3N2XA

Crystal structure of yage, a prophage protein belonging to the dihydrodipicolinic acid synthase family from e. coli k12 in complex with pyruvate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
298
structure length
297
Chain Sequence
ALFTGIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKAIARFAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRYFEQVADSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIDTIDSVAHLRSMIHTVKGAHPHFTVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKAAGYHQTLLQIPQMYQLDTPFVNVIKEAIVLCGRPVSTHVLPPASPLDEPRKAQLKTLLQQLKLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification of biochemical and putative biological role of a xenolog from Escherichia coli using structural analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords Uncharacterized protein yagE
total genus 110
structure length 297
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.28: 2-dehydro-3-deoxy-D-pentonate aldolase.
pdb deposition date 2010-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3n2xA00
3A22A 4KFPA 1S5WA 3NQMA 1ZY9A 2FTPA 3MI6A 5TQLA 1KM4A 4GE8A 3ZS4A 1EEPA 3INPA 1L2UA 4HKPA 1JCLA 1W5QA 5F4WA 4IJBA 4JYFA 1UB3A 4LU0A 2BSLA 2W0UA 1H50A 4RV8A 4UTMA 3GLCA 4MY1A 3S1XA 1F7BA 1V7YA 3VKJA 2TRSA 1KFEA 3C2RA 3G8EA 4FEZA 1TPC1 1G4SA 4DO5A 1HFBA 5D02A 3GDTA 5H2ZA 3W7OA 3LCGA 3TX9A 3UWWA 1GPWA 1H62A 1ME8A 4UFKA 5LZLA 3NQCA 3PC0A 4X9SA 1D3HA 3ATYA 4QNWA 4JX6A 4XWUA 5G2HA 3LCWA 4JTEA 5DN1A 3W73A 3BO9A 3KAOA 3LRKA 2W79A 2B7OA 4JYEA 4PA8A 2ATMA 5D04C 5FF3A 5DY3A 4GJ1A 3E0IA 2QCDB 4IPJA 4RZ6A 3G1YA 2EAWA 3T44A 4WOZA 4Z1CA 1CX9A 1P0NA 1MEWA 4BI5A 3QPZA 3GVGA 1X1OA 3H54A 5FEXA 4LW7A 3WK1A 4W9TA 4HSOA 1P4CA 4JN6A 3RFAA 4WZHA 2VEMA 1O95A 1QO5A 3W6YA 1OJXA 1EIXA 4RLIA 2V2DA 4O18A 1W56A 4JTSA 1JCNA 2Y62A 4QQ3A 2RH9A 3GDMA 1I2QA 3ZFHA 3LLFA 5K9CA 2QCNA 3NQFA 3BG3A 1TO3A 4ZZ9A 2X1TA 4GUIA 3CEPA 1I2OA 3IGXA 3DGRA 5AFDA 2ZRVA 3QMTA 2A6LA 1VQTA 4D2JA 4LVFA 2BZNA 2Q8ZA 1GYLA 3BPWA 3TW7A 1EWEA 2ZRYA 3FEMA 3NG3A 4BR1A 5K9DA 3TV8A 5G2IA 3GDLA 3KRZA 4N4QA 3Q94A 3W2KA 1TPH1 2JGYA 4JS3A 2GUUA 2V9DA 3QRHA 3O8AA 1K7FA 3NPXA 1T0OA 3EX1A 3VI2A 4NJJA 3HGRA 1JUBA 2Q3OA 1OHLA 1NF0A 3I68A 5AN7A 4UUIA 4C1KA 4O50A 1VCFA 3E02A 1MEIA 2ZDRA 3IIZA 3QH2A 3Q37A 3LHUA 1RQBA 3TE9A 3W7LA 3TMLA 3MO7A 3NVTA 3STEA 4A2SA 1X7FA 4DPPA 3TAOA 1TPUA 3GNDA 3JR2A 1OFPA 2P10A 1GVOA 3CIWA 1F76A 2WOQA 3EX3A 5CPMA 3YPIA 1HUVA 1ALDA 1KTNA 3W75A 2Z1BA 1IIHA 4IMGA 2NX9A 4AEOA 2YW3A 1YDOA 3PS7A 3TU9A 3LV5A 1Z41A 2PE4A 5LGZA 3W2MA 2CU0A 1LYXA 4CCCA 1P0KA 2ZQ0A 1WYIA 3T78A 2Z6JA 4E38A 2D73A 3EWWA 3L5LA 1XXXA 3M5XA 3DFOA 2XFWA 5CZSA 1W0MA 3HG5A 4JICA 4DF0A 5SWUA 4Z1BA 1YDNA 1CW2A 1GZGA 3RK8A 6ALDA 4GFSA 2GPTA 2NXIA 3W84A 3IVUA 2DZPA 3MWAA 5E1QA 2B7QA 2QUTA 1F73A 4O1AA 5KTLA 2RDWA 4GC4A 5EPDA 1OYBA 3GKFA 2H6RA 3EXRA 1XDLA 4LVGA 1QPRA 4WY0F 1I2PA 3GXTA 3TQ0A 3P7YA 1G67A 4ZQPA 4JTJA 1QPQA 1I8JA 2CZFA 2ZZ6A 3LCLA 3T55A 2B7PA 3S5NA 4HNNA 1MSSA 2VEIA 5HNRA 2C3ZA 4WQ6A 1EA0A 5AYXA 1ZHAA 1R2RA 3AO0A 4O13A 3DU0A 1UBSA 4A22A 3STGA 3DHDA 1LRQA 3MMTA 2WNZA 3NM3A 2ZA2A 3P80A 3W1LA 1P5BA 1T96A 1G69A 1XC4A 2HTMA 3QMRA 4N9BA 1PL9A 4NNAA 3DBPA 3IIOA 5D32A 3RLUA 1W5MA 1XBYA 3TQVA 1LLZA 4CQ8A 1VJIA 2JK2A 3BLEA 1VYRA 2OT0A 4NVTA 3QMSA 1KBIA 4UTKA 3ZR4A 3W88A 4M6VA 2NWSA 1TPVA 2FPTA 3WK0A 4XBKA 4C1LA 2RKXA 1H1YA 4MLRA 4ZMGA 4K8EA 2Y7GA 1RV8A 4XTIA 3HMJG 1KM1A 2B4GA 1GVRA 3EEGA 2PRLA 4AVFA 2P1FA 4U4MA 3DFTA 3FYOA 3G1SA 5I3FA 1DVJA 3HGSA 1LBMA 3KHJA 5K2ZA 1IXNA 1OFQA 4DPQA 3UXDA 2QEZA 5BMXA 3U8GA 3I7RA 4AXKA 2BWGA 2Z6IA 3PBUA 2J24A 1PHWA 1SFJA 5HR6A 4AWTA 4TO8A 5LHFA 3BLFA 3THAA 5FEWA 1O94A 4DO6A 4CNNA 4LV9A 4ORIA 3BLIA 1NEYA 2E5BA 2V30A 3PF3A 2JKAA 4LS2A 1L6YA 2Y85A 1ZENA 5FF2A 3UNDA 3W1UA 1FBAA 3NQVA 2Y6ZA 1W3NA 3UPWA 3A24A 1FXPA 2ZA3A 1THFD 3GB6A 3L68A 3EX2A 4LV4A 3B03A 5TBOA 4WOQA 5HWJA 1BWKA 1IXQA 4HNTA 2G97A 2ISSA 1YTEA 3TR2A 1N8FA 2I1OA 1JCYA 4M7SA 3W7IA 1LDCA 4CQAA 3PM6A 3CM4A 3FOKA 4FXRA 5AHMA 1Q6QA 2I14A 4JR5A 3UPBA 1W54A 3STCA 1SO6A 4DBDA 1OG0A 3W07A 1GJPA 5EL1A 2WO5A 3R2GA 2YDAA 3C56A 4UMAA 1T99A 1YPIA 2Y88A 3DFQA 3C3NA 2A4AA 3C52A 3W7EA 2Y7EA 3L0GA 3M44A 4MYAA 3W70A 1R47A 2V2HA 1VYSX 1TTQA 1TB3A 1XL9A 3GNNA 1XI3A 4N02A 4LUJA 4I7UA 3NQ7A 4O1BA 5EKYA 3UWZA 2QJHA 3QQ0A 2E6FA 3W74A 1EPXA 1ML1A 4TX9A 4DBEA 5C6MA 2NX3A 4UTWA 2E6AA 1FCUA 1PIIA 1K3UA 4ONVA 3S42A 2ZFAA 3W7CA 3MI2A 4NXSA 1ZNNA 3C2EA 5HMSA 3B0UX 4JTFA 1F6KA 2JGQA 1SZEA 1OVDA 3QM3A 3RLVA 3DFSA 3THQA 1O4UA 5AB3A 1OFDA 2YSWA 5F4SA 2NUWA 3W7DA 1QNVA 1W37A 3LM7A 4EOUA 1G7VA 4PL1A 1I4NA 5CZJA 2WJZA 4CNOA 2H8ZA 3WJXA 4A21A 2B7NA 1MXSA 1D9EA 1AL7A 1SSGA 1FWNA 1QWGA 4CCDA 4M7TA 2PC4A 3TW6A 3DI0A 3TSDA 3KX6A 5KZDA 1HTIA 3G1HA 4K38A 1IIGA 1W31A 3S5OA 3L5MA 1X1ZA 3TH6A 4RXFA 4DELA 1RR2A 3BW4A 3LCIA 4UTWC 3P8JA 4QM1A 4EIVA 3P8IA 3NPWA 3FIGA 4EF9A 4MZ8A 4JX4A 2QCCA 5AOUA 2CZ5A 4LTSA 3SR7A 4RZ4A 2CLMA 5K3VA 2QKFA 1TIMA 2ZRZA 1W5NA 5I3IA 1NVMA 3G8RA 3CPRA 4FX8A 5DBUA 1W3IA 3S9YA 3NPVA 3C2FA 2X1RA 3HJZA 4QJ1A 4KWVA 3W1TA 2ZZ4A 3KOFA 3UD6A 1YXCA 4MY9A 1YYAA 5D2TA 1SQ7A 3U2OA 2ZZ1A 2OT1A 3UY8A 3MHGA 3O07A 2A2IA 4UTJA 1UUOA 5EA9A 5TIMA 3B0PA 4LWWA 2GOUA 4NZFA 5HULA 1NAL1 4K7VA 1W8SA 3LHZA 4UCGA 3NYZA 3OEXA 1TPB1 3QF0A 3KVMA 2ZRWA 4L4MA 1TREA 3KRUA 3SZ8A 3G1XA 1LM1A 4ADSA 3TQKA 2ZTKA 3A21A 4H3DA 3VE7A 3I7SA 4IX0A 2VFDA 4Z08A 2QCDA 4N4PA 2ZTJA 4FHAA 4MFEA 4UTIA 2PURA 3QJAA 3LRLA 2PRMA 3IVSA 3W85A 3LBCA 3W7HA 2V8ZA 3H55A 1TJRA 3VE9A 4HN4A 5ABTA 2A6NA 5CPLA 2TPSA 2V82A 1H61A 2FPVA 3MUXA 4IMDA 5LKYA 1AG1O 5F2LA 3EWXA 3RMJA 3M43A 1XKYA 1XCFA 3KFTA 1J4EA 3WJZA 3ATZA 5F1UA 4O11A 2NWRA 2J9XA 5G2WA 5EY5A 4E2BA 2G95A 4UFJA 2Y89A 1VS1A 2ALDA 1H7PA 1XUZA 5F2IA 1VLWA 1RVGA 3NL5A 3V75A 1GQNA 1KM0A 3R5EA 4YCOA 5LGXA 4HHPA 1LBLA 1XBVA 3EX4A 1PCKA 4OWGA 2IQTA 3BG9A 3IEBA 2DZXA 2E5DA 2JKPA 4MY8A 3GAKA 3NO5A 3O6YX 3FJLA 3FKKA 3DFNA 3SGUA 1YXDA 5D09A 3EKLA 2NUYA 3P84A 2WKJA 3HG4A 2FLIA 2PRHA 4NUWA 3N9RA 1SFLA 4A2RA 3DZ1A 1VLIA 3W76A 2QCHA 4MKNA 5C2XA 2J6XA 5K4ZA 1C9DA 2J9YA 1B9BA 1W5PA 3B8DA 1KV5A 2PCQA 1BEUA 2DORA 2X1UA 4EF8A 4GWEA 3D0CA 4KFOA 4UIOA 3DH7A 3CC1A 2C0AA 3G3DA 1WQ5A 4MUZA 4O14A 2XN0A 4NJHA 3G1VA 1L9WA 1SO5A 4UTTC 1VHCA 3C2OA 1AL8A 5KINA 4IQLA 4UFHA 3LHTA 2YFOA 3BK0A 2QDHA 3CT7A 3G1DA 4MFDA 3T4CA 3BVJA 1LOLA 4UXDA 5E93A 4AHOA 3PB2A 4IGHA 4LVDA 5LSMA 4K36A 2CZDA 3BW3A 1ZAIA 4PC8A 4IPIA 1LRTA 2V81A 3TFXA 1PVNA 3PUOA 1KTCA 3W7NA 4O4WA 3LTSA 1IGSA 3PBVA 1EP3A 1FWSA 1GT8A 4FNUA 1QAPA 2TYSA 3A5FA 2QUUA 4ZL1A 2NXGA 4TMCA 2E1DA 3LERA 1NSJA 4JGDA 4JTGA 5AYZA 1F2JA 4LT9A 4K37A 5EMUA 1HG3A 1PCWA 2VFHA 3USBA 2FPYA 1LBFA 3NQEA 5CPOA 5DLCA 1OX4B 2ZZ7A 4NT0A 3BGGA 4UNLA 1TSIA 3LXAA 3N2MA 1FDZA 2QCFA 3OA3A 3UY7A 3GYEA 4ORMA 4O1DA 4AHPA 2C16A 3P61A 1JQXA 5K4XA 1EB3A 3W7PA 3NQGA 1JJKA 1ZALA 1KFKA 1YLVA 1GG0A 3PSVA 2C6QA 5CZTA 5GVJA 5DCBA 2WNQA 4EVZA 1Q45A 1TPEA 2NLIA 5FEPA 4O4VA 2DZTA 4I7VA 1EUAA 4MZYA 3R89A 1HL2A 3UWYA 4FX7A 5LNUA 4EWND 3LXBA 1JULA 4HPJA 2ATSA 4NXKA 5AHEA 4Y9AA 5DCEA 1F74A 1B57A 2YX0A 2DJXA 2X30A 5U4NA 3ABQA 1T8XA 3QZEA 3NQ2A 4IWWA 1B4EA 4NU7A 5KMYA 1DORA 5CG7A 2TSYA 4PODA 1BKSA 2Q8LA 1JCXA 3NEVA 4N9DA 5HWNA 1EP2A 1WBHA 3DXIA 3W2JA 4YWIA 1ZAJA 1RPXA 5D2YA 2GQAA 4RKAA 1JVNA 1R46A 1Q6RA 3G18A 4CQ9A 4RJEA 1DQWA 5A8GA 4QNEA 3W7KA 1OFEA 4IXHA 3L0KA 3AJXA 3LBMA 4K39A 4R7JA 3M6YA 4YL2A 1VHNA 3L9CA 3G1AA 2OJPA 1J5TA 2AQWA 3ZWTA 4WJEA 2QAFA 3W1XA 3NZRA 1H7OA 4IUOA 3S1UA 3ANYA 2NZLA 5HINA 4ZQRA 5J5DA 1H63A 1O5XA 1ZJIA 4WXZA 4HNVA 4GUFA 2E6DA 2NX1A 2LLEA 4UNKA 1VR6A 1KM2A 1RD5A 1WDWA 2G5WA 1OYCA 1X6UA 4GUHA 3G0SA 3FJ6A 4UTUA 4LRTA 3UZ5A 2Z2UA 3E49A 4JD4A 5D30A 1TTPA 3R8RA 2E09A 3N14A 3NAVA 2E6YA 2X2GA 4GUGA 1I2RA 2DU2A 3QW4B 1YXYA 4Z0JA 2J27A 3SIZA 4K6AA 4R34A 1RZMA 1QPOA 3EWBX 5LNRA 1R30A 1W1ZA 3OVRA 4GUJA 4PH6A 4UC5A 5BRBA 1DL3A 2YGYA 3C2VA 4QSHA 4KWWA 3PVFA 5AC6A 5HWMA 3W1AA 1UCWA 3VFLA 1KW1A 3W2LA 1B4KA 1A5SA 1TPWA 4MJMA 5FEZA 1H7XA 1NFBA 2ZRUA 3C4UA 1TMHA 1TCDA 2R91A 4O28A 4Z0SA 1OABA 5IM51 1DJNA 2Q3RA 3MI3A 3W23A 4JXCA 4MLJA 1LP6A 2OCZA 2ZZ3A 2C14A 3C0JA 1FY6A 3MW7A 3LDVA 1Z44A 4P2VA 2BX7A 1OX4A 1FDYA 5KZMA 3E9AA 4CCEA 3T7VA 3ELFA 3LHVA 5CKSA 2ZBTA 5K7JA 4ML9A 2JBMA 4WXYA 5G1YA 3P74A 1ONRA 5DXXA 3UWQA 2Y70A 3TROA 1B3OA 3VNDA 4MIMA 2A0NA 3HBLA 2G96A 3F03K 3G0XA 1CI1A 1KFJA 1H1ZA 3B4UA 3W1NA 1XUUA 5I3HA 2ZCGA 4WY0A 2C15A 3EWZA 3F4NA 3KXQA 3PULA 1WX0A 1OF8A 3B0VC 1HO1A 3UWUA 1YDVA 3DKLA 4FIQA 3NL3A 3C61A 1XDMA 4DO4A 1M5WA 1X8FA 2WNNA 3FKRA 5EBUA 2GVGA 3HF3A 4BWLA 2QCEA 2A85A 3JRKA 2YYTA 2FQIA 4FNRA 3FFSA 3MHUA 1G4TA 3W2UA 4E2DA 4AB4A 4S1FA 2YYUA 3PAJA 5KSWA 2VELA 3LTPA 2DZVA 1WV2A 3QEZA 3HPSA 3LI1A 4GBUA 5I3KA 4FF7A 4Y6GA 3RNDA 1ICQA 4DQWA 2ISVA 3GK0A 4O54A 1SO3A 1SSDA 4OU1A 1JQVA 4ZQNA 1W3TA 4RR4A 1H51A 2Y61A 4MVAA 5DXYA 3PBWA 5D2XA 3DENA 3M0ZA 2C18A 1F5ZA 2V5LA 4ZQOA 2YR1A 3TKFA 4A29A 3NPUA 2RFGA 7TIMA 2QCGA 3O6CA 5J5RA 3GXNA 2A5HA 2O7SA 1GWJA 2EPHA 3DI1A 1O60A 1QPNA 1EUNA 3RF9A 4DXVA 1R2SA 1XBZA 2CLHA 4N6EA 3FLUA 3G1FA 3O16A 2WQPA 2UV8G 4WY0B 1TYGA 3MP5A 2QR6A 4OQVA 4UFMA 3GX9A 3QC3A 3OIXA 3EKZA 3SGZA 3W1MA 2GQ9A 4QISA 1GTHA 4LC6A 1F05A 3L0NA 2YFNA 1MO0A 1YADA 1SW3A 4POCA 2ZZ2A 2CLFA 3OG3A 5L6UA 1YTDA 1E51A 1C8VA 2RDUA 4JTHA 1RQEA 3SW6A 1H5YA 4N9CA 4IXXA 2H3DA 1H7NA 1XBXA 3C8FA 3UZJA 1TTIA 2H90A 4LVAA 3LLDA 3CQ0A 2VEPA 2GQ8A 5FF7A 1IXPA 3N73A 5G1TA 3L5AA 1A50A 4JX5A 1KFLA 4KFNA 5AC7A 4UMCA 1FX6A 4O17A 2OX1A 3QSRA 1QOQA 3UWVA 1Q3NA 4M6QA 2Z0IA 4JY8A 5D03A 3C6CA 1UJPA 1JUKA 4O0KA 3EB2A 1O5KA 1FWWA 2ZA1A 1SW7A 3NGJA 2P0OA 2V5BA 5MHBA 3NQ8A 3O1NA 4U28A 3G24A 1Q6OA 2EKCA 4JTUA 1FWTA 3W1QA 1VC4A 5AHNA 5C55A 4M5PA 3TSMA 3B06A 1KLYA 2HSAA 3W7MA 1H7RA 3S5ZA 4XQ6A 1Z48A 1QCWA 1M6JA 4JIQA 4IMFA 1C29A 5AHIA 1TV7A 1N55A 2DJLA 3W1PA 3LRMA 4ZQMA 5CZ0A 2DZSA 4B5NA 4AF0A 1BTMA 1A53A 5H91A 1GYNA 3MP4A 3E96A 5F4XA 4MOZA 3IVTA 3EX6A 4O1CA 4OGZA 3T40A 1XFBA 2O7QA 1TTJA 1K02A 1SO4A 3W9ZA 4LNYA 2KZHA 4XZ9A 3N3MA 2HMCA 2ABAA 2Y7DA 3SFKA 5HR7A 4FIRA 3NNTA 3TXVA 5HQEA 3A5VA 2X1SA 3L66A 1PV8A 3HB9A 4RK8A 3CWOX 2CW6A 3PY2A 3O05A 3PG8A 4R53A 3W22A 1K8XA 4ICNA 4L4LA 2HS8A 3R13A 3GXPA 3PUEA 2CLKA 4DF2A 4QIUA 3STFA 1KFCA 4YCPA 4IX2A 1FCVA 2ZZ5A 4AWUA 4K7YA 3SECA 4O15A 4Q32A 2R8WA 4ADTA 5KITA 3NM1A 5AHLA 2C13A 4R33A 4UTLA 3CHVA 2NV2A 3NQAA 5DELA 2R94A 5HUPA 4BFAA 4M6PA 2EF9A 1GVQA 3OVQA 2GVLA 3TK7A 1AW2A 1VH7A 3LB0A 5F1VA 3PB0A 4O10A 4O53A 3QFEA 4GRSA 1KBJA 1MZHA 2F84A 1TRIA 2FB3A 3LHYA 4G1KA 2A7NA 3KVLA 1TV5A 5BMWA 4UTTA 3G0UA 1F6PA 1GTEA 2CFFA 4Q4KA 1LOQA 4O52A 1L6WA 4XTDA 4YXGA 3S8HA 3M5VA 3IIPA 3TJLA 1ME7A 4NX5A 3QW3A 1LTDA 3P60A 2RHGA 3NOEA 1OF6A 1J2WA 4IMEA 4HT3A 1QMLA 3QSTA 3TC7A 4NX0A 3HGOA 3CLMA 4X3ZA 4NNCA 3CU2A 3QQ1A 4N9EA 3NA8A 5D33A 2EHHA 5G5IA 3WK2A 3LTYA 2GJNA 4BI6A 1FQ0A 3GZ3A 1YPFA 4NJGA 1LORA 2QJIA 4AAJA 1K8ZA 3TIMA 4Y96A 3RU6A 1R2TA 2VFFA 3QYQA 4OBTA 1WXJA 2YCEA 1VYPX 2E5CA 5HJLA 4O57A 1UASA 2OMAA 3LGEA 3CEUA 3MJYA 3Q58A 3JS3A 1DKWA 4RX0A 3TXZA 5K9XA 1KV8A 3OHIA 3TFCA 2XN1A 2CWNA 3TSBA 4IOTA 3MYOA 1TPFA 4M19A 1UUMA 3P67A 3CWNA 1TQJA 4WUIA 4GXMA 3FYPA 4Y8FA 1K7XA 3HOJA 1WOAA 1FXQA 5A5WA 2I9EA 2ZYFA 3LX9A 3O6DA 5LNSA 3TNOA 4FNQA 3G3MA 3TC6A 1ICPA 3SJ3A 4MJZA 2A1YA 3HG2A 4ZQCA 6TIMA 3S5YA 2FDSA 4YMZA 3SY5A 3IV3A 3ABOA 5D38A 1Q6LA 3NZ1A 4I9AA 2WSRA 4DF1A 4TIMA 4XUGA 3UQNA 1P1XA 2C19A 3M16A 4BK9A 1IXOA 3LXCA 2CLEA 2ABBA 1K8YA 3IIVA 3WFAA 3IGUA 4QITA 3W7GA 3GAYA 4LVBA 4FX6M 3A23A 2FB2A 4UR8A 1SPQA 1JRCA 2BXVA 1VZWA 3P81A 2F7FA 4IMCA 3S1WA 4O12A 2FIQA 3F1QA 2CLIA 1VCVA 1DBTA 1OX5A 3DHFA 3F4WA 3N19B 1SZFA 2A21A 3ABSA 3QPYA 5CGQA 4X22A 5D37A 4RZ5A 1BWLA 3BGJA 2C1HA 3A9IA 3NXFA 4HIBA 3HO8A 4UFIA 4KKXA 2JKEA 3CTLA 4LS1A 3FS2A 3ZWSA 5BW6A 4TR9A 4JTKA 3G22A 3L65A 4UMBA 3NL2A 2YXGA 2ZRXA 4BWLC 1VGAA 2QAPA 4OE7A 1G4EA 4RCXA 3NR0A 1Z42A 3L2IA 1FDJA 1TPDA 3B04A 3NDOA 3HG3A 3L21A 4CLMA 4S2CA 1OX6A 2V2CA 1SUXA 3IGSA 1TQXA 5HUOA 3I7QA 4PFMA 3S1VA 2DZUA 3HQ1A 1FCQA 2W6RA 3H53A 1OK6A 3K30A 2QF7A 2ISWA 1D3GA 4NJKA 4WD0A 1JCMP 1KFBA 4JY9A 5F2GA 5DCDA 2B0MA 3LCXA 1KM6A 3BARA 2FJKA 1U83A 1ZCOA 4O16A 3HIJA 3Q2DA 2NV1A 3W86A 5DY2A 4XBSA 4TU1A 4E0CA 3PR2A 4JIPA 2YPIA 4GNJA 3IIXA 4DEFA 5T26A 3LI0A 1DQXA 1GOXA 3IRDA 4PCFA 3O06A 1QR7A 1SU5A 5IBXA 3LHWA 4S2BA 2DZWA 5G4WA 3R12A 4MPQA 3TCEA 3OVPA 1QOPA 1KM3A 4Y90A 5AHFA 2QUVA 4ZVJA 3EXTA 1ME9A 4LS0A 1U5JA 4LOCA 2X16A 1K03A 1G4PA 3DFPA 1TV8A 1S3HA 3W3OA 5FESA 3M9YA 5FI8A 1N7KA 2H8XA 2QDGA 4FNTA 1GVFA 1OFRA 1AK5A 1SZGA 3ABRA 4NZJA 5L9FA 2GVJA 3M7WA 3SSJA 3MYPA 2CZEA 2VC6A 3N34A 4AWSA 2DP3A 3NL6A 1H60A 2EGZA 4HSNA 1OFAA 1JRBA 3TA6A 3TDFA 4JTLA 1OK4A 3MBDA 2YW4A 4Q33A 3PBYA 1DJQA 1FCBA 4HNUA 2NUXA 1EP1A 1ICSA 3TMQA 2BTMA 3NQDA 3W7JA 5I3JA 1KM5A 2VKZG 3P5ZA 4JTIA 5C54A 5I3GA 2WPBA 4JDBA 1PE1A 5LNWA 3W1RA 3BV4A 2CLLA 4JDYA 3KVKA 4N6FA 5E0KA 3UYCA 5D2WA 4QAIA 1AW5A 1SW0A 4NNBA 3W83A 3TUUA 1GVSA 3KVJA 4FB7A 4AH7A 2NXHA 3BG5A 1K7EA 1AMKA 5LNVA 1GG1A 1Y0EA 1H7WA 3W7QA 4BF9A 3V1PA 5KZEA 3M5YA 3E12A 3PG9A 3LCFA 1KTBA 4NQ1A 4JTTA 3PWAA 3LV6A 3EWUA 3UXAA 4LY8A 4X2RA 1G6CA 4FXSA 1LRNA 1DOSA 2OZ0A 5IBXC 1AW1A 1EWDA 3W7RA 1FWRA 4MZ1A 3FA5A 3M41A 1S5VA 2Y63A 4ADUA 2VFEA 4H6KA 3S0CA 1QDSA 4FNPA 3MHFA 1OYAA 3DKJA 1ZAHA 2YZRA 4FNSA 3MBFA 2R14A 4AHQA 2V0TA 4N2YA 2VENA 1L6SA 4BI7A 1G7UA 3VCRA 1M7OA 1TJPA 1SZNA 1V5XA 4LC8A 3WK3A 1NF7A 4NJIA 1VCGA 3DAQA 3BW2A 1PS9A 3N2XA 4PTNA 3P82A 3M5ZA 3O63A 1JCJA 4I7WA 3W71A 2VFIA 1WBJA 4JEQA 2QJGA 4LUIA 3EXSA 3PUDA 1LZOA 2A7RA 3GDKA 4A3UA 3B05A 1ADOA 3P5YA 1A5BA 3U6WA 8TIMA 1MEHA 2WV8A 1YTKA 1PHQA 3SI9A 3W72A 4AMAA 1RQHA 4FO4A 5G4EA 4JYDA 1A5AA 1KA9F 2FFCA 1LROA 2XN2A 3M47A 4PL2A 5DBTA 3HPXA 3MP3A 4JNMA 2WSQA 4ALDA 2CLOA 1DV7A 3M1ZA 1W5OA 2GJLA 3S6DA 3KRSA 1XM3A 2E68A 3LCHA 4OV4A 5CSRA 4O8RA 1I45A 4OV9A 4UFLA 1S5TA 3NQ6A 1WOBA 4XKYA 1JUEA 3TJXA 2H3BA 3GKAA 1WAUA 5C5YA 5D2VA 1IF2A 1VPXA 3HPZA 5D05A 3O15A 4RXGA 3P62A 5U7SA 3EWYA 5BNKA 3WJWA 5F2MA 2J88A 2WSYA 4AF0B 4H4IA 5BOOA 4PEKA 1I2NA 1A5CA 2QCMA 3N9SA 1GEQA 5FF4A 2TMDA 4MYXA 4O0ZA 4YLWA 4Z1AA 4Z1DA 3GR7A 3L67A 3PSWA 5LHEA 1QFEA 2J9ZA 1DHPA 2AAMA 1HO4A 1FUYA 2RDTA 3GR8A 3HGJA 4P61A 3W87A 2BLEA 3CIXA 3CB8A 4LRSA 1WA3A 4TMBA 3GDRA 1OFBA 2E77A 2VEKA 1JR1A 3LOTA 2QCLA 1KLZA 3OBKA 2HS6A 3WJYA 1LLWA 1VRDA 3GIYA 1TRDA 2Y7FA 5EYWA 3TAKA 4O19A 3I65A 4K8HA 5AC8A 3I6RA 5CPNA 2VOMA 4HPXA 2VXNA 3WJSA 5CSSA 1EX5A 4CNPA 1ZFJA 4UTHA 4UR7A 1M7PA 1SR9A 4WX2A 2AGKA 1OFOA 4OHQA 1LCOA 5AYYA 2VFGA 4OT7A 2A7PA 1LOSA 4XKYB 4J9JA 3W2NA 5FF0A 1QO2A
chains in the Genus database with same CATH superfamily
4KFPA 1S5WA 1UR4A 4H04A 3MI6A 3WBEA 3SUSA 1KM4A 2J78A 5CLTA 2PDGA 2ZX5A 1JYXA 1JCLA 1W5QA 1VJSA 5F4WA 3V0UA 4IJBA 4LU0A 2YJQA 3H7VA 1WUFA 4O0QA 2W0UA 2V3GA 4UTMA 4MY1A 1XLBA 1V7YA 2WMJA 1TMQA 4XX6A 3U5UA 3VKJA 1KFEA 2XVNA 1VFFA 1TPC1 1JYVA 3VNIA 1HFBA 4DO5A 3SN1A 3GDTA 5H2ZA 1GPWA 4EAYA 4IM4A 3NQCA 3AMKA 4B3LA 3QV8A 4V1XA 4XG1A 3UZZA 4F2TA 2HRWA 4AG0A 3FSUA 3BO9A 2JF6A 4EACA 2NT0A 4DBSA 2ZUMA 2NVDA 5DY3A 3NWRA 3H23A 3TWBA 4FXJA 1KD0A 2YDSA 4AD2A 4US6A 1FFQA 4HPNA 1MEWA 4MNLA 2VX5A 3T0AA 1X1OA 1IEXA 5FEXA 4LW7A 1POKA 4W9TA 3NO1A 4PE8A 5EMJA 3AYTA 4F66A 5FJPA 5JU6A 4H2CA 2PD9A 5GJNA 4GIRA 2POZA 2Y62A 4NSBA 3LLFA 2QCNA 3AXXA 3HJEA 2WZIA 3NQFA 3BG3A 2JIWA 3HQOA 1TO3A 4W4QA 3R4IA 4RDZA 3SN0A 3QMTA 1VQTA 4PMNA 4L1WA 1TWDA 5BXPA 5AZ1A 3TW7A 2DVUA 4RNJA 1DIDA 1JPHA 2EPLX 1EJSC 2A3HA 3SN4A 4FAMA 2NV9A 4CVWA 4PUMA 3QTGA 3GDLA 1RJQA 3KRZA 1IZKA 1H0GA 2JGYA 4I6KA 2GUUA 4Q8TA 3O8AA 3SCQA 1UWTA 4F0MA 3EWDA 4YIWA 4A8NA 1OHLA 1NF0A 1DIOA 3AWOA 4KIEA 1A5UA 3D3AA 4JIRA 4R9XA 3U4AA 3VOJA 4C1KA 3U0HA 2RJGA 1VCFA 3E02A 4EXQA 1DP0A 4U31A 3PNUA 4J3XA 1RQBA 3CASA 3TE9A 3W7LA 1PZ2A 3TMLA 3LGDA 1EFZA 5GNYA 1X7FA 3GNDA 5HPCA 3JR2A 2EEXA 5GQBA 1OFPA 2BY2A 3L4YA 3CIWA 5GNXA 1F76A 1HUVA 1KTNA 5A8MA 1E40A 1H5VA 1GNXA 4MGGA 1V6UA 4C6EA 3LV5A 2PE4A 3W2MA 1T40A 3FK4A 1EDTA 1P0KA 1DXIA 5KZ6A 5T8GA 1U1JA 2I5GA 4JICA 1X7IA 5SWUA 1CW2A 1HL8A 2OEJA 6ALDA 3KCLA 4C90A 5E1QA 1F73A 1EL3A 5CC5A 2GUYA 2QMJA 4EWJA 5EPDA 1WKYA 1OYBA 3GKFA 4YTRA 4LVGA 1I2PA 3GXTA 3P7YA 4ZQPA 2WSPA 2RJHA 4UNIA 5H8MA 3H4WA 1R87A 1HQTA 2ZZ6A 4IG2A 3RAOA 2VEGA 3T55A 1NDYA 3UVIA 3ARSA 1O66A 3WQFA 3MCNA 5HNRA 4WQ6A 2NSXA 4HU3A 4ATLA 3AO0A 4O13A 1ITQA 2C79A 1VB9A 1BRLA 3W1LA 4RE0A 1BSLA 3FJ4A 3MMDA 1G69A 2HTMA 4Z17A 4MNKA 1Z3NA 3QYSA 3S1GA 2BOEX 3PTKA 5CBIA 4KETA 4FPSA 1VYRA 3AHTA 3QMSA 3ZR4A 1YNQA 8CGTA 1TPVA 3WK0A 3TOYA 4MDPA 1B3WA 1S2UA 4C1LA 1KCLA 3B9OA 5HATA 1WO2A 2YCLA 4K8EA 4XZBA 5E70A 4W8LA 4XTIA 3XIMA 1FWHC 2WKLA 4Q6XA 1OIFA 1PPIA 1D7KA 2XIOA 3FEQA 1DVJA 1LBMA 1E9YB 1IXNA 1FWFC 4Y8EA 3TLLA 1NELA 3UXDA 3GVWA 3U8GA 4AXKA 4IP7A 1SFJA 4TO8A 3KOYA 2HK0A 4DO6A 4ZFCA 3S4TA 4W89A 3PF3A 3E0FA 2JKAA 2EPOA 3UNDA 3SM0A 1W3NA 4S3AA 3A24A 5C9ZA 4XZWA 5CPQA 2ZA3A 3H7UA 4Q7BA 2XVGA 3L68A 3B03A 5TBOA 4D72A 4OOZA 4WOQA 2E9MA 1IXQA 2VVNA 5DMMA 1ZBCA 4A6GA 2ISSA 3EA3A 4P8WA 3TR2A 3W53A 1S5NA 4A05A 4M7SA 4HZMA 2NQHA 4KS0A 2ZC8A 1BF2A 4G7FA 1PDYA 1Q6QA 1PZ3A 1DWGM 4IF2A 1UPPA 4NRSA 3UPBA 1SO6A 4DBDA 1OG0A 1GJPA 1A3HA 5HPOA 1OM0A 2YDAA 3KP0A 4WSKA 4UMAA 1YPIA 1XYAA 1AUSL 3C3NA 2ZXBA 2YCKX 4JL1A 3ARQA 3HV9A 2QT3A 2V2HA 1CPUA 1M7XA 3TTYA 3C3UA 1TTQA 4HCLA 3LNPA 1HGYA 4I7UA 3NQ7A 5EKYA 2OZTA 3UWZA 2BHZA 3DIPA 1SZRA 1ML1A 2DV0A 5C6MA 3GBEA 4PCTA 3U2CA 5J04A 1K3UA 1GOWA 3R10A 2PDYA 3ALGA 1UMLA 4JTFA 3H2FA 3EMZA 2BGSA 5ABGA 3QM3A 3THQA 3WBXA 3KWXA 3W7DA 1W37A 2WW5A 2FGZA 4DZHA 1I4NA 3AICA 4PCNA 4TUFA 1UBPC 3WD2A 5CEWA 3WJXA 2B7NA 3UG5A 4OZOA 1SSGA 2INEA 2PLJA 3UGVA 3IWPA 4M7TA 2BGQA 2XUCA 4QJ3B 5KZDA 1XIMA 4DWDA 2PF8A 2DIJA 2NQLA 3BLDA 3TH6A 1YNYA 1KGUA 2D2JA 3BW4A 3P8JA 3P8IA 4R9OA 4HK6A 3RM9A 1JZ4A 1AD4A 1V3MA 2CZ5A 2A3EA 2IPFA 1OB0A 1XHGA 1Y5VA 1Z32X 1S5MA 2Z7KA 1BGGA 5K3VA 1TIMA 2ZRZA 1NVMA 3G8RA 2E40A 5FJRA 3C2FA 1CGUA 3OODA 2F9RA 3APTA 1UWIA 2W3ZA 1SQ7A 3U2OA 1JEZA 4ZOBA 4HU8A 3UY8A 1CGTA 4OBRA 1EYWA 3K4AA 5A6AA 2A2IA 4JN8A 2WMHA 5EA9A 4LWWA 3WN6A 4Q4MA 3EZ4A 3LHZA 2L5HA 1B5TA 1TMLA 1TPB1 3QF0A 4LAZA 4HYWA 3N11A 4L4MA 1E9IA 4Q8WA 4CUCA 1JFXA 2D0GA 3K8KA 7REQB 1G9HA 2I7GA 4IX0A 4QRNA 2QCDA 3T9PA 2YBTA 3GU2A 2ZTJA 2CBVA 3EPOA 2PURA 1MUWA 4HU4A 2DSWA 3QJAA 3LRLA 1UQYA 3IVSA 3VABA 2VP8A 3VKKA 2I5QA 2V8ZA 3CB3A 2A6NA 4X61A 3CHEA 4CQBA 5ECVA 4IMDA 5LKYA 3PTMA 4HTYA 1T41A 3RMJA 1MRAA 4GQ0A 2HV5A 1OD8A 3TYDA 1J4EA 3AS2A 2Y0FA 1PTDA 4IP4A 1P7TB 1Z6KA 3V36A 2NSOA 2VRQA 3ATZA 4KRTA 4O11A 2J9XA 5G2WA 4LB3A 4QG6A 1MUCA 2R82A 1R3WA 1ZQ5A 2WHJA 4LH8A 1PSCA 3NJ3A 5F2IA 5I6SA 1VLWA 1RVGA 1AH3A 4DJFA 3NL5A 3V75A 1KM0A 3PZMA 2VRJA 2J75A 4US5D 3P0XA 1XBVA 4YU1A 3TJ4A 3IAQA 3IEBA 2QGHA 2X1IA 2E5DA 4C6JA 2QGYA 3DFNA 3TJIA 5D09A 2NUYA 2BHUA 3RYSA 1IWAA 4LAKA 1A5KC 1SFLA 2PDMA 3UGRA 3NURA 1VLIA 3PPFA 2J9YA 3B8DA 1KV5A 2PCQA 4DYKA 3VYLA 3ITCA 3LNMA 1WQ5A 3PBMA 4IP5A 1DXFA 3A13A 4LJ3A 4KGJA 3L4WA 1TJ1A 3UA3A 3LHTA 3S6TA 6A3HA 4AZHA 3RCMA 5A6JA 2Z1SA 3G1DA 2OO6A 3ZR6A 4OVXA 4UXDA 3BICA 2DY3A 4AHOA 1KQZA 4IGHA 4Z1YA 4CN6A 3PP7A 2CZDA 3PJWA 2VX4A 4KPLA 4DXKA 1L0PA 1UC5A 4PC8A 1TWWA 2XJ7A 2O9TA 3TFXA 1VFMA 4KBXA 4H8HA 2CWXA 3A3WA 2WPGA 4A3HA 3HN3A 1QAPA 1REQA 2WZEA 5BU9A 2Q71A 1MXGA 4AC1X 4JNYA 4B2DA 1KBLA 3M6DA 3K4WA 2O9RA 3NYDA 1WKFA 1E71M 5AYZA 1F2JA 4QE1A 4FR6A 4K37A 1CB2A 4EAMA 1GPFA 2E8YA 2HJPA 3NZPA 1PCWA 1BD0A 1FRBA 1L8PA 2OOFA 1LBFA 1OC5A 3NQEA 5DLCA 5I03A 1JDCA 2Z24A 2ZZ7A 1ZCCA 4LQ1A 3R79A 1TSIA 2XG9A 2R1PA 3D6NA 2QCFA 1M04A 4ORMA 3IJ7A 2C16A 3P61A 3IK2A 2ZC1A 1JQXA 1KO0A 2F2HA 1EJUC 1JDEA 2WLZA 3EYPA 1KFKA 3L4ZA 1V6VA 2WNQA 1Q45A 1XLHA 1YMYA 1J0KA 2Z29A 1EHNA 1CT5A 4QROA 3WF1A 4RW3A 3KRBA 4QDPA 3TC3A 3XINA 4MWAE 3UWYA 4FX7A 2CC0A 4M3PA 4NI8A 3BL3A 2C1IA 3PWIA 2ATSA 5C71A 3ORWA 1JYNA 3WLQA 2NVAA 4W86A 1F74A 2YX0A 3MY9A 3NQ2A 1Q7MA 2YA0A 3MZ2A 3U3HA 3T0DA 2TSYA 2D3LA 3E2VA 3N2TA 1FWEC 4PODA 2Q8LA 1JCXA 4GI8A 4N9DA 4DWSA 3V3WA 3B9AA 3UCCA 2E1WA 3WQ5A 1R3VA 3QQWA 1HKIA 3PTDA 1R46A 3G18A 1Q6RA 2W5FA 4NI3A 4NAEA 1NWTA 3R0UA 2YL8A 4RJEA 4K1WA 1EJRC 1V0NA 4B9ZA 1NJJA 4IXHA 4XIMA 3L0KA 3AJXA 1OIMA 2NT1A 3GU9A 3N12A 3L9CA 4G5DA 3FV9A 1X96A 3CL7A 2FTYA 4WJEA 3NZRA 3ZJ7A 1RBAA 5HINA 3WH9A 5J5DA 3HTWA 3EEZA 3UXLA 1O5XA 4PB5A 5I7GA 4G8TA 1J11A 1H41A 4JL2A 5REQA 4W7UA 4PBEA 4GUFA 2E6DA 2ANUA 2G5WA 1XLLA 1OYCA 4GUHA 4ICCX 4LRTA 3E49A 3R8RA 4A35A 4J27A 1S46A 5E5CA 3NAVA 5G1MA 3WQPA 2X2GA 4GUGA 5JBDA 3CTTA 1I2RA 2B81A 3F2CA 3PZVA 1YXYA 3N6HA 3WDQA 1XW8A 4ML4A 2WBKA 4Z0JA 2FZMA 3MMUA 2J27A 3SIZA 1EC9A 3PFRA 1RY8A 4PMZA 1QPOA 3EWBX 1TX0A 4AU0A 1M1BA 4EPEC 4UC5A 2PWUA 4DWSB 4CD7A 1SFSA 3ZT5A 4B4FA 4E8GA 2FMOA 4MTVA 5AC6A 2ACSA 2FKPA 4J35A 3W1AA 5HWMA 1UCWA 1KW1A 3A47A 2XINA 1TPWA 1U5HA 1BYCA 1E56A 3EPMA 4HMEA 1NFBA 3C4UA 1TMHA 4Z0SA 1OABA 5IM51 1TCMA 4KRZA 2J62A 3NCOA 2IKGA 1ECQA 1QI0A 4P2VA 3NIYA 2O4QA 1SYTA 4CCEA 3LHVA 5CKSA 4DXXA 1UD2A 4MWAD 2ZBTA 2VTFA 3GC2A 4R27A 5G1YA 5DXXA 1M7JA 1B3OA 4KEZA 2R1NA 5KETA 3HBLA 2XISA 3CIVA 2PTWA 3GFYA 1TWIA 1CI1A 5I2UA 1KFJA 4ZODA 1H1ZA 1XKJA 3B4UA 3S5SA 3U2ZA 4Q4QA 1KKOA 3ZSSA 3SURA 3SUTA 1HO1A 3R1ZA 2WHKA 1UKSA 3DKLA 1P0DA 4LF2A 1W32A 3OBEA 3WQVA 1PX8A 3V18A 5EBUA 1IV8A 3HF3A 3II1A 4H00A 3MSRA 3C86A 3M07A 2WAGA 3JRKA 4FNRA 2W67A 1X6NA 3IUHA 5KSWA 3CQKA 4E3VA 2QPUA 3LI1A 4GBUA 5I3KA 3RNDA 5H1WA 4DQWA 1XINA 3GK0A 4D71A 3WLNA 1JQVA 4HK5A 1SMAA 4HMCA 3N15A 2Y61A 2Y2WA 4MVAA 3QHOA 3WNMA 3DYOA 2BOGX 3DENA 1DJGA 2V5LA 4ZQOA 3ITLA 1FH9A 3GXNA 4IISA 4X2PA 2HK1A 1F3XA 2ZOXA 3AISA 3O16A 4WY0B 2MUCA 2QR6A 4OQVA 2CYGA 2OLSA 4I5RA 1G5AA 3GX9A 3EKZA 3W1MA 2CERA 3MCOA 1E6SM 1I1WA 4WF7A 9XIMA 1SW3A 4XAGA 2ZZ2A 4B3KA 2POTA 4J3ZA 4H9VA 1YTDA 3STPA 2Q8XA 1GONA 1FKWA 3EMQA 2H3DA 1XBXA 1KXHA 4LVAA 4IL0A 4HCHA 5FF7A 5I79A 4PUKA 1DJZA 5G1TA 3L5AA 1TE1A 2Z7GA 4YHGA 4KFNA 2V6AA 3QSRA 3CXOA 4M6QA 2IXUA 2Z0IA 1UJPA 1KCKA 3EB2A 1O5KA 2UY3A 3WNOA 4AZ6A 2P0OA 2KAUC 2V5BA 2HISA 4RNIA 3O1NA 2EKCA 4JTUA 4W5ZA 3KS6A 1IEQA 4CCZA 2QV4A 3B06A 3AU6A 1VEMA 2HSAA 1YKWA 3KEHA 1Z48A 1M6JA 5HNNA 5A3HA 1XH2A 5JVLA 2J7HA 4IFRA 3T8QA 2X41A 3W1PA 3EDKA 1E6QM 1T7LA 2A79A 4MM1A 3CZGA 4UR9A 1A53A 1MW3A 1C90A 4O1CA 2O7QA 4XBJA 1K02A 4G2DA 4XZ9A 1V3IA 4KIRA 3SFKA 4FIRA 3CV7A 1PV8A 3IJLA 2OYMA 2FFIA 4R53A 4ICNA 4IL2A 2HS8A 3R13A 5CLWA 2D69A 4MPKA 4AWUA 4K7YA 3SECA 4O15A 4Q32A 2PGFA 1ISXA 4M1BA 5JXQA 2CHRA 3QGKC 1LUCA 1HKWA 4RDYA 4DNHA 5FJJA 4R33A 3NQAA 3UZWA 1RCQA 4BFAA 4TVDA 3KZPA 3W6MA 3FAWA 3LB0A 2J25A 4O10A 2VMFA 4O53A 1Q65A 3MS8A 1KBJA 1E9ZB 3KBJA 3DDMA 3LS9A 3FVMA 4GD0A 5ECUA 3KVLA 1TV5A 4CU8A 5BMWA 3RX3A 2CFFA 4IFKA 4NX5A 4GYPC 1UH3A 1LTDA 3P60A 2PLMA 5HBFA 3TC7A 3SB0A 4QBXA 1FWIC 3CLMA 3WLJA 1EJWC 3TVAA 1LQ0A 4FS9A 5CBJA 1EO7A 4IQJA 2R1KA 3LTYA 1JXJA 2GJNA 3LUTA 1FQ0A 1YPFA 4NJGA 3SCVA 3I4EA 3RMEA 1K8ZA 4NZCA 1AQ0A 1W1A1 4FLRA 4YVXA 2E5CA 4DNMA 2FZ8A 4LFYA 2NQ5A 4WKFA 2OMAA 1B9ZA 3Q58A 1XIDA 2F61A 1KV8A 5JH1A 1UWQA 2JE8A 3TFCA 1U5VA 4IOTA 4QE4A 1OCNA 1ZTVA 2PDBA 2PDXA 4WUIA 4Y8FA 1RH9A 1ZBKA 3VDHA 2I9EA 1MQRA 1WP6A 3AIEA 1R9XA 3AXIA 4FNQA 1X98A 7A3HA 1ICPA 4MJZA 2RGMA 4ZQCA 3S5YA 3CV6A 1W2PA 3SY5A 2XWDA 3ABOA 1V51A 4CD4A 3VVGA 1P1XA 1JAEA 4BK9A 5CBBA 2CLEA 4XZNX 3CQIA 3WFAA 3IGUA 3WF0A 4LVBA 3A23A 4EK7A 3CZLA 4MB3A 5ABFA 2F7FA 3Q4DA 4IMCA 4WRHA 1DBTA 5FD0A 2A21A 1HL9A 5I02A 1BWLA 3A9IA 3URAA 4AD1A 1VFLA 3LEPA 3CTLA 1L2QA 4V15A 3ZWSA 3SUWA 3G6LA 4NRRA 3GD6A 4HHMA 3QHNA 4RPQA 5D9OA 1E0VA 1XH0A 1Q7QA 2QAPA 3OLGA 3U5YA 4OE7A 1QHZA 1ONEA 1XSKA 4YTTA 3RPTA 3EOEA 3NR0A 1Z42A 1FDJA 1TPDA 3L21A 2BV9A 1R7OA 2V2CA 1SUXA 5HUOA 3KBMA 3S1VA 2DZUA 1ONWA 3SQSA 1KBBA 2FDMA 3LCXA 1ZCOA 2NV1A 2WCGA 3QVQA 4DEFA 4O1EA 5DANA 5T26A 2P3ZA 5FJTA 1SU5A 1CNVA 4QE5A 3M0LA 1XISA 1EBHA 3TCEA 1CWYA 2PB1A 2QUVA 4ZVJA 1YX1A 3DOPA 1VKFA 2J7EA 1G4PA 3DFPA 1S3HA 4CU7A 1RBLA 3N4AA 1NFPA 4FNTA 5AZ0A 1EJTC 1G0CA 1SZGA 2IMRA 3ABRA 4US5A 1W1YA 1FP9A 2NW0A 3N34A 1GGOA 3WUFA 4B3ZA 3NL6A 1H60A 4NASA 4HSNA 4IZGA 1DXEA 3PFMA 3TDFA 4QLKA 1DJQA 4K1GA 4HNUA 2NUXA 1EP1A 3U2EA 3UVAA 1NU5A 5C54A 5I3GA 4UQEA 1GVYA 4JDBA 2WWDA 1A0EA 5D8ZA 2CLLA 1AD1A 1CBGA 3KVKA 4GOAA 1AW5A 4NNBA 3W83A 3TUUA 3GDBA 3BTNA 4GZ7A 4H9ZA 4AH7A 2OR2A 4KERA 1F3EA 2ZDSA 3W7QA 4BF9A 5KZEA 4AIEA 2ASHA 2JEQA 1UJQA 3OYXA 3B8IA 1KTBA 2WANA 1EDQA 3FXYA 3BCFA 1LUCB 4X2RA 4H9MA 4FXSA 2VYOA 5IBXC 2AQOA 1X39A 4TTGA 3WLRA 3W7RA 4AYSA 4L6OA 1EDGA 3CUZA 5CQ1A 4ADUA 5C8BB 4FNPA 3DKJA 5E0FA 3RG6A 1OGGA 2R14A 4AHQA 4ERIA 4LSBA 1G7UA 1JPIA 1TJPA 2HROA 4BQ3A 3VIFA 1SZNA 4LC8A 3WK3A 1JNDA 5HA7A 1M41A 3DAQA 1JZ3A 1XIHA 2OQYA 3WH8A 1KNWA 4P7OA 4GZEA 1S2VA 1EX1A 3K5XA 4NZ3A 3WDIA 1UIPA 5A6LA 3PZUA 4GBDA 3W71A 4BS0A 5FJUA 4LUIA 3CT2A 3EXSA 2H9AB 3AXHA 1R3RA 3FDKA 4A3UA 3B05A 1ADOA 4TTUA 4X0NA 3OLIA 3TN6A 5FKYA 4PRRA 1OD0A 4FO4A 3UA4A 4JYDA 2ISDA 1HXJA 3HPXA 3MP3A 3IJ6A 1XGEA 4ZOEA 3S6DA 2O4MA 1P6WA 4N0RA 3FA4A 2ZUVA 5CPSA 4OV4A 2D24A 4B2DD 4O8RA 1I45A 4LCRA 4LYKA 1W1PA 4Z2JA 3NUKA 3NQ6A 2QIIA 1IZJA 1XLAA 3MQTA 2VR5A 1JUEA 3TJXA 2XFRA 3N2CA 1GW1A 1IHIA 1HIZA 3M0XA 2PU0A 1PKLA 3ABXA 1V02E 3P62A 1UH2A 3EWYA 1M65A 3EOSA 4YPJA 3WJWA 1POJA 3KW3A 4H4IA 1A5CA 3N9SA 4WEVX 5FF4A 4DJFC 3GR7A 3PJXA 4XZHA 1CXFA 2WYSA 3PSWA 1QI5A 5E09A 1E5NA 1HW6A 1A3WA 3CB8A 3M0KA 3NO3A 3SY1A 5DRCA 1WA3A 1ECEA 3GDRA 1OFBA 2PTXA 4DLMA 3EA1A 1BHGA 1E6PA 2QS8A 2QJJA 3QGVA 4DAFA 5BRPA 3VTRA 2FH8A 7ENLA 1CIUA 3N25A 5EYWA 4J1OA 3I6RA 4HPXA 4CNPA 1KXTA 3ZJ6A 3PUGA 1J0YA 1M01A 4GI9A 1SR9A 4WX2A 2AGKA 1OFOA 3NFUA 1M3UA 2VFGA 1LOSA 4XKYB 2E8ZA 2ON3A 1GCYA 3NQMA 5LA2A 2PSNA 4GE8A 1X8CA 4J5NA 1EEPA 3INPA 5LIWX 2GZXA 4HKPA 5BXTA 3UG3A 3AQUA 3IGHX 3DHPA 1RJPA 1UKPA 4GXWA 3WY1A 3B8WA 1U1HA 4KEUA 3VX1A 1UD6A 1XG4A 3NOYA 1WZKA 2FGLA 3G8EA 4FEZA 3PZOA 4B15A 5CCZA 3LCGA 3TX9A 4DYJA 4IIBA 5ABFB 3GY1A 1YHTA 3GC5A 4QNWA 5G2HA 2O56A 2XZ7A 3T2QA 1R5YA 4EPDC 3R58A 3WQ6A 3T05A 1R0MA 4D8AA 1UPMB 2QCDB 1EKOA 3CYJA 4RZ6A 3SCOA 1UR9A 3BSMA 2VOTA 4BI5A 2GGIA 1ISZA 4KEVA 1CLVA 1OQFA 1LF1A 2DVXA 3AXKA 4HSOA 5E9AA 1O95A 3W6YA 3QHMA 4O18A 4IPPA 3TR9A 3TLQA 3GXDA 2W66A 1I2QA 3ZFHA 5K9CA 3R0KA 3VOIA 4DHGA 4PB4A 2YDQA 4QLLA 1QI2A 5FAGA 3VPLA 1E0TA 2VD9A 4ZZ9A 1QW8A 1Z69A 4GUIA 2OWXA 1J0ZA 3IGXA 3AZSA 1VJZA 4HCDA 4PBGA 4Q8NA 3I4KA 3GW0A 4RE2A 1DJXA 4CD8A 2CBJA 5DMNA 1UG6A 3BPWA 5J8LA 2OPJA 4Q4OA 1EWEA 2ZRYA 4MDOA 2A3BA 3OTRA 3N1AA 3GZAA 4JZ5A 4OKDA 4N4QA 4QXIA 1E1CA 1D7FA 1TPH1 3G6MA 1Q6DA 5A95A 1K7FA 1OCBA 4GKTA 1ISYA 3TQPA 1TVLA 1HKVA 2VX7A 3RJXA 4XK2A 3RR4A 3VMPA 2VJXA 4TV6A 4UUIA 2GLKA 3AS0A 2ZDRA 3IIZA 3QH2A 2TAAA 2P50A 3IAPA 4W7WA 3OOQA 4JCMA 8XIAA 2BFGA 5I00A 2Z1XA 2G3NA 3NVTA 1V6YA 3VD3A 1M68A 1XICA 4DPPA 3WMCA 3TAOA 1TPUA 3F2DA 3V16A 2YCJA 3EX3A 5CPMA 3WD0A 1ALDA 3ITOA 3W75A 3CUJA 1IIHA 2IXVA 3QLDA 3BOFA 4AEOA 1IWBA 4AEFA 3TYBA 3PS7A 5LGZA 1U30A 2X40A 1LYXA 4CCCA 2ZQ0A 1WYIA 1K4GA 5JUVA 3T78A 2XM1A 2D73A 2V38A 3RRXA 3DFOA 2XFWA 5CZSA 3HG5A 3B97A 3NGFA 1GZGA 2HE8A 3RK8A 5BWAA 3MUAA 2NXIA 1NOWA 2X7VA 4B4HA 4HHLA 4Q3MA 3VIKA 1CLXA 3OJGA 4UB9A 1YBQA 2WKGA 4UZSA 3R43A 5A6MA 1I9CB 1G67A 1QK0A 3KM8A 1O7AA 1KRCC 3LCLA 4RDWA 1KWKA 1NIUA 3N18A 3KCOA 3KBVA 1V0LA 2X2YA 3GNOA 4HNNA 4W84A 1MSSA 1P1MA 2C3ZA 1EA0A 5AYXA 2GFTA 3XISA 1R2RA 4TVCA 2PGRA 4A22A 3Q67A 3DHDA 2WB5A 2ZA2A 3P80A 3USZA 4ZO8A 4HBKA 3A64A 3VC5A 4DWSC 3QMRA 4K68A 1VFSA 3IIOA 3RLUA 5D32A 1QWKA 1DYSA 2HEJA 2OT0A 2YCLB 1HVXA 3EKGA 3LMYA 1O1HA 4PMRA 3FN9A 1S2WA 4XBKA 4MLRA 1RV8A 3AAMA 3HMJG 1KM1A 3H24A 1GVRA 1PDZA 4P5UA 1HJWA 4FMVA 3BE7A 1E9LA 3KHJA 4G6CA 4D6CA 2VDGA 1JZ8A 1CLKA 2BWGA 2Z6IA 2XU2A 1ESWA 4AWTA 3T2PA 1ZBWA 3A9BA 4ZB2A 5FEWA 1O94A 2XIIA 3AMGA 4AY8A 2EXOA 4H83A 2V30A 1XRTA 4LS2A 1L6YA 3PPGA 2DVTA 3NQVA 2Y6ZA 1MI3A 1X6LA 3AXMA 1ADDA 1FXPA 1SFTA 3T4WA 2OSXA 1E4MM 3UERA 5B80A 4JIEA 1BWKA 4IMAA 1O1ZA 1YTEA 3BLLA 1N8FA 3TP4A 1C8YA 3PJTA 1LDCA 3WKZA 3PM6A 4FXRA 5T91A 1W54A 3VMNA 1QTWA 2PU1A 3W07A 5EL1A 5I07A 1E4IA 3C56A 1B3YA 2Y88A 3IJ9A 5DF0A 3THCA 4HZ6A 1KGWA 3W7EA 2XVKA 4GCXA 3TN5A 5M2FX 3L0GA 4MYAA 4XSLA 2IUZA 1JNEA 4WKAA 1XI3A 2VGIA 1B3VA 4O1BA 2QJHA 3QQ0A 3W74A 4U3CA 2E6AA 4ZO6A 1S2AA 2G4JA 3S42A 3G5EA 4W88A 2ZFAA 3W7CA 1ZNNA 1PWLA 3C2EA 1KXVA 1AZ2A 2J4GA 3JW7A 1PKMA 2JGQA 1SZEA 1OVDA 1S1RA 3RLVA 1C3FA 2J8FA 1O4UA 1F61A 6REQA 3JVAA 1NWRA 1QNVA 3LM7A 4CEUC 1G7VA 2WLYA 4PL1A 5CZJA 4GNKB 2PWHA 3B8TA 1ITCA 2PP0A 1FWNA 4ZENA 2Q6ZA 4CCDA 2PC4A 3KX6A 1TFVA 4WGHA 2PWVA 3CHCA 3FSTA 4H9XA 3CK5A 3ISIX 1XYBA 1W31A 3S5OA 4D9PA 1E4LA 1E1CB 1R86A 4UTWC 3ZMRA 4M8UA 4QM1A 1GUVA 1A4MA 3WQWA 4EF9A 3JZUA 2F38A 5JBEA 5AOUA 1K77A 4AD4A 4LAOA 3KBNA 4F8XA 4U2YA 3QLLA 1V08A 4RZ4A 1PWMA 2QKFA 3F5KA 1ONXA 5I3IA 3D5HA 4CN1A 5M3WA 3APGA 1QHPA 2WJDA 4FX8A 5DBUA 4R88A 3NPVA 4F0KA 4QJ1A 1C91A 2PLKA 1XYLA 3UR7A 2J6VA 4V27A 3CLWA 2UY5A 2HVMA 2DW7A 3VA8A 2ESCA 2ZZ1A 3MHGA 5KEZA 2ZICA 2D2OA 4H6RA 1JDAA 1SJCA 1EZ2A 5GJPA 2CBIA 3B0PA 4DLFA 3FHAA 1W8SA 3RPDA 3OEXA 3KVMA 2ZRWA 3V7PA 4E6MA 5C9RA 3IRSA 2OODA 1EEXA 3NSNA 3THDA 1LM1A 3GRIA 3TQKA 2ZTKA 4O1FA 2E3ZA 2VI0A 5CC6A 1JDDA 3VC6A 3F2BA 4Z08A 2PRMA 3UNTA 2WHMA 3SUVA 2XGZA 3FVDA 1TJRA 1MW0A 3VE9A 4HN4A 5ABTA 1EXBA 2TPSA 3TTSA 1EA9C 1J10A 5F2LA 2WC7A 3OGVA 3R25A 3WJZA 1PYMA 3SRFA 2HNHA 4ZA0A 1AQMA 3SUUA 3OGSA 3MANA 2DUZA 4UFJA 3IS4A 1VS1A 2ALDA 1H7PA 3AFBA 1XUZA 3PPHA 2CPUA 4DJEA 3QV6A 3T2OA 4LUSB 2GOKA 4Q8UA 3VZYA 1GQNA 3R5EA 4HHPA 5DX7A 1P43A 4P8XA 1PCKA 4OWGA 3FYYA 1UWAA 3QXBA 1G94A 3O6YX 1RPKA 3FKKA 4YVVA 4IFKB 2WMGA 1IE7C 2WKJA 1Q6CA 1UD3A 2FLIA 3ZVIA 1V6WA 3SCSA 1TV2A 1W2VA 3IPWA 4RL3A 3W76A 4GI6A 1VPQA 4BQ4A 5K4ZA 1L6GA 2X1UA 4GWEA 2PFHA 4L56A 4UIOA 3DH7A 3H2NA 1GYMA 2XN0A 4NJHA 4MNMA 1L9WA 1SO5A 4UTTC 2OQHA 3WQGA 4UFHA 3WEZA 5I0DA 5BXRA 4H01A 3CT7A 3UG4A 1GKQA 4B5WA 4MFDA 4JKKA 3T4CA 3BVJA 5EB8A 5E93A 3WELA 1IT0A 4LVDA 2BVYA 3H2CA 4LBSA 4K36A 4GY7A 3BLKA 3O2LA 1EC8A 3SY8A 3S9ZA 3W7NA 2OZ8A 1FWSA 1UHVA 4FNUA 3A5FA 2IQDA 5CJMA 3ZJ8A 4H19A 1KC7A 4PMXA 4AIBA 1PTAA 2E1DA 3LERA 4DB7A 4JGDA 1C8XA 3PN8A 4EXAA 2DFAA 2BBFA 4PUUA 3UT0A 5EMUA 4D6EA 1HG3A 2PWEA 2FPYA 1PKYA 2PI6A 1MZRA 4NT0A 3BGGA 4DI9A 4UNLA 2Z25A 4YVPA 3LXAA 3MKVA 1B90A 1FDZA 3ZT7A 4S3JA 3VD4A 1YPXA 2GDQA 4NZ5A 3GH4A 4YYCA 2PDQA 3ZXWA 2PDHA 3POCA 1QUMA 3W7PA 3NQGA 4ERGA 3PSVA 2I56A 1WCGA 4EVZA 2NLIA 1HKKA 4P7NA 1HP4A 3WEMA 4I7VA 1EUAA 3J7HA 4WIWA 3AMDA 1HT6A 5AVHA 3R89A 4F9JA 1HL2A 4GVHA 3WZ0E 2CITA 2KX9A 5LNUA 4F0HA 2C7FA 4FF5A 4HPJA 3LK6A 4KT2A 4B5UA 4D6FA 4XIAA 5U4NA 4KWSA 1J93A 3GG0A 4JTDA 3L4TA 2CEQA 3QC0A 2QUMA 3VGEA 1YIXA 3TEVA 1DORA 2FTWA 3VM7A 3AUJA 3NEVA 2WNWA 4NAEB 3AIWA 4CEXC 1RK6A 4OUEA 3DXIA 4B5TA 3W2JA 3VIJA 4U33A 1RPXA 3PTQA 1BLIA 1V6TA 4ATWA 1JVNA 2PWFA 3S83A 4CQ9A 3QPEA 5A8GA 5A6BA 4QNEA 1BPLB 4HB7A 3W7KA 1W9UA 3VINA 4K39A 5D9MA 5C7HA 3VK5A 3G1AA 1GHRA 1J5TA 3RO8A 7ODCA 4PTMA 1FHDA 3W1XA 5A94A 1H7OA 2V5JA 4IUOA 4X60A 4J4KA 3S1UA 3ANYA 4OOUA 4DUXA 1ZJIA 1RK5A 4UQBA 4IGNA 2DIKA 3RXZA 1TA3B 4ZCWA 3FJNA 3G0SA 3FJ6A 2Z2UA 2OKTA 2RAGA 2A3AA 1XD0A 2E6YA 5JIWA 3M64A 3HA1A 3QTPA 3RO6A 3REQB 4R34A 1VBJA 1RP9A 4DM1A 2INZA 3CPGA 2CKSA 3BJTA 1Q7ZA 3HMCA 2YGYA 1XYMA 1XLKA 3PVFA 3H21A 3VFLA 3W2LA 1E55A 3FGCA 4MJMA 3QV9A 1VBGA 4O28A 3UFYA 1ZZMA 3DFHA 2Q3RA 4JXCA 1NWSA 3OHMB 2ZZ3A 2C14A 1FY6A 2J7BA 3LDVA 2PDPA 4GQGA 1FDYA 1OEPA 5KZMA 1TIWA 4UWMA 3T7VA 2QDEA 4IJRA 4ML9A 3A4WA 4C1NA 4WXYA 1UA7A 4EPBC 1BWVA 3P74A 5AC4A 4CKQA 4M1RA 3TROA 5CSUA 4MIMA 1XLCA 2J7GA 1GHSA 2J7CA 1DJHA 3GFZA 2W62A 2G3IA 3L12A 1A5OC 1HJSA 3IJ8A 4MMWA 3S46A 1MDRA 1VPYA 3G0XA 2VT0A 3ZT6A 2QHAA 3W1NA 1T5AA 1XUUA 5I3HA 4WY0A 2C15A 3KXQA 4LCSA 3GIQA 2RGLA 4UCFA 5XIAA 2YL6A 3VIGA 3RX4A 9CGTA 1EGVA 2AL1A 3OG2A 4HZ8A 2DIEA 2XYLA 4HNOA 3QFWA 1LWJA 4BWLA 4BZYA 5LA1A 1GVEA 3QR0A 3MHUA 1G4TA 4AZCB 1B2YA 4AB4A 3QOMA 3PAJA 2PDIA 2DZVA 3HPSA 4FOKA 3W37A 4ACZA 2ISVA 4WGXA 1RD6A 1SSDA 2PAJA 4OU1A 2WC3A 1W3TA 3E0LA 4GIYA 4KCTA 4ZQNA 4RR4A 1MXDA 4AUBA 3DUGA 2Z1VA 5D2XA 3AHYA 2UBPC 3TYUA 2C18A 1VBHA 1FHVA 2YR1A 3TKFA 5H6HA 5LIYX 3W28A 4H1ZA 2OTDA 1DQUA 7TIMA 2QCGA 4HA0A 6CGTA 1R3YA 4W5UA 3UJEA 3DI1A 4DXVA 2CLHA 1XBZA 3VGHA 3G1FA 4D6JA 2WQPA 2UV8G 1TYGA 3GHTA 4UFMA 3MV11 1UC4A 3OIXA 3WBYA 1K8CA 4TQTA 2VM8A 2VHLA 1FP8A 3L0NA 1A5MC 4JIHA 4L6HA 1BYAA 4IIDA 4POCA 4UOZA 1RA5A 3O9NA 9XIAA 2BVWA 1RQEA 3SW6A 3N17A 4IXXA 1J9YA 1LLOA 2EKGA 4J40A 3C8FA 2H90A 3E74A 3VDGA 1UIOA 3ICJA 1W9PA 3SCPA 3GW3A 3DBNA 1WZMA 2WZMA 3ZLGA 4AYGA 2PPGA 4JX5A 1EO5A 5AC7A 3WQOA 5CGTA 1DJIA 1FX6A 2OX1A 1WZAA 1QOQA 3AUOA 1PAMA 4UTFA 1KWGA 2OZ3A 1SJDA 4O0KA 3NGJA 4LBUA 5MHBA 5H8PA 2REQB 1TE6A 3ANUA 5C55A 4F9DA 2HDJA 4PMQA 2AOSA 3NTYA 3S5ZA 1QCWA 4ZTYA 2XHYA 4IMFA 3AHXA 5AHIA 3QV7A 2DJLA 3LRMA 4ZQMA 1V3HA 2DZSA 4A8IA 1BTMA 3LQGA 5H91A 3MP4A 4MOZA 4OGZA 3T40A 1TTJA 2AKZA 4JQAA 4JFUA 3W9ZA 5I06A 2J7DA 2FZBA 2ABAA 2Y7DA 4ZB5A 3TXVA 4DJEC 3N9KA 3L66A 4PB3A 3P0WA 3PY2A 1HKMA 2G37A 3OZMA 2IKIA 3WYZA 1QASA 3MDWA 3PUEA 4DF2A 3CS2A 3HURA 3STFA 4BF5A 4YCPA 4MB5A 1VD6A 3WQDA 1AH0A 1TZ7A 3BAIA 1Q8JA 3GXIA 3WDHA 3NM1A 2C13A 4Z2LA 4ZFMA 4Q8VA 1FVPA 1JXKA 2PDLA 4GZJA 5DELA 5HUPA 4C7GA 1K1DA 1CCWB 2GVLA 2CIPA 3QFEA 4GRSA 4NG3A 2PLCA 2OELA 4J3VA 2FB3A 3LHYA 5M5DA 1UR3M 2PP1A 4UOQA 4G1KA 2A7NA 3N3TA 1HZYA 3VOCA 1B1YA 2VZOA 3G0UA 1F6PA 3S8HA 2WQDA 4DRSA 2PTZA 6REQB 2PBOA 2RHGA 1OF6A 3HGOA 4U5IA 4X3ZA 5HAOA 1XLIA 4GJJA 2IPJA 3REQA 1ZLPA 2QYGA 3HFTA 4I90A 5G5IA 3WK2A 4RPPA 4G7EA 2YA1A 3HV8A 3CV2A 1A4LA 4W85A 1Y5XA 4AAJA 3PPCA 3VDCA 3RU6A 2VFFA 3QYQA 1WXJA 3BLPX 4ZXOA 2I16A 1W3KA 4O57A 1UASA 3LGEA 3MJYA 3N6QA 1XRVA 1ISVA 2MNRA 1DKWA 3TXZA 5K9XA 3OZOA 2OSWA 2CWNA 4KQNA 4ZB0A 4ZR8A 3CO4A 3TSBA 1O5QA 1JPMA 1IQ8A 4M19A 5A69A 3LU2A 3CWNA 1TQJA 3H6OA 4GXMA 1K7XA 2PBGA 3L4XA 1FXQA 5FSEC 2CNCA 4GO9A 4XVEA 3QBUA 5HNTA 3G3MA 3TC6A 5C2CA 2A3CA 1VFUA 4IGSA 2A1YA 3OPSA 4AQLA 5IHRA 1XYFA 3CH0A 3R8HA 1EQPA 2D0HA 2UY2A 3IV3A 4M80A 5D38A 1Q6LA 3ECQA 1BRLB 4DF1A 4TIMA 4W8BA 2C19A 3M16A 5HMFA 1IXOA 3LXCA 2QNEA 1K8YA 3UYIA 3FX4A 3B9DA 4QITA 3NZGA 4YNGA 1GW9A 2AKMA 3W7GA 3WEOA 3WMSA 2DUAA 4TX6A 3GAYA 4FX6M 4UR8A 3QN3A 4H9UA 1NQKA 3RJYA 1JRCA 2BXVA 2YB1A 2VCAA 3QOKA 5GJMA 4Q6JA 1UKOA 3OBAA 1GQLA 2CLIA 1VCVA 4WK9A 3ZSTA 3CZKA 3QPYA 1SJBA 4GJIA 5D37A 4RZ5A 2IPWA 3NXFA 4F0LA 1L8NA 2Y5EA 3HO8A 4S38A 3K46A 1ZU8A 3DERA 2XH2A 3BLOA 3L7RA 4P7RA 2DT0A 2ZXQA 3L65A 3NL2A 4AX7A 3KHDA 1K9FA 4BWLC 4MWAC 1VGAA 1XRSA 2GGGA 3VZXA 2DUXA 1QI3A 4XAFA 3AROA 3NXLA 4A3YA 2DT2A 3O6AA 3WLIA 2Z2AA 1I60A 5C0QA 4HVXA 4AVOA 1PZ0A 3IANA 4OJYA 4AW7A 4FOUA 1CEOA 4EXBA 4IH3A 4S2CA 3UR5A 3IGSA 3I7QA 4PFMA 1OK6A 3BANA 2QF7A 4XAZA 4W7VA 5EFFA 4AZCA 1JCMP 4JY9A 5DCDA 2B0MA 2EJAA 3WCZA 1U83A 3HIJA 3Q2DA 3W86A 1HNYA 5DY2A 4TU1A 4QEEA 3PR2A 4JIPA 3IIXA 1R8LA 1OZMA 1EGZA 1H2JA 1R9YA 2Y8KA 4ICMA 3VCNA 4F0RA 1QR7A 4DX3A 3ABZA 4S2BA 3R12A 1QOPA 1KM3A 4Y90A 1QXLA 2CXGA 1ZUAX 4PN2A 5JQ9A 3EXTA 1CYGA 1V0MA 1ME9A 3PZNA 1OINA 2OEMA 1HKJA 1TX2A 3AS1A 2FGBA 3VIMA 5HOSA 4YHEA 1V8EA 1WB0A 2GVEA 2H8XA 2QDGA 3PJUA 1AK5A 3B4YA 3VDBA 3M7WA 4AWSA 3CV1A 3MDUA 2BY0A 4QG9A 1R3SA 3OU8A 2YW4A 3A3XA 1QT1A 3NZQA 3WD4A 1ICSA 2BTMA 3NQDA 2X09A 3W7JA 5I3JA 3VKBA 3U48A 2VDHA 3UWEA 3P5ZA 4HJWA 2GSJA 1PE1A 3W1RA 4JDYA 1NP2A 1YE4A 4N6FA 3UYCA 5D2WA 3KL3A 4JN7A 2QJNA 5LA0A 3AHZA 3K2GA 2OWCA 2X42A 5LNVA 2BY3A 5BOFA 4NZ4A 5E6YA 4XD3A 5LXXA 5E9XA 3PG9A 3LCFA 4HA1A 4QSFA 4R5EA 3H2AA 4NQ1A 3K8MA 3PWAA 3E5PA 1W9XA 3LV6A 1GOOA 1LRNA 3H26A 2GQ3A 5BCAA 1AW1A 1TR9A 2Z2BA 4XAPA 4QLJA 3S47A 3T81A 5C2GA 2BASA 2Z4GA 5EMMA 2YLAA 2OGJA 3TYCA 3S0CA 3MHFA 3S2CA 3MBFA 4PMJA 3EWCA 1J12A 3I10A 3VOHA 2BXYA 2BVTA 1FWGC 2YKKA 5FJOA 1EJ7L 1S3TC 3BW2A 1AJZA 5I5RA 1PS9A 4RNHA 3N2XA 3DGBA 4PTNA 3O63A 3L4VA 5A6BD 1TWSA 3W81A 1JCJA 2E9LA 2QJGA 4WSJA 1LG1A 2A7RA 3WDRA 1MEHA 2WV8A 3NDYA 1PHQA 4AMAA 1RQHA 4GK8A 5G4EA 1A5AA 1KA9F 2Z1WA 3M47A 2OVLA 4PL2A 5DBTA 3EBVA 4XUYA 2WSQA 3WNPA 1Q13A 3M1ZA 1W5OA 4GMEA 3APYA 2UY4A 5CSRA 4UFLA 4OV9A 1S5TA 3LN3A 3IJIA 4FSAA 2BOFX 4MB4A 1ISWA 5TAOA 5A2AA 2H3BA 3RN6A 4PR4A 5C5YA 5D2VA 1IF2A 1DIEA 2DQXA 5D05A 3MUIA 3O15A 2B31A 2VC9A 5JIPA 4RXGA 2WHLA 5U7SA 3GTNA 1J18A 3FNDA 2JALA 1VFTA 2VC7A 4OIFA 2XVPA 5F2MA 4AF0B 5BOOA 1XFCA 2TMDA 4YLWA 2BODX 4FP1A 3I3DA 3L67A 3GIPA 2WMIB 2OO0A 3K1GA 3CHFA 5AC5A 5LHEA 6XIMA 1XDJA 1E0XA 1E4NA 3UP8A 2V3DA 2RDTA 3GR8A 1M53A 4P61A 3CIXA 4E4UA 4LRSA 1OSEA 3FXGA 2E77A 2VEKA 3DYMA 3KL0A 1TVNA 4Y9OA 1GZJA 3NDZA 1AVAA 5HK4A 3IJDA 4C6LA 4QR6A 2I57A 4HPHA 1VRDA 3GIYA 3U7BA 4O19A 4K8HA 2VXNA 5CSSA 5AVNA 1UD5A 2PZNA 4K2SA 1LCOA 5AYYA 2A7PA 4E8CA 3W2NA 5FF0A 1O12A 3A22A 4DJFD 4PGLA 1ZY9A 2WVSA 1TELA 5TQLA 3GH5A 2VR2A 3MV01 3ZS4A 1L2UA 3PHAA 2J8TA 3ZVHB 4JYFA 3DG3A 2BSLA 1QJWA 1Z9AA 1JD9A 5CH9A 1BVZA 2OGYA 3GLCA 3VGBA 3S1XA 4HOXA 3C0SA 2TRSA 3EOUA 3WDPP 3GNRA 3PZGA 2GK1B 1E3XA 3UJ2A 1B3XA 1O5RA 1XLGA 3CUIA 3MO4A 3W7OA 1H62A 3C2YA 5LZLA 2GWGA 4HOZA 1D3HA 3ATYA 7REQA 2EG8A 4JKMA 3WENA 4O8AA 5DN1A 3W73A 3KAOA 1OWQA 2Y8UA 2ATMA 5FF3A 3E0IA 8A3HA 4IPJA 2W92A 3GVVA 3G1YA 3T44A 4GACA 1RXOB 3F7JA 1NTHA 4WOZA 4Z1CA 1KKRA 5CJNA 5BXSA 3URQA 3KLLA 1I75A 3RILA 4XZMX 4HMNA 4LUTB 3WK1A 3CWHA 2DEPA 1P4CA 4JN6A 3RFAA 3QGAC 1QO5A 4NP7A 1OJXA 1EIXA 4YN5A 2V2DA 2WCAA 1W56A 4L9YA 3GG8A 4KCUA 2PS2A 3BGAA 1RAKA 2RH9A 3GDMA 4HQVA 2X8RA 3TZFA 4JOMA 2ZXDA 3WUEA 2GJXB 4PTVA 3GHRA 3H7RA 4FK9A 4WDWA 2W27A 2X1TA 3K4DA 3DGRA 1GJUA 4BKNA 4M0XA 5AFDA 2ZRVA 2A6LA 4D6GA 2O92A 4D2JA 3ZO9A 3WFZA 2BZNA 2Q8ZA 3CMFA 1GYLA 3W38A 4PMUA 1VENA 3WX7A 3FEMA 3NG3A 1UD8A 2G3FA 5K9DA 1JL8A 2XM2A 4ZBCA 3S6OA 4G7EB 5G2IA 1EF3A 1JI1A 4JS3A 1H4PA 2V9DA 2CETA 3OZPA 3NPXA 1T0OA 4I5XA 1CGWA 3EX1A 4NAFA 4NJJA 4GQRA 4MNJA 3HGRA 3HM7A 2XPKA 3I68A 3UBPC 3H2OA 1IZCA 2FMNA 4O50A 1LJYA 1XF0A 5FIPA 4UOJA 3Q37A 4Q22A 3KDNA 4E2VA 2HBXA 3SO7A 3BZGA 3ZR5A 3CQJA 3STEA 4A2SA 4PUNA 2Z28A 4L80A 2WOQA 3WF2A 3VD5A 1OADA 4GA8A 1HJQA 2P0IA 4N7QA 4IMGA 3H70A 1SM9A 1NDZA 1TV4A 4MUPA 2YW3A 1YDOA 3B8VA 1Z41A 2CU0A 3N13A 3DG6A 4DZ5A 2YIHA 3WLPA 1XLFA 1VEPA 2Z6JA 2GGJA 4E38A 3EWWA 3L5LA 1XXXA 1AJ2A 3M5XA 1EJVC 2NQJA 4Z1BA 1YDNA 1TR1A 2XSBA 3KUMA 4ZE4A 2XVLA 3W84A 3IVUA 3MWAA 4LYQA 4O1AA 5KTLA 2RDWA 4GC4A 3BV7A 2V3EA 1DEDA 3UW6A 2OFJA 2XIQA 1QPRA 3GNXA 3HZ3A 3VD7A 1CZ1A 2D3NA 1RALA 4D1JA 4JTJA 3DECA 1QPQA 4HGXA 3U7VA 5EMKA 4S23A 2EPNA 5GPRA 3IACA 4JBRA 2B7PA 4KW2A 3MUZ1 1QNPA 1V6XA 2ZXAA 2PA6A 2GJPA 2VEIA 3R0DA 1IWPA 1ZHAA 2WZHA 5I23A 3M46A 3MJMA 3DU0A 1UBSA 2YDRA 1XR2A 1DE6A 4WSHA 3NM3A 3EDEA 2PF0A 1XC4A 1Y8BA 1MUMA 2R1LA 3WLSA 4N9BA 1KRAC 3DBPA 1XBYA 1LLZA 1UR0A 1VJIA 1UMYA 2WMIA 1F07A 3P2VA 1LL4A 4GO8A 4M6VA 2AL2B 2NWSA 3U57A 5HMDA 1PEZA 3BAXA 1EYEA 3GSMA 2RKXA 1H1YA 4ZMGA 1PKNA 3OQ8A 2CESA 1J6OA 2EPKX 2PGEA 1J2BA 2PRLA 4AVFA 3GYCA 2P88A 4U4MA 3G1SA 4P7LA 2XSAA 1NH6A 5I3FA 4KEMA 1XSJA 5BROA 2J79A 4C6KA 1E43A 4DN1A 1OFQA 3N4FA 4DPQA 4C6OA 4AD5A 2QEZA 1C7SA 4DBUA 4TVUA 1PHWA 5HR6A 5LHFA 3BLFA 4LYPA 3VAVA 3V4BA 5TF0A 4ORIA 1NEYA 2E5BA 1BQCA 3WQ4A 5FF2A 1FBAA 3DN5A 1GKRA 1Q85A 2OG9A 3URBA 3H22A 3EX2A 4LV4A 3NEHA 5HWJA 3ITGA 5FA5A 2ZUWA 4LUSA 3VOGA 3CM4A 3V5OA 4AZ7A 5HXMA 2I14A 2XGIA 2W9MA 4XSMA 3VUSA 3F5JA 3QY7A 1DWFM 3CAWA 3TW9A 2WO5A 4GZIA 2QXWA 4W87A 1T99A 4C65A 2A4AA 3C52A 1E15A 3OO2A 4C6PA 1FWDC 2Y7EA 5CJ5A 3W70A 1XS2A 5CAHA 1TB3A 3GNNA 3PK7A 4QG8A 3KLKA 1US3A 4ROPA 1E1FA 4LUJA 3SRHA 1P0EA 1RUSA 1K4HA 1UROA 3LD5A 2E6FA 1EPXA 1QK2A 4DBEA 2NX3A 1PIIA 2PC8A 4W93A 4HD5A 1Y5WA 4C6FA 2PUZA 4REQA 3MI2A 2YZ5A 4F0SA 2PWDA 3ES7A 5HMSA 3B0UX 1F6KA 1H11A 3S2NA 3ARUA 3DFSA 3F4DA 1XIIA 4RUBA 3QZAA 4EOUA 2HZGA 2WM1A 4CNOA 3AI0A 3WQEA 4DAIA 3OLEA 4J3TA 3WSUA 3TW6A 3DI0A 2XTKA 2DW6A 2VDIA 4H8VA 3G1HA 4HNLA 3VOFA 4K38A 1IIGA 2NLYA 3L5MA 1X1ZA 4HSHA 1D8CA 4DELA 2OKOA 3RLGA 3QKEA 1JZ6A 1W91A 1Z8AA 4IFOA 3NPWA 1JCTA 3MT1A 4MZ8A 1OT1A 3FGCB 4JX4A 2QCCA 1JYWA 4LTSA 2QW5A 7PTDA 4B5VA 1W5NA 3RCNA 1XLMA 3CPRA 1P48A 2BVDA 1BVWA 1A5LC 4KWVA 2Y4SA 4I8YA 3UD6A 1YXCA 6PTDA 1YYAA 4IHCA 2ALRA 8XIMA 5D2TA 1FWBC 3O07A 3UESA 4D6IA 4I6VA 4UTJA 2J13A 3GBDA 4M81A 2VUNA 5TIMA 1NAL1 3R8GA 4TX8A 3W02A 3KRUA 5A2BA 3G1XA 3H8AA 1MFVA 4W8AA 4M29A 1KCXA 4H3DA 3VE7A 2BGNE 1NWUA 1UZDA 4HA4A 1TJ2A 4HOWA 4FHAA 4MFEA 4UTIA 3WH6A 3D47A 1PYFA 2VQUA 3LBCA 3W7HA 4ZXLA 3B9EA 5CPLA 2V82A 4L9XA 2P8CA 3WLTA 2AL2A 4S3BA 1QATA 1BFNA 4F40A 2C71A 3T0TA 1JF5A 4KGLA 2HVOA 3DESA 4FLSA 1H0IA 1K6AA 1ZBVA 5EY5A 1VBRA 2HPIA 3N6JA 4K3ZA 5I77A 2Y89A 4NY2A 4KF1A 2CLPA 3COTA 4L64A 4RNFA 2PODA 4L1GA 1B3ZA 1PIFA 1NP0A 3VNMA 2PZ0A 1JF6A 5LGXA 4WKHA 3EX4A 2CCRA 1UWUA 1CGVA 3RRAA 2DZXA 3WBWA 5CZKA 1QHOA 2J77A 2GK1A 4MY8A 3OGRA 3NO5A 3FJLA 2Z27A 1YXDA 3EKLA 5JH2A 3P84A 2V3FA 1ODUA 2FYMA 1IYXA 1LL6A 3WBAA 3GG7A 1V3KA 3L2MA 4LF1A 3K1DA 1IT8A 3N9RA 4A2RA 3DZ1A 1DJYA 3NSMA 2QCHA 1ZJAA 1F6YA 2J6XA 1B9BA 1W5PA 1MNSA 4JTAA 1BEUA 2DORA 2YL9A 3D0CA 1DTUA 2XDFA 3CC1A 4O14A 2WXDM 3G1VA 3C2OA 4DUVA 3L4UA 1JFHA 2YFOA 3BK0A 2QDHA 2C8NA 3SRKA 2ZUTA 1LOLA 4BQ5A 1XJBA 1ZL1A 4J2MA 1KR1A 2VD8A 5LSMA 3MUCA 3VGDA 4AZGA 1ZAIA 1LRTA 3PUOA 3Q45A 3ARWA 3LTSA 1EP3A 1GT8A 4FA3A 1NDVA 1OGBA 2TYSA 1AZ1A 3VKDA 1YQ2A 4ZL1A 3P93A 4B92A 3TONA 1YEYA 3M0JA 1Y7VA 4TMCA 1RY0A 2QV5A 4JTGA 3OP2A 4LT9A 2G8ZA 2DZBA 5AKQA 1P0BA 2FVLA 4LX4A 3GQYA 2O55A 2FH6A 2V5DA 4U5KA 3LLXA 5CSYA 3N2MA 4MJ2A 5HANA 3UY7A 3GYEA 3GO2A 1XCXA 4S3GA 4O1DA 4QGCA 3BWWA 3KS5A 1GZ1A 2VZUA 4L7ZA 4EKJA 1JJKA 1ZALA 1ZS2A 1F8IA 1YLVA 4IQEA 3W0KA 2C6QA 5CZTA 5GVJA 1TPEA 5A6TC 4O4VA 1XV8A 2DZTA 3CO8A 3SCTA