3N2XA

Crystal structure of yage, a prophage protein belonging to the dihydrodipicolinic acid synthase family from e. coli k12 in complex with pyruvate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
298
structure length
297
Chain Sequence
ALFTGIIPPVSTIFTADGQLDKPGTAALIDDLIKAGVDGLFFLGSGGEFSQLGAEERKAIARFAIDHVDRRVPVLIGTGGTNARETIELSQHAQQAGADGIVVINPYYWKVSEANLIRYFEQVADSVTLPVMLYNFPALTGQDLTPALVKTLADSRSNIIGIDTIDSVAHLRSMIHTVKGAHPHFTVLCGYDDHLFNTLLLGGDGAISASGNFAPQVSVNLLKAWRDGDVAKAAGYHQTLLQIPQMYQLDTPFVNVIKEAIVLCGRPVSTHVLPPASPLDEPRKAQLKTLLQQLKLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein yagE
publication title Identification of biochemical and putative biological role of a xenolog from Escherichia coli using structural analysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 110
structure length 297
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.28: 2-dehydro-3-deoxy-D-pentonate aldolase.
pdb deposition date 2010-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00701 DHDPS Dihydrodipicolinate synthetase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3n2xA00
5G4EA 1DORA 3FKKA 4PODA 2E1DA 4LC6A 3LCXA 3W7GA 1VRDA 2ZRVA 2V5BA 2A0NA 1C9DA 1KM6A 2ZDRA 4LWWA 1WYIA 3CIWA 3GR7A 1J2WA 1FXQA 4CNPA 3TH6A 4RXGA 6ALDA 4M19A 1N8FA 4X22A 4ZVJA 3LTYA 3NQ8A 1KFLA 2F84A 2NUXA 2GVJA 2CLLA 2QUTA 1ZENA 1JVNA 5BMXA 4IMFA 2GVGA 3IIPA 4QNEA 5K3VA 3LHWA 3MP4A 2TMDA 2DZVA 1THFD 3W7QA 4O19A 1KTCA 2ABAA 4CQAA 1W3TA 4LRSA 4MY8A 3DFNA 4R34A 4WOQA 1A5CA 1YPFA 3QM3A 4PA8A 1OFOA 1K3UA 3NPWA 1ZHAA 5HULA 2QAPA 4TMCA 1OG0A 4FNTA 5A5WA 1J5TA 2JKAA 4JXCA 1JRCA 3NO5A 3T40A 4AWTA 3TK7A 3E49A 3E12A 3PR2A 4PC8A 2CZDA 1O94A 4XBSA 1ML1A 4O8RA 1T96A 4GWEA 4CCEA 3C61A 3GNNA 4WUIA 5DN1A 2QJIA 2FQIA 2A85A 3QC3A 3HQ1A 1CX9A 3P67A 4O1CA 3NPXA 3P61A 3NQFA 1AW2A 4MUZA 3MYPA 1XC4A 1WBJA 3L66A 4C1LA 4MPQA 3TR2A 1JUBA 2A2IA 1GTHA 4R33A 5AYXA 3BGGA 1XM3A 3MMTA 3UWVA 1JRBA 1DBTA 5KZMA 5C6MA 5KZEA 5E0KA 3C56A 2CLHA 1H7RA 1PS9A 3C2OA 4LV4A 2R94A 5CZJA 3Q58A 2PCQA 3NGJA 1LCOA 2KZHA 2Y89A 2WSRA 1KW1A 3EWYA 3QQ0A 1ZAIA 3GAKA 2XFWA 5FI8A 1W0MA 1GWJA 1TTQA 3E9AA 2E6FA 2G97A 1XBVA 3DI0A 3STEA 3A9IA 1VCGA 2CZ5A 1NVMA 1DOSA 1SW7A 5BRBA 3LTSA 3ZWTA 1NF7A 4GUJA 5J5RA 3SIZA 2NXHA 3LHZA 4M6VA 3ZWSA 2RHGA 2QR6A 2Y6ZA 1I8JA 3UZJA 4DQWA 3KX6A 3PF3A 1HO4A 1LLZA 3W86A 2NX1A 3CT7A 3TW7A 4MKNA 3WK2A 1FDZA 3TQKA 3BW2A 4O1BA 2PURA 3GKFA 1B9BA 3MUXA 4ADSA 2VEIA 4PEKA 2ATSA 2GJNA 5CPLA 4XBKA 2QDHA 2V0TA 5K2ZA 2FFCA 2AAMA 5LSMA 3G8EA 5LNSA 1KM1A 3LCGA 3UWWA 3P74A 1A5SA 2NUYA 4PL1A 4N9DA 1HTIA 3P5YA 2H8ZA 1LRQA 4ZQNA 3OG3A 2C14A 2FIQA 1QR7A 4EWND 2V2DA 3QMRA 4DF1A 1JJKA 1W5OA 1TV5A 4RZ5A 3ABQA 3EKZA 1ICSA 2B7NA 1F76A 1JQXA 3NYZA 4IX2A 2NX9A 3OA3A 1L6WA 3K30A 3W2LA 1ME7A 1TIMA 3DHFA 3HPXA 4QJ1A 4PCFA 3QEZA 3MBFA 4Z1BA 1Z44A 3TROA 1QFEA 4IPJA 4UFLA 3BW3A 4RJEA 4DF2A 3DKJA 1ADOA 1XDMA 4UTKA 3EXTA 5G5IA 1OJXA 4O11A 5D2XA 1FCVA 5KMYA 2J27A 3G22A 4S2BA 3D0CA 5TBOA 2QJGA 1OX4A 1B4KA 2CZEA 3LXBA 5LNWA 5D09A 2DZPA 1LZOA 2D73A 3IVUA 3STFA 3NVTA 4LVDA 3T44A 4MJMA 5CPOA 2YR1A 4WY0A 4FIRA 4NJGA 1EIXA 5CZ0A 1W3IA 3O07A 4DXVA 2BZNA 4O50A 1FWSA 2QCFA 4XKYA 3LDVA 4L4LA 3Q2DA 4JYDA 1F2JA 2ZZ7A 4K36A 3A5FA 2X1UA 2YW4A 4YCOA 3BG9A 3TMQA 3MI2A 4N2YA 3THQA 4TIMA 3USBA 2C16A 3PM6A 3QRHA 2GQ8A 4LV9A 3O05A 5FF0A 2XN2A 3TU9A 5GVJA 3W2KA 1G6CA 1MO0A 3LCHA 4X2RA 5LHFA 4CNOA 1QDSA 1VHNA 4MZ1A 1W54A 3BO9A 5J5DA 3LV5A 2DZXA 1DVJA 1TPC1 4AVFA 2H6RA 1I45A 1KV5A 3QSTA 4ADTA 4FHAA 1OX6A 3LB0A 3L5MA 3NQDA 3HGSA 1KLYA 2JGQA 3KVJA 2QCDA 1L9WA 4LW7A 4JS3A 5G1TA 4WD0A 4D2JA 1XFBA 1YDVA 4JX5A 2ZTKA 3SW6A 3MHUA 3C8FA 5HINA 2I9EA 3RF9A 1KFCA 5IBXC 4P2VA 1NEYA 3TUUA 1WV2A 3S5NA 4UFKA 2Q3OA 1O95A 4OQVA 4LVBA 2E09A 5EL1A 4U4MA 3MO7A 4JNMA 2RDWA 5AC8A 3CEPA 3GDTA 3VE9A 1ZCOA 4YL2A 1SUXA 2RDTA 3N2MA 3DI1A 1D3HA 4TU1A 3GAYA 1SPQA 3NOEA 1VJIA 4HN4A 2Y62A 5G4WA 3P81A 1ZAHA 5L6UA 2FPTA 3G1VA 2J88A 3EXRA 3OEXA 3CWNA 4QQ3A 5DY2A 4UTHA 2TPSA 2PE4A 3L67A 4HNUA 1SW0A 5BNKA 4A29A 1N55A 4CQ9A 2BSLA 4A3UA 3QFEA 1YADA 4LVGA 5F4XA 1AL7A 1XUZA 4YLWA 4Y9AA 2OT1A 4K37A 4N9BA 1BWKA 1RR2A 4XQ6A 2PRMA 4XTIA 4AEOA 2Y7EA 4O13A 3ATZA 4JTEA 4MYAA 2BLEA 4UCGA 2NV1A 5F4WA 3RLUA 5E1QA 5LKYA 3NR0A 3R89A 3TV8A 3E96A 3W7IA 1OVDA 1TTIA 5AC7A 1SZEA 4WY0F 2J6XA 4GBUA 1A53A 4AF0B 1KTBA 4QITA 4BI6A 3M5VA 4MJZA 4Z1CA 4UUIA 2E5CA 3U8GA 3CIXA 5AHNA 3JR2A 3P60A 1LTDA 2EKCA 1I2PA 3W7EA 1L6SA 1OFQA 3MYOA 1W5QA 3NEVA 3IVTA 1TO3A 1KV8A 1YTEA 2A21A 4QM1A 4PFMA 1OFBA 3PY2A 1UBSA 3WK1A 1OFAA 5C55A 4UR7A 4GC4A 1H1ZA 3LXCA 4OGZA 4M7TA 1JCJA 2QF7A 3W6YA 4JIQA 3HF3A 4UNLA 3W85A 1X6UA 2WSYA 2ZZ5A 1LP6A 4JTFA 3DZ1A 2X1SA 4Q4KA 1TPH1 1JUEA 2W79A 2ZRYA 4ML9A 2J24A 1AL8A 2YYTA 3HG2A 4ALDA 1GJPA 1P1XA 5H91A 5AHFA 4FXRA 1AW1A 3O8AA 3G1XA 4I9AA 5IBXA 3TNOA 2C6QA 3PWAA 3LHVA 1ME9A 3KRUA 1LOSA 3W1LA 1AMKA 4GFSA 3UD6A 3W7JA 1H63A 5AN7A 3QMSA 4IWWA 3IVSA 3W1AA 4K8HA 1KA9F 2NXGA 2HS8A 2I14A 2RDUA 1IIHA 2EF9A 1TTPA 3C4UA 5G2HA 3ELFA 3NQEA 1FCBA 1Y0EA 2ZZ4A 3NPVA 1SQ7A 1PIIA 3W74A 3B0VC 1RV8A 2Z6JA 1VYPX 3S0CA 5KZDA 4UFMA 3W1QA 3TCEA 4TR9A 3W7HA 4IMEA 3WJXA 5AYYA 2TSYA 5HR6A 4NQ1A 1OK4A 3HMJG 1SZFA 2J9XA 2DORA 3LCFA 4OU1A 1LLWA 5CSSA 4MZYA 1M6JA 1B57A 2ZZ1A 3Q94A 1EX5A 3M47A 1WDWA 3P82A 1T8XA 1DL3A 3QZEA 4EOUA 1H7PA 3EXSA 4GXMA 1TCDA 3HIJA 2GUUA 2RH9A 4QNWA 3QQ1A 2A6LA 3M43A 3W2JA 4Q32A 3DGRA 4YWIA 4LY8A 3TSDA 1Z41A 1B3OA 3C3NA 3PG8A 1C8VA 3N14A 3WK3A 5HWMA 1VLWA 1L6YA 4K38A 3P8IA 5LNVA 4K7YA 1H51A 1ICQA 3R5EA 2GPTA 3BW4A 3G24A 3MI6A 1GYLA 2H3BA 2VFHA 3G18A 3DAQA 4I7VA 3SI9A 4AHPA 2C0AA 3JRKA 3QF0A 4PL2A 1SW3A 1BEUA 3G0SA 1SSGA 1GG0A 3GB6A 5D32A 4HHPA 4O17A 1OFPA 4LVAA 2CLOA 3B06A 2CW6A 3TMLA 2CLIA 4BR1A 3O6YX 4IMDA 3KRZA 3KHJA 2WJZA 3B0PA 3EB2A 4LS0A 3M1ZA 5D03A 1DKWA 4NNAA 1VC4A 2DJLA 1Q3NA 1KFEA 4DELA 1DHPA 3W22A 1J4EA 1WQ5A 3B04A 4CNNA 3UY8A 2J9ZA 3BLEA 2Y70A 1Q6LA 5EMUA 2QKFA 2TRSA 3W2NA 3QH2A 2V2HA 3F1QA 5LZLA 3RMJA 3C2FA 2QCLA 1YXYA 3UPBA 1XI3A 1GPWA 1R2SA 2YCEA 3KOFA 1QMLA 4O0ZA 3S6DA 3LHTA 1P4CA 3UQNA 4JDYA 5FEWA 3W1RA 1F73A 3VE7A 2NWRA 1IXQA 2Z1BA 3PUDA 2ZRWA 1K8XA 1NSJA 1IF2A 4NU7A 2YX0A 5DCDA 3TFCA 4ZQPA 4JTJA 1F05A 4Z0SA 2Q8ZA 3T7VA 3W7NA 4PH6A 3IIXA 1FX6A 5FF3A 3O15A 1DV7A 3NQ6A 4ZQCA 5D04C 5D37A 1R2RA 1TQXA 4GE8A 4FF7A 1LORA 2YDAA 2CLKA 3FLUA 3TC7A 1WAUA 3SZ8A 4BI7A 3O06A 5K9DA 4KKXA 5DBUA 3LM7A 1F74A 4O1AA 4O0KA 3OVRA 4RZ6A 3FJ6A 4AHOA 1YDNA 5TQLA 2V2CA 2OX1A 2E5DA 2B4GA 1GVFA 2HS6A 1DQWA 4IGHA 4K7VA 4KFPA 4R53A 2FLIA 3M6YA 3LI0A 3I68A 4O16A 2VEPA 4J9JA 1M7OA 1I2QA 3FS2A 3O1NA 3NL3A 4X3ZA 4NZJA 1OX4B 2GQ9A 3CC1A 5I3KA 3MWAA 1IXNA 1X8FA 4N6EA 1W56A 1ALDA 3W2UA 1DJQA 1EB3A 3TW6A 4JIPA 4WY0B 1H62A 2VFDA 3EX6A 3KRSA 3PSWA 3GXTA 2YSWA 3GK0A 3GVGA 4W9TA 1FCQA 4XKYB 3W1UA 2ZRXA 4Z0JA 4LC8A 1UJPA 5DELA 3R13A 5FEXA 3DFPA 3W1MA 1UASA 3NZ1A 2VELA 4A21A 3P62A 3YPIA 2XN0A 2V5LA 2C1HA 4Y8FA 1BTMA 1KM4A 4C1KA 2FDSA 3WK0A 1H1YA 3OVQA 2CZFA 4GUIA 1R2TA 3O63A 3ABOA 4EF8A 3W1PA 2E6YA 4JX4A 2WQPA 5CPMA 1X1OA 4LNYA 3DFSA 4JEQA 3W7LA 4XZ9A 3FKRA 3WJYA 2C19A 3N19B 5F2GA 4LOCA 2OCZA 4NNBA 4AWSA 4RKAA 3W72A 2BXVA 3IIZA 3PBUA 5F2IA 5DXYA 1VR6A 1W1ZA 2CLFA 2CWNA 4H4IA 5U7SA 2A7RA 4NX5A 1OHLA 1MSSA 4WJEA 2QCDB 4BFAA 1XUUA 4GUFA 5KINA 4CCDA 1FDYA 1ICPA 1U83A 4NJKA 3UWZA 3GDLA 2FPYA 1FBAA 3WJSA 1GOXA 2NLIA 1VS1A 2Y61A 3LHUA 1TTJA 4LS2A 3O16A 1UUOA 2YFOA 3HPZA 3VNDA 1VZWA 1FQ0A 2GJLA 1K7EA 3PG9A 1C29A 4OV9A 1FXPA 3TXZA 1Q6QA 1P0NA 1M7PA 2VOMA 1YTDA 3NL6A 4PTNA 3N2XA 1RQEA 2WSQA 5G1YA 1OFRA 1QO5A 1IXPA 1LRTA 2A6NA 1SO4A 2HSAA 3LRLA 2EPHA 5FEZA 1O5KA 4ZZ9A 4O53A 4UFHA 2VFEA 3INPA 3TSBA 2R14A 3LRKA 1ZFJA 1TJRA 4WXZA 2B7QA 2C18A 1JCXA 4RCXA 2A7PA 1OK6A 3OVPA 2NWSA 2VKZG 1LOLA 1RZMA 2PC4A 3W7OA 1JQVA 1G4EA 2X16A 4DEFA 5BOOA 3KAOA 4BWLA 5A8GA 2GVLA 3I65A 3RNDA 3W76A 5SWUA 2FJKA 2O7SA 3TQVA 3C52A 1K8ZA 3MHFA 4MFDA 1PCWA 1SO6A 3W23A 2JK2A 1YXCA 5AHMA 3FOKA 1MEHA 3UWUA 1YTKA 3HGRA 1T99A 2Y7FA 5K9XA 4IQLA 1OFEA 5T26A 3T4CA 2YPIA 4O4VA 5DCEA 4O12A 2NUWA 1ZJIA 3FIGA 3S1WA 2X2GA 4O52A 1XL9A 4JGDA 4L4MA 4YMZA 1VYRA 3NQVA 3HGOA 3A22A 5DBTA 4FNQA 1G7UA 3TJLA 2DU2A 1IIGA 3W1XA 3PS7A 1GG1A 2QJHA 3M16A 4FNRA 1TPEA 3NG3A 4JTUA 4UIOA 3W1TA 3TJXA 2R91A 4JTGA 1SU5A 3IIVA 2VFFA 3L65A 4K39A 2JGYA 2CLMA 1WOAA 4ICNA 1CW2A 2AGKA 1B4EA 2NZLA 3LV6A 4DPPA 3C2VA 4NX0A 4UTWC 2EAWA 3EWBX 4FB7A 3SJ3A 4BI5A 4UTJA 5FF7A 5I3GA 2NX3A 3WJZA 3HGJA 4FX7A 4YCPA 3VFLA 3O6CA 1Q6RA 1OFDA 1JCMP 4TMBA 5I3JA 4O10A 3F4NA 4EF9A 3DHDA 3F03K 3V75A 3P80A 2Z0IA 1PL9A 3N9RA 3TDFA 4A2RA 2TYSA 2Q8LA 3HG3A 4FIQA 3MP5A 1G69A 3RK8A 2P10A 3FJLA 2A4AA 3M5YA 2VC6A 4FO4A 2P0OA 3PAJA 3TX9A 1P5BA 2DZWA 3IRDA 4JN6A 5K9CA 2FB2A 1R47A 3LBCA 4MFEA 1I4NA 1WBHA 1PE1A 1GVRA 4UTUA 3G1DA 3SY5A 5MHBA 2VENA 2FPVA 1RPXA 2CLEA 3NL2A 3CHVA 4JTLA 4LRTA 3G1AA 3I7SA 3S1VA 4CQ8A 3HB9A 1W5NA 4MOZA 4FNSA 3NQCA 4IOTA 2V82A 5D05A 4N6FA 3O6DA 5D2WA 3QMTA 4DO4A 5HR7A 4JX6A 4FNUA 1JCLA 3ABRA 3NQMA 5EKYA 1RVGA 4WX2A 1GVQA 1V7YA 3R12A 4OV4A 1AG1O 5DXXA 3UZ5A 4QAIA 1V5XA 1FWTA 5FF2A 1EUAA 3L2IA 1R46A 2ZA2A 4WOZA 5D38A 1KM0A 2I1OA 4QSHA 3UPWA 3NM3A 3G0XA 1I2OA 5DLCA 1VHCA 4FXSA 2FTPA 3H53A 3PBYA 1NF0A 1LOQA 3NDOA 1VCFA 3JS3A 3LCIA 2NV2A 1OF8A 5AYZA 4IXHA 1LYXA 3DBPA 3PUEA 4UTIA 6TIMA 3A21A 1TPVA 3IGSA 4M6QA 1TB3A 3W84A 4JTKA 2Y63A 4HSNA 5HQEA 2V30A 4ZQRA 4M6PA 1KFJA 1XKYA 1K02A 1VYSX 3NPUA 3S5ZA 3HOJA 2DZTA 2W6RA 3DFQA 1LBFA 1EP3A 3NQGA 1GEQA 1AK5A 5D2TA 1OF6A 4LTSA 1R30A 4EIVA 4KWVA 4UTTA 4OHQA 1WXJA 1L2UA 2ATMA 1VH7A 3GX9A 4AXKA 2BWGA 2B0MA 4XWUA 3B4UA 5FEPA 1EP2A 3S5OA 3SGZA 3I6RA 1KFKA 1YDOA 1SR9A 2WPBA 4RLIA 1LBLA 4IPIA 1X7FA 3TQ0A 4OWGA 5KITA 1E51A 3HBLA 4YXGA 3NM1A 4Z1DA 2JKPA 4X9SA 3S42A 4WXYA 3G1SA 3RLVA 3IV3A 4UTWA 2G95A 3OBKA 3DFTA 5D02A 1PVNA 3BGJA 3STGA 4JYFA 4HPXA 5C54A 3W70A 2GOUA 4JTHA 3LCLA 3SECA 3TSMA 5LNUA 3THAA 4AMAA 3LERA 1SO3A 5HUOA 2IQTA 4JTTA 1FWNA 4M5PA 1KBJA 4O1DA 1Z48A 3R2GA 4UNKA 2E68A 5F2MA 2W0UA 2VEKA 3C6CA 4IMGA 1EPXA 4JR5A 3KXQA 1QAPA 4IJBA 1EWDA 5ABTA 3UWYA 2WOQA 2A1YA 4Y6GA 3I7QA 2ZRZA 1GTEA 4UXDA 4NUWA 3V1PA 1LDCA 3M0ZA 2WV8A 1UB3A 3WJWA 1SSDA 3LBMA 3TKFA 1TPFA 3GR8A 3W2MA 3NA8A 3STCA 1FWWA 1S5VA 4NJIA 2H90A 3UXDA 3SR7A 1HG3A 5CSRA 3S9YA 1GVSA 4A22A 3KFTA 5F1VA 4H6KA 4NNCA 3P5ZA 2YFNA 3LX9A 2RKXA 2C15A 1W5MA 1W8SA 2O7QA 4NT0A 1M5WA 4ZMGA 1KTNA 3LGEA 2OT0A 3HO8A 1SZNA 4K6AA 1EA0A 2B7OA 4HNNA 3QSRA 2RFGA 3FEMA 4NXKA 8TIMA 4RR4A 3Q37A 1FUYA 4GRSA 1DJNA 2QAFA 1H60A 1WX0A 4HNVA 2H3DA 3CPRA 3E02A 1WOBA 4MYXA 4Y96A 3W87A 3IEBA 3PULA 4JY8A 2ISVA 5FF4A 1KM3A 3CB8A 1A5BA 4M7SA 1TQJA 3BK0A 4MVAA 2QCCA 4DO6A 3G3DA 3LLDA 4IMCA 3GNDA 1MEIA 4AWUA 4N02A 3UY7A 5HWNA 1YXDA 4G1KA 3S5YA 1GVOA 1XXXA 5LNRA 3PBWA 2QCGA 1Z42A 3QW3A 2F7FA 5EYWA 5HWJA 2QCHA 3LXAA 3U6WA 5D2VA 4E38A 4NJJA 5AOUA 3NQAA 5LGXA 3QW4B 3G0UA 2QCNA 1EEPA 1QOPA 4IUOA 3L5LA 1P0KA 1LM1A 1FWRA 3SGUA 3B0UX 2E77A 1K03A 1K7FA 2EHHA 1EWEA 3EX1A 4GNJA 2DZSA 3M44A 3W7MA 1VGAA 4HPJA 3S1UA 1JUKA 4KWWA 2DJXA 3HG5A 3LTPA 3W73A 3UXAA 3M5ZA 3GLCA 5AC6A 5K4XA 3DKLA 2E6DA 4LUJA 3KVMA 3CEUA 3DXIA 3W07A 4AHQA 1X1ZA 4BK9A 4N4QA 3B05A 3PBVA 4JTIA 1YPIA 2PRHA 2OMAA 2J9YA 3IGUA 2PRLA 5DCBA 1HFBA 3NL5A 4R7JA 2WO5A 3BLFA 2A7NA 4U28A 2QUVA 3N34A 3CQ0A 4UC5A 3NNTA 2C13A 2X30A 2ZA3A 3L68A 3PUOA 4AB4A 1U5JA 5HJLA 5FESA 1OYAA 1ZY9A 4LS1A 2Y7GA 4O4WA 3B03A 4GUHA 1XDLA 5AB3A 1VPXA 1TV8A 3FYPA 3U2OA 1F5ZA 4FX8A 1YLVA 3W7CA 3TFXA 4JY9A 4N9EA 4TO8A 2Q3RA 3HG4A 4K8EA 4BWLC 4RZ4A 2G96A 2FB3A 3LLFA 1GT8A 1PHQA 3A23A 5EBUA 1W31A 3T55A 1UCWA 4NZFA 3DFOA 3N3MA 1HL2A 3PSVA 3G3MA 4FEZA 4N4PA 4UFJA 1O5XA 4E2DA 2ZZ6A 2VEMA 1QPRA 1ZNNA 2ISSA 4MLJA 3W75A 1AW5A 3M5XA 3SSJA 4RV8A 3TAKA 4IXXA 3GXNA 3GDRA 3VI2A 3GZ3A 5E93A 2ZZ2A 3W88A 3ZFHA 3N73A 2QDGA 4FNPA 1TRDA 1TPUA 3TC6A 1O60A 1OYBA 2ALDA 1ONRA 1GYNA 2YZRA 4EVZA 2CU0A 3LOTA 3BPWA 1OABA 5EY5A 1TPWA 2YGYA 4GJ1A 5G2IA 1G4SA 4OE7A 1G7VA 4JTSA 3TE9A 4LVFA 3W83A 1LRNA 3EKLA 3ATYA 4AH7A 3SFKA 4NJHA 3WFAA 2A5HA 1W37A 2CFFA 2ZZ3A 3MI3A 3BVJA 1H61A 2ZCGA 4HNTA 1IXOA 4OT7A 3ANYA 1PHWA 5EA9A 4O54A 2XN1A 3IIOA 2HTMA 4LUIA 4UMCA 3PC0A 3TA6A 2QUUA 4LT9A 3W3OA 2P1FA 3S8HA 2H8XA 4ORMA 1GZGA 3ABSA 3N9SA 3E0IA 1QPNA 1W3NA 4S2CA 3W7KA 2B7PA 2ZQ0A 5AHLA 3FA5A 3EWZA 4DO5A 1CI1A 1D9EA 3TIMA 4CCCA 1Q6OA 4ADUA 3L0NA 3MW7A 1TPB1 3EX4A 4FX6M 1NAL1 4B5NA 3W7DA 3TXVA 5LGZA 3GDMA 5AHIA 2OJPA 5HMSA 1JCNA 1JR1A 3PVFA 4KFNA 4IX0A 3B8DA 5HNRA 1JULA 1LROA 2JBMA 1OYCA 1A50A 3G1HA 4HSOA 5CPNA 1VLIA 3AO0A 3OHIA 3GYEA 1SZGA 4O14A 4Y90A 1G4TA 5I3IA 4ZQOA 1IGSA 1KM2A 4WZHA 3W7PA 3BV4A 1MXSA 1FY6A 4WQ6A 1DQXA 4GUGA 2ZA1A 1F6KA 4HIBA 2VFIA 1I2NA 5H2ZA 2X1TA 1HO1A 4CLMA 3F4WA 3P84A 4UTMA 3L0GA 3W7RA 4JDBA 2ZYFA 2ZFAA 3L5AA 5I3HA 2G5WA 5DY3A 3RFAA 4JD4A 2WNNA 3HPSA 2OZ0A 1H7XA 3AJXA 1PCKA 4HT3A 2JKEA 1SFLA 1TRIA 1XBZA 3A24A 4A2SA 3EWXA 1TV7A 2QEZA 3H54A 1ZAJA 3LRMA 3RU6A 4JYEA 2GQAA 3G8RA 1W5PA 2Y7DA 3MP3A 3BG5A 1G67A 5AHEA 1QPQA 1QNVA 1QPOA 1TPDA 3NXFA 4O18A 1KBIA 1EUNA 3FFSA 4ZL1A 1A5AA 4DBDA 2QCMA 3LCWA 3VKJA 1LBMA 1FCUA 3ZS4A 3MBDA 4I7UA 3TAOA 5CZTA 1S3HA 4UTTC 4O15A 2LLEA 3UNDA 5HUPA 2ISWA 4NVTA 1NFBA 2YW3A 3QPYA 3T78A 4RK8A 1F7BA 1RD5A 3VCRA 1YYAA 2BTMA 4HKPA 4QISA 4NXSA 5K4ZA 1XCFA 3UWQA 2YXGA 2V9DA 1F6PA 5C2XA 4LU0A 2R8WA 3BG3A 3NAVA 4Z08A 1SO5A 1H7OA 4POCA 5BMWA 1ZALA 2AQWA 3PB0A 5EPDA 3P8JA 3NZRA 5BW6A 3GXPA 1KFBA 3FYOA 3LHYA 4Q33A 5CGQA 1H7WA 2VXNA 2ABBA 3CM4A 1XBYA 2WKJA 2WNQA 2Z2UA 4DPQA 3KVKA 1UUMA 3DH7A 3MHGA 2Y85A 5TIMA 4Z1AA 3DENA 2C3ZA 3M41A 3M9YA 1QWGA 3R8RA 1JCYA 5C5YA 4MY9A 2V8ZA 1VQTA 3ZR4A 3M7WA 1FDJA 3GKAA 4QIUA 3G1YA 3NQ2A 3OIXA 4E2BA 3GDKA 2ZRUA 4RX0A 5LHEA 1KM5A 3HJZA 4TX9A 5D2YA 2X1RA 3W9ZA 4MY1A 3L9CA 5G2WA 5K7JA 2E6AA 2E5BA 1OX5A 1XBXA 3BARA 1QOQA 4MIMA 3C2RA 3DU0A 2ZTJA 2HMCA 1SFJA 1BKSA 4XTDA 5D30A 4ORIA 5CZSA 2DP3A 1Q45A 1MEWA 1TJPA 4RXFA 3GIYA 4DBEA 2WNZA 5CG7A 4E0CA 5KSWA 3CWOX 3LI1A 1N7KA 3EWWA 1HUVA 2EGZA 4AAJA 2VFGA 4ONVA 3QPZA 3UYCA 4O57A 5AFDA 1H50A 7TIMA 3W71A 1QCWA 1O4UA 4P61A 3P7YA 2ZBTA 4JICA 4ZQMA 5F4SA 3EWUA 2NXIA 1ME8A 3QJAA 4UMBA 1PV8A 3L0KA 4MZ8A 1VCVA 4DF0A 1MZHA 3IGXA 5F1UA 1H5YA 1T0OA 1KLZA 5I3FA 1G4PA 1S5WA 3S1XA 2YYUA 3EEGA 1TSIA 4AF0A 1K8YA 5D33A 1D3GA 5IM51 2Z6IA 4UMAA 4I7WA 4MLRA 3QYQA 4H3DA 3I7RA 3NQ7A 4S1FA 4BF9A 5KTLA 5F2LA 4UR8A 3L21A 4KFOA 3BLIA 3EX2A 4UTLA 3C2EA 3C0JA 3G1FA 1QO2A 1TREA 4UFIA 1WA3A 2V81A 4XUGA 3A5VA 1K7XA 3KVLA 4OBTA 1RQHA 2BX7A 3W1NA 1S5TA 5L9FA 2QCEA 3CLMA 1BWLA 1RQBA 1GQNA 3MJYA 3CTLA 3PB2A 1I2RA 3EX3A 5CKSA 2DZUA 3CU2A 1H7NA 1EP1A 1TMHA 4O28A 5U4NA 2Y88A 3H55A 2UV8G 4N9CA 1TYGA
chains in the Genus database with same CATH superfamily
1OD8A 3GNXA 3FKKA 3LCXA 2ZRVA 1B5TA 1KM6A 4LWWA 1WYIA 3CIWA 4LGXA 3GR7A 1FXQA 1DE5A 3WH5A 6ALDA 1XYZA 1DIOA 2F84A 2GVJA 2Z7KA 2ZXAA 1Y65A 4GQBA 1GOIA 2GVGA 3IIPA 3R25A 3WUFA 3BSGA 4J40A 3KL3A 3LHWA 2DZVA 1THFD 4F40A 2FFIA 4O19A 3AIBA 2ABAA 1W3TA 1BVWA 3BOFA 5GJNA 3NPWA 2QAPA 2WM1A 1OINA 4DWSC 1HNYA 1XKJA 3OJGA 3STPA 3SRDA 3TK7A 4EAMA 2HK1A 3PR2A 1ISYA 5D9MA 1O94A 4XBSA 3BLKA 1ML1A 1DE6A 1T96A 4GWEA 4PUDA 4DZAA 3BQ5A 4CCEA 3GNNA 4L9ZA 4WUIA 4JHOA 1UIOA 4LUTA 4O1CA 3P61A 3NDZA 3U5UA 3NQFA 2P50A 3MPGA 3MYPA 1XC4A 4NZ1A 2VNCA 5MKGB 4MPQA 4BEQA 4G8TA 1PX3A 4PN2A 2PGRA 3EA2A 1GTHA 4R33A 3BGGA 3AICA 3K8KA 6CGTA 4G1NA 3RJYA 1PKLA 2WZTA 5KZMA 1NY1A 1TFVA 3C56A 1PS9A 3C2OA 3KDOA 4ZA0A 3Q58A 3N1AA 3MMWA 3O9NA 3KDNA 4KGJA 2KX9A 3VDCA 1KW1A 3ZLGA 3QQ0A 4XZWA 3NO3A 4IJRA 1TTQA 4UOZA 2PDPA 4DWSB 3CPUA 4MJ4A 1UWUA 3GG0A 2QHAA 4QS6A 1EC9A 2E25A 2CZ5A 4HNLA 1F3WA 3VZXA 3LTSA 3ZWTA 1NF7A 4EK7A 4GUJA 5MF5A 1VBHA 1VFUA 5J5RA 4L9XA 2PDHA 4M6VA 4J3SA 1LWHA 1W91A 4Z2HA 4HQVA 1GKRA 2ZC8A 3SCQA 3VD4A 3PF3A 1JYVA 2NQ9A 3CT7A 1UOZA 3TW7A 4MKNA 4ZE5A 3GE7A 1FDZA 3A3WA 4ZO9A 2Y5SA 4NY2A 2VQTA 3MUXA 2VEIA 2ATSA 2GJNA 4W93A 4OIFA 5LNSA 1KM1A 4F3HA 5I23A 3UWWA 3MWCA 1R9ZA 4PL1A 3JW7A 4ZQNA 3AZTA 2C14A 1QI4A 1QR7A 1JZ5A 4RPPA 2V2DA 2D2HA 3QMRA 4DF1A 1JJKA 1W5OA 1TV5A 4PUWA 4HHHA 1S39A 1L6WA 3V1HA 1A80A 3URQA 4LNCA 4YVVA 4J3WA 3LQGA 4PCFA 4A3YA 3QEZA 1CLXA 1DJXA 1O5RA 1XLHA 5HATA 1ZS2A 1QFEA 1RCQA 3CV1A 3WF4A 4ZB5A 2BVYA 3EXTA 1E9ZB 2BXYA 4XIMA 3UGVA 1FCVA 5KMYA 3G22A 4S2BA 1B4KA 1QHPA 3GUGA 4U5KA 5BU6A 1UD3A 1KO0A 2Y1HA 2OPJA 4EXQA 3VD5A 3NVTA 2XINA 1XG3A 4RDWA 1GNXA 2J6VA 2F9RA 4NJGA 2BGNE 1EIXA 1RK6A 2PP0A 5CZ0A 1V0KA 4XKYA 2WVUA 4L4LA 4PE8A 5AC4A 4PRWA 1ONXA 2UZ9A 1M1BA 3H7VA 2OO0A 2ZZ7A 1TZ7A 2YW4A 2E9LA 2FZNA 1KR0A 4N2YA 2WQDA 3MVTA 3NO1A 5C8BB 2GZXA 3E1F1 2WMIA 2DY3A 3UBPC 3U0HA 4NHVA 5GVJA 3P2VA 4CNOA 2NV9A 4UZSA 3EA3A 4OBSA 4GJIA 3ARYA 1TPC1 2POZA 4M51A 3REQB 3S9ZA 3LB0A 1XJBA 1E40A 3KVJA 2JGQA 3EPMA 4NL1A 1O1HA 3GTXA 4LW7A 4MWAD 5G1TA 1YDVA 4KEVA 2UY4A 3KTSA 3VNMA 4W8AA 5IBXC 2ANUA 4P2VA 2AKMA 4EKJA 2GK1A 3TUUA 1WV2A 4K2SA 3WF1A 5CBJA 2J75A 2YCIX 1O95A 2VWSA 1SGJA 2WLYA 5HA7A 4JNMA 1TWIA 4YL2A 4L1XA 3N2MA 4GQGA 3WFZA 3GAYA 2XWEA 4NAFB 3HURA 2Y62A 4HN4A 5L6UA 2FPTA 3G1VA 4MB3A 3OEXA 3CWNA 1GONA 2BB0A 4HNUA 4RE4A 4A29A 2XVKA 3I4KA 3OPSA 2XTKA 4ACZA 2OSYA 4O1FA 4WDTA 4Y9AA 2PWVA 4CCZA 1GUVA 4AEOA 4B91A 2VGBA 4O13A 4JTEA 2NV1A 2VRKA 2E9BA 3OA5A 2IQ0A 2DSZA 3TV8A 3W7IA 3CMJA 1OVDA 1WZAA 3W02A 2FGZA 2J6XA 4GBUA 1P1MA 1A53A 3CZJA 3ITGA 3SY8A 2ZC1A 3M5VA 4UUIA 4R9XA 3CIXA 3U4FA 4LAOA 3P60A 4GQRA 2EKCA 1L6SA 1W5QA 2UY2A 3T0DA 1UWSA 4EAYA 2A21A 2XH2A 4PFMA 1AMYA 2QT3A 3WK1A 5C55A 3AYSA 3MQTA 1H1ZA 4RE2A 3LXCA 5DF0A 4PMVA 4AYSA 3W6YA 4JIQA 4HK6A 1MNSA 2ZXDA 2HCVA 3N3TA 4ZSTA 2FJUB 2W79A 1VFTA 3UJFA 2UWFA 4ALDA 4FXRA 3GW3A 3PWAA 1RCXB 2FGLA 3QMSA 4IWWA 1E3ZA 3LPGA 2RDUA 1B3WA 1IIHA 4LYRA 1XW8A 1FCBA 2G37A 1WZLA 4U33A 1PIIA 2P3ZA 3VIKA 2BVDA 2OZ8A 4LX4A 4WEVX 4UFMA 4X63A 3WJXA 4FR1A 5HR6A 4HU3A 3AUOA 4NQ1A 3A4JA 6XIAA 1OK4A 3JZEA 3MDWA 4JFUA 4YNGA 1S2VA 4JKLA 3RX3A 2GL5A 3Q94A 3FDKA 3ARTA 3M47A 1NFPA 3P82A 2Q6ZA 1T8XA 1DL3A 4EOUA 4DUOA 3CAVA 2ZUUA 4GXMA 1VD6A 3HIJA 2RJHA 1ZP3A 4MHBA 4ERIA 4QNWA 4HZMA 3A4WA 3W2JA 3S2CA 4Q4OA 4EACA 4LUTB 3GUWA 1JPKA 3C3NA 3N14A 5HWMA 1VLWA 4K38A 1M3UA 3QR0A 4A8IA 1H51A 3DHUA 1ICQA 1YPXA 1OEPA 2E28A 4WJ8A 3DAQA 4I7VA 4PL2A 1XP3A 1NDWA 3G0SA 5GQBA 2VEGA 3FGCA 4O17A 4LVAA 2CLOA 4E6MA 3O2LA 1TX2A 1TWWA 2WANA 1J10A 3UXLA 4S3KA 5CZKA 3TMLA 3O6YX 3KRZA 2WJZA 5HJXA 4H83A 2JE8A 9CGTA 3VCCA 1A5OC 4NNAA 4DJED 1US3A 1VC4A 3CHFA 2OZ3A 4QDPA 3H24A 3W22A 2XIMA 4O0QA 2VP8A 4ZFMA 4AD5A 1G9HA 1FH8A 2J9ZA 2Y24A 4AMCA 5HK4A 4BS0A 3W2NA 3BDKA 3N6QA 3F1QA 5XIMA 5LZLA 4D6FA 3M0VA 1P48A 1YXYA 5LIWX 4BCEA 4ZO8A 1R2SA 2YCEA 1QMLA 4O0ZA 1P4CA 4DI9A 4QFUA 2CERA 3BMVA 1F73A 2NWRA 2J79A 1IXQA 2Z1BA 3PUDA 3VNJA 1NSJA 1K8XA 7REQA 4NU7A 1VJSA 3TFCA 3WF3A 3T7VA 4Z0SA 4QTGA 3W4RA 1O1ZA 2AL1A 5AKQA 2DSVA 5C7VA 2FVKA 3N17A 1DWFM 2DQWA 1DV7A 3OYXA 4AEEA 5BXTA 2ZXQA 4C91A 5D37A 4ZE4A 2CESA 4GE8A 4L5ZA 1CXKA 4QXIA 1SJBA 3H22A 2BVWA 5FCZA 1WAUA 2PWGA 5K9DA 4ZOBA 5DBUA 3VINA 4D8AA 3KS6A 4O0KA 3AHYA 4RZ6A 1YDNA 2OX1A 3R43A 2FZDA 2B81A 3LMZA 4GX8A 4R53A 2P3EA 3WKZA 1E3XA 3C0QA 1M7OA 3FS2A 4IL2A 2GQ9A 4H9YA 1K4GA 5I3KA 2WZHA 1IXNA 4HOZA 2FH6A 4XSLA 1Z32X 3UZYA 1XQKA 1W56A 3TW6A 3AHTA 2OOFA 3EDEA 1ZGDA 2AMXA 2W5FA 1H62A 2EXOA 3F4VA 4REQB 3EX6A 3N2BA 2V6AA 3PSWA 3GK0A 5AZ1A 3K8MA 3GH7A 4XKYB 2NVDA 3W1UA 1W6TA 3LBOA 4MF4A 5AZ0A 4BQ2A 3T2PA 2OLAA 5ABGA 2NQHA 3H2OA 2VGFA 1UASA 4GG9A 3N29A 4F66A 2BHUA 2C1HA 4Y8FA 3S3GA 3WUEA 1H1YA 1FKWA 1Q8JA 2CZFA 2WMIB 2NSOA 1XS2A 3O63A 1LWJA 3ABOA 4XAYA 3SO7A 2E6YA 2WQPA 5CPMA 4DJDD 1KD0A 1MI3A 3M0KA 4XZ9A 1CGUA 1E0UA 2INZA 3ID7A 4H8UA 4MTVA 4PTVA 3RX4A 3V4BA 2OCZA 4WGHA 4H9XA 4B9YA 5HBFA 4RKAA 2GQ3A 3IIZA 1GW1A 4PTWA 4WIWA 1MXGA 4H4IA 4NX5A 1MSSA 4U3AA 4A35A 4LH8A 2XGZA 3A47A 3CAKA 1XUUA 2BNJA 5FJUA 3CUJA 4NJKA 2VZUA 3GDLA 2FPYA 2QPXA 3WJSA 4DM1A 3VIIA 1BAGA 2NLIA 4JL1A 2GK1B 4LS2A 4F9JA 1VZWA 4GABA 1HT6A 3W37A 3B4YA 1J11A 3QGVA 1P0NA 2VOMA 2QJJA 2OO6A 5BWFA 3EKGA 4IMAA 2J66A 5CJMA 3LRLA 2HSAA 4CN6A 2EPHA 1O5KA 4C65A 2VFEA 3PZTA 4Z2GA 1UP0A 3HJEA 3LRKA 1TJRA 5KZ6A 1WPCA 5A2AA 3OVPA 3F4DA 2VKZG 4MDPA 2WK2A 4ACZB 2R1MA 3WH9A 1UW9A 2G3IA 4DEFA 5A8GA 4GI6A 5D9OA 3W76A 1PYFA 3UF9A 1E5JA 2GYIA 4KT2A 1UWIA 3C52A 5C70A 4MFDA 4NZ3A 1PCWA 3QY8A 3PZVA 5AHMA 4H41A 2WB5A 3FOKA 1I1WA 3HGRA 3WD0A 5K9XA 2DVUA 4Q4QA 2HBVA 2Z25A 5T26A 1CECA 4O4VA 4O12A 4HBKA 3FIGA 1BVNP 3S1WA 2Z24A 1AQ0A 2X2GA 3H6OA 4LUSA 1TJ1A 4AZCA 3M0YA 3S2MA 4DUVA 1CENA 2PP1A 4YMZA 1VYRA 3NQVA 3DERA 5DBTA 1G7UA 1RH9A 5CXPA 3D3FA 1VFOA 2ACQA 1CGWA 3IJ9A 3NG3A 1JFXA 3E2QA 2VFFA 3L65A 2JGYA 4GY1A 1PWLA 1B4EA 2QGHA 3C2VA 3NTYA 4UTWC 3KTCA 3SJ3A 2NX3A 3WJZA 5JH2A 3VFLA 2WHLA 3O6CA 3N9KA 3WQPA 4TMBA 1RCOB 3RYSA 2XYLA 1OADA 2YDRA 3F03K 4XAFA 3P80A 3N2CA 1AQMA 4IPPA 2Q8LA 4PMRA 4F8XA 4FIQA 4YVPA 5ENLA 2P10A 3FJLA 3S2NA 5GJMA 2W3ZA 3U2ZA 4FO4A 3CHDA 2O56A 4MM1A 5I3DA 1UKPA 3WQFA 1OBAA 1WBHA 4ZCWA 3G1DA 1CBGA 5MHBA 3BXWA 3LEPA 1LG1A 4NILA 2FPVA 2CLEA 5GJPA 4LRTA 3G1AA 1VKFA 3AU2A 3TOYA 4FNSA 5D05A 3TN3A 1FWDC 4FNUA 3ONBA 4H6RA 3ABRA 3NQMA 5EKYA 3SUWA 2REQA 5DT7A 3BAJA 4B5TA 3DC8A 3BGAA 3R12A 4MJ2A 2CBUA 4OV4A 3CASA 1S2TA 1V5XA 4ECLA 3L23A 2I1OA 4JIIX 4DXKA 5DLCA 1VHCA 3H53A 4AD2A 3APGA 3B97A 5HMDA 6ENLA 1OF8A 5AYZA 3VIOA 1TVLA 4YYFA 4M6QA 4ATDA 4JCLA 2Y63A 4OFCA 4ZQRA 4M6PA 3NUKA 1PXGA 2QJNA 3MTWA 5EMYA 1VYSX 3S5ZA 4HMEA 3HOJA 2ACRA 5B7ZA 2VZSA 2XGIA 1JZ6A 2PB1A 1AK5A 4QG6A 3VIMA 3F4CA 4AXKA 2BWGA 3R8HA 5C9XA 3WNNA 3S5OA 4JQ1A 1OT2A 6TAAA 4DUWA 2WPBA 1TWSA 4IPIA 2GSHA 4LCSA 4ZOCA 4YXGA 2JKPA 4Z2KA 4WXYA 4KCUA 5KETA 5LXEA 1UD8A 3M7SA 3OBKA 4WJXA 3BGJA 1XX1A 1E70M 4F0MA 3UWEA 4JTHA 3RPDA 4XK2A 2J7FA 3UGRA 4RDZA 3HQOA 1FWNA 4M5PA 2BY3A 1V4YA 3NIYA 1ISVA 1A4LA 3AYTA 2E68A 2W0UA 4IMGA 1EPXA 4JR5A 3UERA 1EWDA 2EG8A 4IGMA 3MSRA 2WOQA 1E1EA 3I7QA 4UXDA 4BA0A 3B8VA 2EPLX 4NUWA 1LDCA 2FTYA 3M0ZA 4K1WA 5M3WA 7REQB 1GYMA 1H0GA 1R3SA 1QI5A 3TKFA 4UZUA 3ARRA 1FWWA 4NJIA 2H90A 1HG3A 1V3JA 3TJIA 3I3BA 2IPJA 2RKXA 3QVQA 4P7OA 1H5VA 3MA8A 3DOPA 1Z3NA 4QG8A 4CU7A 1VEMA 3TWAA 2J62A 4K6AA 1EA0A 2B7OA 4HNNA 1KGWA 8TIMA 4RR4A 1OD0A 2QAFA 1E72M 2I7GA 1HL9A 2ZE0A 1H11A 2H3DA 4MPKA 3E02A 1WOBA 4MYXA 1TV2A 2ISVA 5FF4A 1V79A 1KM3A 1A5BA 4IP4A 1K4HA 2QCCA 5TAOA 5HQMA 3G3DA 2Z1SA 3LLDA 3AMKA 4AWUA 4DVOA 3UY7A 3CYJA 1V08A 5A1AA 1DIEA 3F5KA 1GVOA 5TD4A 4JHZA 2PDBA 2V3DA 3GVWA 3VNLA 4IGNA 2QCGA 5EFFA 3WG6A 2F7FA 3V0UA 2PTZA 4QE5A 5CH9A 2QCHA 3LXAA 4UOJA 5D2VA 3G2GA 3U6WA 4PMQA 4KCWA 1F6YA 4HGXA 4JFWA 4Y7EA 5BXRA 1DIKA 3ERPA 4J3ZA 1C8XA 4A8LA 1EJRC 2EHHA 2BASA 1XC6A 3A3HA 4AD4A 3M44A 4W86A 1IZCA 1Q85A 2INEA 2O9OA 2W63A 3LTPA 2BDQA 1RPKA 3GLCA 3DXIA 3W07A 4PMNA 4XZNX 4GY0A 4AHQA 1HJWA 4HMCA 1WE5A 4YTQA 4Q8TA 2J9YA 1IEVA 1BG4A 3GHRA 3IGUA 1JD7A 1HFBA 3NL5A 5DMLA 5LIYX 4PMXA 5I7GA 2VT0A 1HQTA 3N34A 4LFYA 4MAVA 1O12A 1QT1A 5HJLA 1ZY9A 4LS1A 1XLCA 3HV9A 3BV7A 5J04A 1YQ2A 2XIBA 3B03A 4GUHA 1XDLA 1VIZA 3MKCA 2R1LA 1YLVA 4JY9A 4N9EA 3WQDA 4TO8A 2FHCA 3CWHA 2P88A 2FB3A 4LJ3A 1OC5A 2YL6A 3LLFA 3CNYA 1GT8A 1PHQA 3ZJ6A 1W31A 1RY8A 1ITXA 4ZGYA 1UCWA 6A3HA 3N3MA 3WF2A 3UG5A 1RD6A 4GKTA 2ZZ6A 4M1RA 1S2UA 2ISSA 3M5XA 3SSJA 4I9TA 1OY0A 4DIAA 4RV3A 1O6IA 1C8QA 1FHUA 1ISXA 3EOOA 3VI2A 3GU9A 5IDZA 2OB3A 1TRDA 4FNPA 3EOEA 5HNTA 5IHRA 1ONRA 1JDCA 4H01A 3W01A 5BXSA 2HXTA 3OQEA 3CT2A 1G4SA 1G7VA 4JFTA 4NJHA 3UA4A 2J8FA 3DYMA 4AY7A 4ZXOA 2HRWA 3BAWA 2XN1A 2HTMA 4LUIA 4S39A 2QUUA 3BZGA 3W3OA 3SY1A 4MWAC 3S8HA 2QV4A 3CQIA 4B3LA 3N9SA 3E0IA 3SRFA 1ZCCA 3RLGA 1V03A 2OSXA 1MYRA 3CV2A 3EWZA 1D9EA 4CCCA 4ADUA 3MW7A 1L8NA 4FX6M 3MV11 3BAIA 4LUSB 5AHIA 1F9CA 3QLLA 4GVFA 4AZCB 3N15A 2GUYA 3AALA 2DT3A 4IX0A 1UZDA 1GQJA 4JTAA 3G1HA 3KP1A 1A3WA 1L8PA 1G4TA 4FLQA 2PSNA 4PFHA 5I3IA 4ZQOA 1IGSA 4WZHA 3C0SA 4M56A 1ECQA 1E15A 4W8BA 2Y5EA 1DQXA 2ZA1A 2VUNA 2VFIA 4GISA 1HO1A 1X98A 1TWZA 3F4WA 4LBRA 4B5WA 4CLMA 3L0GA 5M1TA 2D2GA 4JDBA 3WLOA 4RL3A 1ZJAA 2ZFAA 1SMDA 3AJXA 1PCKA 2VX7A 2JKEA 2ACUA 4S3DA 2P76A 1TV7A 2QEZA 1ZAJA 3RU6A 1A0DA 1OZMA 3MP3A 1KCZA 1BXNA 1W3KA 2BOEX 2XFFA 3SN0A 2Z28A 1KBIA 3ARVA 5HMFA 1EUNA 2OKOA 2V5JA 2ASHA 1O68A 5CAHA 3TAOA 3VNKA 4GXWA 1XIMA 5CZTA 3R0DA 1XIIA 3UNDA 2ISWA 1CXIA 1NFBA 3T78A 4KIEA 2REQB 5CJNA 3WBXA 1YYAA 2BTMA 2WNWA 4NXSA 3MZNA 1XCFA 3UWQA 2V9DA 1XH2A 1F6PA 3WH7A 3BG3A 4Z08A 5I2UA 1H7OA 2DSUA 1WDPA 5EPDA 1DWIM 3P8JA 1KFBA 3LHYA 4Q33A 1H7WA 4QBXA 3BSHA 3CM4A 2VJXA 5D9NA 2WKJA 3CGTA 3OO2A 1BKHA 4UQCA 3MHGA 5E5CA 3NCOA 1BRLA 2Y85A 5E70A 4GI9A 4IICA 4Z1AA 4P8XA 1GOOA 1E9IA 1JCYA 3HM7A 1AJ0A 5C5YA 1VBJA 4B5XA 3M7WA 3DUGA 4HMNA 5LXXA 4XISA 2PDLA 3G1YA 1V7AA 3UG8A 3NQ2A 3OIXA 2XM1A 1K70A 4H9VA 4AVNA 4MY1A 5HDRA 2D24A 3L9CA 5I07A 3GHUA 3PZGA 2E5BA 4LF2A 2R9RA 3Q4DA 1XBXA 1NQKA 5E6YA 4GA8A 1EEXA 4E3TA 1D7KA 1DPMA 4XTDA 1W32A 5CZSA 3BSMA 1EJ7L 2HE8A 1Q45A 2Z00A 4M6UA 1R3TA 3QR1A 4PMUA 2X0HA 2IXVA 3LNPA 4DBSA 1XLLA 2EGZA 3ABXA 2VFGA 3THDA 4DO7A 3UYCA 3BJFA 3EZ4A 3W71A 1QCWA 3KOWA 1EX1A 3N12A 4P61A 1LL7A 4HNOA 2VR4A 3I3EA 1UD6A 4DF0A 1MZHA 2A3CA 4OKDA 1H5YA 4HJWA 1T0OA 3THCA 3GM8A 3FSUA 4HU0A 3S1XA 3IJ7A 3CXOA 3E0FA 2IUZA 4AF0A 1K8YA 3E5BA 4UMAA 4F2BA 1XLMA 1XPYA 3LLXA 2DT1A 4CNTA 1Y5XA 3KUMA 4GGHA 4UR8A 3BLIA 3EX2A 2QZRA 4BHYA 3TN5A 3MSDA 1QO2A 1ZBWA 4UFIA 2OWXA 3BJTA 2V81A 4XUGA 1K7XA 1GVYA 4US5D 4CD7A 4Y9PA 3VK5A 1RQHA 3I3DA 5L9FA 3UA3A 3R0UA 2BV9A 1GEHA 1RBLA 1GQNA 2J78A 3WMSA 1I2RA 1DEDA 1DTNA 2DZUA 1HJXA 4TOQA 1EP1A 1TMHA 4O28A 3T2QA 1XLBA 3CMGA 2VHLA 4Q4PA 3V0SA 4B5VA 3HMCA 4PMDA 4PODA 2E1DA 4LC6A 1FOBA 1FKXA 2V5BA 3GQYA 1J2BA 1R3YA 4KEMA 3BAXA 3C5QA 4C6LA 2PDMA 2PD5A 3GU2A 3EMZA 3LTYA 4HHLA 1KFLA 3VGDA 2NUXA 2QUTA 5IHSA 4DNMA 1C8YA 4QNEA 5K3VA 1JDAA 3QV9A 2TMDA 4FP1A 1CLVA 4CQAA 4XBJA 4R34A 4WOQA 4GYJA 4WVXA 3QM3A 4PA8A 4TMCA 4FNTA 3AWOA 3IAPA 5BROA 1RBAA 4J27A 4YHGA 3T40A 3E49A 4CU8A 5F7UA 2A3HA 1Q5MA 3QHOA 4LYPA 2QJIA 1V93A 4AC1X 4GC3A 4BEUA 1LUCA 3NPXA 2ZWZA 1IZKA 2QMJA 4LF1A 4DJFD 1VEOA 3BLLA 3MCMA 3KCJA 3AXHA 1W1TA 5M17A 4DYEA 2WJFA 3TR2A 4DRSA 1RALA 1XM3A 4KF1A 3VZYA 3TJ4A 3UWVA 1JRBA 1DBTA 1JXJA 5C6MA 5KZEA 2OYMA 1H7RA 3AS1A 1LCOA 3KW3A 3IRSA 2KZHA 2POTA 2FGBA 3GXMA 4GYKA 1OGGA 1M53A 3S6OA 1ZAIA 5C9WA 4S3BA 4FXFA 3R6IA 3M0XA 5FI8A 2VC7A 4MB5A 4AWEA 1E6ZA 1FWJC 3LY0A 3EPOA 4DJDC 3WBYA 2G97A 1S2WA 1XBVA 3EDKA 3UR5A 4JHMA 4EX4A 1NVMA 5FACA 1DOSA 1TV4A 2P8BA 3VU2A 4LANA 1K8CA 1UROA 1IZJA 4AIBA 3B8UA 4WF7A 2NXHA 2PLKA 2RHGA 3CQKA 2Y6ZA 3UZJA 3AMCA 4QLJA 3UCCA 1JL8A 1LLZA 3UJRA 1QNRA 3WQ5A 1BFNA 3WK2A 4PUKA 4DHGA 3PJWA 3ZR6A 4BY3A 2PURA 3DG6A 3SCNA 3NZGA 1P43A 3CZEA 1HF6A 4OOUA 2QDHA 2V0TA 3KBNA 5K2ZA 4C6BA 3OTRA 2Q01A 4L6DA 1A5SA 3THUA 2NUYA 1W1IE 2XVGA 3P5YA 3BCDA 2H8ZA 2H9AA 1PAMA 3IUIA 3OG3A 5JBFA 2FIQA 3AU6A 2YCKX 4UWMA 1BTCA 1ICSA 4GZJA 1WDDA 2B7NA 1F76A 1GZ1A 2NX9A 3PFRA 3OA3A 3HPXA 1SMAA 1CXHA 4F0SA 3VGBA 1Z44A 1TJ2A 4JQAA 2ZX6A 4J2MA 4IPJA 3BW3A 1ADOA 1XDMA 2CXEA 3QFWA 4PBEA 1WKDA 2C7FA 3OB8A 3T09A 4DUXA 2J27A 3WNPA 1W1VA 3ZJ7A 3UESA 3LXBA 2INFA 5D09A 2DH3A 4IGSA 2DZPA 3IVUA 3IUHA 3UNTA 4AXNA 4LBUA 1KCLA 3BZJA 4FIRA 4LSBA 3I6TA 4LUYA 4C90A 1W3IA 4DXVA 3UR7A 1FWSA 3H7UA 2GDQA 4D6EA 2D3NA 4C6EA 5FAGA 4D6DA 3GFXA 1UR1A 4K36A 3A5FA 4E2VA 3WQ6A 4I8YA 3TMQA 3ANUA 1C7TA 3MUZ1 1IE7C 3FYYA 1EO7A 5A2CA 1CNVA 2Z4GA 2HXUA 1MFUA 3AXXA 2GQ8A 3HTWA 2QULA 3DBNA 2XN2A 3TU9A 4R3UA 1FH7A 1MO0A 3LCHA 4MZ1A 3H2NA 1MW3A 3KZSA 5J5DA 3PTMA 5H8PA 1GHSA 2XIJA 2WHMA 1N8WA 3AUJA 1BRLB 1T41A 2VZTA 4YPJA 1U30A 2DQXA 2QCDA 1IWAA 1QU4A 3FHQA 4JS3A 4WD0A 1JAEA 3G5EA 3C8FA 4XUYA 1E4MM 3AMGA 5HINA 2I9EA 1D8WA 1OSEA 2E40A 3VGGA 1KXTA 3S5NA 2Q3OA 4JTQA 4FZIA 1UWQA 4PZVA 4LVBA 4H8HA 4U4MA 3MO7A 2RDWA 4CEXC 1ZCOA 4K3ZA 4TU1A 1D3HA 1SPQA 3CYVA 3TNBA 3NOEA 3HN3A 2DVTA 4NI8A 5G4WA 3SSZA 3K46A 3VMNA 2J88A 3QR3A 4UTHA 5DY2A 4Q8OA 3VX1A 4MNKA 3PNUA 4Q7IA 4XZHA 5M03A 3QFEA 5F4XA 1WXZA 2AAAA 4C5ZA 1M7XA 4H8NA 3ITCA 4JL2A 1EZWA 4XTIA 3VX0A 2WVTA 3ATZA 4MYAA 2NQLA 3V5FA 4UCGA 4LCRA 1XCWA 3BLPX 5F4WA 5E1QA 5LKYA 3WDRA 4WLCA 4Q6JA 4OVXA 3WLIA 3NVDA 2YLLA 1SZEA 4WY0F 1ADDA 4B3KA 4AF0B 4BI6A 1G5AA 4MJZA 5A2BA 1LT8A 3LSBA 3GH5A 3EMCA 4FXJA 3UG4A 2PGFA 3WEOA 1PX8A 2AQOA 1RLCL 3IVTA 1KGUA 3PNZA 3LGDA 1X38A 3SGGA 4QM1A 4D1JA 1K9FA 3CV7A 4G5DA 2WMHA 1OFAA 2D22A 4UR7A 4GC4A 1HVQA 2PP3A 4M7TA 4GLEA 3SB0A 1XGDA 2WSYA 2ZZ5A 4JTFA 1CWYA 2X1SA 4Q4KA 3SCPA 3LN3A 1TPH1 4IJCA 4C60A 3BMXA 4B4HA 1GJPA 4HYVA 2WSKA 2C6QA 3W1LA 1EH9A 3E74A 3H7RA 2QPSA 5G1MA 3IVSA 3T0TA 4KRUA 1MW1A 1UZHA 3AS2A 4ZB0A 4AZGA 3C4UA 4HSHA 1JYWA 3DEQA 1Y0EA 1XRVA 3NPVA 5KZDA 5JBDA 4JFSA 3W1QA 3B8IA 4DZ5A 5AYYA 1V6YA 1KR1A 3NXLA 2EPKX 3GY1A 1QVBA 4FS9A 5FL0A 2J9XA 2O9RA 3K1GA 4QLKA 4EXAA 1VFSA 5CSSA 1M6JA 4F2UA 1K9TA 4WDWA 1RVKA 1R9XA 2YL8A 3K4DA 1WDWA 1M7JA 4QJ5B 2P8CA 2HEJA 1EA9C 1B31A 3EXSA 2G0WA 1TE6A 1H4PA 2RH9A 3QQ1A 2A6LA 2G41A 4GFIA 2NSXA 3TSDA 2Q09A 1LUCB 4X0NA 3MUIA 2OOGA 2FMOA 3PG8A 1S3TC 5EMJA 3F2CA 3WQCA 4GZIA 1M9HA 2Y8KA 1L6YA 4W8LA 3P8IA 4AVOA 1SFSA 4MWAE 3BW4A 3SI9A 3RR4A 3JRKA 3QF0A 2AGTA 4BQ3A 4FI4A 1GG0A 1IGWA 2FYMA 3N6JA 3EOUA 4ZO6A 2PDKA 4HHPA 1K1DA 1C92A 3C8NA 3MUY1 2WWDA 5EGRA 2CLIA 3WLHA 4IMDA 1T7LA 3EB2A 8XIMA 2QVHA 1V6WA 3RGTA 1DXIA 5BRQA 1DKWA 4C6QA 1QBAA 3ITVA 1KFEA 1E6XM 4DELA 1DHPA 4CD4A 1J4EA 5A6KA 2CBVA 4Q8QA 2Z1XA 2VQUA 1V3MA 5XINA 2Z1KA 3UY8A 1ECEA 4AZ7A 5A8QA 5EMUA 3URBA 4HHMA 2TRSA 2V2HA 4QCFA 2CETA 2WMKA 3QXBA 3UPBA 3KOFA 4PTMA 3ALGA 3B9DA 4GH3A 2ISFA 3K5XA 3LHTA 3GIQA 4FOUA 1CGYA 5FEWA 4YS1A 3W1RA 2FZ9A 4FK9A 1DQUA 5E0CA 1IF2A 3AIUA 3ISIX 5DCDA 2O9TA 4ZQPA 3QYSA 4D8LA 3W7NA 3WEMA 2D69A 2DIEA 1KCXA 2H9AB 4L6OA 5D04C 3BE7A 3TTQA 4W87A 2FHBA 1XIGA 2CBIA 2YDAA 2PTDA 3FLUA 3M0HA 3U2EA 3OVRA 1Z7AA 2V2CA 1Y5WA 1F8IA 5CBIA 1QNSA 1XIBA 1J0HA 4KFPA 2FLIA 3GXIA 4Z17A 5CLTA 4J9JA 3O1NA 3COTA 2Q8XA 3NL3A 1QHOA 4NZJA 2ZVIA 3VMPA 1E5NA 3CC1A 3W27A 1HJQA 1UR3M 3WMBA 2D2JA 4N6EA 1R3RA 4JIPA 4L7ZA 5AECA 2VFDA 1Z9AA 3KRSA 2V5KA 3EWCA 4ZEPA 3QV7A 3PP7A 2OWWA 1FCQA 2BGQA 3MCOA 5A6BA 3R13A 4I90A 2E7FA 3H2EA 3KRBA 1ELSA 4E4UA 1NJJA 3NURA 3W1MA 2PWEA 1RSCA 2VVNA 3NZ1A 2RGMA 4A21A 2NLYA 1V0MA 2XN0A 3QZ6A 1BTMA 3BOXA 4V28A 5DRCA 1KM4A 3WK0A 3OVQA 2XGBA 4LB3A 3W1PA 2VC9A 1NOWA 4H04A 2XSAA 4LOCA 1JGIA 5TNVA 3UU0A 3W72A 3N04A 5DXYA 1MNZA 4C6FA 3GBEA 3WBAA 1A5KC 1W1ZA 2R24A 2ZOXA 4S3GA 5U7SA 3D5HA 2DIJA 1GVIA 2QCDB 4BFAA 4GUFA 1BYBA 2WMFA 5LA2A 3VOIA 3QBUA 1FBAA 1UQYA 2OEKA 1GOXA 3WBWA 5A6AA 4QE1A 3M46A 1TTJA 2YL9A 1UUOA 3H2CA 1OCQA 1OC6A 3G77A 4YN5A 4K1GA 1XLJA 2GLKA 2PF8A 1Q6QA 3E6EA 4PTNA 1W3HA 1RQEA 2WSQA 5G1YA 3OOQA 2V69A 2A6NA 2QNEA 5FEZA 1IWPA 3INPA 3PWIA 1Q4NX 4S38A 4EPDC 1GORA 2Q71A 1TIWA 3UG3A 4IQEA 2HPMA 2B7QA 1JCXA 3ZYZA 4RCXA 1WKEA 3TC3A 2NWSA 1UA7A 3O0FA 1J12A 3DN5A 1XPGA 1JQVA 2IKHA 3LPFA 2DV0A 1G4EA 2OKTA 5BOOA 3RNDA 4PCTA 3WQOA 5SWUA 2C71A 2DIKA 5BWAA 2QVNA 2NVAA 1SVDA 2BG5A 3H4WA 4AY1A 4GO9A 3AISA 2FVLA 1XHGA 3ITXA 3QY7A 1FP8A 1OFEA 3N2TA 2ZUVA 1GOKA 3ITLA 3K4WA 1IT8A 2YPIA 1JIBA 3GTNA 2NUWA 4KWUA 3VDHA 3QTGA 1ZB5A 4WHBA 4O52A 3CK5A 4S3FA 4EPBC 3WD4A 2YB1A 2VC5A 3H8AA 3HGOA 2CZVA 4PTXA 2DU2A 3PS7A 3CJPA 4NKCA 2QJHA 1Z6KA 3M16A 3ES8A 2YKKA 3VNYA 2G4FA 4JQ3A 3WZ0E 4AG0A 1ZSXA 3WYZA 1FH9A 1EGMA 3PANA 1SU5A 1AZ2A 3T9PA 3PZNA 4K39A 2CLMA 1WOAA 4ICNA 1QUMA 4L65A 4DPPA 3W29A 1ONEA 2EAWA 3EWBX 4FB7A 4BI5A 4UTJA 1C91A 3HGJA 4FX7A 2PWHA 4FSAA 4ZTXA 1N2VA 1OFDA 1JCMP 4ACYA 4IZGA 5I3JA 4O10A 3F4NA 4PSPA 4EF9A 3DHDA 4YU1A 3V75A 4B15A 3TDFA 3N9RA 4HYRA 2TYSA 1QNPA 3HG3A 1GHRA 3GIPA 1A5LC 2BOFX 1G69A 1AQFA 5CPTA 1FFRA 3TX9A 5C2CA 1P5BA 3SEPA 4TV6A 4V27A 2HVMA 2FB2A 4MFEA 1GVRA 4HA1A 4UTUA 2TODA 2FZ8A 2PWFA 1DP0A 4KGLA 3CHVA 3I7SA 3S1VA 3HB9A 1XWYA 4GVHA 3BTNA 3NQCA 1JPHA 1UG6A 5D2WA 3QMTA 3FXYA 1JCLA 3S47A 1RVGA 4N0RA 2XUCA 1ENUA 2WJEA 4PMYA 5GNZA 4QAIA 1EUAA 3L2IA 1R46A 2ZA2A 2C1IA 3PFMA 5DQPA 3ZZ1A 4WGXA 2DSKA 4YWSA 1J6OA 4XD5A 4QSHA 1BSIA 4AW7A 5I02A 4FXSA 3WQ4A 3IJLA 4MKSA 1VCFA 3JS3A 3FV9A 1J6PA 3DFHA 2GUBA 4IQDA 4B5SA 1W2PA 4UTIA 4W85A 6TIMA 3SCTA 3CHEA 5JBEA 1TA3A 3KOYA 4L6HA 3W84A 3VGHA 1BXBA 3VDGA 2V30A 4MNJA 4MAZA 1VFFA 3ITTA 1GJUA 3NPUA 3USZA 3EDDA 2W6RA 3DFQA 1LBFA 1EYEA 3TW9A 4UCFA 1HJUA 1XLDA 1R30A 4KWVA 1ZQ5A 4OHQA 1BYCA 3GX9A 2B0MA 4FLRA 4XWUA 1BF2A 3U2CA 4QS5A 5JIWA 1YDOA 4PUNA 1LBLA 1NP2A 2ZADA 4OWGA 2DVXA 4I3GA 3NQBA 1P6BA 4X9SA 4I9JA 3WQVA 2D0HA 3G1SA 5ECUA 2R1KA 1PVNA 1H1NA 2QYGA 3STGA 3VC5A 4K68A 5C54A 3W70A 7ENLA 3SECA 1F3XA 3TSMA 2YA2A 1XRFA 4PMOA 1TE1A 3AXIA 5LNUA 3THAA 3G6LA 1SO3A 5HUOA 1KXHA 2IQTA 4JTTA 3ZMRA 1AZ1A 5FJOA 4LAZA 1OWQA 2HROA 2OSWA 4C1NA 4L61A 3KXQA 4TQTA 3MV01 4IJBA 4DJFC 4MUPA 1XSJA 3T8LA 3UXKA 2WC3A 3H2MA 3ZT6A 4Y6GA 1MW0A 3TYDA 1GTEA 3V1PA 2WV8A 1UB3A 1AD1A 1R9YA 3T4WA 1ODUA 5I78A 2GGIA 3W2MA 1KRAC 3STCA 1P0DA 2DUAA 1S5VA 2E67A 3UXDA 3S9YA 4GH1A 4A22A 2J7CA 4XZIA 3TVAA 1W8SA 2Z26A 1M5WA 3QC0A 3E0VA 1SZNA 1QK0A 3Q37A 4GRSA 1Q6FA 1DJNA 4I8DA 4L64A 2PMQA 1UR8A 1E6PA 4Y96A 5FSEC 3II1A 4HTYA 4OBRA 4GOAA 2NVCA 1V3IA 4P8VA 1RLDA 4HCLA 1DJHA 2Y4SA 3CB8A 1IR1A 3UCDA 3MDUA 1TQJA 4MVAA 4DO6A 3POCA 3GNDA 1KQZA 1MEIA 4JIHA 3K13A 4G1KA 1XXXA 3KBSA 1PEZA 1XGEA 2D2OA 1XSKA 3TP4A 2IKIA 3W28A 4AD1A 5AOUA 1CB7B 1QW8A 3TR9A 2F61A 5LGXA 4B90A 3G0UA 1EEPA 1FWRA 1AD4A 4WKFA 5JQ9A 1YMYA 3RIKA 1K03A 1EWEA 4GNJA 3W7MA 2BGSA 2AOSA 3S1UA 4UTFA 3B3DA 4C6PA 2WBKA 2BS9A 1I60A 5AC6A 3KVMA 3CEUA 3OBAA 4XV0A 3V35A 3B05A 4JTIA 3AXMA 4Q8UA 1KFWA 1WUEA 4R7JA 2D3LA 2WCAA 3BLFA 4XAZA 2A7NA 6REQA 3CQ0A 3L68A 1PWMA 1UZ1A 5FESA 3W38A 4IQJA 5T8GA 1VPXA 1XYFA 1TV8A 1I9CB 1F5ZA 1SJDA 3I10A 4WKAA 2CXGA 2Q3RA 4O8AA 3BOLA 1QI0A 4K8EA 1U5VA 2CLPA 2G96A 2Z2BA 5DFAA 4F2TA 2VZOA 2PTYA 3KTXA 4XVDA 5EBUA 1AUSL 1RA0A 3T55A 1GVEA 1HKMA 1TR1A 4NG3A 3PSVA 2QMKA 4E2DA 1BXCA 4M1BA 1Q4WA 2W67A 2VEMA 4IL0A 1QPRA 1ZNNA 2D23A 4GXPA 3W75A 5DEZA 1CGVA 3K2GA 4AYGA 3SRKA 3TAKA 4M3PA 1R0MA 5JVLA 1JF5A 5JUVA 5AY7A 3GZ3A 5E93A 2ZZ2A 4DWDA 4PUMA 4BF7A 1KWKA 2YZRA 3QGKC 2CU0A 3AFBA 2R82A 3CBWA 5HPOA 3BPWA 2YBVA 3SCVA 4GJ1A 5G2IA 4OE7A 4JTSA 3TE9A 4LVFA 3W83A 3ATYA 3SFKA 4XVEA 3WFAA 4Y9NA 3IANA 3SN4A 2ZZ3A 3MI3A 1H61A 4E5TA 1XLGA 5HPCA 1UJQA 3HPAA 1LQ0A 2O9PA 3SCUA 3IIOA 1UH2A 2XSXA 3TA6A 4LT9A 2P1FA 1M03A 1GZGA 1KBBA 3ABSA 2BP1A 4S2CA 3W7KA 3UXIA 1NM9A 2ZQ0A 3C2YA 5AHLA 5A8PA 2OEMA 1WDSA 4ZTYA 3ARSA 3TIMA 1MMFA 1Q6OA 3QHMA 4D6IA 2PDIA 3WLMA 2NW0A 1CB2A 1TPB1 3EX4A 1NAL1 3W7DA 5LGZA 1OGSA 3LUTA 4PB5A 1JCNA 4DM2A 3PVFA 2HE5A 2NT0A 4JN7A 2Z27A 5HNRA 2GVEA 3VA8A 1VIWA 3L4ZA 1A50A 1ADSA 4HSOA 1E71M 1LL4A 1W9VA 3W53A 1M01A 4Z2IA 2FVMA 1FY6A 4WQ6A 1JEZA 3OLIA 1F6KA 4ZXLA 5EMLA 2IKGA 2X1TA 3RRXA 4CNUA 3CUGA 3RAOA 1JZ8A 4UTMA 4HB7A 4AZIA 3W7RA 3GVQA 4FPSA 4Q8MA 3VGFA 1LL6A 4NP7A 3RFAA 2I16A 2PTXA 4JIRA 2CWXA 2OZ0A 1H7XA 3HFYA 4CGTA 1UC4A 2ZX7A 3M07A 4A2SA 3KL0A 4CN4A 3EWXA 1IEQA 4XZBA 3TWBA 4JYEA 1R38A 3ZLHA 4GQQA 1QNVA 4O18A 2ZX5A 2XIOA 3EGJA 1A5AA 4ZL1A 4J28A 1FCUA 1R3VA 2D20A 4ZFCA 4KS0A 5CGTA 1ITCA 4NVTA 3SAZA 5D9PA 1GK8A 1RD5A 1W9PA 4PSRA 3I4EA 4QISA 4Z1YA 4S3CA 5C2XA 2C79A 4XX6A 1SO5A 2BY1A 3NJ3A 4POCA 2DW7A 3E2SA 3S6TA 1E9LA 1HKKA 3PB0A 4HJFA 1X6LA 3FYOA 3DC0A 4W7VA 2ABBA 2WZMA 3VD7A 3AYRA 5CSYA 1TA3B 2WNQA 2Z2UA 1OCNA 3GXFA 3WLTA 1UUMA 1F3TA 4R5EA 2CHRA 5C2GA 4ROQA 4AEFA 5HANA 1BGAA 3UPMA 2VWTA 2TAAA 2V8ZA 4GYPC 3ZIZA 2JF6A 5H8UA 4QROA 1FDJA 4GIEA 3GO2A 4UB9A 5FKYA 3KOXA 3HJZA 3VNZA 5D2YA 2YBTA 3TZFA 3IGHX 3LA4A 3CAWA 4LXFA 4QHRA 4WDXA 3BARA 1Q7QA 3UJSA 3C2RA 3DU0A 2ZTJA 4KRZA 4QRNA 1SFJA 3AJ7A 1NWRA 3ZT7A 1MEWA 5LIUX 4DBEA 3AOFA 2WNZA 2HQAA 4CEUC 4GPNA 1NIUA 3LZ5A 5J8LA 1Q7ZA 4C1NB 2E8ZA 3EWWA 3QKEA 3WLPA 4AAJA 1YDYA 4U5IA 2VGGA 4ONVA 4O57A 1H50A 2WMJA 1O4UA 2ZBTA 4JICA 4GX9A 4ZQMA 3EWUA 4UMBA 2V67A 1Q7MA 3L0KA 1YRRA 1VCVA 1J8VA 1RY0A 4DN1A 2J25A 4IFRA 3ZQ9A 2YYUA 3WQEA 5E0FA 4HA4A 5ABHA 5JH1A 3EEGA 1TSIA 3KM8A 1JG9A 4QGCA 3PJXA 5IM51 2Z6IA 1A49A 3QYQA 4H3DA 4KETA 3SQLA 5KTLA 2WCGA 3BJSA 1C90A 1J0IA 3S5SA 2QPUA 3VOJA 4UTLA 3C2EA 3C0JA 2VGIA 3AAMA 1XIFA 1Y8BA 4X61A 2XH7A 3WCZA 4A3RA 4C6MA 2PDQA 1P7TA 3MUCA 3W1NA 1QNQA 1S5TA 2QCEA 2ONEA 3EB4A 1RJPA 1BWLA 4R27A 5BZAA 4JAWA 1W1B1 5CKSA 3P93A 1JI1A 2W4XA 4HOWA 1FFQA 5FJRA 4MNLA 3H55A 2UV8G 4N9CA 3QGAC 1TYGA 1XGZA 5G4EA 5FD0A 2PCEA 1VRDA 3S9IA 4UQAA 1C9DA 2X05A 4RW3A 1J2WA 3GNRA 4F0KA 4CNPA 5A94A 4I5RA 4M19A 4HPGA 4X22A 3SCSA 4ZVJA 3NQ8A 1X6NA 1PZ1A 1PDZA 1JVNA 4MADA 4C6KA 1R7OA 3UETA 4J7RA 2X0YA 4MY8A 3DFNA 1A5CA 3TQPA 1YPFA 1I1XA 1DJYA 1W1YA 3U48A 1OFOA 1K3UA 5ABEA 2V5DA 2JFEX 1REQA 1UPPA 3WNOA 6REQB 3QKZA 5A5WA 4IP7A 1FWFC 2YXXA 3VKBA 4JXCA 1JRCA 3NO5A 2WXDM 4A4AA 2Y8UA 3W24A 4Q8VA 4O8RA 3NWRA 1O66A 2RAGA 4P5UA 2A85A 1JZ7A 3P67A 3AZSA 2VX6A 1AW2A 2YA0A 1WBJA 3L66A 3WN6A 1UP2A 5G4HC 1EDGA 1JUBA 2A2IA 5AYXA 3GG8A 3VKAA 2R1NA 3C3UA 2QDEA 3MMTA 3EWDA 2OX4A 5E0KA 1HW6A 1RAKA 2CLHA 3L4TA 1VAHA 2R94A 3N4EA 3T81A 3VD3A 3ANVA 2PCQA 3MSGA 3VDBA 2GGHA 1MFVA 2WSRA 1EO5A 1QXLA 5DRIA 4CN1A 3GAKA 2XFWA 3DDMA 1GWJA 4J4KA 3E9AA 1EGZA 1MVYA 1QBBA 2E6FA 1J0ZA 2OELA 3STEA 3B8TA 4ZODA 2DZBA 2CNCA 4OECA 2WPGA 1SW7A 5GNXA 5BRBA 2XVPA 4R85A 7PTDA 3FHAA 3SIZA 1GGOA 5BOEA 2VD8A 2GSJA 1AJ2A 3ARWA 3BC9A 3ZWSA 2XISA 6PTDA 4H6EA 4DQWA 1ZBCA 3KX6A 3UZWA 1N82A 1UKTA 1VJZA 3W86A 4QLLA 3OZOA 4XKMA 4DNHA 5CAKA 3VXGA 3L4VA 1TX0A 4FOKA 3TQKA 4E8DA 4KBXA 1AVAA 4Q8PA 4PEKA 3T08A 4XBKA 5LSMA 1W9XA 3G8EA 4JN8A 3SRHA 3EBVA 3WLJA 1CT5A 4Z2JA 4N9DA 1A3XA 5CC3A 5A69A 4H2CA 3GVRA 4EWND 4DWSA 1GZJA 3ABQA 7XIMA 1IEXA 5I79A 3PBMA 4IX2A 3WDIA 2VRQA 3DCPA 2BY2A 1IT0A 1CXFA 3K30A 1ME7A 3DHFA 3TYUA 3D47A 2FMNA 3GRIA 4GYFA 2HJPA 1BSLA 4RJEA 3DKJA 2HZGA 1B3YA 1PKMA 1OJXA 4I5UA 4O11A 1A0CA 4JPGA 4JNYA 3J7HA 3WD2A 2EPOA 3PK7A 5C7HA 5TBOA 2QJGA 1OX4A 2QW5A 2CZEA 4WRHA 1MQQA 1G94A 1LZOA 2D73A 4LVDA 4MJMA 4LAMA 3LD5A 2YR1A 3CZKA 4WSJA 1BG9A 1NARA 4NYUA 3OZPA 3RR1A 4P7LA 1V8EA 2BZNA 3E38A 2F38A 3LDVA 3B9AA 3CH0A 3Q2DA 4JIEA 2OGYA 4JYDA 1F2JA 2DZAA 1KXVA 2DT0A 1XF0A 2PAJA 3OIHA 4YCOA 3K1DA 3QOMA 4J3TA 3MI2A 3THQA 1MWOA 3BURA 3USBA 1EJSC 2C16A 3QRHA 4LV9A 1NOUA 2RGLA 2YDSA 5FF0A 2DPEA 4B4FA 2VURA 5CSUA 1G6CA 4X2RA 1QDSA 5CC6A 1VHNA 3LV5A 3WNMA 2DZXA 4RDYA 4AVFA 1YIXA 2H6RA 1I45A 1F4HA 5CG0A 5EU9A 1OX6A 3L5MA 2V68A 2AQVA 4GIRA 3HGSA 2SFPA 4D2JA 3BMWA 1XFBA 5FJTA 4JX5A 1UOKA 2ZTKA 4E4PA 3QOKA 3SW6A 1V6TA 1KFCA 3PBGA 4I5XA 2F6KA 1W2VA 3VUSA 1DHKA 2PODA 3CZ8A 4UFKA 2VM8A 3R8GA 4OQVA 2YCJA 4BF5A 1WP6A 2Z1WA 5EL1A 5AC8A 2CKSA 3A64A 3GDTA 1PPIA 4D71A 3VE9A 1FHLA 4GCXA 1XD1A 3WENA 3CO8A 2RDTA 3PTQA 1VJIA 2BVTA 3WH8A 3P81A 4UOQA 3EXRA 4QQ3A 1XQLA 2TPSA 2PE4A 3VM5A 1S5MA 5BNKA 1N55A 2V63A 1NDVA 1YADA 4LVGA 2HBXA 1AL7A 1XUZA 3FJ4A 4FOJA 4N9BA 1GPFA 1ITUA 1BWKA 1R3WA 1UBPC 1RR2A 4XQ6A 4CNSA 5I77A 2Y7EA 5C71A 2OLSA 2BLEA 3JUGA 1BHGA 4A8NA 3BLOA 4NZCA 2FTWA 3NR0A 1E73M 3RM4A 1TTIA 3FA4A 4PBFA 4QJ4B 4QITA 2UY3A 5ABFA 4PUUA 4U31A 3A3XA 1LTDA 1I2PA 5HNUA 3W7EA 1OFQA 3MYOA 3E5PA 4ENLA 1YTEA 5T9CE 1OIMA 3KOZA 1HP5A 4QE4A 2Q02A 4OGZA 1JCJA 3ECQA 1P7TB 1FWEC 3CL6A 4GK8A 3U5YA 1S2CA 5M5DA 1LP6A 2QIIA 1TUXA 3DZ1A 1R6WA 1AQHA 4V1XA 4TVCA 1XYCA 2PBGA 3URNA 3N18A 4ML9A 2J24A 3M0IA 1AL8A 1E4IA 3FY1A 5LA1A 3HG2A 1PKNA 1P1XA 5H91A 1J93A 4MNMA 1E0XA 4HPNA 3NYDA 4I9AA 5IBXA 3TNOA 2VDIA 4J2PA 4PCPA 3LHVA 1ME9A 3KRUA 1LOSA 3RO8A 1T6MA 1AMKA 1GQLA 4GFSA 1V0LA 3UD6A 3W7JA 3E0WA 4MKVA 3PZIA 2RDXA 1UYQA 2W9MA 4GBDA 3W1AA 4IM4A 3BAYA 5EBAA 3ARXA 2I14A 4LY4A 3EYPA 2EF9A 1TTPA 4V33A 3ELFA 2VD9A 2QS8A 3RDKA 2ZZ4A 3NEHA 3B0VC 3FGCB 3W82A 1VYPX 3PJUA 3T2OA 3S0CA 3KLLA 2UY5A 2WC4A 4QJ3B 3W7HA 2YA1A 4L4PA 2PUZA 1GOQA 4PCNA 3HMJG 3HPFA 3RM9A 2DORA 3LCFA 3W6LA 2NQ5A 2PZ0A 3H4XA 4MZYA 4CD8A 3MKKA 1B57A 1HGWA 2ZZ1A 1LG2A 1REQB 3L4YA 1EXPA 1A5MC 1NU5A 4QQUA 4Q4MA 3QZEA 3G6MA 1R7AA 1E43A 4ZOEA 3WH6A 4Y9OA 1A0EA 1A5UA 2GUUA 2PGEA 3F2DA 3M43A 1UR4A 4Q32A 3DGRA 4YWIA 4J3XA 1Z41A 3WDQA 4YHEA 1B3OA 4MB4A 4PRTA 3FEQA 1YW1A 1ZUAX 2I5IA 1B90A 3GVVA 2GPTA 3G24A 1HKIA 3MI6A 3R5EA 3SIMA 2H3BA 3G18A 4GO8A 3EEZA 4KEUA 2GGEA 1SW3A 3UR2A 1BEUA 1I6NA 2X7WA 4XZLX 3ZO9A 3VC6A 3S1GA 4BR1A 3H21A 3KHJA 3TN4A 3M1ZA 4DXXA 3CO4A 5D03A 2DJLA 3VVGA 2WMGA 1NH6A 1V02A 4LB4A 4TTUA 4YTRA 1WQ5A 3B0YA 3B04A 4CNNA 3E2VA 3BLEA 2QUMA 2Y70A 3H2AA 3C0LA 4IIEA 3CUZA 3QH2A 4L9YA 3BUVA 2NQZA 3RMJA 3C2FA 5BOFA 2QCLA 3T0BA 1E1FA 1GPWA 1WUFA 3UZZA 4J35A 5CC5A 3XIMA 1JF6A 2CIPA 4JDYA 2ZVRA 1QWKA 4PGLA 3OG2A 2ZRWA 1O5QA 4DZIA 3AHZA 1PDYA 2YX0A 1B30A 2Q8ZA 4PH6A 1FX6A 4LALA 3KP0A 4OUIA 3EDJA 3O15A 8A3HA 4LYKA 4XG1A 4ZQCA 1ZZMA 1X39A 4FF7A 2XZ7A 1LORA 1G01A 2A79A 1J79A 1W17A 2CLKA 1U2YA 4BI7A 1UPMB 4KKXA 4FALA 1EBHA 3LM7A 1F74A 4O1AA 1V77A 1DXEA 4AHOA 3FJ6A 5TQLA 2E5DA 1WKYA 3VOFA 2HS6A 1Q2RA 1DQWA 4K7VA 5E9XA 3RRAA 2XM2A 2QXWA 1KC7A 2YXOA 3I68A 4H7VA 2GDUA 4EPEC 3Q67A 2PF0A 2V5CA 4V2XA 2MNRA 1OX4B 3IJQA 1EQPA 5HAOA 5HOSA 3ARQA 1EB3A 2D0FA 3BWWA 3DYOA 1EOMA 2GGGA 3MC5A 1ZBVA 3GXTA 2YSWA 4W9TA 4M29A 2PWDA 5FIPA 1PSCA 4URIA 4V1YA 4Z0JA 1UJPA 5DELA 4A3QA 2VI0A 2OZTA 1SYTA 3DFPA 1W8GA 1K77A 3IS4A 3LNMA 3M0MA 3IV8A 2VELA 1EDQA 3YPIA 2F2KA 3GS6A 1HKVA 3ARUA 4C1KA 2FDSA 4EANA 3GXDA 4G56A 1R2TA 4GINA 3M6DA 4EF8A 1OG6A 3T0AA 1Q8AA 1FWIC 4LNYA 2CEQA 3DFSA 2CITA 3N19B 2O4QA 5A6LA 4NNBA 4INFA 4AWSA 4AD3A 4WSKA 3PBUA 1VR6A 3L7RA 3VKCA 2A3EA 3MJMA 3QZAA 3ZVHA 5FA5A 3PZQA 3MB9A 4KW2A 1CDGA 4G7EA 2JIEA 2A7RA 3KE0A 4IISA 2AL2A 4CD6A 3H26A 5KINA 4CCDA 2JIWA 4XD3A 4L4OA 4REQA 1PJ9A 1XICA 1RJQA 4JTCA 1VS1A 2Y61A 3GD6A 2PU1A 1PTDA 3HPZA 4ZO7A 4GQ0A 3PG9A 1M7PA 3NL6A 3VOCA 3ZSTA 1OFRA 1UC5A 1IXPA 4JQ4A