3N3FA

Crystal structure of the human collagen xv trimerization domain: a potent trimerizing unit common to multiplexin collagens
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
54
structure length
54
Chain Sequence
b'NLVTAFSNMDDMLQKAHLVIEGTFIYLRDSTEFFIRVRDGWKKLQLGELIPIPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Collagen alpha-1(XV) chain
publication title Crystal structure of the human collagen XV trimerization domain: A potent trimerizing unit common to multiplexin collagens.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.10.50 Mainly Beta Ribbon Seminal Fluid Protein PDC-109 (Domain B) Seminal Fluid Protein PDC-109 (Domain B) 3n3fA01
3HSHA 3N3FA 3HONA
chains in the Genus database with same CATH superfamily
2XD1A 1H8PA 3L25A 3L29A 3HSHA 3WD4A 3MQLA 1OGGA 4Z2KA 4NZ3A 3KS8A 1UR8A 4IBCA 1E6PA 1E8BA 1YU1A 1YU0A 4IJEA 4IBDA 3WD1A 3FKEA 4Z2HA 3WX7A 3L26A 2BG1A 3L2AA 4IBJA 3M7PA 2JE5A 1GOIA 1OGBA 1GXDA 4HMDA 2UWXA 1ED7A 1L6JA 2JCHA 1E88A 1E6RA 4IBBA 2FFFB 1YU2A 1E6NA 4IJFA 3HONA 2XD5A 4TX8A 4Z2JA 4OJ6A 2D49A 2Y2IA 2Y2LA 4NZ4A 4IBKA 1W1PA 3KS4A 2RTSA 4OJLA 4IBEA 2V5OA 2Y2QA 4MB3A 2Y2MA 3L27A 5BPVA 1QO6A 4GHLA 1J7MA 1AIWA 4HMEA 1YUEA 1H0GA 4IBFA 1YU3A 3WD3A 2Y2OA 2Y2PA 4GHAA 3WD0A 4OJPA 4MB5A 4LG2A 4MB4A 4Z2IA 1GPFA 4NY2A 4OJOA 1CXWA 4GH9A 2FN2A 4OUIA 4IBGA 1E15A 1O6IA 4NYYA 1UR9A 3WD2A 4QNLA 1PDCA 4Z2GA 4Z2LA 1CK7A 2IOUA 2Y2JA 1YU4A 2Y2HA 2Y2NA 4HMCA 4IBIA 3L28A 2Y2KA 1E6ZA 4NZ5A 2Y2GA 1W1TA 4NYUA 1EAKA 4NZ1A 1W1YA 1KS0A 1W1VA 1H0IA 4OJ5A 3N3FA
chains in the Genus database with same CATH topology
2XD1A 3L25A 4OUIA 3L29A 4IBGA 3L26A 2BG1A 3KS4A 3L2AA 4IBJA 2JE5A 3HSHA 4IBEA 4NYYA 4OJLA 2Y2QA 2Y2MA 4IBKA 4NZ3A 4QNLA 3KS8A 3L27A 5BPVA 4GHLA 2UWXA 1YUEA 4IBFA 2JCHA 1YU3A 4IBCA 2IOUA 4IBBA 2Y2OA 2Y2JA 1YU4A 2Y2HA 2FFFB 1YU1A 2Y2NA 2Y2PA 1YU0A 4GHAA 1YU2A 4IJFA 3HONA 4IJEA 4OJPA 4IBIA 2XD5A 4IBDA 3FKEA 2Y2KA 3L28A 4NZ5A 4LG2A 2Y2GA 4NY2A 4OJ6A 4NYUA 4OJOA 4NZ1A 2Y2IA 2Y2LA 3WX7A 4NZ4A 4GH9A 4OJ5A 3N3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSH A;  3N3F A;  3HON A; 
#chains in the Genus database with same CATH topology
 2XD1 A;  1H8P A;  3L25 A;  3L29 A;  3HSH A;  3WD4 A;  3MQL A;  1OGG A;  4Z2K A;  4NZ3 A;  3KS8 A;  1UR8 A;  4IBC A;  1E6P A;  1E8B A;  1YU1 A;  1YU0 A;  4IJE A;  4IBD A;  3WD1 A;  3FKE A;  4Z2H A;  3WX7 A;  3L26 A;  2BG1 A;  3L2A A;  4IBJ A;  3M7P A;  2JE5 A;  1GOI A;  1OGB A;  1GXD A;  4HMD A;  2UWX A;  1ED7 A;  1L6J A;  2JCH A;  1E88 A;  1E6R A;  4IBB A;  2FFF B;  1YU2 A;  1E6N A;  4IJF A;  3HON A;  2XD5 A;  4TX8 A;  4Z2J A;  4OJ6 A;  2D49 A;  2Y2I A;  2Y2L A;  4NZ4 A;  4IBK A;  1W1P A;  3KS4 A;  2RTS A;  4OJL A;  4IBE A;  2V5O A;  2Y2Q A;  4MB3 A;  2Y2M A;  3L27 A;  5BPV A;  1QO6 A;  4GHL A;  1J7M A;  1AIW A;  4HME A;  1YUE A;  1H0G A;  4IBF A;  1YU3 A;  3WD3 A;  2Y2O A;  2Y2P A;  4GHA A;  3WD0 A;  4OJP A;  4MB5 A;  4LG2 A;  4MB4 A;  4Z2I A;  1GPF A;  4NY2 A;  4OJO A;  1CXW A;  4GH9 A;  2FN2 A;  4OUI A;  4IBG A;  1E15 A;  1O6I A;  4NYY A;  1UR9 A;  3WD2 A;  4QNL A;  1PDC A;  4Z2G A;  4Z2L A;  1CK7 A;  2IOU A;  2Y2J A;  1YU4 A;  2Y2H A;  2Y2N A;  4HMC A;  4IBI A;  3L28 A;  2Y2K A;  1E6Z A;  4NZ5 A;  2Y2G A;  1W1T A;  4NYU A;  1EAK A;  4NZ1 A;  1W1Y A;  1KS0 A;  1W1V A;  1H0I A;  4OJ5 A;  3N3F A; 
#chains in the Genus database with same CATH homology
 2XD1 A;  3L25 A;  4OUI A;  3L29 A;  4IBG A;  3L26 A;  2BG1 A;  3KS4 A;  3L2A A;  4IBJ A;  2JE5 A;  3HSH A;  4IBE A;  4NYY A;  4OJL A;  2Y2Q A;  2Y2M A;  4IBK A;  4NZ3 A;  4QNL A;  3KS8 A;  3L27 A;  5BPV A;  4GHL A;  2UWX A;  1YUE A;  4IBF A;  2JCH A;  1YU3 A;  4IBC A;  2IOU A;  4IBB A;  2Y2O A;  2Y2J A;  1YU4 A;  2Y2H A;  2FFF B;  1YU1 A;  2Y2N A;  2Y2P A;  1YU0 A;  4GHA A;  1YU2 A;  4IJF A;  3HON A;  4IJE A;  4OJP A;  4IBI A;  2XD5 A;  4IBD A;  3FKE A;  2Y2K A;  3L28 A;  4NZ5 A;  4LG2 A;  2Y2G A;  4NY2 A;  4OJ6 A;  4NYU A;  4OJO A;  4NZ1 A;  2Y2I A;  2Y2L A;  3WX7 A;  4NZ4 A;  4GH9 A;  4OJ5 A;  3N3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...