3N3FA

Crystal structure of the human collagen xv trimerization domain: a potent trimerizing unit common to multiplexin collagens
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
54
structure length
54
Chain Sequence
NLVTAFSNMDDMLQKAHLVIEGTFIYLRDSTEFFIRVRDGWKKLQLGELIPIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagen alpha-1(XV) chain
publication title Crystal structure of the human collagen XV trimerization domain: A potent trimerizing unit common to multiplexin collagens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.50 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3n3fA01
3HONA 3HSHA 3N3FA
chains in the Genus database with same CATH superfamily
1CK7A 2Y2HA 4IBDA 4MB5A 4OJ5A 3M7PA 2Y2QA 3L27A 3N3FA 1J7MA 4IBJA 1GOIA 2Y2KA 4OJ6A 4IBFA 4IJEA 4IBEA 1W1YA 2Y2PA 5BPVA 1YU1A 4OJLA 1UR8A 2D49A 4GHLA 4OJOA 2FFFB 4TX8A 1AIWA 4IJFA 2UWXA 1W1VA 4GH9A 4Z2GA 4NYYA 2BG1A 3KS8A 1YUEA 1EAKA 2Y2NA 4NY2A 2Y2MA 1E6ZA 2RTSA 1O6IA 3WX7A 2Y2IA 4QNLA 4MB4A 3L25A 2IOUA 4HMDA 4NZ1A 1E6PA 1W1PA 1GXDA 1GPFA 4LG2A 1UR9A 4MB3A 1ED7A 3L28A 1YU3A 4IBCA 4NYUA 4HMEA 4IBIA 1OGGA 3HSHA 1E8BA 2XD1A 1H0GA 2FN2A 1QO6A 3HONA 1H0IA 1E15A 2JCHA 3FKEA 3WD1A 2Y2JA 1W1TA 1PDCA 4Z2IA 4IBKA 1OGBA 3MQLA 4NZ3A 1CXWA 2XD5A 3WD0A 3WD4A 1YU0A 2JE5A 4HMCA 4NZ5A 1H8PA 2Y2GA 3L29A 1YU2A 1E6NA 3L2AA 3KS4A 4Z2LA 1KS0A 4Z2KA 4IBBA 2Y2OA 4OUIA 4Z2JA 4OJPA 1E6RA 3L26A 2V5OA 4IBGA 1YU4A 3WD3A 1E88A 1L6JA 4NZ4A 3WD2A 2Y2LA 4Z2HA 4GHAA
chains in the Genus database with same CATH topology
4IJFA 4LG2A 2UWXA 2Y2HA 4NZ3A 4IBDA 2XD5A 4GH9A 4GHAA 4OJ5A 2JE5A 1YU0A 3L28A 1YU3A 2Y2QA 3L27A 3N3FA 4IBCA 4NYUA 4NYYA 4IBJA 2BG1A 4NZ5A 3KS8A 1YUEA 3HSHA 4IBIA 2Y2NA 2XD1A 2Y2KA 2Y2GA 4OJ6A 4NY2A 4IBFA 2Y2MA 4IJEA 3L29A 1YU2A 4IBEA 3L2AA 3KS4A 3HONA 2Y2PA 4IBBA 3WX7A 5BPVA 2Y2OA 4OUIA 1YU1A 4OJPA 2Y2IA 4OJLA 2JCHA 4QNLA 3FKEA 3L26A 3L25A 2Y2JA 2IOUA 4IBGA 4NZ1A 4GHLA 1YU4A 4OJOA 2FFFB 4NZ4A 2Y2LA 4IBKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HON A;  3HSH A;  3N3F A; 
#chains in the Genus database with same CATH topology
 1CK7 A;  2Y2H A;  4IBD A;  4MB5 A;  4OJ5 A;  3M7P A;  2Y2Q A;  3L27 A;  3N3F A;  1J7M A;  4IBJ A;  1GOI A;  2Y2K A;  4OJ6 A;  4IBF A;  4IJE A;  4IBE A;  1W1Y A;  2Y2P A;  5BPV A;  1YU1 A;  4OJL A;  1UR8 A;  2D49 A;  4GHL A;  4OJO A;  2FFF B;  4TX8 A;  1AIW A;  4IJF A;  2UWX A;  1W1V A;  4GH9 A;  4Z2G A;  4NYY A;  2BG1 A;  3KS8 A;  1YUE A;  1EAK A;  2Y2N A;  4NY2 A;  2Y2M A;  1E6Z A;  2RTS A;  1O6I A;  3WX7 A;  2Y2I A;  4QNL A;  4MB4 A;  3L25 A;  2IOU A;  4HMD A;  4NZ1 A;  1E6P A;  1W1P A;  1GXD A;  1GPF A;  4LG2 A;  1UR9 A;  4MB3 A;  1ED7 A;  3L28 A;  1YU3 A;  4IBC A;  4NYU A;  4HME A;  4IBI A;  1OGG A;  3HSH A;  1E8B A;  2XD1 A;  1H0G A;  2FN2 A;  1QO6 A;  3HON A;  1H0I A;  1E15 A;  2JCH A;  3FKE A;  3WD1 A;  2Y2J A;  1W1T A;  1PDC A;  4Z2I A;  4IBK A;  1OGB A;  3MQL A;  4NZ3 A;  1CXW A;  2XD5 A;  3WD0 A;  3WD4 A;  1YU0 A;  2JE5 A;  4HMC A;  4NZ5 A;  1H8P A;  2Y2G A;  3L29 A;  1YU2 A;  1E6N A;  3L2A A;  3KS4 A;  4Z2L A;  1KS0 A;  4Z2K A;  4IBB A;  2Y2O A;  4OUI A;  4Z2J A;  4OJP A;  1E6R A;  3L26 A;  2V5O A;  4IBG A;  1YU4 A;  3WD3 A;  1E88 A;  1L6J A;  4NZ4 A;  3WD2 A;  2Y2L A;  4Z2H A;  4GHA A; 
#chains in the Genus database with same CATH homology
 4IJF A;  4LG2 A;  2UWX A;  2Y2H A;  4NZ3 A;  4IBD A;  2XD5 A;  4GH9 A;  4GHA A;  4OJ5 A;  2JE5 A;  1YU0 A;  3L28 A;  1YU3 A;  2Y2Q A;  3L27 A;  3N3F A;  4IBC A;  4NYU A;  4NYY A;  4IBJ A;  2BG1 A;  4NZ5 A;  3KS8 A;  1YUE A;  3HSH A;  4IBI A;  2Y2N A;  2XD1 A;  2Y2K A;  2Y2G A;  4OJ6 A;  4NY2 A;  4IBF A;  2Y2M A;  4IJE A;  3L29 A;  1YU2 A;  4IBE A;  3L2A A;  3KS4 A;  3HON A;  2Y2P A;  4IBB A;  3WX7 A;  5BPV A;  2Y2O A;  4OUI A;  1YU1 A;  4OJP A;  2Y2I A;  4OJL A;  2JCH A;  4QNL A;  3FKE A;  3L26 A;  3L25 A;  2Y2J A;  2IOU A;  4IBG A;  4NZ1 A;  4GHL A;  1YU4 A;  4OJO A;  2FFF B;  4NZ4 A;  2Y2L A;  4IBK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...