3N3FA

Crystal structure of the human collagen xv trimerization domain: a potent trimerizing unit common to multiplexin collagens
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
54
structure length
54
Chain Sequence
NLVTAFSNMDDMLQKAHLVIEGTFIYLRDSTEFFIRVRDGWKKLQLGELIPIPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human collagen XV trimerization domain: A potent trimerizing unit common to multiplexin collagens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Collagen alpha-1(XV) chain
total genus 9
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.50 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3n3fA01
3N3FA 3HSHA 3HONA
chains in the Genus database with same CATH superfamily
4IBDA 4LG2A 1CXWA 2V5OA 3WD2A 4Z2HA 3L27A 2FN2A 3L25A 4NZ5A 4QNLA 1O6IA 4TX8A 4NZ3A 4HMCA 4NZ1A 2XD5A 3WD4A 1OGGA 1CK7A 1H0GA 1E15A 4NZ4A 1AIWA 3WD0A 1YUEA 4IJFA 2IOUA 2Y2KA 2JCHA 1W1TA 4GHAA 2Y2IA 3L28A 3MQLA 4Z2JA 4OJ6A 4Z2IA 1E8BA 2RTSA 2Y2QA 4IBEA 4OJOA 3L2AA 4IBGA 3HSHA 1UR8A 1W1VA 4IBIA 1GXDA 4Z2GA 4OJ5A 2Y2JA 1E6RA 1H0IA 4IBFA 4GH9A 3KS4A 5BPVA 2XD1A 3FKEA 2D49A 2JE5A 4IBBA 2Y2NA 4IBJA 4NYUA 2Y2HA 2Y2GA 1KS0A 4MB3A 4HMEA 4HMDA 3M7PA 4GHLA 3HONA 1W1YA 1EAKA 2BG1A 3N3FA 4IBKA 4MB5A 1E6NA 1ED7A 1H8PA 1YU1A 1GOIA 4NYYA 1QO6A 4OUIA 1YU3A 1YU4A 1L6JA 1YU0A 1E6PA 4IBCA 4Z2LA 3WD3A 2Y2LA 1OGBA 2Y2MA 1GPFA 3L26A 2Y2OA 1YU2A 4Z2KA 4IJEA 1E88A 2FFFB 4MB4A 4NY2A 2Y2PA 3L29A 3WX7A 4OJLA 1E6ZA 1J7MA 4OJPA 3KS8A 1W1PA 1PDCA 1UR9A 3WD1A 2UWXA
chains in the Genus database with same CATH topology
4IBDA 1YUEA 4IJFA 4LG2A 2IOUA 2Y2LA 4NZ3A 4GHLA 2Y2KA 3HONA 2JCHA 2Y2MA 3L27A 4GHAA 3L26A 2Y2IA 3L28A 4NZ5A 3L25A 2Y2OA 2BG1A 1YU2A 4OJ6A 3N3FA 4IBKA 4QNLA 2Y2QA 4IBEA 4IJEA 3L2AA 4OJOA 2FFFB 4NZ1A 4IBGA 3HSHA 2XD5A 1YU1A 4IBIA 2Y2PA 3L29A 4NY2A 3WX7A 4NYYA 4OJ5A 2Y2JA 4OUIA 1YU3A 1YU4A 4IBFA 4OJLA 4OJPA 4GH9A 3KS4A 3KS8A 5BPVA 1YU0A 2XD1A 3FKEA 4NZ4A 4IBBA 2JE5A 4IBJA 2Y2NA 2UWXA 4NYUA 4IBCA 2Y2HA 2Y2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3F A;  3HSH A;  3HON A; 
#chains in the Genus database with same CATH topology
 4IBD A;  4LG2 A;  1CXW A;  2V5O A;  3WD2 A;  4Z2H A;  3L27 A;  2FN2 A;  3L25 A;  4NZ5 A;  4QNL A;  1O6I A;  4TX8 A;  4NZ3 A;  4HMC A;  4NZ1 A;  2XD5 A;  3WD4 A;  1OGG A;  1CK7 A;  1H0G A;  1E15 A;  4NZ4 A;  1AIW A;  3WD0 A;  1YUE A;  4IJF A;  2IOU A;  2Y2K A;  2JCH A;  1W1T A;  4GHA A;  2Y2I A;  3L28 A;  3MQL A;  4Z2J A;  4OJ6 A;  4Z2I A;  1E8B A;  2RTS A;  2Y2Q A;  4IBE A;  4OJO A;  3L2A A;  4IBG A;  3HSH A;  1UR8 A;  1W1V A;  4IBI A;  1GXD A;  4Z2G A;  4OJ5 A;  2Y2J A;  1E6R A;  1H0I A;  4IBF A;  4GH9 A;  3KS4 A;  5BPV A;  2XD1 A;  3FKE A;  2D49 A;  2JE5 A;  4IBB A;  2Y2N A;  4IBJ A;  4NYU A;  2Y2H A;  2Y2G A;  1KS0 A;  4MB3 A;  4HME A;  4HMD A;  3M7P A;  4GHL A;  3HON A;  1W1Y A;  1EAK A;  2BG1 A;  3N3F A;  4IBK A;  4MB5 A;  1E6N A;  1ED7 A;  1H8P A;  1YU1 A;  1GOI A;  4NYY A;  1QO6 A;  4OUI A;  1YU3 A;  1YU4 A;  1L6J A;  1YU0 A;  1E6P A;  4IBC A;  4Z2L A;  3WD3 A;  2Y2L A;  1OGB A;  2Y2M A;  1GPF A;  3L26 A;  2Y2O A;  1YU2 A;  4Z2K A;  4IJE A;  1E88 A;  2FFF B;  4MB4 A;  4NY2 A;  2Y2P A;  3L29 A;  3WX7 A;  4OJL A;  1E6Z A;  1J7M A;  4OJP A;  3KS8 A;  1W1P A;  1PDC A;  1UR9 A;  3WD1 A;  2UWX A; 
#chains in the Genus database with same CATH homology
 4IBD A;  1YUE A;  4IJF A;  4LG2 A;  2IOU A;  2Y2L A;  4NZ3 A;  4GHL A;  2Y2K A;  3HON A;  2JCH A;  2Y2M A;  3L27 A;  4GHA A;  3L26 A;  2Y2I A;  3L28 A;  4NZ5 A;  3L25 A;  2Y2O A;  2BG1 A;  1YU2 A;  4OJ6 A;  3N3F A;  4IBK A;  4QNL A;  2Y2Q A;  4IBE A;  4IJE A;  3L2A A;  4OJO A;  2FFF B;  4NZ1 A;  4IBG A;  3HSH A;  2XD5 A;  1YU1 A;  4IBI A;  2Y2P A;  3L29 A;  4NY2 A;  3WX7 A;  4NYY A;  4OJ5 A;  2Y2J A;  4OUI A;  1YU3 A;  1YU4 A;  4IBF A;  4OJL A;  4OJP A;  4GH9 A;  3KS4 A;  3KS8 A;  5BPV A;  1YU0 A;  2XD1 A;  3FKE A;  4NZ4 A;  4IBB A;  2JE5 A;  4IBJ A;  2Y2N A;  2UWX A;  4NYU A;  4IBC A;  2Y2H A;  2Y2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...