3N41B

Crystal structure of the mature envelope glycoprotein complex (spontaneous cleavage) of chikungunya virus.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
338
structure length
337
Chain Sequence
NFNVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDRTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 envelope glycoprotein
publication title Glycoprotein organization of Chikungunya virus particles revealed by X-ray crystallography.
pubmed doi rcsb
source organism Chikungunya virus
molecule tags Viral protein
total genus 64
structure length 337
sequence length 338
ec nomenclature
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2400 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n41B03
2.60.40.3200 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n41B01
3.30.1490.280 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3n41B02
3N44B 3N40P 3N42B 3MUUA 3N41B 3N43B
chains in the Genus database with same CATH superfamily
2EZ0C 3UTPE 4N8PA 3T77A 1FNFA 3BKYH 2HRHA 2J55A 4GRMB 1JXFA 3FTWA 2XYBA 1G7IA 1NLBL 2YUXA 3B2UC 5EIIB 2M83A 1YNKH 4MTMA 2Y24A 3SDYH 3QZ8A 1JNLH 5CEZD 2B15A 2JCWA 4N0CD 1DJIA 2HWZL 3ALWA 2H7WA 4XODA 1V8HA 4O00A 2KZBA 3WFCL 1AZVA 1XTLA 1EXUB 3PHQA 2EP6A 1DLFL 2D8KA 4OV5B 4C2MA 4C4BA 1ZA6A 5KS9F 3MV11 3L5IA 3VW3H 1FNGB 2BRRH 2VMFA 3NIFB 4JZOB 3RIFK 4FZ8L 2QLVB 2YD6A 2F1AA 4M93C 4XP9H 3L1GA 4XAWH 5IQ7L 3KD4A 1G7QB 3MOBL 4F80A 1MJUL 4WRLA 4DUYH 2RJMA 5HDBE 3K46A 3QEQB 3AMKA 5E99H 3BOVA 5KTEH 3E6FA 5CHNB 3UO1L 2P5WB 4QEGA 3FQRB 3NGBB 3HLAA 4K8RH 4MDJB 2X9XA 2OULB 4UB0L 2GHZA 43C9B 2COQA 3PWNB 5HI5C 3EGXB 5LGJA 3NEOA 1YG9A 4NBYB 1SUHA 5AVQB 2A0LD 1T1XB 3DIDA 3VTMA 2VDPL 4NJAL 5IBTH 3O4LB 2Y7OA 3LRKA 3FBQA 3V0WH 3L81A 4APXA 1MHPL 3VPBA 2OMNA 3TU6A 2JI2A 3ARGB 5I16A 1SM3L 2HFFB 4YSPA 1RLBA 5I1KH 5DRXB 4J23A 3BUTA 3CZUB 2HVJA 4KKBC 4AYBE 2XWDA 3OXRA 5I18L 5IVOA 1KPVA 4F2EA 5DGBA 1MHHB 1NAKL 4HS6A 2UVUA 4XBGA 3ZRFC 4AI7A 2IDCA 3BP6B 1VEMA 4LU5H 1E50A 4CADB 2P46B 3E3QC 4M7ZB 3ZDYF 3EO0A 1NCNA 4HU2A 4B5ZA 2R85A 2BSEA 3N42F 4XC3L 3QJHB 4HFWB 1D7DA 1AO7A 2YD5A 4K94H 5DD1H 5D7JB 5KBNC 2R92A 4PEEA 4M4RA 5HYJA 4KV5F 5FO8A 1T5WA 1TENA 1XSJA 1DN0B 5FDWA 5JHAA 4PIRF 4DETA 4O2FA 1DLHB 2G5BA 1BD2E 2Y23A 5GSVA 5I15L 2XWZA 3F00A 1QAWA 1F00I 1JGVH 1YHPA 3IBOA 3FHEA 1MW1A 4OF8A 3ILQC 1E4WH 3IDNA 1MCKA 2HLEB 1ZT7A 5FGBC 3PGCB 1F4WH 1JD7A 1AXIB 3VRIA 5K9QI 5KFDA 2ZIDA 4NT6A 2F5BL 1BVNP 2R56L 4HOWA 1FFNA 4D0CB 2IQAB 1QUNA 3OBAA 1SDDA 3LMJL 4Y2OA 3ULUE 4AGNA 1BVNT 32C2A 3GI8L 3WEMA 3NAAL 1L9TA 1K6QH 2NW2A 4LLUA 5C0RL 4GI6A 5HGAA 4UMSA 2Z93B 4H88H 4Y5VA 4U6YA 3BEVA 5GGQL 4A67A 5BS0D 2OMBA 3FSZA 2IGFL 4AZUA 4BA0A 1R47A 4E41A 1JD9A 2P5EB 4GH7B 1NGPH 1WV7T 3RIAF 4PTUB 4BBWA 2YZ8A 1BMZA 4HP5A 4GUPA 3MRCB 2UWEA 1A02N 5EB9A 1MCJA 2Y9RT 2XWJB 3DURA 1K83A 2VC2H 3PHOA 2YGQA 4JGMA 5D1XE 4HWNA 5F88A 2FP4B 2FX9H 2GK0A 4TNWK 4LF6H 3OVUB 3VI3A 2J72A 4JZNB 2MEJB 1D5MA 1WGVA 4L0PB 3FO2B 2XD4A 2XICA 2WLKA 1OGTB 1I7TB 3AAZA 4GRWF 1RVFH 3UBXA 3UTQA 3EG9B 4R3SA 5CN1A 5FYLE 1X4ZA 3D1MC 3ECWA 2K9UA 4WI4A 1S7QA 5C70A 2BHZA 2W80C 2XN0A 1MI5E 3ETSA 4X5XB 4PRHE 1CS0A 2QSTA 5C0CD 1KC7A 3TCTA 2P24B 4EN2A 3EGDB 4DK3A 4CU7A 4MA3B 1TQCC 2B3IA 3AM8A 4RX4D 5IVZB 2FD6L 3BT2L 1KGCD 4YXHL 2X4NB 1KWGA 1KJMB 3KBEA 1R5WB 4EUPB 3L3OA 5I1HL 3FQTA 1GSHA 1FHNA 3FRUA 2QBWA 3DHPA 2B7DT 3B2UD 1A4BA 1TTCA 5DR5L 2FGZA 3EO1A 3RGVA 1I8MB 3C08L 1M05B 4N5UA 2K6WA 1KJ2A 5K1NA 3ASOB 2KL6A 4NBZB 1OCOB 1JPGB 1G6VK 3ZO9A 3H55A 2J6WA 1XIWA 2ATKB 3C5JA 4Q4IA 1BQHA 1MUJA 2ED8A 2NSMA 5L6YH 1RD6A 1TVHB 5I28A 4AG4L 4XYMB 1KCSH 5AAPA 4TUOB 3KH4A 5CN3A 2AEOA 4OT1H 4MNQE 1MNNA 1MEXH 4B96A 2AZUA 4P2YA 3EJCA 4PJIA 5FR3A 1R0AL 1VS0A 4IR1A 1N0LB 1GZHC 4GRLA 4C8XA 2YOCA 4MDIB 3I74A 2BERA 3US0A 1BMGA 3GWJA 2EVIA 2IPUG 2FX8L 2NDGA 2VLLA 2XN9A 1KBVA 2OYPA 5E8PB 1N2RB 5ILTH 2VQ1A 1SRDA 5KYUA 1ID5I 1UOLA 1XGUB 1JZ4A 2A6DB 3GHBH 3MJGX 1XF5B 1TVBB 3TPUA 2E5EA 4JFFE 2ENPA 4MBOA 3CVHA 5HI5D 5IJVB 5SV3A 4OKVB 4W4OC 4N2AA 3MGTA 4XP1H 5CKAA 2RDIA 4K73A 3ZTJG 3O0LA 1AC6A 4X0NA 2JB5L 1JPTH 4WHYH 2R7NA 2QPDB 2GSGB 4A3DG 1KTDA 1KFAH 1NKOA 3MHZA 4MCMA 1NL0H 2DI7A 2ZF8A 3DRTB 4ZX4A 1RK0B 2E4FA 4PJAB 2VUMG 4YGVA 4OJDH 4C83A 4KKBD 1R17A 4JZJA 3ZR6A 4Y1AB 4TOYL 1O9ZA 1DVFA 3LEXB 1G6RL 4A7QA 4HZLB 3SDXF 2WXPA 1UQSB 4KKRA 1RLWA 5AKVA 2YEQA 3KWUA 5DQ9B 3GMMB 1ZTXL 4JFYB 5FYJU 4HIJB 4PBWD 1OP3K 4UV7H 1KBGH 3WFBH 4YLCA 3BAIA 1HWGB 2KPWA 4P9HL 1EAOA 2YPKA 2VZ3A 3CCHB 2AITA 4PJDB 3RHWF 4D7BA 2DH3A 1XGZA 3HG4A 3U25A 4PP2A 1E4HA 4JN2A 3M45A 2R29L 4ODHL 4Y9EA 1U91B 1XR8B 4EZKA 2R82A 3QHFL 4XT1C 4YJZL 2QVKA 2BVTA 3ILQD 5ICZA 1IGFH 1VBHA 1D5IH 2ZXCA 4JG0H 4ZOLF 3GMLB 3OX8A 1CE6A 3B9DA 4I48A 3F85A 1JNNL 5FFLA 3W0WE 3VYNA 4YXKL 4DPAX 3NIDF 4GUOA 3BCDA 5ALCH 3UTTA 5HHQB 4CSZA 1HKLL 3IDJB 1KYAA 4JO3H 1CFVL 3I12A 4X4KA 3ATDA 3D4YA 2XBZA 4GUCA 4JFQA 1KC5H 4JCWA 2B2XL 3NPSC 4XP5L 3T0XA 4X5RA 3TPKA 5JW5A 5BQ7B 1UZ6F 3MLWL 5JIKA 3LKSB 4A6YA 5C0GB 4MD0B 3P9WB 3VTTA 3OHBA 2OXHA 5A16B 5BZDB 4TRPH 5CWSB 4ZUUB 5ECJE 1CLCA 5IWLA 4XBPB 4KQ3H 3GM0A 3L4YA 3EZ8A 2WZPA 1XB8A 2JKNA 1BVKB 3VD1A 2W8LA 5D96C 1QKZL 3Q6FB 3VYOA 4NFBA 5KSAB 4OVVA 4M8QB 2IMNA 4Y19B 2D4DA 3WNMA 5B38G 3DI2B 1OLZA 2Y1ZA 3L9YA 4QF1B 4U1KA 4LFCH 3BKJL 4RETB 5DK3A 4RRPG 1OF0A 2WW8A 2J1KA 3V9FA 5JHDA 4HWBA 1RURL 1NEZB 2C3VA 4ZUWB 3RG1C 2BSRB 4JK0D 3S34L 2EE0A 2EACA 1X7TA 2WYTA 4FFZL 1XGQA 5EO0A 5J8OA 4KRLB 4OI9A 4WUUA 5ESAB 1IL1B 3CFKA 3ZTDC 2LTQB 1ZV2A 3BFOA 3PFQA 3ULVF 2C34A 4P0DA 3BP4B 5JNYB 2O5XL 1A7OH 1E5AA 5DGRA 5KYXA 4LOVA 2BZCA 1YY9C 5ID1A 3QCUH 5F1SA 4KQ0A 3J07A 1VRSA 5INDB 3CSGA 1CGSH 5EC1A 2BIIA 4HF5H 3DYMA 4IMLB 3AWGA 2RB8A 2WQXA 2CNZA 1C08B 2D7NA 1TWCA 1GOGA 3QRBA 3NSFA 1WC7B 2EH7L 2LU3A 2WZ0A 4PJGA 2YXMA 2DQTL 1GMIA 4IKJA 4S1DC 4XZUA 2EDDA 5E56A 5EOCJ 4Z77A 4XPBH 4MJ6A 3NT0A 2NX5B 2E7DA 4KK6C 1X44A 5E08L 4J2XA 5A40E 1Q72H 2VR9A 4GO8A 3QUMH 1S7VB 1IB5A 3KYMB 1E7VA 4I77L 2GEQA 1A4AA 1FFOB 5CU5A 1PZAA 2Y69B 5IR1A 1FZMB 2VXVL 5E7FA 4U7SA 3A4AA 3DBXB 4XMKL 3K5IA 3QO0A 3K80A 4UAOB 4EDWH 1LK2A 1KCBA 3FL7A 3IXAA 5IB1B 1L7IL 4E9QA 5L88L 2AJSL 2MH4A 4R4FH 1KLUB 2CO7B 3DTUB 1OAKH 3N1PC 4XNBA 2CZGA 3EFDL 5FA4A 2YS7A 3M7OA 4AM0Q 4ANWA 2OCJA 4LCWB 1H3UA 1OSZB 1IFRA 5BUAA 1UXLA 3KAJA 1A7RH 3QXDA 4MLSA 1PIGA 2J2ZA 1DVTA 3D4CA 2WY3B 1NOLA 1TFPA 3HN8A 3JT2A 4U1IB 5F9WB 5DQDH 3LRMA 1W15A 1AI1H 3FQ4A 2WXIA 4NUQA 2YYAA 1WTGT 4FDWA 3Q8AA 1TJXA 5CUSL 1O7VA 4YLBA 4DTGL 2EXTA 1IMHC 2KLSA 2RIKA 2YLKA 4I3RL 3SDCD 3CG8A 4UIKH 3QQ3B 1U3ZA 4FBTA 2UVEA 4NPJA 5K39A 1QWNA 3VXQB 1ZV5A 3VFGL 5C0NC 4DVRL 4ECYA 3QP3A 2QVMA 3S0PA 3HAEB 3S5ZA 1G7LB 3CMOL 5I1AA 1XZWA 1F11B 2A6KB 3MREA 4QJFA 1NBZB 4RMWA 1WQVT 2A99A 4KXZH 1HQRB 2GSIA 2VWEE 5AUMB 1BWWA 3MNWB 5DQIA 2VXTL 3Q43A 3EYOA 4FQ2L 3ESPA 4KXDA 3QI9D 4PHZA 1XZ0A 3WIHH 3EJYC 3OZ9L 4CN6A 1A3ZA 1SJMA 4P2QA 4XNZB 5A2LH 1S5IL 1TUPA 1ZT4A 4Y5YB 3S8FB 4OD1L 2YFNA 3DUUA 3WIFA 2DRUA 4AE1A 3V4VA 2W60B 3U6XA 1FO0A 3UTSB 4P23B 1I7UB 2ZXGA 3L1OL 4ZSOB 3V0EA 1R3IL 3GNML 1IBYA 3AQZA 4R26L 4UOW1 4LOUD 5BS0A 1T03L 1J8SA 2WAQA 3CFDA 3HFML 5G5DB 1XGTB 4QRRE 3ORJA 2BVQB 3SSGA 2VLRE 1KY7A 1QLFA 2CRZA 1DFBL 1TTGA 2Y25A 1L9SA 1DGSA 4X80H 2EIMB 2E46A 2PWFA 4OGXH 4GRWB 4KI5F 4GKKH 3MQIA 2HVBA 5EZIL 4Z3IA 2JE8A 1BXRA 4AL8L 4BHUA 3ALXA 4ZYKA 1RUPH 1ZS2A 4I3SL 1R46A 1E4XH 3VWJB 4BELD 2R2CA 1KXTB 3BGFB 1CL7L 3MNVA 2UZYB 3BEWB 2BIQA 3GBNL 2PCFA 4Z78B 1IU1A 2F53D 1BX2A 1AGFB 4BE6A 1XO8A 4RGOH 3U82B 4KDTA 4BZ2H 3QHZH 5BV7H 5CLWA 3BLPX 1RZPA 4N28A 5F7BA 1N26A 4U1GC 5TQ2H 4GG6A 1JPSL 1QWHA 5GS1C 5KFCA 3KHLA 1KENH 3R5XA 3HE6C 1HKFA 2KZKA 5IZ7A 2ZJTA 3IJHA 4ODUA 3ULUL 5GGRB 4H13C 4O02A 1KJJA 2HG0A 3I3EA 1TZHB 1Z0NA 4IKKA 2RFXA 4I9WD 4TQIA 2FIKB 5KN5A 3IFLH 1V7MH 3T4YB 4ME6A 1NFKA 4WDIB 3B1TA 5C07D 5FF6A 2WQWA 5IW1A 2DLFH 1S9WA 1KJ3L 4HWEH 2QYZA 4S1DD 9PCYA 5HY9B 4NWUH 1NAML 3SGJC 4FM9A 1FVCB 5FCSH 1HHGA 2PYEA 3AG2B 3FH5A 3HG1B 2FK9A 3RJQB 4GXVL 4J3BA 4FS2A 4KK6D 4NC0B 4YFEA 4PJ9B 4UI2A 5IFJA 3N6YA 4NHUA 5I6LA 1WFIA 2OI9B 1ICTA 3VXUA 2ADIA 3K0YA 3IDGA 4XMZA 2JEJA 3VQ1C 4AVKA 4CDHA 1FFPA 1KPUB 5HPMA 2RAMA 3DUSB 2H1XA 4AT6A 4RZQA 5FCUL 5I0ZA 2B59B 1GGYA 3I75A 4BYHA 2W0KA 5KBPA 5FYLL 3AUVA 3O2DA 4YHHH 2ZG1A 4UOQA 1JAEA 1E4EB 5D8DA 2Y7SA 5ID0A 2XCPA 3BUQA 2KLRA 2W8KA 3FJTA 1C12B 4PGZA 3V6OE 2APBA 3EH2A 3I2CL 1NMAL 3Q5OA 4HK3J 2OZ4A 4DOHE 5DZVA 4WAFA 2B1HL 4P59H 4MRCA 5B3JE 5LBSH 3PR5B 3OSVA 2BSBA 3U4BL 3C6SA 1Y1WG 4FA8A 1RZIA 4IJTA 2DZDA 5KVFH 1MCOH 1JN6B 2GI0A 2UVFA 2YPLA 5DTFB 3RWJA 5C0JA 5IOPB 4OW6A 4ZUTB 1EMTH 4YSQA 3NA9H 4FZEH 3ZKSD 1DJXA 4JFWA 3O4OB 5C08E 3BMVA 3FU3A 1A0IA 3HNVH 4XHJD 1UT1A 4NRZB 2OSLB 2C9AA 4G8AC 4MHHG 1TO5A 2QV4A 3QYNA 1CO1A 1JHKL 3O6LH 3BPCB 2E2HA 3IFPB 3T3PF 2F6AA 4EEYA 4ZFOA 3V8CA 4K7PX 2W9EH 4P9ML 3CFJB 5E94B 1F90L 2H9GA 2EEXA 4HPOH 5F7MC 2J12B 3TQ1A 1JL8A 4U6VL 5DZPA 4JPWH 1MJ7L 4H0GA 2IH1B 4XVJL 3LH2H 4ZQTA 3ESMA 4HMCA 5IVNA 1DZBA 3EJYD 5FGBA 3N0AA 2W9CA 5A6IA 5L8KB 4NNYB 5B38A 3JYBA 3ZK0A 4OQ1A 3RKPA 5BO0D 3B7RL 4M8VA 5LMNH 3IAGC 2ATPB 1QNZL 5IMKB 4KVNL 3D50A 3WN5B 3MGOB 1FL5A 5CP7B 1RZKC 2VR5A 3L17A 1P7KB 5A2JH 4GXFA 4GLXA 4P2OB 4HQQL 5FLUA 1PYWA 3TIDA 2BHFA 4HEMA 4WW1A 4B9GA 5CFHA 3VWKC 1V7NH 4M5SA 2F7PA 3I9IA 4GLRH 4HBCL 5EZPA 1CF8L 1PU0A 5EZLA 2Q86B 4PRNB 3H0GG 3TV3L 3KXYT 3D87B 3DMMC 1EBAA 1SQ2N 1DBKL 4ETSA 4DO6A 1WGOA 4TNWF 3RKDC 3DX2A 1OOAA 4PGBA 1EERB 2R69A 4QHLA 3JZIA 5GZNA 3HS0C 4LQ1A 4QXUH 2QQLL 4IZOA 2D3LA 3BXNB 4UU9A 1IFHH 4AKQA 3NACL 3D9AL 2JJTC 3NQKA 4BGLA 4ZNEE 1M53A 3K5HA 3QUZB 3QWQB 4G6KH 5TF1H 1RZQA 1AAJA 4X9FA 3WAJA 1U8NB 5F9OL 3VD7A 3VG0H 3GHEL 4LPUA 4ZMVA 4FQIH 1QFWH 1JWUA 5E24E 2E3VA 1WF5A 1S3KH 1NFDF 4QRTA 5DJ0A 3QXAA 1JCKA 3S88L 2ROYA 1AUXA 4MJ4A 2VZ1A 3IAQA 1PVHA 4EQ2A 5IK3A 3FUEA 4BE5A 5I8OL 2XZQL 4GLRI 1ETJA 3HE6D 4XO5A 4DP9X 2P43B 5D1ZI 1JZDC 3UYPA 5MP6L 1NFIA 3APNA 4BRJA 2K9FB 5DJDA 1O7DE 4FKKA 3BISA 2QTEA 3MRBB 3LRGA 3N04A 5DMKB 1ULVA 1DEEA 1MFDL 2LVEA 5DJ2B 5LG1A 4KUCD 5J0BA 4EEQA 1I85A 4HG4J 4ZFGL 5HGBA 4F1SA 3RU8L 4H0IA 2FECI 1KELL 2H32B 4PRIA 4RB2C 2A2QT 3HVDA 4KPHH 5HGDB 1UJ3B 5BQDA 4OJFH 4O9HH 5I1JH 2AEPH 4MA8L 5TJWK 4YZFF 2YPVH 3G5XB 1IBHA 4XBEH 4YDLC 3FXIC 3BH4A 4KKZA 1HL9A 4AV5A 15C8H 4ZPVA 2JLLA 3OJDA 1QFWI 1FJGH 1U8QA 2ZKMX 3TO4B 3P30H 2IWGA 1NCCL 3OSKA 2YZNA 1P4LB 4A63A 2HKHH 3QWOB 3WNZA 1C1EL 4HDIA 3OSNA 3VH8A 1D2PA 1GZHA 3BZFA 3KPRE 1DQMH 2JB6A 4P8QA 1GH7A 4IRSB 2JK5A 3EH4B 1U8IB 4PJ5E 4EQ3A 1OHZA 1W16A 5EORH 5KBMA 1QBLH 3CX5K 3O41A 3QSKB 5GGVL 1BZDA 3ZIMA 5IF0B 2XXFA 3VFPB 3GSXA 2CPUA 5DQHA 4U6TA 1LWHA 4X6CA 3ATBA 4HCRA 3BZ4A 3DX7B 4LVNB 3ZDZB 4Y9CA 1UZGA 1X5XA 4N2MA 4XPHL 3FFCB 2ZG3A 3OHAA 4JANB 2VDQB 3D08A 1OARH 4PCKA 4XVTL 3J2PA 4G9FE 2WXOA 4B60A 4F9LA 4EZLA 5CLYA 4G43A 4KHXH 5ADPL 3E7JA 3RILA 4A7TA 3D48R 4KOCA 2AK4D 2GTWB 3LQMA 2ZG2A 3F6IA 4YWGH 5F7UA 1A9BB 4L4VE 2N59A 4AYFA 4ZMPA 2Y7QA 4GKOA 3WBDA 4EPSA 1UFGA 3TFBA 3LSOB 5F7EH 2DJSA 5SWSB 3WO3B 4NGHL 1LGVA 3L6FB 2XG4B 4Q0XH 3UJJH 3EDJA 3BUYA 3SPVB 1K4CA 4OJEH 3KYKH 5IT9W 1SJXA 2GSMB 2WBKA 4HJGA 2FO4A 1PX8A 3QQ9C 5LBVA 4JFPB 3L5XH 5ANME 2NY2C 4M93B 2VDOL 3WO1A 4JFOB 4UCUA 1R4XA 5HVFB 1A3QA 1J5EH 3IJ9A 3WIIH 4NKOB 3RWFB 2GLTA 3R5FA 5CD5D 4LGSB 4ERSL 2W9DH 4PJBA 3L08A 4YEFA 2Y5TA 5DRWA 4RAZA 1UM4L 3NH7H 5KG6A 4LEOB 4UNTA 4AGOA 4QIWA 3D25B 2PYFA 4M48L 4ONFH 5D2NB 1A6TA 4LAQL 1I3RB 4KH9A 4PW3A 4RNMA 3Q2CA 2Q7YB 2IV8A 3E8VA 1MVUB 2V5YA 1HYSC 4IS6A 1BEYL 1NCDL 2V2XA 3P9LA 2JIXB 2UY7A 1ASPA 1JGEB 2AVFA 3CDGB 3GYRA 1K2DA 5LN8A 1ILSA 3BJLA 1N0XL 4K5LA 5D2LF 3RDJA 3GV7B 1QLEL 3VWKD 3QEGH 4NX0A 4F37K 2G3ZA 5B39G 4BXVA 3DXAA 3K6SB 4Z5RB 1WAAA 5FXCH 2FJHB 1ZA3B 3DIFA 3STBA 3DMMD 4LARL 4LEBA 1ZGLM 1J8KA 2WYIA 1B6SA 3RKDD 1T2QH 3ABLB 5IHHA 1J5CA 4FFWC 1CBJA 2P28B 1D9KB 3TIEB 1RZJH 4GY4A 1MZBA 3RB0A 3HRZB 3W37A 4G80B 1GYFA 1LWJA 1E6JL 3WO4B 2HZHA 5T3ZH 4WFFE 1CFQB 2G2PA 3IWUA 1V10A 4EVNB 2JA5G 3U6RA 3KPNB 4GSDL 1SF3A 1INEL 4HWZA 1RU9L 4NAMA 3WY1A 4EGJA 3VSUA 4AYGA 3GSOB 4G8IA 4NUGH 1IEAA 4U0RC 3ATAA 2F53A 5BZZA 1T66D 2E9GA 3NSJA 1EHLH 1G9EA 5LHDA 4X7SH 1JJUA 5BRZE 3S37L 1U3HA 3NA4A 5D5MA 3AU1B 4XN7A 4QHNB 3O6MH 3S48A 3VACA 1MFNA 3VAEA 1BP3B 4YHNA 2VXUL 1A9XA 4JDEB 5EO9B 4PGDB 4M5YL 4KY1H 4AKPA 1FYTE 3U2JA 1KJ2H 3D34A 2VIRA 4OD3L 4H20H 3GTJA 4LLYA 4M61A 1JDCA 2KSWA 1CICC 2DJMA 2LLGA 2ZSVA 4PJ8C 4MD5B 5IM7B 5C07A 4NQEA 3IMBA 2DJUA 3C09C 1N5AB 2ZNXA 3WAKA 2ZXBA 5JORA 3PR4A 3DOSB 3EH3B 3QUGA 2IFFH 2W6QA 2VDLL 2DQFA 5DCCA 3D69A 4U3XA 1J10A 4NCC1 1RUKH 2W94A 3DVIA 3PV6B 1OGSA 5I71C 2RGVA 1MDTA 2BWQA 2J8UA 3KCPB 1T0NB 4YSCA 1JDBB 2GCYB 5KT7A 2CDGA 4W9FC 5DHEA 4JHVA 2DWEB 4S1SL 2OAAA 3OWRA 4E36A 2Z31C 4BDVA 2NY3D 1QOKA 3OHXA 4OZHA 4BFEA 4O5LH 1A6PA 3CV5A 2B63G 1DUZB 3RX9A 2EDKA 3DC0A 4Q97A 5I1IH 2J5LB 4W70A 1IO4C 3D5OF 4CAGA 1MPAL 4DWHA 1L6ZA 5DRNB 2ITCB 3IFOB 4PR5B 2IADB 4WW2C 3PDOA 1LM8V 1ZHNA 3RTQB 4OCNC 4Q6YA 4TLSA 1HE8A 1Z5LA 1QNIA 2YGOA 3FYIB 3PL6C 4BA8A 1YPZE 4RAUB 2VRQA 4JJ5B 3CHQA 2ISDA 2C9VA 3OTOH 2F18A 3IETA 4ED6A 1PKQA 3FTVA 4Q2ZA 3T3PB 5B1KA 4D9LH 1LEGA 4HUVB 3K8MA 1I7LA 4Z7UA 4JM2A 1LD9A 4WKZB 3NBNA 3DVGB 3QQ9D 1ASOA 5BO1L 1B0RB 4G3YL 1A6AA 4BJLA 1S7WA 1HILB 3GBML 3RNQB 3G6XA 5SX5K 2O5ZH 4PJXA 3LQAH 5E1AA 2WAHA 4MMYA 5KUKA 2OWOA 3FQWB 1BQLL 4AV0A 12E8L 1CZ8H 2QVFB 2W92A 4NQQA 4DW2L 2BQUA 1YNLL 2AK1L 2BM3A 3SO3C 2Q5BA 3GK8L 4H25B 1IQDA 2PP7A 5B21A 3BUPA 5D6DA 4N5EC 1GHFH 4AVJA 4FA6A 1NTDA 4R97C 3NJNA 5FYKH 4NKMA 2CO6B 3ZDXF 4RZCA 4R8WH 4KO6A 3OR6B 1CYXA 1HYSD 2YSSB 4ADJA 3MGAA 2V4RA 4QOKB 2CDFA 4MWFA 4J7RA 2P49B 4KUZL 4U3HA 3S36H 3QFFA 5CM1A 2VDMH 5HHXL 1KV3A 2VE6A 1SLVA 4LEXL 4RWHA 3KBHE 3LAFA 1S4IA 2GEEA 1AGBB 1J5OH 5EO1B 3SD5A 2QR0B 1HH9B 4JMXA 4A6YH 5E9NA 4FXGC 1GYVA 1B0WA 1T04B 3P73B 4RB0A 1UD3A 2HB0A 4FFWD 3MROB 1IM9A 1VERA 4P3DA 4QTIH 4P5KA 1GGCL 1NGQH 1A9EB 2R27A 3GGWA 5J13C 2H1PL 3G08A 3VXTB 2EC9T 2YA1A 1SGKA 3SDCB 1NFDB 4IU3A 1EHIA 1GOFA 3JWNC 5EIIA 3A5VA 1LO0H 1CPUA 3OZLA 2NUPA 1UACH 3FPYA 2QLYA 4NC1C 4MQSB 1EO8H 4JHAL 4XPGL 2E74C 4HWBH 4MD4B 2Y1AA 1EUTA 1EJOH 3K6NA 5EU6A 4OV5A 5DLFA 3QCTL 5FFGA 3MXWL 1L6PA 3FRPG 1JZIA 2G3NA 1CU4L 2Z8WC 3C5SA 3P77B 3QCVH 3QI9B 3UDWC 5GS1A 3BZ5A 2VZSA 2WNGA 3EADA 2Q87A 3HE6A 1XD1A 3L45A 5T33L 1KGXA 4JVPA 1OTTC 5K9JL 4YHPA 4LASL 4OIIL 4AC2A 4HKBA 1I4FB 3BT0A 5I6XC 4RSVA 5JQ6H 4GKZB 4PJHF 4CBZA 4HUXA 1R34A 4ZMXA 4WGVB 3PWLA 4RIRB 4RESB 4U1NA 2P5WA 1UC8A 3MJ8B 3FQRA 4RAYA 2UXDH 3IJEA 3ZPDA 1JVLA 4K9EL 4MDJA 4DV6H 3HUJA 4G2AA 1CICD 1FLRH 1S7UA 3X3FH 3CD4A 43C9A 1CUOA 5CEZH 4CL7A 2BDNL 2H3NB 4FTVA 3OMNB 3V0DA 3SGJA 2XV2A 3WOVA 5GXBB 5F89B 1YUHB 3ILPB 2ENJA 3H40A 4XMUA 1UEYA 4A39A 4NC2B 5DRXA 2ZUQC 4XAKE 3V4PB 3ELAT 3S4SA 3UPRA 3KLAB 1W91A 1MHHA 2XKSA 1PZ2A 5E5UB 2DYPD 2B0SL 1PL3A 2NTFB 5B1JC 1FGNH 3UJTL 4GAJH 5BPFA 2ICWB 4KGLA 4PVMA 3GXIA 3LH8A 4EG0A 1DQDL 1XCTB 2E6QA 4MA1C 3CQZA 2VW6A 2H3XC 3QDJB 1EJFA 2BHUA 2VO8A 1DN0A 2BOCB 2FEDC 3F5WB 1O6VA 2WE6A 2UYLB 2HX8A 5ECGA 3GTLA 4B53A 3TBYB 3RWCA 5AW1B 4ELMA 4L2LA 1JCVA 4M1DL 3TJHC 4WI0B 1XCXA 4AC4A 1FSKB 2FGWH 4KFZC 4OF3A 4FP8H 3PGCA 1A14H 4ORGB 5DD6B 3FT2B 3S2CA 4LCCC 4GS7C 5KFLA 4FQCL 1VKXA 1B3IA 2IQAA 4ZOAA 2R8SH 3TO2B 4XVSH 3KPTA 1F8TL 4P46D 1NWOA 4G6JH 3NIGF 2HVSA 1RXLA 1MVYA 4H5SB 4XPFH 1M6OA 1MFAL 1ZWIB 3QRGH 3L4UA 4DKFL 3FMGH 4JO2H 2P8MB 2BP8A 3QIWC 4WI6A 4WU7A 1UWXK 5EU5A 4LQFL 1SHMA 1K1SA 2Y2TA 2V4LA 2MNJB 3S96A 3OG6B 5GSRB 1A5FL 3ULAB 4N5ED 5ENWA 2P5EA 2YFOA 3X1NA 2EEFA 4MJIE 2AJYL 3MV7B 4R2GD 2ZSWB 3MRCA 2YR3A 2DS4A 4I85A 3W9EB 4JO4H 4ZI8A 3CFEB 4N3TA 1F97A 1ETZB 1T2XA 2OTUA 2Z35B 4RFOL 1UVQA 5DUJA 3LDBB 1NDGB 2ZYRA 5FO2A 5EOTA 3V4VH 4DN3H 4QCIA 3AROA 4NQVA 3GXMA 1W0WB 1FO0H 4ONGL 2QQQA 4JG9A 3FONB 3ZQXA 1XMQH 2H32H 4NKQB 2DF3A 1RK6A 4XN9A 3MJ7A 4J2QA 4IHBA 2K4WA 5A1AA 4JR9L 5F1IA 3TNNA 1DJZA 4NNPL 1MI5D 2Q2LA 1JX4A 4PRHD 1JUFA 5LG6A 3IU3A 5JDSA 3D0LA 3RAJL 6CGTA 4Y4HB 2X4NA 1KJMA 2DWTA 3JV0A 1P1ZA 3HS0A 4G7SB 4LVHC 5EBLA 3ML8A 5LAXA 4EUPA 5E2JA 5JXEC 2HLAA 2YJLA 4QRSA 4I13B 4XZ3B 5B3NA 5AW7B 4EYHB 5FHBH 2R2BB 4DR2H 1OPGL 3CHPA 2JJTA 1O6SB 1TZGH 1NBYA 2NNCA 1I3GH 2G9HB 3GB7B 3HW7A 4DKDC 3O3EB 2JEFA 2ATKA 2XHNA 3JUYA 3I3BA 1LE5B 1W0YT 1IGJA 5D70H 5I6OA 5C8JB 2AJZA 3GSVA 1JZ5A 4B50A 4Z6AT 3QJOA 5BXFB 2JELL 4J27A 2OL3L 3DGCR 3GMOA 1G94A 1SY6L 4GOSA 5F72S 5DVPA 5MERA 4B9YA 4JUZA 5JQHC 3REWB 1UB6B 4TUKL 1OTTD 3TX4A 2G60L 3LKOA 1WH2A 1N0LA 1S3RA 4MDIA 5C0AE 3CBRA 1UCBH 2CIKB 3LKNB 3LKRB 4Z7QF 4EMZA 2YU9A 1N2RA 4O02H 4OTXH 4PRPD 2O1AA 5T1LD 2AHIA 1XNQH 4TSBH 3MLRH 5E2TL 1B2WL 1XGUA 4HJEA 3U7YH 4RAHA 1TVBA 5E5MB 2MHAB 1PSKH 2R83A 2WB1A 4BHUI 4JFFD 1MOEA 4F8TA 5IJVA 2W95A 1RIHL 2AW2A 3ZTJH 2KPNA 3RL1B 1EH9A 5JW4R 4W93A 1TZOA 3WL9A 4PG2C 2EKJA 5CB4F 5C1MB 1YMMA 2C7UB 3V0FA 1QA9A 4A7VA 5D7LE 3PAYA 3RNKB 5EWEA 2J88H 1NC2B 1BGXH 3JTSA 2XZCL 4OBSA 3T5LA 1U8PA 2VDPB 3BW9B 4PJFA 3UEQA 1IGCH 1WAEA 1RK7A 4Y1AA 1ZLDA 4X4YB 3F7VB 2QEJA 3FQUA 1HOEA 4U6XA 1LQBC 1BBDH 2J7LA 4APQD 4GKLA 5AB1A 1MAKA 2R4RH 3NZHH 3U1QA 4DR6H 5C09A 1TETL 4OUUB 1VACA 2NY7H 3A4EA 2UY6B 2FPPB 2DQDL 2VCOA 4L29B 2EE6A 1N36H 5IKCA 3O2DH 4PV9B 5AAWC 4XRCB 1XGPA 2Y07L 2GUYA 1R3HA 3B3IB 4O4YH 5F7YC 3ZUNC 3QIUC 5EBWA 3BI9X 4M5ZL 2FEDD 1LE9B 5I2IB 1RAMA 1OVZA 2GG1A 3U36A 1QPXA 3NCYP 1WBYA 4NWTH 2BCMA 2OZ4H 3A47A 3ZW3A 1LO4L 3EBAA 1HQ4B 1JK8A 3U9SA 3F8NA 4Z76A 1IJNA 1CFMA 3TJHD 1K8IB 1ASQA 3GMLA 2DQEL 1QFUH 3QQNA 3MCLL 2JKJA 1W72A 4L9LB 4Q89A 5GRUL 5J3HD 4J8RB 2Q2TA 1D7BA 3RFZC 3DO3A 3V0IA 1JV5A 3ECQA 3NJLA 4P3CH 1QSEB 3ISWA 4KMTH 1SBSL 4Q7DA 4A66A 4UT6A 4L18A 5HHQA 1P1VA 2B4CL 5FUZH 1JZ8A 2GABA 4G8FA 4YMPA 2I9TA 1E4JA 1CG9B 1XCQA 4PMEA 1TITA 4NCDA 3D2TA 3OAWA 3IMWA 1FH2A 1OZUA 1RIUL 2QPUA 3IWVA 3QIWD 3VFSA 5AWNL 1KCWA 1ZHQA 4GC7A 4NHCL 5C1PA 4YAQB 4QW9A 4X6DE 4Q4EA 3F12A 4BFOA 4JQIL 3ZDXB 1MREH 3SJVE 4ALAC 4JFZL 4KI5C 3TEXA 5HHMD 3RIKA 2WOBA 4ZUUA 1VF5C 4X65H 2W65B 4A3IG 5HI3C 3WTYA 1M0WA 4KZEL 3C87A 4OBRA 3VNYA 5KSAA 1J18A 5CF3A 4M8QA 2I60L 3L4WA 5D6CB 4N6QA 3N9GH 3GLZA 4OGQC 4XNUH 5BVJB 4S0TD 25C8H 2A83B 2JJWA 4QRAA 1T3NA 1P6WA 1UD8A 1SYVA 1H6UA 2EKSB 5CD3A 3D33A 3LKQA 3MRHB 3GLEA 3BAEL 2KYIA 2AK4B 2O5NA 4ZUWA 3GBDA 2OTWA 4OQTA 4WK4B 2WANA 5F0MB 3NSCA 1B33N 2UX6A 4FFVC 1F0LA 1D5BB 3GSWB 5LP6F 3NFPA 5DI8B 5JXED 5ESAA 3G5ZA 4GINA 1S2EA 2FJGB 1I9JH 3G3LA 3WJJA 3KYOB 1OAZL 4YQXL 5B39B 4A2AA 4E42B 4MXVF 1OCWL 2VERA 3K6FA 4C4KO 4EN3D 5KS9A 3ZRCC 5E6RB 2DQCL 2OQJB 1LDSA 1EEZB 4JS7A 1U2CA 5INDA 3VGAB 1KY6A 3QZ7A 3FNKA 2CR3A 5JQWA 4MV6A 1HNWH 1IILE 3HN5A 4Y16C 5F6IC 3ULUF 1CI5A 2Z4QB 4N2LA 2V9TA 1TQBB 4LLMB 1I8AA 4PJHB 4BWTA 4UDTB 3BAYA 3LTVA 2H0EA 1AY1L 7FABH 1U8HB 3KVQA 4JFDD 1RZ8B 3I50H 3PWJA 1PF3A 4IRJC 1VADB 4MCZB 3FT0A 5DURD 3HOXG 2WZ5A 3HR5B 2NR6C 4NO3B 5IQ9A 3NEEA 3UROR 3VWKB 2VJ0A 4HBQA 1WA1X 5KFPA 3KWTA 3J27A 3O11B 4YL4A 3ZTNH 4C56E 3DMMB 3OQ3B 5IB1A 1XL6A 3TH4T 2F19H 4MMZB 4PJ8A 1KIPA 4QXGH 5FPOA 1LP9A 1V55B 2CO7A 1LLAA 2JJUA 3HC4H 1J9RA 3APFA 2PPCA 2H2SD 3UYRH 4OLZH 4OJAA 2OMUB 1OSZA 1J1XH 1HL4A 4NCC2 4PM1A 2ZXQA 1JMXA 3IF1A 5HJDA 2FE3A 4WF7A 1XH3B 3FOMB 4XCNA 3IU4H 1G6RB 3FO9A 1PZ5B 3DSNB 3L9BA 3PRZA 4ISVB 2HVKB 3BIKA 2DD8H 2Z31A 3QYCA 3GXDA 1GGIH 3HMXA 3AXLA 3L9RA 4OCSL 3GKZA 4B5EA 2W07A 2JI3A 2XV6B 3D2UA 5HDQH 3PY9A 4DGYL 5KJ4A 3WLBB 1F2QA 4XOAA 3FPXA 1TQTA 1ZLEA 1QYGH 3VXQA 1M7DA 1KB5B 2OS7A 4ODTH 3U6XS 3HAEA 3MUHL 1G7LA 3ZMRA 3F05A 4ZXBC 1TDQA 2A6KA 4M9PA 4WW2A 1CD1B 4PLOB 4EAEA 2H41A 2VERN 3MNWA 2LOEA 2B9AA 3RA7L 1JYWA 4NQXB 2OLDA 3PL6A 5C7XH 2B8OT 1FV1B 2D7QA 5FO9B 4R84A 2X38A 3TWYA 2X4QB 5INCA 3KWWB 1NSNL 1DE4B 1TZIB 4A93G 3U1PA 2OX5B 1UYWL 2I7SA 1YMHB 3FTSA 4Q8FA 4WNQA 2JEIA 2DQJL 2LFGA 1QEXA 5MEPB 4BFFA 4CN1A 4JRXE 4P23A 3CIQA 3TEUA 3WY2A 3NFSH 3OKMA 4GQPH 3HB3C 3L3GB 1JFQL 3GSNL 4Q0YA 3TONA 1EUUA 2FJFA 5E00B 1X9LA 1XSIA 4L3EE 3WKMH 4JI7H 1R9FA 5D72H 4DKEH 3ABKB 2RQ8A 5G5DA 5HI3D 1A6VH 1XGTA 1KLFB 1SXBA 3N40F 3RI5K 3RVXD 5KG0A 4AMXA 5TDPA 2QQKH 5AVXB 2NY3B 1FCGA 4G6FD 5IW6B 1PY9A 2D7OA 4ES8A 4HS3B 4Y88A 3MLTA 4JPVH 4KBPA 3NJKA 5J57B 4LPYA 1M2VB 3BKYL 4G72B 5SV4A 1C3OA 3F65A 1DJGA 2NY6B 3RWGB 3H9SD 1OALA 1O9WA 3EYQC 5CSGA 1USQA 3O3UN 1YNKL 4B9KC 5M95B 5LKNA 1JNLL 3BEWA 1Q9WB 3LHAA 3BWZA 4E9YA 3ARFC 3G9VA 5IFHH 4WEBH 3D18A 1AGFA 3OKKA 2XLLA 4AW4A 5I30H 1FLTX 4FXGA 4H8WC 2ZCLH 4G8GB 4FFVD 5JA9A 1RHFA 3VW3L 4Z0BH 2BRRL 5GGVY 1KIRB 1YQVH 4MDRA 2LLNA 3K5SA 4ZX5A 5EHFA 1P4UA 3MWMA 3IMTA 4HQ6A 2HLFC 4XP9L 3S3DB 4XAWL 3POCA 1P9MC 2R0LH 3PLYA 4NYLA 1GO3E 2EIZB 2QADB 5E99L 5KTEL 4QLRA 1BQUA 1B4JH 2C9QA 4QTHB 4QRPD 5GJSH 1GSKA 1I1AC 2FIKA 2KHAA 1FVEA 2NY0B 3CDZB 3T4YA 2XTLA 4Y16D 4K8RL 3QG6B 4XH2B 1K5WA 1EHAA 1FVDB 3ARTA 4EI6A 1G1KA 3GILA 4UT9A 4Z7QB 3UXFA 5GS2D 3BSZA 3II1A 1PKOA 2EDBA 3BH9B 5CCJA 1JV2B 2H0JA 3FTXA 3HG5A 4TM9A 2XA8L 4IK7A 3UDWA 1ZEAH 2A5UA 4IRJD 4PJ9A 3V0WL 4X7TB 2FYVA 3S98A 2NZ1A 4G59C 5I1KL 2ZP8A 3AT0A 3TT3H 4XMVA 3AABA 3VFNB 3DUSA 3MOQA 5DS2A 1YRKA 4MVBC 4DZ8B 4PRPA 4FL4C 1MWAB 2GY5A 3QJQB 4GQZA 1AXTH 4LU5L 5F1NB 3FRPB 5FIEA 5FM8A 3PWPB 1J11A 3UIZA 4J3OF 4WI7A 4YHOH 1E4EA 3NN8B 1WT5A 4K94L 3QT2A 5DD1L 3QXVA 5I1DB 1D6EA 5CJQH 3SDXA 1RJQA 1C12A 3K4DA 3KHQA 2QT6A 2FZ3B 3FN0H 1W0VA 4DQAA 5IMLB 2PR4H 1PD0A 2V9WA 3PS6A 4L8CB 4MYWB 5DHXB 1L0PA 5DMIH 3CSBA 1JGVL 2VN7A 3SB3A 1H3WM 2WVVB 4X5WB 2XV0A 3D85B 1E4WL 2VSKB 4XNQB 1F4WL 2I8CA 1DQJB 4FU0A 5B1JA 3ROOB 5C08D 5I19H 3PUCA 3QNZB 4ZMYA 3SGKC 4H26A 4OFDA 5E23A 5KG9A 4HJSA 1EJ8A 2FJSA 4HSAC 4J6RH 3VFMB 1K6QL 3BPCA 2M1KA 5E2UH 1IAIH 1M1XB 2PP9A 3IFPA 1AHKA 1MJ8H 4HJTA 1ROCA 3C5ZC 3DIVA 4LL4A 1TG8A 4ZXBD 1EANA 1A7PH 4PGJA 3CFJA 4H88L 5HSFA 1C9SA 2X9YA 4JGNA 3KBPA 2QDVA 3UP6A 5T5FA 3RP1A 5A2FA 5IB5A 2CKZB 1GR7A 3NG5A 4L8SB 4OFVA 5HDBB 5T1DH 2IH1A 3CN3A 1SDAB 1TSRA 1S68A 1EPFA 1UB5A 1QASA 4OIBA 2HX7A 5KBDA 3T6QC 3QEUB 2WN3A 4U3SA 2XQYG 5F96H 2VC2L 2B14A 1CICB 2FO8A 2NW3B 3MA7B 1GGBH 3C09B 1U92A 2FX9L 3QJXA 4UAHA 4PRAB 2DMGA 5C0IA 4M7LT 5CP7A 3MRJB 4WIQA 3S7GA 1JVKA 3WS6C 1AH1A 4YR2A 4N6RB 3HB3D 3QEHA 2NSXA 4DGWC 1P5VB 2XFXA 4P2OA 2UU9H 3OGCB 3H4HA 1IKNC 3MLVH 1RVFL 2QKIC 4KJPC 1H15B 5F93C 1IAII 5KFOA 4IRDA 3ULSB 3BQUB 4YS4A 2EDTA 4KNUA 5DK0B 3T9WA 1GTNA 2R23A 2HUHA 1Q4NX 3I6KA 3OKNB 3UP1A 1F58H 2CJSA 1AGCA 5L0QB 1OK8A 2DWDB 4B95C 1X5JA 3O6KH 3REVA 5IB2A 2FL5A 1OHQA 2X4RB 4OZFB 4ZTOL 4TNEA 3GTMA 3RX7A 5ICUA 3EYQD 4L37A 5JUMA 3QUZA 5E6ID 3U4AA 1IOVA 3JWOC 1UKTA 2C22A 2AV7B 2KQMA 3ARFD 3FB7B 4MNHA 3US9A 1ORQB 3PXLA 3D07A 4O51B 3UAJC 1BD2B 4O3QA 2VUOA 2IAMC 3C2SA 3VE0B 5L6YL 5F9NA 3BSGA 4MAUH 5CSZA 1YEEH 3LS4H 1KJ8A 4NM4H 1KCSL 3UO1H 3WXWH 3FCSB 3O3AB 4FG6C 4OZIF 4Z3HA 2EIDA 4OT1L 4RFEB 2AJ3A 3G6JE 4MXQD 1S9XB 1MEXL 4UNIA 1T36A 3IYLW 4AYDC 2HLFD 5FHAH 3M9OB 4GSXA 3IMSA 4RUAA 2HRGA 5JXEA 2J4WL 4P46B 1NEUA 1PIFA 3EH5B 5ILTL 4PJCE 5GRVL 3V9CA 4UTCA 1I1AD 3EHBC 3VFUB 3NSDA 4YIQA 5JO5B 3GXTA 3VFTA 3GHBL 1YNTF 3H7BB 1FUNA 1FL6B 1SN5A 1ECYA 2HRLA 3BHBA 4RGNC 3SO3B 2PMZE 3NJFA 1G9NC 4BH7B 2FLPA 3VCLA 3W82A 1ZE3C 2HVQA 1RPKA 2ZX7A 2QFRA 4XP1L 3CN2A 3CH1B 4KFMA 3TO4A 4R2GB 1JPTL 3QIBB 4IOFC 1RH8A 1NAMB 1FC1A 4Z9KB 2FB4H 5CFAA 4L3CB 4QD2E 1HJCA 3OB0K 1ETB1 1LO3H 1KFAL 4BFBD 2OLSA 1NL0L 2J73A 4FERA 3H0TA 4JFDA 2WLIB 2WTRB 5D1XB 3ZLQC 5JOPE 2ICWJ 5TGBB 3M07A 4MVBD 1P7QB 4PAZA 1MCHA 3HMWH 4HUUA 3C75A 2OSYA 5ICXB 1G87A 1L9PA 4EGQA 5IG7A 3VFPA 1TR7A 1VENA 3ZZLA 2IAAC 1QVOA 4UV7L 3BD5A 1KBGL 1R1CA 1PLAA 1B6DA 2PN5A 3WFBL 2W6PA 5CZXC 4XCYB 1MI5B 5EWFA 4PRHB 4PG2A 3L95B 1A6UH 2OMWB 3FFCA 4V1DB 4YDMA 4JANA 2Y2YA 5IGXH 3UX9B 2JKSA 1JXDA 4G9FD 3ASNB 4KGJA 4JRYD 3EOBB 3ALPA 4GT7A 1VFUA 3WEAA 3SIKA 1IGFL 1COBA 1D5IL 4JG0L 5C0DB 1I6UA 3RBEA 4QNPE 4WTWA 3L3JB 5F3FA 3OLIA 3MACH 1WWWX 1UD6A 1VJSA 3TVMC 3M17B 4G9DA 5J9PB 3GUFA 1E40A 3BE1H 2E9BA 1GRWA 2XG4A 5ALCL 3ENEA 5JLZA 5K9KB 3QH3A 4JO3L 4BZ1A 3NJHA 2WWKO 4R83A 4OH2A 4JREC 2A4EA 4EFBA 4TNVK 1KC5L 3CQFA 2J57A 3QIUA 4MNQB 4Q6IC 1X7QA 5C7ZA 4LMQE 4PV8B 4B27A 1U6AH 1WBZA 4DR3H 1SOQA 1YSOA 5EEWA 3S35X 4F7PA 4A2BA 4S2SB 3ROLA 5AB9A 4DV2H 5CLXA 3KXFE 4JPSA 1UKQA 5IBLD 2RR3A 1A8JH 3BP7B 5T1LB 4ELDA 4TRPL 4H0LC 2BP5M 5KG1A 4KQ3L 5DYFA 3FDSA 3C6EA 2PPEA 3GQFA 2HG5B 3LNEA 3RFZA 2FK2A 5LDUA 2PKDA 2GJJA 3QA3A 4YO0A 5G4NA 1YCSA 3HA0A 2LAAA 2Q7YA 5DJ8B 4CILA 4EIBA 7PCYA 1EZ1A 4ZTPH 6PCYA 4M1GH 2MNWA 3POHA 4UQCA 3IDIB 2Y4SA 1IGYA 1Q1PA 4AEIH 4TL5A 1JGEA 3V5DB 1NWPA 1YC8A 1J8RA 1VSCA 4XMTA 4KI1A 5DQGA 1T7XA 5EV7A 4TPRH 3QARA 3QNYA 4KJPD 1WFNA 2AJVH 1U36A 3VFRA 3TYGH 3P4MA 1ZA3A 5BR8H 2VR6A 3SY6A 4BZYA 5C92A 1SFOA 2ZUXA 1E2ZA 4APQB 5B7EA 1BF5A 1D9KA 4TUJB 3ME0B 4U6HA 4B3VA 3GJFB 3HRZA 1J0JA 2I32A 1A1OA 5HGGS 1H9VA 3T8VA 4XXWC 4WSKA 3K3QA 3K72B 2ERJC 1S7TB 1MZYA 4LCVA 1A7OL 4P06A 2PO6C 5DVNA 3CN4A 2CUHA 4BFRA 3ARDC 3QCUL 1I3UA 4OM1H 3H9SA 2IAMD 3R0NA 4U2YA 3C60A 4Z7NE 3GMPB 1AR2A 3VSVA 2DPJA 1CGSL 2C7FA 2FX8H 4RSYA 1R5IB 4HF5L 3ZE2F 4FG6D 1M3IA 4ZMZA 3DV6B 1QFPA 5T8IA 2FEJA 1KSRA 1SNRA 1GA2A 4AJWA 1T4KB 2IXQA 4NN5C 4XPBL 4GKSA 3W0WB 4NUJB 4TV8F 1AO7E 5BRZD 4YX2H 4X9BA 1BZ7B 2J5WA 3DGGA 1XF2B 3D05A 5HYJE 1QTPA 1K72A 3SDDC 1JOIA 4Q58C 2ITDB 1ZHLB 1NUGA 1Q72L 1VIWA 3MNMA 4M4PA 1T80A 2FLBT 2UXTA 1Z9SA 3QUML 4JDEA 3EHBD 2FHFA 2DI9A 2X4SB 5EO9A 3WMPA 4QHKJ 4L48A 1IGMH 4OLXL 4RGND 3T0EC 1F86A 3ISRA 4QRPA 4QRQA 1NCOA 1QABA 1A0QH 3FSAA 3O9WB 4X9GA 4YSOA 3JUZA 3VD3A 4NM8H 4EDWL 3V4SA 5DFTA 2Q0ZX 1EUCB 4N8CH 1S5HA 4AV4A 3HPLB 1Z7JA 3QGVA 4IOFD 5L8LB 4UFZA 4QWWC 3DOSA 3QJRB 4PJ7F 4R4FL 1OAKL 2C3WA 2F68X 2IANA 2R7EA 4PCYA 1UADC 5A2IH 2YZ1A 5CZVH 5I75B 4K3DH 4KKAC 1ZIAA 2ED6A 2YQ3A 4KROD 2DOCA 2W71A 2NOYA 2VOTA 4IRJA 4UM8B 1A7RL 1KB5H 2VAAA 4A2EA 4DUZH 3X1FA 1R3KB 2NR6A 4J4PC 3LZLA 3U30C 3KCPA 5KG4A 2IVFC 5DQDL 2XKUA 4E41E 1AI1L 1FDLH 2J6EH 1BZOA 3SBRA 2D7MA 3VXPA 5T1JA 1OD7A 5CMAA 2PPFA 2JTYA 4R7RA 3MFIA 5CZXD 5AW9B 2UWEE 3DA0A 3VMOA 3B6SA 1T2JA 2AMUA 2P9RA 2OW6A 4N2GA 4UIKL 1M7XA 2JXMA 4CDGC 5E8NA 4TV3A 1RZGA 4YP3A 3ILEA 1EA9C 5T3ZE 3JRWA 4G7YH 4LVHB 3U9UB 1CDIA 3BRGC 2ITCA 5FGSA 4WV1B 3VI3E 1FORH 1ZLWH 3U4EA 3LXBA 4J0MA 1MNUH 3R8BB 1KXVC 2P45B 4GQ9L 1MG3C 4EN3B 2AQ3A 1NANH 2V2TB 1KJVA 3FN3A 4R96B 3QO1A 3E6HB 2WBJC 5KYYB 4HOXA 3EJQA 2ICEB 2XXGA 4PSRA 3WIHL 2KI6A 2OMVB 4LSSH 4AXWA 4HUVA 3HKFA 3KDMB 4ZOCA 2OSXA 4BKSC 2CJTA 3GXPA 3RNQA 1HHHB 3Q9QA 3V4UH 1QKZH 5BJTA 4HIIA 4XHQA 1N5YH 3FQWA 1BG1A 4NN6B 4AIEA 2VDOB 1EZLA 2E6PA 3IJ7A 5DURB 1F41A 2DN7A 4MAYC 4ODWB 4PY8J 2RCSH 5JPNC 2P42B 2E7HA 3MV8D 4L0YA 4CSTA 3ORRA 1W72H 3CHRA 4X80L 2WD0A 5C3TA 2ZX9A 4UQ9A 2YSSA 4OGXL 2HXAA 1HZLA 1YEKH 5E4OA 4BQBA 4PJIE 1QR1A 1ONQA 1SYSB 2C1PB 3GIVA 4FFZH 3FT3A 5JW4M 1RUPL 5DYOB 3FH7A 3ZY7A 4PWQA 2NQ3A 1E4XL 4FQQB 3FCTA 1ZLVH 2XN9E 4NN7C 4U4IA 2AQNA 3K1KC 2FPIB 1AGBA 4LP4A 3CFQA 2QR0A 2W7OA 1TWAA 1HH9A 1QLEB 3MRFB 3PG2A 5BV7L 4BZ2L 5K5YA 4LF3A 1T04A 3QHZL 1E28B 4AUJA 3B8SA 1UZ8A 2IOOA 5TQ2L 5KFIA 1KENL 1QBMH 2BVEA 2K8MA 4K5NA 4CVZB 5B1CA 4ELKB 4CSPA 3SOTA 5KG2A 4WWKC 1IAOB 5H37A 2Z34A 4LH6A 3QRLA 4UCRA 5B7MA 1OTUC 1MCFA 3PPEA 4HIHA 2PO6D 5KFKA 4KZDH 3ARDD 4XXDB 1T6VN 4U1SB 5EMYA 4MTEA 4OZIB 4W9IC 1JK9B 4FABH 5HHOD 2IH3B 1XCWA 1AKJB 1U8CA 1NMBH 1FZJA 3UZQA 3SPJA 2C28A 1V7ML 3ARFA 4GBXD 4O2CB 2ARWA 1MWAH 2DLFL 4HWEL 2A74C 2NY5H 4NWUL 5D7SH 2I26N 3JSSA 4PDBA 1HNFA 1LILA 3HKZA 5H35B 2PW1B 1KGIA 1L3WA 1W9XA 3KPQB 4NQDE 4AEHH 1ZJAA 3CDCA 1WRFA 2NY4C 3VXNB 3O2VH 4HKZB 2GT9B 4JFHE 3UABA 4MQ7A 4ZS6C 5C71A 1MY7A 5EG6C 1NCHA 4ED3A 1WFTA 5AAMA 4NENB 4DGIH 4XMXA 4LRNH 5F7HA 5C0BA 3TTYA 2WO3B 2DM2A 2Z7ZA 2EO9A 1GW6A 3HZVB 1OB0A 3Q9PA 1E27A 4N85A 2BMKB 4HX1B 5FW7A 2EXYC 1PTZA 2PXYB 3MRGA 4FLOA 4X4XA 3CPUA 3EJUA 2VUYA 4F2MA 5IESH 4R0LC 4KVCH 4QWWD 1ZETA 3JSNA 3A4DA 2I5YH 4QHPA 3DETC 4QRRB 3UTTE 3WDIA 4KKAD 2VLRB 5E9AA 3LEVH 4QRUA 3H3BC 1U2HA 4XX0B 3BLKA 2VDLB 4Y4FC 4P59L 4RB1A 4PI2A 4XN8A 4IK6A 5LBSL 3V4PA 4M6NH 4J4PD 4XAKD 3F58H 5KVEH 4NPYA 3VMNA 5KVFL 1G1CA 1OF2A 1MCOL 3VU1A 3PABA 1G7HA 5J11B 1EMTL 1W96A 2K78A 3CMOH 3NA9L 2NTFA 4FZEL 3BAXA 1RUAH 4PLJC 2CALA 1ACZA 4H1LA 3HNVL 3DTXB 2ICWA 4ZNCD 2X5PA 4DERA 1UXWA 2CKBA 3G6AB 1XCTA 2Q76B 5GGUB 3O6LL 4PB0H 1GZQA 1SN2A 3U0PA 1FRGH 1SHWA 2BOCA 1R9TA 4P49A 8FABB 5DHYA 4DF9A 2DWSA 1FZKB 4X98B 2W9EL 4TUYF 3QORC 1L5GB 4HPOL 4JRYA 1IRAY 3BESR 2E9IA 4MS6A 5T5NG 4JPWL 2VLME 1U58A 2WBJD 3LH2L 4ORGA 2QZQA 5DD6A 1CGVA 3FT2A 2UUDH 4AENB 2ZXWB 2O93L 1KOAA 1TJIH 4Y16B 2E86A 3OAZK 3ES6B 3L3KA 5DLLA 4F8PA 3GINA 5C44G 3M1BB 3SGKA 3TO2A 1P4BH 2VLKE 3OKDB 4WUUE 1XSKA 1NDMB 3HVNA 4M1CC 2VDNH 4HH9B 1ZWIA 2UXBH 1OT1A 3UFIA 4F7CA 5EBMA 1DJHA 1OAUH 2VGLM 1VZGA 2TRYA 3C5ZA 2TAAA 5F3BB 2CGYA 3UZVA 4XI5C 3LPGA 1V7NL 3EFFB 3AACA 1E2WA 1OAXH 4BINA 4M9OA 1QFHA 3QZWA 3NTCH 5CN2A 4LFAH 5CEZE 1N9PA 2H6OA 3DO4A 1BWMA 4DJMA 3FQXA 5D2LA 4PJGE 4QXUL 4D0DB 3SDAB 4YHYC 3TGXA 3GS7A 2FECL 4HKJA 1IFHL 3QNXA 4D0BB 3PP3K 1PY0A 4WFED 1QQDB 2OJZH 4AL8C 3IE9A 2R7ZG 1NDGA 2DQUL 3CZLA 3TBCA 4YXLH 4G6KL 3IK2A 5TF1L 1KDIA 3CSYB 4XN4A 1P2CA 5E9DA 2VMCA 3WD5H 1CXHA 4DOHB 1FN4A 1TOXA 2AXFA 3VG0L 1BPVA 4FQIL 1QFWL 1OAJA 2OJEB 4DR1H 2QKIA 5CEXA 1S3KL 5FYJH 5HXMA 1F5WA 2G75A 4ONHA 3UPCA 2EAEA 4OCRH 4LNRA 3MOAH 2AGJH 4Z7VE 1U95B 4WWKD 3C9NA 2J6TA 3RDTC 2F7IA 1TEFA 1OTUD 3ZQWA 5C08B 4FNSA 2I27N 4K3JH 3L3IB 4J6IA 3N41F 2X4OA 2PTTB 4KRPB 2QK4A 2D31B 3ZE2B 1YPZF 4G8EA 4U1HB 3V6BR 3DVFA 2EXSA 4TVUA 1LO5A 2DQ6A 2X09A 5H8DA 2ZZUT 2V8LA 3O3EA 2UZXB 3OAYH 4OJFL 4O9HL 5I1JL 2AEPL 3E2HB 3UAJA 5J2UF 3VYPA 2DJ4A 2IAMA 2YPVL 5C8JA 4XBEL 3RPIA 3P0VH 3ZZ1A 4GT0A 15C8L 4X8JB 5DFWH 5K9QG 1HHJB 4LEEA 1XF4A 3P30L 5KT3A 5BOZG 2BSSB 3REWA 1UB6A 2HKHL 5IP4A 5MEND 4BKLB 3STZB 3HHSA 4ZS6D 1JP5A 1NLDH 2CIKA 1UG9A 1DQML 4HWUA 4UF7C 2M26A 3BN3B 3B7YA 5CIPH 4RRPM 2VQUA 5EORL 4P5MB 1QBLL 4NLGA 5T3XD 2H2PC 3BWAA 1FG2B 4J9OA 2MHAA 1AQDB 2EXYD 1GAFH 2BWIA 3Q8FA 2X70B 2CW7A 3DETD 1NGWB 2HT2C 2XT1B 1OB1B 4XNMB 4P2QE 3BSZH 3KAAA 1YZZA 1NC2A 5EZJB 1OARL 4Y4FD 4TQHA 1I8IA 1CT8A 2CUAA 2JCCA 5G4MA 2WKGA 5G4OA 4KHXL 3TA3B 4FULA 1CFNB 3F7VA 3VM5A 4YWGL 1AXSB 3O8XD 3TS8A 2DTMH 1A2YB 4F7EA 1XVSA 5E6IB 3FUDA 1MCLA 5EDXA 5F7EL 4PLJD 3AB0B 3MX0B 4UQ3A 5BS0E 1SXZA 5FECB 5KSVA 2WAQE 5CJOH 3BUIA 1GZPB 3EGSA 2UY6A 1THAA 4DHLA 3IXTB 4Q0XL 1GW0A 1JHTB 4P4KB 3UJJL 3W2DH 4PV9A 3KYKL 2EQDA 4I50F 2C1OA 4QWCA 4F7KA 2PCYA 5AKRA 1T6BX 1P5UB 3BVVA 3LRSA 1MJJB 1QWUA 4XMPH 3WHXB 2OH2A 3SPHA 2B5IB 3L5XL 4AVIA 1FE8H 5G55A 4PU2A 3WIIL 9CGTA 3PAZA 4IBSA 3QORD 2VMEA 1VFAB 2FHCA 4ZFZB 4HD9A 1Q9OB 2W9DL 1RUMH 4WZ9A 3V0AC 3GMQA 3GC3A 3S5LA 4GUQA 2P44B 3NH7L 2CJUH 1SZNA 4XWOC 2DLIA 2NT1A 1ZSDB 4GG8B 2WQAA 1AGEA 1BQKA 4ONFL 4ZMWA 5I8EB 4G7QB 3TVMA 3BDBA 4GG6E 1H3TA 3O45B 1EHXA 5HHPB 3MJ9A 2C3XA 5C0CE 3TBSA 1M9WA 3FBKA 1UCTA 1HWHB 1CG9A 4U1LB 5I47A 5JZ7C 2YRPA 1MCDA 2DYRB 2EDXA 4F8QA 1MLBA 5GS0C 3UPAA 4A55A 3FB6B 1MLCB 4Q6IA 4YAQA 4XI5D 4PW4A 1QSVA 3QEGL 3K71A 4X9HA 1MN4A 2LFEA 3KPRB 1F6FB 4A68A 5F7WC 4A3LG 3UAAA 3SI8A 4QKTA 4PJ5B 3WNPA 5T5FH 4R8UB 1T2QL 3GMNB 5IUSA 3P0GB 2DBJA 5FO7A 2I85A 5T5NF 5C0FA 4NP4H 1RZJL 3BZEA 2V7NB 4FLHA 1NKRA 2PYEE 4W9GC 1JTOA 2H1LM 3O3DB 5AVZB 3QUYC 5L8JB 2ZWYA 4GC6A 3QQ4A 1H5BB 1IEBB 2JF1A 3B9KC 3CZSA 5T3ZL 3QULB 3FQYA 3VXUE 2CGRH 3IJYA 4WCYH 3HJEA 4UBDD 3PV7A 1HHIB 1C5DB 1AHWC 1HI6B 3ETBF 5D9SB 4G9FB 3WS3A 1QI5A 4KJWC 4HT1H 4Y8VB 4MV1A 1FC2D 1CXKA 4NUGL 2FDBP 3LD8C 4X99B 3MBXH 2WLJA 4L4VB 4L8BB 3E9UA 4P2RD 4AUYA 2K70A 5I6PA 1EHLL 3EAKA 3B83A 3CC1A 4LF7H 1D5BA 3RDTD 5J12C 4X7SL 4HG4K 1KYDA 2ZUVA 5C97A 1MAMH 1TYJA 3QNFA 4KZCA 1OE1A 1A4JA 1TVDA 3H42H 2EC8A 3O6ML 3T08A 1T1WA 1BDYA 1HSBA 2AABH 3FCUB 3PAVA 3PQYD 5DS8A 3P9MB 3VQ2C 4E42A 1HFUA 3B8YA 1SHXA 1C1EH 2PO6A 4OZGA 2C3GA 5DEJA 5ANMB 3ARDA 2E27H 1HCZA 4KY1L 5SWZD 2I7OA 1X7SA 1TPXB 1YYLH 1KJ2L 2R87A 2VN5A 4JDVB 4ZW3A 4ZAKC 4YJ3F 3JZYA 5HHOA 2I24N 4H20L 2JA6A 5I73B 1JF1B 2MQCA 5SX4I 3E3QE 4G6AD 3TFKC 2DKUA 4PJHA 3SKJH 4KJQC 2IF7A 3G5YA 1HXMB 4DVBA 2V59A 2IFFL 1KT2A 2WHVA 5GIRA 3TNMB 2OL3B 5FB8B 1SEBA 1MW3A 3W9DB 3D39D 2Q6WA 3VXMB 2Y7MA 5DG7A 4MYPA 3EIFA 2FWSA 3DX1A 2ARJA 4J3OC 1RUKL 2RA1A 3SDDA 1KJQA 4YSSA 4LPCA 4OGYH 4CKQA 1SVZA 3CBJB 2KZWA 1UWYA 4DN4H 1I1CA 4HFUH 4UNVA 4HALA 5F7NC 5EFIB 3C6LD 1XV8A 3SBWC 3T0EA 1T21B 2BNRD 2ZCHH 1XR9B 2I07B 4O5LL 4MMZA 4HXBH 1UWEH 1IGTA 2DQGH 2J25A 3F8UB 3HHRB 5I1IL 1SOXA 1X9RA 1YYCA 4CC6A 3LV3B 2QPEB 2OMUA 1FFRA 3EO9L 1TO4A 3NP4A 3MRLB 2Q7AA 3VJ6B 2WQ8A 3EYFB 1XH3A 3MCG1 3QR0A 4HEME 4IBLT 4CN4A 4J4PA 1G6RA 2HSIA 1J9TA 2CK0H 4NZDA 3AY2A 4GW1B 2V9QA 4D9LL 2WMPB 2W9BB 2J20A 1M9SA 4KKQA 1EX0A 4ED1A 2CIIB 1E5CA 1BF8A 2YUWA 3WTVA 2BC4B 2WVSA 1B0IA 5FGCE 2O5ZL 3ARQA 1NBCA 3EDFA 3G6DH 4DL4A 5HHNA 2IBKA 2XPGB 1PG7H 3LQAL 5BRZB 5BUGA 3G6VA 3SQBB 5JPMC 1EZVY 4X6BA 1PS3A 5AQ0A 3T2QA 1CZ8L 3CTTA 2R29A 3MCKB 4CW1A 1DBJH 3FT1A 3QPXH 4XWOD 4AQ1C 4I7ZC 4JKNA 2IIJA 1KXVA 1OSEA 3BAKA 3D3VA 5LO7A 3ZKNC 1UH4A 1FV1A 3DLQR 1GHFL 4Z0XB 1WFJA 2RH0A 4TF4A 3O3BB 3NEXA 5I23A 2H5UA 3FB8A 1FYTB 2R4SH 2WBJA 4BUHA 4CNIB 1QEWB 2D2CC 3OHMB 1X5HA 4R8WL 5AFAA 1FA4A 4LDLB 5CEYB 1YMHA 2H47C 2MTPA 2ZX5A 5JZ7D 2OXGB 3ARPA 2XCMC 4PCTA 4BZ1H 5MEPA 5GS0D 3KPPA 4IGBB 3S36L 4P4RA 4XE5B 2VDML 2OCCB 1KCKA 4KKPA 1MG2C 1BVLB 3L3GA 4KROB 2YS6A 1UD4A 4QIRA 3KHHA 3QR2A 4PRIE 1J5OL 5E00A 1X4YA 3UACA 4A6YL 3IDUA 3X13B 4OD2A 4MAYA 3TV8A 4KU1A 3RFCA 5JPNA 5DSCA 4UCSA 4A7GA 4OI7A 1KLFA 1FGVH 3K4AA 2IO5A 1ZIBA 4JRWA 3QFDB 5JQIB 5JR1H 3ZSSA 3VRJB 4QTIL 1I7ZA 1NGQL 1VGKA 4EDXB 4X9IA 2WV3A 4HS3A 2BW4A 2P8PB 3KYNA 3B9KD 4F7MB 4CVXB 3T0AA 3OKOA 4GAYB 2D0GA 2NXYB 2YD4A 3RWGA 1BIHA 4AGQA 1LO0L 2F61A 3L2LA 3PJSB 4KJWD 1UACL 4E9SA 4A2FA 2Z64C 1EO8L 4A1RA 5I66A 1TYRA 2W57A 1QUPA 4WK2B 4HWBL 3P2TA 2WYOA 4FF9A 3MLUH 3AFLA 4ALAH 1EJOL 4G8GA 1T1YA 4M5YH 5I76B 4M7EA 4JRFA 1YPZB 4X6CE 1VCBC 2XWRA 3RURA 2IFGA 3QCVL 2FQGA 1KIRA 4M02A 2GQHA 3E1F1 1ESOA 4EBQH 1ZD6A 3ZMNA 4WWKA 4E5XB 5E1IA 4TLUA 1CFSA 5GQBA 5KVGH 3KEHA 4UCTA 2QL1A 4YH6A 3QPKA 5JQ6L 3QUXC 5GHWH 5J1AA 3IJSB 4QTHA 4NO5A 1Z2OX 2XG5B 5T1KD 1BFOB 1Y1UA 4UYQA 4YAJB 4XOBA 1H9DA 3X3FL 1N8ZB 4HEPG 2F8OA 3RZCB 2DMHA 1GOHA 2EDFA 3V6ZB 5MHSD 5CEZL 3TFKD 2KQNA 3M46A 2A74A 4KJQD 3TINA 1U41A 3GBEA 1CIUA 4LSXA 3FQ1A 1UUNA 5F1KC 4F5CA 1MH5B 3T6ZA 1E4FT 4PW9A 3FSOA 4J3OD 4JY6A 3SKNA 1RSYA 5K1VA 2X6MA 1OGAD 5MENA 3V6HA 3O2WH 1U3YA 4EBDA 2FT7A 1WFOA 5GRXG 1HEJC 3Q8BA 2BVPA 3DX9B 4DZ8A 3ATFA 5EF3A 1E90A 4WO4C 3SKOB 3VVWA 1ED3B 1ILUA 1FGNL 4QIWE 2V17H 1TA8A 1A1NA 4GAJL 4H44C 4KK8C 3NN8A 1MQ8A 4R0LA 2EDMA 3TBWB 4FJ6A 1TWGA 3GLDA 3VXRD 4R7XA 5KFUA 5JYMA 4Q45A 3K0WA 5GS2H 4IDJH 3V0VA 4XN2A 5HYSG 4IIZA 4FXLA 2EH8H 1ZSHA 4JKKA 3RTLA 3AG1B 4Y4FA 4JI1H 3MLSH 3ECBA 2R51A 3KPSD 3D85A 3DXAE 2YBRA 1PZSA 1WAAE 4QGTA 2FGWL 4K71C 4XYLB 4FP8L 2ZAHA 1A14L 2C3HA 3VPDA 1S9YA 3MO1B 2R0ZH 1HINH 1JHLH 4GBXB 2ADGA 3MRNB 2R8SL 4XVSL 3INOA 5EOQH 2WXJA 4G6JL 4OV6F 4XPFL 1RJYB 3VFMA 2AJXH 3QRGL 1M1XA 2ZOUA 5JDJA 3FMGL 5DHVA 4JO2L 1RJPA 3JAMW 1S7XB 3WU1A 4I8DA 3O6FC 3HOVG 2R93A 1E30A 1T89A 2BXYA 2YD0A 4P5TB 1WEJL 3KTMA 3ZKND 1M1SA 1YY8B 1X5KA 1V05A 2WVTA 4K4KA 5KSUB 3B34A 3ZHLA 4PS4H 1ZHBB 3GIQA 3CN1A 3GIDA 2F53E 4JO4L 5HHVH 3RV3A 1E5ZA 3Q8CA 3GIPA 2XY1A 2NW3A 5DC4B 5D5ME 3BQ2A 5E8OB 4ETQB 3I85A 2FVNA 3V4VL 4DN3L 4YC2C 5LWYH 1FO0L 4HJ1A 2AV1B 3VD2A 1SHSA 3BG5A 2GIXA 4D7PA 1FIGH 1HNGA 2R1WA 3VFVA 2YCHA 3GSNB 1QHOA 1ND0B 1BQSA 3KH3A 4I9WE 3EOAB 3T65B 4XCEB 3QAQA 3CN0A 3ZE0E 1HEZB 3RTXA 5E4EB 2YAEA 4HXAH 5C07E 4NRYB 4NQEE 2K6YA 3UQ8A 3TESA 4GO9A 5IROA 3NCBB 1G43A 2GB2A 2YRLA 1OP9A 4OZFA 1G4MA 3STLB 4KJYA 2E7LC 2HT4C 4ADIA 4MV9A 4JLRA 3F7QA 5FHBL 3T1FB 3TCLB 3EFOB 3GUTB 1I94H 3H3KA 2KDGA 1TZGL 2OKMA 3FB7A 1OK0A 1I3GL 3ZUCA 2IALA 5DJZB 5GGSY 1HEHC 2J8UE 3CXHK 5D70L 3KGSA 1F4XH 2CPCA 5TH2A 3VE0A 4C58B 2FK1A 3ZT5A 3ARBC 2ASLA 4AQEA 3HZKB 4FLRA 3MUGA 4OZHE 1NM9A 2JA7A 4LSTH 4OF0A 3WNIA 1AGDB 4W4NA 4P2RA 5EEYA 1HJBC 1KCLA 4ZW6A 3K6DA 3RDTA 2WXLA 1OY3B 2GK2A 5GJTH 5H37H 5DG8A 1UCBL 4V11A 4D9QE 3BPLC 3UCQA 5I6KA 2N0KA 2BRQA 5F6HJ 4NAQA 3QUXD 1JTTA 5C0EB 4O02L 2WIIB 4OTXL 4WY7H 5B3SB 5IMOB 1XNRH 1MCBA 3WG7B 4GFTB 2GIYA 4TSBL 3MLRL 1AG0A 3PQYA 4LLDA 3RPKA 3V7MA 1WUZA 4LLQA 5IJBC 3BX7C 4JPIA 3U7YL 5JO5A 3SD2A 2XGQA 1PSKL 2VB5A 3GMRA 1J0HA 1JNHA 1RY7B 4BH7A 2QSQA 4IEFA 2WO4A 1ZAGA 5FKAA 1F6AB 5LCVA 2FYYA 4EZJA 1PKQE 3S37X 4X62H 4IKNA 1ORSA 3RY6C 3QIBA 4MJIB 1NAMA 1QTSA 3PF2A 2CZNA 2H6PB 2J88L 1BGXL 4BWSC 2EIBA 3VNZA 4BD4A 1IGCL 3J81W 3BLBA 2ETWA 2WLIA 2WTRA 1LMKA 2XX0A 2ZF9A 3CHOA 4LSQH 3D39A 3QB7C 4QMEA 5EWIH 3GRGA 3KNBB 3DJTA 3PZPA 1P7QA 4LPVA 4YVUA 1VA9A 1E43A 1LDPH 4WO4D 3MYJB 1OD9A 5J6HB 5D1ZD 1N56A 1BBDL 1BBJB 4Y5VC 2R4RL 3NZHL 2WQRA 1YAZA 3OKEB 1U8LB 4UIMB 5CILH 2NY7L 4L8DA 4KK8D 1DVQA 2FEEL 4P57B 2BNRA 3O2DL 4LPTA 3T4AB 2L0DA 4EO5A 5AVSB 2JKIS 3B2MA 4O4YL 2ZNWA 4PREB 4PTTB 2GITB 4V1DA 4X7FC 4R7NB 5J56B 1EZSA 2KH2B 1B04A 3KLHC 4HKXB 3LQZA 4FQCH 1VAJA 3BJYA 2MKLC 3RIAK 4NWTL 5KEZA 2OZ4L 3LZOA 1JZ3A 2Y6SC 1AHMA 3VM7A 3NUKA 4NO0B 1EDYA 1WZAA 2VDKH 2BP3A 3F7YB 5AOZA 1ZGLP 1QFUL 4DV1H 4OAWB 1WCMG 1HH6B 1AN7A 1IM3B 3HOGA 3M17A 3V9EA 5J9PA 1HZHH 4P3CL 4QXTA 3SQOH 4KMTL 3I6SA 3CUPA 1H0DB 2X1PA 5DEFB 5FUZL 4IJ3B 5F7DB 5BZWB 1NGXB 1Q9LA 4FQ1H 4H1LH 1A6WH 4AM0B 4BFIA 1OP3H 3VMMA 3R1GH 1T0MA 3PW7A 4YBLC 3O6FD 1IBGH 3MCYA 4S1QH 1OP5K 1CDUA 3IMUA 4IMKA 4PVNA 4RFNB 3SE9H 5B1AB 4AQOA 2EYSB 1S7RA 3L7EB 2VDRH 4H8VA 5C0AB 4XE0A 4K5OA 1SXSA 3RGVC 5F9JA 5ICYB 3TXAA 3D6GA 2CMRH 3X12B 3T5HA 1NBVH 1Y1VA 4R9HA 4AJ0A 2LU4A 2BY3A 3FO1A 3DVNA 3NJJA 5FPRA 1UKSA 4PGCA 1XIWC 2FT8A 5EU6E 1VZIA 3P11H 1T7VA 3V5HB 4RB3C 1NMCC 2IG2H 1XH1A 3QDMD 3V5KB 1T1ZA 1DUYB 2FK3A 2NY1B 4IU2B 2OMTB 4P2AA 4U7CA 4WJ5B 3FUIA 3CFBB 3N9GL 3BQ1A 2Y0SA 1LXMA 4OJYA 4XNUL 2C5DC 25C8L 5D7LB 1WTLA 3DK2A 5FKPB 3ZL1A 2ICWI 2WXGA 2F74A 3I6GB 3ASWA 4IIQC 2NXZC 2VISA 2P5WE 3VUAA 5A2QW 3R06B 3NCCB 3O8XB 4LHUD 3BUDA 3IRCA 2PABA 1F2XK 3NIFF 5T1MB 1CIDA 2PUQT 2YRBA 3HUJE 3ZE1E 4TUJA 3ME0A 1JWMA 2BVYA 3ZYOA 4FTVE 1L7TH 3GJFA 3FAWA 2YD2A 2EVHA 3FOLA 4EE2A 1VFBB 2HT4D 1I9JL 1PZUB 2A73A 1Z2NX 3QUYA 2H8PB 1U3NA 1BZ9B 3B9KA 2OFQA 2MCPH 2CHDA 5CGBA 1MAJA 1MF2H 1YA5A 1XEUA 3FSWA 4N2IA 4DEPC 4ZODA 4CUCA 3GMPA 2YD9A 3QORB 2B16A 1R5IA 1LVEA 4CGTA 1KBPA 3RX5A 5EU3A 1Z9MA 2R2HA 4ETYA 4NQCD 1KEGH 3RB4A 3MN8A 4JFXB 1RQ5A 1T4KA 5ACZB 3WUWB 4NUJA 2P7TB 4XMLH 5CBAA 2F7RA 7FABL 1AO7D 3HBGA 3IE4A 3CFCH 3I50L 4JVWA 1XF2A 4GFXA 5AVRB 5I17A 1EK3A 4PS7A 5BMFH 2QHRH 3QK0A 1J8HB 5CU9A 2AZAA 2MQ3A 2OW7A 5IB3B 4KOBA 2HYMA 3LYRA 3WJLC 4ELME 4X6DB 3JWOH 3RHWK 3GRWH 4MCYA 1OIOA 2K3HA 3X2QB 3Q8RB 2DW5A 4ZAKA 3SJVB 5HGHB 4U1JB 1AZBA 1QLRA 3ZTNL 5JVLA 4ECNA 2X4TB 4S0SD 1XGRB 2F19L 4QXGL 5B8CB 4E68A 2VKXA 1DEDA 4TXVB 3MMEB 3HC4L 3LNIA 1EJ6A 3UYRL 4OLZL 5EN2B 5L7XH 1J1XL 2ODIA 1Y18B 3MUZ1 1A66A 1PJ9A 1OGAA 2Q3AA 4YSTA 3HE7C 1UH2A 3BAWA 2L7UA 3IU4L 4L1SA 1EEQA 1OE3A 4W1TA 4N26A 5C6WH 4PJEF 2UUBH 3EBHA 3KPLB 4QWEA 2DD8L 1GGIL 3IVKB 1FZOA 2G0LA 4WGWB 1UT2A 5IWLC 1LJMA 1G9NH 4ENEC 5HDQL 3OUUA 3CK0H 4I2XB 1PQZB 4HPHA 3KW7A 3KLHD 5I74C 1CI3M 5DGQA 1QYGL 3ARRA 3A6CH 3II2A 4K15A 1ROWA 3KZ8A 4IM8A 2B4CH 3KEDA 4N2FA 4ODTL 2Y6SD 1NPNA 3VXRA 1ZVSB 4FQHB 5DVMA 1C16A 1IAKB 3KDPB 3SPIA 4KITB 3EKCA 3I02B 1CR9H 1DDHA 4QHMB 4CRPA 1NGZA 3G6JF 5C7XL 1AACA 2F5AH 4DV3H 1REIA 3KPSA 1DVYA 4JQIH 3CXDL 3KWXA 2JKTM 1CDHA 2W8CA 2X9WA 4TQRA 3BH8B 5TDNB 2GAZB 1CBVH 5I5RA 3FQ2A 3RBDA 3BFQG 1WAPA 3W11C 1OKEA 3KWVA 3PW4A 4EXPX 4GSUA 2JTDA 3NFSL 4P04A 2BNQD 4GIAA 5JPMA 3JV4A 3RGVD 1QO3B 3F3HA 3AGVA 4ODWA 3HI6H 1FAKT 4QHKI 2A6IB 3WKML 5D72L 4QRFA 2VSMB 4AQ1A 4DKEL 1A6VL 1TLKA 1XIWD 3KR3L 1XAKA 2B08A 4X8XA 2QQKL 3C6LB 1DV1A 2D9CA 3FU8A 4LSRH 2IH9A 4C56B 4JPVL 3MJ9H 1VLXA 1S8DB 1SYSA 2C1PA 2CLRB 5D1QC 5DYOA 4LVOC 1GTFA 4RNNA 1CK0H 1YN7B 4AQYH 4K3EH 4WI2A 2XN9D 2M2DA 2NXZD 5IFHL 4HOZA 1PG7W 1RJLB 4WEBL 4PGEB 3MRFA 5LXGH 3ABMB 5I30L 5C6TH 1BPLB 3U0TA 5DT1H 3EYSH 4WTZA 2ZCLL 3FZUC 2WB1E 4FS0A 3MBEC 5ES4B 2NNAB 4OVUA 1LK3H 4ODVH 1YUKB 2AVGA 2ALZA 4Z0BL 5AW3B 4YHIB 1YQVL 1MCWM 2R2EA 3E0GA 1YMME 4L1DA 4TN9A 3TOPA 3WKYA 3CDFA 4AZ8A 1BQHG 2VQFH 4NZJA 3APCA 3DX3A 4UOZA 5ISZA 5IFAH 2R0LL 3GSRB 4PJFE 4X0KA 2ODHA 4A3KG 4OZIA 1U33A 1B4JL 4XP6H 4DGVH 5GJSL 2IH3A 1AKJA 3IKCA 1AMXA 2YAMA 4O2CA 2AI0H 3MFFB 2EYTB 1QBBA 3OGOE 1DBMH 2CO2A 3THMH 2E9WA 4YDVB 2E0PA 3PW0A 1JI2A 1QD0A 1G7PB 5C09E 2BFGA 4YHKL 2FMAA 3BRDA 3MRRB 1K4DB 2DIAA 2ZOKA 4PJAF 4G1MA 5CGTA 3KPQA 4YZWA 3AREC 1ZEAL 5DS1A 5E03A 1FNEA 2P5PA 3R0MA 3FSVA 1HN1A 1YNTA 4Z8FH 1V4YA 1AIZA 4JFHD 5LB1A 1UWFA 3BDXA 2XETA 4Y8DC 4BXSV 5F8RC 3TT3L 3IDYC 5DVLA 5EC2B 2XX1A 4JRXB 1ECZA 3QUXA 2XV3A 3QUMB 4UOJA 2EDHA 4PY8I 1OCRB 4WGKA 1AXTL 4GIPD 2AEWA 4G83A 4I0CC 2DIKA 2YKLH 4PJDF 5FM5M 2XWBB 4L3EB 4YHOL 1D3CA 1KBLA 3WFHA 2X7LA 5FM5O 1CDJA 4QXVA 4QRRA 1YN6B 2ADJB 43CAB 3C0FB 1MCSA 4NXNH 5CJQL 4HCIA 5DJXB 2V9RA 3BABA 4CC5A 1R33A 2PR4L 3BWUF 5ERWA 1OAYH 3Q1SH 2DBLH 1M71A 4N20A 5ADOH 3HE7D 3Q1KA 5DMIL 3VG9C 4NB7A 3L2PA 3P1VA 4G42B 1JF5A 1AZRA 2V2WA 1AHWB 2HFGH 1MFEH 3FT4B 1DSYA 1JWSB 4LL9A 3SE4A 4CGUB 3LKPB 5FC9A 4DKAA 2OK0H 1PZCA 3ARWA 5I19L 1WWCA 2WZPD 4ENED 2X4UB 3L3DB 5AD0A 4ZD3H 3EXJA 1X5MA 3MODH 4HV8A 4J6RL 2MJWA 3U46B 3MZTA 2F54B 5E2UL 1IAIL 1U42A 2CO3A 4O2AF 1MJ8L 5TFSH 1UH3A 3G04B 4OY9A 2V5TA 1FZKA 3HI1B 1A7PL 1B0GB 1PLBA 4LDCA 2L7EA 2Y7LA