 3FEMA 2WZEA 1WE5A 3LXCA 2YA2A 3AXXA 3HF3A 1XGEA 4PMUA 3C8FA 1H7NA 4LAOA 4GFSA 3HQ1A 1UP0A 1KFCA 3REQA 1V77A 4XKYA 4GUJA 4PUDA 1J12A 2YW4A 2W66A 1PDZA 2JIWA 3LM3A 4UBPC 3WJXA 1J11A 2WMIA 3TDFA 4GQQA 4YU1A 3VGDA 2NQ5A 4IZGA 5I09A 2F8QA 1TWIA 3V36A 3UZWA 2E40A 1C8XA 1C8QA 3OU8A 3PZGA 6TIMA 1B57A 3ALFA 2E5DA 1R3RA 1EWDA 1HKKA 3LQLA 1C90A 1TVPA 4L4MA 3PSVA 3L2MA 1GG0A 3S46A 1J9YA 3KWSA 4B92A 2E6DA 1K7EA 3UG8A 1XQLA 4Q7BA 4K8EA 5A3HA 3QBUA 1AW1A 3NPUA 2ZTJA 3DYOA 5BCAA 4IIEA 4LS1A 3A9BA 2BY3A 1RUSA 3URQA 1EZ2A 3HPSA 3WQGA 4QROA 3U9IA 1V93A 4HZMA 1KTNA 1GNXA 4N0RA 4U5IA 3W71A 3T09A 2CXGA 3FXYA 3S2NA 1Q63A 1U1HA 4UTHA 1G1YA 1V3JA 3S5NA 2VTFA 3GNOA 2QPXA 8XIMA 3F4DA 1EPXA 5MF5A 4U4MA 3QH2A 2WXDM 3O16A 2CZEA 3H53A 4QISA 1OD0A 3STEA 5CBIA 1VPXA 2ANUA 3HMCA 3RF9A 1TQJA 2NVCA 2NXHA 2VNCA 4X2PA 2VT0A 4CN4A 4NYUA 1MEHA 1R9ZA 3C0LA 4DF1A 1U30A 3QY8A 2ZICA 2PGWA 2UBPC 3P6LA 1WKEA 4FXRA 1W3IA 1DWFM 3F5JA 2AGTA 3E2SA 1JZ6A 5D32A 2GDVA 4YCPA 3ZLFA 4A3UA 1J18A 5A8OA 4U3CA 5EBAA 2OR2A 2FPTA 1AG1O 5CBJA 4J40A 5HWJA 1XC4A 2GJPA 4FR1A 2JF6A 3CWHA 3RCMA 2J7CA 3WJYA 3CMJA 1MQPA 2FQIA 3JR2A 1DYSA 2PTXA 4NY2A 1Y5XA 3JW7A 4UQEA 3PBMA 5LNWA 5FJTA 2WM1A 3LI1A 4RDWA 4IFOA 4MLRA 4IJBA 3N1AA 3DCPA 3VIIA 3NQ7A 2PF0A 1XL9A 2DZPA 3W9ZA 4G7EB 4DZHA 4E8DA 3SQMA 1PS9A 2WSYA 5CSSA 1H61A 4PFHA 1H2JA 4RPQA 3KDNA 1BRLA 3TMQA 4A22A 5CCZA 4MDOA 3U2CA 4Q8TA 4DF0A 2QAPA 4GK8A 3EA2A 3LPGA 2XFYA 1MFUA 1WOAA 4N9CA 3OLDA 3CMGA 1R3WA 4E0CA 1XXXA 3TOYA 1US0A 2BZNA 2Z2BA 4I3GA 2QCMA 2RHGA 1UD4A 3N4FA 3TP4A 3G1SA 4WSHA 4E2VA 1FWNA 1Z48A 4LANA 1S1RA 1N55A 3FA5A 2NZLA 2PCQA 1RBOB 3BARA 3IWPA 1VFFA 5T9BG 1BFNA 2QQ6A 4KERA 3S5OA 3TYZA 1UC4A 4C7FA 2AQVA 4RDZA 3O0KA 4ZMGA 3G6MA 1W54A 4QDMA 4MMWA 1MDRA 5D2WA 3IVUA 3UNDA 3E0LA 3L4WA 3VNLA 1GKRA 1FDJA 2PE4A 3QY6A 4O18A 3IJIA 4HNUA 5HPCA 2WSPA 4H2CA 2RJHA 4QR6A 3W28A 2VCCA 1BTCA 3UT0A 3NL5A 1T8QA 2QT3A 5DXXA 1FDZA 2G5WA 4IP4A 4BWLA 1HVXA 1XGDA 3IARA 4GY7A 4QGCA 7REQB 5JQ9A 3TTSA 6ENLA 3CHVA 3FXGA 4RDVA 2PRHA 2YDQA 4RNJA 1PCWA 1U5JA 4LH8A 1FH8A 4JYFA 2OMAA 4MWAE 2RKXA 4ICCX 5REQA 2VX5A 3F2CA 3GNNA 3QMRA 2D23A 3AO0A 1DIEA 3M0YA 5EL1A 3BLEA 4JZ5A 3PBGA 5FI8A 3EWZA 3TJLA 1KFKA 4RJEA 4ZTYA 3EOOA 3WK2A 3B40A 3PPGA 3O7UA 3MTWA 5CSRA 4HN4A 4WKHA 3OBKA 3W2MA 1B3OA 1FCQA 3LN3A 4HJFA 5BZAA 4HK7A 4NZ5A 1AW2A 1Q66A 1XH1A 2NUXA 2BY2A 1E6QM 1JDEA 5EFDA 4PBFA 3KM8A 4KT2A 4DZIA 2W5FA 1OZMA 2QF7A 4OECA 4Q8PA 1RP9A 1SZNA 2CLFA 4I5RA 4H9ZA 4NX0A 4HOXA 3BW4A 5FJJA 3F4WA 3NSNA 4DXKA 4O14A 1DV7A 2EPMX 2BHZA 3IGSA 2VCBA 3CL7A 1DQWA 1Q6LA 5HULA 1FWFC 1NDWA 1VHCA 4UFLA 3W76A 4C6IA 3SUTA 3LMYA 3TMLA 4ZXLA 3L7RA 4JTIA 2D3NA 3MT1A 4IMAA 4K68A 2Z2UA 3MO4A 2PDKA 6ALDA 2F6XA 2R1NA 5HUOA 2CBUA 2QPSA 5CXPA 4W87A 2XH4A 2A7NA 3ZZ1A 3IAPA 1CCWB 4J4KA 3NM1A 5JH2A 3ERPA 5I0DA 3TH6A 1PTGA 4N4PA 4CD4A 3BLIA 4PMOA 3TQKA 2DZVA 1TTIA 4KFOA 2EG7A 1XDJA 2W63A 1PX4A 1X8FA 5J5RA 1UW9A 2RGMA 5FAGA 2PDUA 4FXFA 2R24A 2Y7DA 3AWNA 1XCXA 2OZ3A 4J1OA 2C1HA 1A47A 1ONWA 1KFBA 4K1WA 4J3XA 3A24A 1LOSA 3M16A 3WD4A 4DZ5A 1B3ZA 2YCLA 9XIAA 4LS0A 3MP3A 3BJFA 4GZIA 4M0XA 2DGAA 3LRKA 3WBEA 1HKMA 3WLNA 3UF9A 2HK1A 2PZNA 3O1NA 3U5UA 4NJJA 2ZXQA 1SYTA 2PF8A 4LS2A 1K8ZA 4PB5A 1JYXA 1MFVA 4GC4A 2FLIA 3S5SA 4FLRA 3AIWA 3TC6A 3NQCA 1TWZA 1PL9A 1X7IA 1JDAA 1K9FA 1W6TA 3H7RA 3PJTA 3GXMA 2DH2A 3EOLA 5E5CA 2GJRA 3E2RA 2DQXA 1D8WA 3QY7A 4G8TA 3BSGA 1GWJA 2QHAA 2C71A 4NXSA 1DWGM 3T42A 1QNVA 4XZMX 1VP5A 3EB2A 4PMXA 2QUNA 1N7KA 1IGWA 2H90A 1B3XA 1IWAA 3AS0A 4ICNA 1TCDA 2WQDA 2HK0A 1GQJA 1WZMA 2OLSA 4XBSA 2QUTA 3G18A 3V18A 4B2DD 2WVVA 3BAWA 4O4VA 3TZFA 3TYUA 4K39A 4QSHA 3JS3A 3TU9A 3AALA 4O4WA 3T07A 3EMCA 3IRSA 5FKYA 1N8FA 1BYAA 3JZEA 2PTDA 2XGIA 1IZKA 1XDMA 1L6FA 2XIBA 2CZDA 3B0XA 2DW7A 4UXDA 2VFGA 3BLDA 1IHIA 1AH3A 1F6PA 3SRDA 4KRTA 4MG4A 3UGRA 4NVTA 4DYEA 3QGVA 1BWKA 3FY1A 1G4TA 3FVDA 1GVIA 1UR3M 1V0LA 3UWEA 1RV8A 4QP0A 1ITXA 1DHKA 1AODA 2W67A 1F5ZA 3TYAA 4EVZA 2OO0A 2W62A 3A47A 4JKLA 1JDCA 3LBMA 2PDGA 1OK6A 3L65A 3CXOA 4D72A 1H4PA 2H9AA 4E2OA 2PP0A 1YDYA 3U4FA 1XUUA 3HQPA 2Z1XA 1H3GA 1H7XA 1YTKA 4GI6A 4XSMA 1E6ZA 3B8TA 4GNVA 5M5DA 1VRXA 3TYEA 3FAXA 1XRSA 3SUVA 2ZDSA 1SUXA 4OZOA 4DJFA 3SQLA 4GO9A 4L4OA 3MA8A 1YPXA 5D38A 3UY8A 4GXPA 2X09A 4TR9A 2ZQ0A 1IEIA 1OCJA 4RX0A 3SADA 3NAVA 1Q7QA 1D2KA 4AYGA 3A22A 2D2GA 3GTNA 4YPJA 3CV2A 1YBQA 3D47A 5KEZA 1S5WA 4K37A 3BSHA 4WX2A 2WQPA 1B1YA 2XVNA 1XIBA 4NIRA 3RPDA 4G1KA 1ICPA 4AHQA 5HNUA 2YL5A 3MVIA 1EA0A 1XIJA 3OGSA 2QDDA 5A6BD 1L0PA 1X96A 3M0XA 4GC3A 5EA9A 1P7TB 1KRMA 1IXNA 3GFYA 1XPYA 4KIEA 2VR2A 3VDBA 4ZQPA 3WBAA 4AEFA 5AYYA 3TKFA 4P61A 1KBJA 2I14A 1DTNA 2NLYA 3W27A 3IJDA 1TWWA 2CLOA 5BOOA 1TPVA 4W85A 5AY7A 1F3EA 4MUPA 5BXPA 1XQKA 3WK1A 5C70A 2FZBA 4H9TA 1SMAA 2X7VA 4PCFA 1V4YA 1X6LA 4Q4PA 2EPKX 4AIUA 4GX9A 3L2LA 5KZMA 1F8IA 4ADUA 4DF2A 3APGA 4M56A 2P0OA 2XIQA 4CD7A 3QR0A 4F0SA 1XIHA 4UCFA 3TFCA 1SO4A 4B3ZA 5D09A 2RGLA 4UR9A 2A2IA 1KFJA 5AHLA 2HE8A 4BI7A 4NAFA 2VDIA 5D04C 3LBOA 4CVUA 2NT0A 1LWHA 2ISDA 3STPA 3M07A 3C0SA 1FWRA 3GHUA 2HS6A 3R5EA 2CEQA 5HAOA 4C6CA 1O5RA 1RK6A 3GKAA 2V68A 1VCGA 4U2YA 4F0RA 3VNKA 1HJQA 4ACZB 5EMJA 1QOQA 1PHQA 5D8WA 3P82A 2ALRA 2X1IA 1BXNA 3K4WA 4HD5A 2Y1HA 2ZCGA 1G4PA 1OCQA 1QOPA 4O8AA 4ZL1A 4BKNA 2V8ZA 3OJGA 1J5SA 3HV8A 5DQPA 4XD6A 3T2OA 1DJNA 1YRRA 3DN5A 4CU7A 1Y5VA 2L5HA 3QMSA 4IMFA 1XLIA 1EJXC 1UKSA 3UBPC 1XI3A 1Q6DA 1UH4A 5BNKA 5D9OA 2O7SA 1BG9A 1WDRA 4PRRA 1LBMA 1YKWA 4HNNA 1HQTA 2J77A 4PCNA 1F3TA 2JKPA 3HTWA 1XPGA 2PDQA 8CGTA 3HN3A 3SFKA 6A3HA 3MO7A 4B4FA 4H9MA 2IXUA 3B0VC 1AQMA 4Y2WA 1LP6A 2GL5A 1ONXA 1QCWA 3VNYA 3LHUA 2BVDA 3L4XA 2E77A 1VJIA 1V02E 3WJZA 3VU2A 2ZA1A 3C8NA 2E25A 4P7QA 5FF0A 1UWSA 3QHNA 3N13A 1O5QA 1AA1B 1UWIA 3SRHA 3WQVA 1PB0A 1UD5A 1WBJA 1TVLA 3MUAA 3U3HA 3MU7A 3HPFA 3WK0A 1G6CA 2D20A 1EDTA 3C52A 4WZHA 1WNOA 1OSEA 3W7IA 4W7UA 4W7WA 2BOEX 4CCCA 3MCOA 2V30A 3MI2A 2KZHA 3QTGA 3A23A 4FZIA 2EJAA 1J96A 1LWJA 1BYBA 5U4NA 2OQYA 3LTSA 1VRDA 4ENLA 1TREA 2YBUA 3M7WA 4HMEA 3DHDA 1HW6A 4POCA 4DUXA 4HHHA 4MFDA 5TQLA 1S3TC 1KR0A 1S5MA 5C9WA 2CHNA 2BB0A 3WLIA 1XSKA 3VI2A 3DIPA 1XBXA 1ZJAA 4Y96A 2E09A 1NTHA 1XLHA 3S2MA 2OEJA 1O95A 1SFLA 3PJWA 3M0HA 1DPMA 3CZGA 4IFKB 4H9YA 3B9NA 3THCA 1CDGA 4TIMA 2FZDA 2ACUA 1IT7A 1KXTA 1DJWA 3VYLA 3UJFA 1W3TA 2FTYA 3T44A 2DSKA 3SGUA 1QNRA 4AEOA 2YB1A 2D69A 2CLHA 1IIHA 4H9UA 1TZ9A 3FJLA 5JIWA 1S1PA 4RNHA 4DIAA 1HP4A 3OLGA 3FYYA 1MUMA 3KCOA 1A5CA 4I9AA 1QWKA 1S2CA 1UQZA 1W91A 2CZ5A 4AMCA 3R8RA 1B3VA 2OGYA 4B5UA 1TPDA 4A4AA 3LPFA 1IIGA 2GOKA 3OVRA 3LCGA 3I6EA 1HL9A 5I3GA 4M6QA 1HVQA 2FZMA 3HBLA 3UXIA 2J8FA 1QVBA 1HO1A 1Z6KA 2XZ7A 2F61A 2NV2A 3OBEA 7CGTA 3WCZA 1OWQA 3ZR5A 4C7GA 4IPNB 2CIPA 3PZOA 1PKNA 4XG1A 1OVDA 2XIOA 4IUGA 1QUMA 3VCNA 2Q09A 1IYXA 2Z6JA 2GWNA 2XUCA 1JIBA 2RH9A 3BL3A 4PYSA 2VC7A 3WSUA 1UZHA 3RIKA 4B5XA 2NT1A 3VIOA 2FB3A 4A3RA 3PK7A 1WB0A 3QQWA 3ZFHA 3WF3A 1GGOA 3RO8A 3KLKA 2HXTA 2BG5A 3PZ9A 2Y70A 1CECA 1GCYA 1YLVA 2E1WA 3VAVA 4M6UA 3TJ4A 1Q45A 4JFWA 4MY1A 1RY8A 1E9LA 1A5AA 2X40A 4O10A 1VGAA 1QASA 2HWGA 3SCTA 4WD0A 1K4HA 1H0IA 2JEQA 4LCSA 3AI0A 2ACRA 2NSXA 2XYLA 1PKYA 4LSBA 1E55A 3QV8A 3ANYA 4X0VA 1MZHA 4MAVA 5JMUA 1E9YB 2WVTA 2XSBA 5C8BB 1QI4A 1SR0A 5GVJA 5AC6A 4AU0A 6REQA 1OG6A 3RN6A 3CQIA 5LHEA 3PR2A 4FAMA 2Q3RA 3B9DA 2GGEA 5A8MA 1RXOB 5DT7A 1W8GA 2P10A 1FWTA 4IGSA 2YIHA 1B0IA 2CKSA 3P8IA 4G7FA 4EXBA 1OF6A 2YYTA 3SY8A 3K13A 1MW0A 4JBRA 2Q01A 2QLYA 1T40A 3WMSA 4QJ5B 3SEPA 3FHQA 2QXWA 4OUIA 3USBA 1R38A 5AECA 2QDGA 4S3KA 5I3KA 1H7RA 1D8CA 4L61A 4DUOA 4JKMA 5CAKA 1JXJA 1PTDA 1AFSA 4M51A 4RZ4A 5M2FX 2YXGA 3BAKA 4CEUC 3E0VA 2BY1A 2VEFA 4JQ1A 2BXYA 5AZ1A 1OGSA 2GUYA 2PFHA 1TPB1 1E5NA 1CGWA 4S3GA 1EJRC 4LC8A 2YL6A 2IXVA 3IJ6A 1W31A 1SZGA 2G37A 4O0KA 3UG5A 3MPGA 3S1UA 3GVQA 4WHBA 3TSBA 1NVMA 3W6LA 3SUSA 2AMGA 1GTEA 1E6RA 3OZMA 1OC5A 3H21A 3PPFA 4F0HA 3LNMA 4DUVA 3VGGA 1TV2A 4J3VA 1AMYA 3WX7A 2DIEA 4ZOCA 4Z1AA 3DHFA 3EXTA 3S5ZA 1W32A 3GXPA 4JTEA 2J88A 2RDWA 1T8XA 4OJYA 4O50A 3U0HA 3MWCA 3LCLA 3O2LA 4AD4A 4MYAA 1FDYA 4DHGA 1GOQA 3FN9A 4R85A 1BF2A 2X1SA 5E0FA 2OYMA 3N6QA 2VZSA 3D46A 3VC5A 3W7CA 5FESA 1RLCL 3KE0A 1LWIA 3QZAA 1XLEA 1B5TA 3O3RA 1UH3A 4YHGA 2DZTA 1UR2A 4B5SA 4KCUA 5B7ZA 4PUUA 1Q2SA 3P14A 1DXFA 5EMUA 1U1UA 5ABFB 2DZUA 3FK4A 2QV4A 3I3EA 1O94A 4OKDA 3KL5A 4KWUA 4H8HA 1P0EA 1A0EA 4J2PA 1VFMA 1J0JA 4MSSA 2EBNA 2EKGA 5HR7A 5DCDA 3VDGA 1YNPA 2OX4A 2J9XA 3GHTA 7TIMA 2QJGA 3V1PA 3W26A 5IRPA 3PBWA 1K77A 3P3BA 2AL2A 4AISA 4MNKA 4IPJA 1A5SA 2GGHA 3GW0A 4AD3A 4MWAA 3THQA 2RDUA 5E09A 1ZBWA 3CPGA 3M0ZA 3WQ6A 3M0JA 5GJMA 3IIPA 3DDMA 4QG8A 1ZUAX 2CCRA 1RSCA 3ABRA 1XDLA 3G22A 5HQEA 4J28A 1ENUA 5IFTA 1G69A 1E43A 3A6OA 1XP3A 2QCNA 3IV3A 1TJ1A 2NUWA 1W1B1 1OGBA 4B90A 5A6KA 3QSTA 3CPUA 1Q7MA 3ANUA 4XAFA 3RX3A 4HIBA 4MPKA 5CLTA 2BGQA 3BW3A 4ZA0A 2FZ8A 1U33A 2FFIA 5AC7A 4H8NA 1GVOA 2YL8A 1TRDA 1VB9A 4QJ1A 1JZ5A 5PTDA 2ATMA 5BW6A 5BU9A 3PTKA 3WDRA 3AIVA 3ARRA 4IMEA 3ARQA 4RNFA 4X60A 2VGGA 1CXFA 1SFJA 1XIEA 2J7GA 3EYPA 2DW6A 2B31A 3VC6A 4FK9A 3VKBA 4H01A 1E6SM 1UOZA 1ODUA 1RJPA 3WLHA 4IXHA 2XH0A 4ZB2A 1IXQA 1KFWA 2VFIA 1DJIA 2HMCA 4L64A 3U8GA 2CERA 4X3ZA 3OYZA 1B54A 3W81A 1Y0EA 4LW7A 1E0UA 3PBYA 4JFUA 3QVQA 3TFXA 5IBXC 5JBDA 5G4WA 3VM5A 5TNVA 3ABQA 2C3ZA 3G8EA 3VD7A 2AL1A 4V1XA 3Q4DA 3Q65A 3C86A 4D71A 5JVLA 3G1DA 3G1XA 4YTUA 1PWMA 1RH9A 3CK5A 1ZL1A 2WJZA 4GIEA 2DIKA 3L9CA 4MB1A 4NJIA 3OLIA 2VRJA 4TV5A 4OBSA 4Q4OA 1WDQA 5AC5A 3VK5A 1G67A 3MDWA 4M29A 5IM51 3WLMA 1IT0A 2HZGA 1UD6A 4MYXA 4XIMA 2Y2WA 1KCLA 4HNVA 4CKQA 4F0KA 4JYEA 4FX8A 4JIPA 4WDTA 1X98A 3SCSA 2V5BA 3CZJA 2O4QA 4M7SA 2QCDB 3IAQA 2IW0A 3WQ4A 2GDUA 4GFIA 4FALA 4DYKA 4DJDC 4IIFA 3THDA 1PV8A 3ME3A 1TV5A 3G3MA 5BMXA 4DM1A 4O1AA 4QX4A 4UTTC 4F0LA 3NR0A 1LOLA 3ABSA 3AS2A 2ZE0A 4Q33A 4H8UA 3G6LA 4I7WA 3MMDA 1XYLA 1HG3A 3IJ9A 3TXVA 4C6OA 2P8CA 3GO2A 5HMFA 2EG6A 4K38A 3UPWA 2XH2A 5LZLA 3PJXA 3TQVA 4GD0A 1TTJA 3W6YA 4HNTA 5HOSA 1BYDA 5XIAA 4JHOA 1D3HA 3BK0A 3QOMA 2EGZA 3E0WA 1QW9A 3I6RA 3W1AA 4HPGA 3KTCA 4DEFA 2WPBA 4FF7A 4H6KA 3M9YA 3S1WA 1V6VA 2A7PA 4LXFA 2WLYA 1X1OA 2ZZ2A 3H2CA 1LG1A 1TELA 2XZ9A 1BHGA 3V5CA 3FSTA 1H0GA 5E0KA 1ICQA 2ABBA 4BI5A 3WELA 4V1YA 4JTQA 1F4AA 1FP8A 5AB3A 1EFZA 3OLEA 1UASA 1QOXA 2V3DA 7PTDA 1BTMA 2G0WA 4M6PA 2Y7EA 2EO7A 1V0NA 1HFBA 1W9DM 1H09A 4GKLA 1PX8A 3SGZA 2J25A 3GTHA 1DQUA 4E5TA 1EJSC 4PSRA 4O1FA 1DORA 1EEPA 4HCLA 2ZZ1A 4NNAA 4ERGA 1H41A 5AHIA 3NM3A 1EP3A 1QI2A 3OA5A 4BA0A 3S1GA 1S46A 2GK1B 1C9WA 3QJAA 1UJQA 1ISWA 4R88A 3GG1A 1FFQA 4JQAA 4MJMA 4IF2A 4UNKA 4GQ0A 1UJPA 3DBNA 4AY8A 4RE2A 1OYAA 2G95A 2FKPA 1P5BA 5CZ0A 5FF4A 5DN1A 1WP6A 3CO4A 5C2GA 3LHZA 3HIJA 1JZ8A 3R0KA 1LOQA 3VIMA 2X2YA 4UQBA 3QC3A 1DEDA 3MZNA 2DSUA 2YB4A 4OOZA 3MI6A 4F48A 1CNVA 1POJA 4S23A 3BANA 3MMWA 4Q32A 1HTIA 1A4MA 1XUZA 2X1TA 3MUXA 2BGSA 4L1GA 3W7LA 4FA3A 4I9MA 1HF6A 3C0JA 4FIRA 1XC6A 2VOMA 2XU2A 1GYMA 2OKTA 3O6YX 1FWBC 3VIHA 4J2MA 2WHMA 5HANA 2WSQA 4HYVA 2GQ3A 1LT8A 4B3LA 3TONA 3UR8A 3L23A 2IMRA 4JIHA 3VILA 1UKTA 1GZ1A 4XKYB 3ZSTA 3DFHA 1OK4A 3MHUA 3TWAA 1OT1A 5JH1A 2YR1A 1ZNNA 4IQLA 4ZVJA 3AJXA 3MHFA 1OY0A 3AHZA 2CLPA 1TMLA 2WMIB 1FVPA 3LS9A 4MKSA 4JFVA 3WD1A 1ME7A 3BG9A 3WNPA 3IIZA 5D2TA 4LV4A 1ZFJA 3DFSA 1E0WA 4DWDA 3DGBA 3OHIA 5J8LA 3EWDA 4O0QA 1TA3B 2AKMA 2BWGA 1ME8A 4JHZA 5TBOA 3S9IA 1QK0A 3CMFA 1ZAHA 1GORA 4YVXA 2QKFA 5C2CA 5DANA 4UFMA 3EWBX 4GUHA 1GVRA 4B5WA 3HO8A 3NVDA 2Z7KA 2Z24A 4NQ1A 4K1GA 1TO3A 1JPIA 5EPDA