3N41B

Crystal structure of the mature envelope glycoprotein complex (spontaneous cleavage) of chikungunya virus.
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
338
structure length
337
Chain Sequence
NFNVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDRTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 envelope glycoprotein
publication title Glycoprotein organization of Chikungunya virus particles revealed by X-ray crystallography.
pubmed doi rcsb
source organism Chikungunya virus
molecule tags Viral protein
total genus 64
structure length 337
sequence length 338
ec nomenclature
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2400 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n41B03
2.60.40.3200 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n41B01
3.30.1490.280 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3n41B02
3N43B 3N42B 3MUUA 3N40P 3N41B 3N44B
chains in the Genus database with same CATH superfamily
1CE1H 1WWWX 3BEWA 4X9BA 1JPSH 1EVUA 3IGAB 1HI6A 1RZ7H 5FAAA 3G6JE 2CA4A 3WSQH 2R92G 4L0PB 3RWIA 4L5FH 1J8KA 3G5YA 4FA7B 4YBLC 4BFJA 2R0WL 3MBXL 3HAEH 1DV2A 4KAQH 3SCMA 2CKBH 3H4BA 3WFDL 4NDMA 4Y8AA 4MQXD 1JPFB 2FZ3B 1U58B 5LG6A 4WI5A 1FYTE 2DBLH 3RBGA 1HC1A 4JM2C 4QIRA 2MQ0A 4UF7C 3IGLA 4ZOLF 5AL0A 1PLGH 4D7PA 3SQOH 3FT4A 3B9DA 4PJHF 4ZI8A 4FTDA 1N70A 4HEMA 4YBHA 3AROA 4HH9B 1BEYL 1CBJA 3RB4A 5EFIB 4DUYH 5I82A 1P4LA 4NNXA 2NY7L 3QQ4B 2E74C 1NBQA 4N68A 1CYXA 4NHCL 5C3EG 4PIRF 3T04D 2EKJA 4GRWF 3LEXB 3GJEB 5CBAB 5LN8A 1YEKL 2ICEB 4C58B 3BDYL 3U9UB 1GS7A 3ZDWA 1UXSB 1D5ZA 4ABVA 4LVEA 2RACA 1KEGL 4YQWA 4ZNEA 1YPZE 1BBDH 3ABLB 1FVCB 3WLBB 1R3JA 4O3OA 4DLKA 4YUEH 1PVHA 1ZLSL 5JHLH 4R97B 4PN6A 4K23L 5IUSA 4TSCH 2VC2L 4HFUH 4P5RA 1Q90A 1IBGH 3WJJA 5LXVA 1SFDA 4M3HA 4G7VL 1WEJL 2GSIA 3VFWB 1CYWA 3TM6A 1QKZH 3KXFA 4GRWH 3P73A 5ABZA 2ZAIA 3BIBX 3VD2A 2V7HB 2DI7A 3BX7C 4M5SA 4Y2DC 4HKZB 4LLWB 5HDQH 3PO2G 1BF8A 3VE0B 4AXWA 1LE5B 3WFBL 2AXHA 3IKKA 3K0WA 4GXVH 4R6UA 2QK4A 2JKJA 4IMLB 3BVWA 3MFGB 1YJDL 1P84K 2XTJD 3UO8B 1YDPB 2P8LA 1N68A 1X5YA 2XFXB 5I1IL 1GSOA 4UFZA 1E42A 4PJ6A 1HJCA 3KLHD 1BJ8A 3V4UH 1JWSA 4FYSA 3L8QA 4NWUH 5C7XL 1KCSH 1AGDB 3RTQA 2YZ1A 3B7UX 1I85C 4FXTA 4KI1A 4WWKA 1KXTA 4S1RH 3CC5B 3TFKC 1P1ZA 3PUCA 4Z7QB 1S7RB 1UOWA 4GAGL 4GG8A 1SRDA 3CFBB 3RVXD 4U6YB 4XNXL 4M7EA 3T6ZA 3N06B 2QVTA 4O2CB 2R7ZG 2ORBH 4N2IA 2Z7UA 3QJFA 2AEPH 1TJHH 5DLGA 4CGUB 2H1LM 5AD0B 2ZD0A 2FWUA 1MWAL 2Z35A 3OR6B 4CGTA 1X4XA 1R34A 5D7IE 4FBUA 1YA5A 3K71A 4XB3A 4M61A 4K15A 5HDOA 4XN4A 3J27A 3MLUH 1FL3B 1P6FA 4IMKC 3VGBA 4HWBH 2F53B 1X5MA 4LKCA 4FQIL 3VQ2C 2WTOA 1RK7A 1T4WA 3M1CA 1TEYA 1IBDA 2B59B 4LSDA 1CB4A 2V2XA 3TBBA 1E90A 1FFPA 4MZ2A 4U33A 1JZFA 1NEUA 3AQYA 3EGDB 5DK3A 1OOWA 3K72B 1LMIA 1VESA 1RK0A 4OLWL 4G43B 3EZJB 3GSRA 1S9VA 1CK0L 5E4EC 4P3CH 1T21A 2FBJH 3LKOB 2BR0A 1NDMA 1HJBC 1FLTX 3FONB 3UGUA 3KWTA 3BIAX 4XWGH 1HCYA 4XCEB 2YPKB 1KIUA 3ESPA 3WFZA 3LS5H 4AYMC 2IXQB 5TJWK 4MA3B 4NRYB 1DL7L 4YOKA 4CVZB 3MKKA 3OXRB 1RSFA 2WJ5A 2G3NA 3TCLA 1GJUA 4UDTA 5D93B 2EC8A 1CFTA 2PYEB 4JM0A 3FFCD 1CGSL 2NR6D 2ZKMX 1CZ8H 5KFUA 2F8XC 1AZCA 3Q7JA 5DHXB 2B08A 2GI0A 1Q72L 4DR4H 2KLTA 3LZOA 2IV8A 4DP4X 1HFUA 2YN3A 4Y4KC 3TF4A 4OD2B 5I1JH 1Q0XL 2VITA 1NCCH 1KELH 3VFGH 4WY7H 4S0HA 3IPFA 5IEHA 1AZUA 1IC0A 1JI2A 2G5BA 1ND0A 3DXAA 4MA8L 1HU8A 4FHKA 1NOLA 3JYBA 5GGQH 5HXMA 3RJDA 1NKOA 4HLZH 4NQCB 2D4FA 1D7FA 3V8OA 3K5RA 4DV5H 4E5XA 1ZLUH 1XFPA 4IRCA 2OMVB 3RL2A 2MIZA 1TXKA 4IEFB 4P3DA 5HGHB 5LP6F 1U95A 2NDGA 3JSSA 2HFEA 3MV9D 1QMUA 3Q1EA 5T33L 4R96B 1DQDL 1EBAA 3P0VH 2DL9A 4MSWB 4RMRA 2J4WH 1V3JA 3P9MA 5BV7C 3SE4C 4J9SA 5I1AB 4ED8A 3B1UA 1BAFH 3UBXA 2NY4D 3T5WA 1A7NL 5ESQA 3RVUD 1EEUA 1KN4H 4XRCA 1HXYB 5E8NB 2W07B 5D8JL 3T9WA 4X99B 3Q8CA 1FBIH 1Q9KB 3RBDA 1IBMH 3D3VD 3V79C 3EO0B 3MJ9L 1KJVB 4MASA 1G6RH 1YY9D 4Y8VB 1ASPA 3FNKA 3V6FA 3MWEA 1C30A 5D7EA 4E9QA 3ARGD 4TOYL 2KBGA 5C09D 1YUKB 4LCCA 1MHCA 3HZMB 3WKML 5ECGA 1BFVL 2YPLB 3KM1A 2Z6FA 3OHMB 2GIXA 4XX5A 3JUZA 1GC1L 5DJYA 3T77A 5AVXB 4F2ME 5F9JB 3VPCA 1MUJB 5CJXA 1MVFA 3SD5A 2PYFB 5FGRA 1SOXA 1IM3D 5FYKH 1HZHL 3PL6A 3HKZE 3QNYB 1OPGH 4G6JL 2CR6A 2AI0L 4JHBA 4QHUB 3BVVA 3FAWA 3CVHB 3QJZA 3NJHA 3FUMA 3GJFK 4TQIA 2Y06L 5CEXA 5ISZD 4P2AA 1G9MH 4EZMA 2NNFA 4AGMA 1WBYB 3FN9A 4S2SA 2YPVL 2UVVA 1XEDA 1KWGA 1D5BA 3UACA 4TRPL 2EXTA 3VDCA 2ZP9A 3I84A 4XMPL 5A43C 1NLBH 2OR7A 5GGTA 1XF4B 3H9SB 3MUJA 1F3JB 2G30A 2WWKO 5FFGA 4NERA 2OL3B 3FH7A 2VGLM 4H5SA 4Q9RH 1UA3A 4U4BA 3IBEA 3TZVC 4XP1H 2CR0A 1NPNA 2I9LB 2R7LA 5DRWA 2NSMA 4QIWE 2XN9B 2VLKE 3HR5B 3NUKA 4IU2A 3O3DA 4B5EA 1S0NA 3LY6A 3GSUB 4PB9H 3W38A 1OM9A 2MQGA 4A2LA 2V2WB 1RMFH 3LD8B 4HMCA 5DSCA 4M3JA 5L9DH 4H25A 3GLKA 1X4YA 3BGFC 3DX9B 4DR1H 4HIPA 1XIWA 2FT7A 1F11A 2ZT9C 3BN9C 4BQ9A 3WENA 3PFUA 1ZA3A 1QAWA 1RUKH 1UD5A 4CA4A 2J6SA 2WBJB 1RKRA 5KFPA 4I7ZC 4LCVA 4M1DH 1ITBB 2ZWYA 3HRZC 4V1DA 2ZX9A 3BPCA 3O9WD 3BPNB 1F2XK 4XAKE 1ZGLM 2Y7OA 3STZA 2WSPA 1EEZA 2ZUQC 1U8QB 4UILH 1JDBB 2A0LD 3TQTA 5C2BH 4O4IF 1JBJA 1DVXA 3TVMB 1MCNA 1HZKA 3PHQB 4GW1A 4L3AA 3PDGA 2VR4A 3NIGE 1UA7A 4NQED 5IW1A 5MEOA 5FK9B 4NQUA 4JM4H 3QJTB 4N0CC 2NYZA 1ZVYA 4GO9A 4PJIE 4R7DA 5EIIA 3HS8A 1K2DA 4DGUA 3MRFA 2FPPB 3F5WB 1RULL 5F1SA 3NFSH 3O3BA 4JO3H 3KTMA 1P2CA 3KYMA 4AIXA 4JFPA 3TT3H 5EWGA 3LXUX 4ETYA 1R5IA 1H8LA 1JZIA 4OCSL 5DI8A 2Y36H 3PJSB 2OMZA 3V6OA 2QSVA 3V0VA 3LNHA 4M6NH 4B6ZA 4NO5A 2FEDC 3PXHA 3QXDA 5JXEC 5CFAA 2L3BA 2WUCL 2JE8A 2XZQL 1WBXB 1U8CA 5MHSD 2JCCE 2V0AA 2C26A 2JQZA 2GUOA 4WFGE 3RWDB 3EOTL 5EUKB 1AVAA 2BINA 2OKMA 2JKNA 5FO7A 3NZHH 5B3JF 5BZXA 4AGNA 4OLVH 3SDCD 5L7XH 3VGGA 4X8GA 2E2HA 2ZDGA 4P2RD 3SPVA 1RK1A 2JB5H 2IEPA 2EIZA 2F5BL 2XBTA 4JG0H 4LPCA 2JI1A 3QIUB 5IK3A 2BC4A 5E6ZA 3RVVC 5HHPA 3GXIA 3IJHA 1J48A 1BZ9B 1DQQB 1SYVA 2ICEC 1T1ZA 5F6HJ 1KLGB 4EI6B 2CRZA 2KDGA 5DD3H 2Z8RA 3EDEA 4JFTA 5J7CC 4NXMH 5E99H 4FNLH 4XMTA 1SUHA 1N7MH 2OCJA 1VGEL 1DJWA 3D9AL 4R97C 4C56E 2JH2A 4I1NB 1OP5H 1T04A 2WVTA 2E9JA 2L7QA 4R3SB 2WXLA 5KFVA 4RRPG 4RAUA 2PWGA 1EQWA 1BBJB 2HVJB 2VXTL 5C08E 5EWIL 5JPNA 2COQA 4NX0A 1E4GT 1JXJA 3EJYD 3V4VB 3L5WB 2O5YH 1OV8A 5L0QB 3K6FA 4N9GA 4KUZH 3N40P 3MLVH 4TUKL 3MGTB 4C83A 3MO1B 1Y18B 3NCJL 3WXWL 2OWOA 3LEVH 3IMRA 1OAZH 4FYRA 4JVWA 4PJ9D 2UZYB 1YEDB 4TVPL 4OCXH 1UA6H 1AZZC 3FT2B 4ABWA 4K5NA 5JUEL 4K7FA 3MV7B 4UCOA 2VQDA 2B14A 3OAZH 1Z5YD 1TETL 3D39A 5EIQA 3ARDD 3C08L 2V9RA 3ZL1A 4G8EB 4UOW0 4E4TA 4XVOA 3IWVA 3N85H 2HKHH 1S7TB 4MV1A 3ELQA 3EYSH 3ZDXE 1QQDB 5L2JB 3D33A 4MGXA 3A4AA 5C0FB 4KITB 1ULVA 1TUPA 5IM7A 2BOLA 4L1LA 3BVNA 4P04A 5FUCE 4Z8FL 3PN1A 2JJSC 1NL0H 2C3XA 5KX5F 3CE1A 4R2GD 2BPBA 2AJUH 2JQAA 3D69A 2NUTA 4RZCA 5L8JB 1G7QB 3K1DA 1MCCA 4I2XB 3FO0H 4Y9FA 2R2HB 1BVKB 4UIKL 2WSKA 4P57A 1PZ2A 4Y5VB 3AXIA 3M46A 4PRPD 4X80L 4TVPE 1YEGL 3OB0H 4BZ1A 3BGMA 4X6EA 4JJHA 4MQSB 3EYYA 2K3TA 5AYUH 1YEIL 4OM1H 5F89B 3TEWA 3OD3A 4JEGB 4HJGB 1N5YH 4S10A 3C8KB 3QIWA 2HJFB 5H4YA 2VAJA 5IVZA 1WCBA 5GZOD 4KRNA 3T0XA 3AZUA 2XWZA 4B3EA 3LQAC 4FQXB 1E3ZA 2PBZA 2VR8A 3ZR6A 5DQDH 1AACA 3RB7A 3CZFA 4EZLA 1K1SA 3TIGA 2XTJB 4YFLF 5LGYA 2Y22A 5ES4B 8PAZA 3QDJA 5TE7L 4JM2F 4AV4A 4RA0C 4AJWA 2RCSL 4AYEC 2DWDB 4GG6E 1WO2A 1OAUL 3QG7L 3ZYJA 5DK2A 3BP7A 5CB4F 3LZFL 2ESVA 3LVTA 1A64A 1DSFL 4ME6A 4RZRA 1C5BH 2WVVB 3WJLA 2ZDQA 2ZAHA 1BHGA 2YIHA 4DO6A 1MG3C 2HFGL 5D1ZI 4HFWA 4JL1A 1A6VH 5FEBA 3DTUB 5D93C 2D4DA 4LSVL 4OV5A 3T4YB 4IRSA 1TOXA 2IF7A 4K8RD 2CZNA 3UIZA 5IKCA 5D96B 1UEMA 2DQIL 1XGQA 2QKIB 4PGZA 1VFAB 5HPMA 2GFBB 1CL7L 4KKPA 3CLWA 2VQ1A 4U1GB 3P1VA 3QBTB 2R27A 4JLRA 4K5LA 4MDJA 4P5MB 1N8ZB 5G55A 2GC7C 4WGVB 3AT0A 3FCGA 4GMTH 4X9IA 2L0DA 1FH2A 3I9AA 4IU3B 5SWZB 2XDHA 3MV8E 1S7WA 4MDIB 1R3LB 5HYSB 2VWEC 2DM2A 3D85A 2OMTA 4EKJA 1CC3A 4LF5H 4YAQA 3PS6A 2B1HL 1U91A 1TENA 5TE4H 3S4SG 1ECYA 3CBKB 4KKCD 1S5HB 5TQ2H 3P40A 4P2QB 3S5LA 4KK8D 3MMEB 4XXWA 4YPGA 5DHVB 5IVXF 1ZMYA 1A5FL 5IEKA 4N0YL 2G75A 2ZSWB 4CSSA 2XVBA 5L2KE 3WS6A 3NABH 3C9NA 4UT7H 1FIEA 3BSZA 3T09A 2YLKA 3MLYH 5BPHA 1I9RL 3L2LA 1YNTF 4EGJA 4ZUWA 1K8IA 3ROLA 2J12B 3MRHB 3FFCB 3V6KA 5EO9B 4PWJA 1P7QB 2LAGB 2HT4C 1D5MA 3NRPA 1NM9A 1N0XH 1LD9A 3QIBA 3PU7A 3Q2OA 2XU9A 2DDQH 3TEYA 1QA9B 5INDB 5JHDA 5HHVH 3LMLA 4XTRC 3S8GB 3AADB 4JDEB 2NU6B 1TZHA 1ZD6A 4LLUB 3VTTA 2GJ6E 3QNZA 3KPOB 2XI9A 4UUJB 2ADGA 4PV8B 2X09A 5SWSE 4MXQC 4NZFA 3RIAK 4QLRA 3MV9B 4G8IA 4UQDA 2DTSA 3F65A 1N2RB 2WWMC 1EGJA 4LESA 4OZGA 3MNZB 1YRKA 4XNUH 1MCBA 5I74B 3L3JA 2X40A 4FYTA 1L3NA 5GSVA 3ZU8A 4MNQD 5ANME 1S10A 1ODUA 2NY4B 5K9KB 3A67H 3KWVA 5J57B 4Z7WE 5CN2A 3KPLA 4AUYA 2WLIA 3D3VB 3G08A 4G5AA 4GKNB 3CSTA 4Q0XH 5D1OA 5I0XA 1FVIA 4FCAA 4I7HA 3LD8C 4UT6L 1I1FA 3FPXA 3VD1A 4A3EG 1FDLL 4L9LB 4N1CA 1ZXQA 3ARGB 2A77L 5I2IB 5C09B 5IQLA 3ZE0B 1C08A 5ITBL 5EEVA 1DVTA 5AOJA 4W9LC 4I85A 4ALAH 1OXYA 3HNTH 5CD3B 1RIVH 5FW6A 3TP4A 4J9NA 1FRGH 1J0KA 4TV9F 3PW4A 1NA8A 2ADIB 2VZSA 3P0YL 5GSRA 4MMYB 4QRFA 4OLXL 3SN6N 1CGTA 3AQZA 4GT0A 2JWYA 1SN0A 3EOAB 2WBJC 5E8OB 5I5JA 3WIHA 4RMSA 1HZLA 1VZGA 2TRYA 2V8MA 1IM3B 4XOCA 4JKPL 2ZYRA 3BPNC 4Z76B 2Y23A 3EOBA 1EFXA 1OSPL 3DUSB 2QT6A 3VUAA 1FNEA 2PCPB 3OKMB 4EI5A 3TURA 3QWRD 4X6CF 3RKDC 1DDHA 1SN2A 1A0IA 3IDNB 5IR1B 2OCCB 4DWHA 4E9SA 5ISZB 4UV7L 2BNQD 3LN9A 3RFZA 3FQTA 2Y0SE 3JQOB 3TVMC 2WW8A 4WU5A 4DGIL 1LNUA 2NNRA 3HCVB 2YSSB 3TJHD 3CC1A 5TDNB 4TV8F 4LLYB 1AXTH 3JWNE 1O9WA 3B6SA 2APXA 2VSMB 3CHQA 3EYQC 3EG9A 1PY9A 5EEZA 1S7VB 2N7AA 3WN5A 1KF9B 4ODSH 4XNMA 4M1GL 2ITDB 3KCWA 3RYMA 5HY9B 4RGOL 2C1PA 1Q8MA 2QQKL 3GUTB 3HC3L 4PP1D 3TPKA 2IWKA 3HZVB 3L13A 4OF8A 1ZLWH 3RUGA 5L8KB 1GGOA 1ADQL 4RNNA 5LBSL 3KGRA 5D7KD 2WINA 1QX1A 2V59A 1RUPL 1PTZA 1R3HB 5AVYB 4PJBB 5F2FA 1OGAA 3DX4A 4JPIB 1Z2OX 43C9B 1H9VA 2J5LB 1CQYA 2ADFH 1S46A 5CAEB 5I8OH 3ZDZE 5BV7H 3CLEH 4B97A 4OCNC 1BAWA 3O9WB 1E7UA 1OK0A 3TNMB 1C5DA 3ZXAC 1L9PA 3U7YH 1KJ2A 2NVXA 1QLFB 3AWEA 5JTWA 1PFOA 5JO5B 1RJCA 4B9CA 2ATAA 3ZYIA 5GGRA 1KLUB 3QIUC 1BYNA 4L4VD 2V6HA 2BSTB 5EIIG 2BXZA 2OYKA 4JPVL 1KB9K 3VG0L 5JW5A 4BCZA 2YS7A 1U6AH 1D6EB 1CIDA 3CFCH 2UX6A 4XC3H 3OMIB 4NQEB 3UBFA 3CN3A 4KTYA 4DR2H 4N9OB 5AVSB 4ZUSA 3GM8A 5LHDA 3UC0L 2VDML 5C0BD 5DG8A 4OUUA 5KG0A 4POUB 4U1JB 4A3FG 4H0IA 3KD4A 3IETA 3PAUA 4EUPH 4GW4A 4URTB 2DIAA 1IGML 2GYSA 1CIUA 3KPRA 4KXZI 2YQ2A 3CQFA 3EFFA 3L1OL 4MS8D 4PCSA 2RGSA 2DJUA 5L0QC 4R5VA 2QSQA 1K3ZA 5B8CA 1OK8A 4AVKA 4UNVA 4WAFA 2X4QA 4MQXC 4XMXA 3KNBA 3CFJB 5JW4Q 3WXVH 1XMQH 1WTLA 5H2BB 3UX9B 3BJLA 4X5QA 3INUL 3QPQD 1PAZA 2DRUA 5KFCA 2BZ7A 4GQQA 1Z66A 4AZ8A 3HAEA 2VKWA 3SDCB 5FYLD 2CKBA 2Y7MA 5BZWB 2QFRA 4O3NA 3UZEA 4YE4H 4YDJB 1XQ4A 2EACA 2MCAA 4P2RB 2W7PA 2UVUA 1S3KL 1UXWB 4HC1H 1W6WA 4G7QB 5AVZB 2YW2A 4YP3A 2A9AA 3L16A 1EH9A 3WOVA 4QDGA 5JW3L 2R8IA 1INQA 4FTVD 4PG9A 5AZEH 4PTUA 1PD1A 5CJQL 4YHKL 3GMOB 3UDWC 1NFDE 2F74A 1NBZA 3EJZD 1IQWH 3G3LA 1NDTA 3EYVA 1HEJC 5B1CA 1YZZA 4U1LB 2XPZA 3J2PA 3U4KA 2JA6G 4JPQA 4Y5VC 1IZJA 3T8VA 3VTMA 2CW8A 4HKJB 5CSZB 5D70L 4XMLH 3ZRSA 4PJHA 1E4WH 4QT5A 4WV1B 3X13B 5JHLA 4JRLA 1KPRA 5HGDA 3KPQB 2BVOA 3FN0L 4BGDA 2Q7YB 1NC4D 4W9GC 3FQ1A 2EEDA 3K8LA 4PJ9B 3U9TA 5DYOB 4GUPB 1LLAA 3DO4A 4FQXC 1QI5A 5EORH 1WK0A 1MRFH 1GZHC 4ZX5A 5IJVB 1JGIA 2WQUA 1U42A 1E50A 1Z5LA 2XTJC 4ODVL 3ZY7A 2R8JA 4K0KH 3I50H 2VQFH 2FBRA 4HJUA 4Z0BH 3OGOE 1FO0H 3GTTA 4P4RB 5DK0A 5BRZD 4MAMA 2HRPL 3RY4A 1C5CL 2JELL 4MWFB 2UWEB 3IJSA 4ABUA 4KI5E 2ASJA 1QWNA 2GITA 4PJ7B 1WISA 1NFAA 5IMOA 1RJZA 3D5OF 1JGLH 3HNSL 3OKEB 4Y1AE 3LSOB 5D6DA 1I7TB 1L6XA 4YHMH 4Q4EA 4WENB 5CCGE 5JNYB 4R2GB 1CXIA 4RFEA 4Z7UE 2I80A 4IR1A 4YAKB 3V9CA 3OJDB 3HE6D 4PSPA 1Z9SB 4UOJA 3OKDB 3CZUB 2EUXA 3RVXC 3RZCA 1HOCA 5CSGA 1Y6NR 4PHXA 5JHBA 1UKTA 1RJRA 1KGYE 5CAYB 5CBEB 5I0VA 3GSWB 3L7FA 1SY6L 2AVFA 1K5NA 1TVBB 3QEQD 1E3XA 5D96C 2QKIC 3ECBB 3K80A 2LABA 4FS2A 1JF5A 1IQDA 1TG8A 3PLYA 5AW7B 3BWUC 4JE4B 2R8KA 2HXAA 3QDGD 1CFSA 4XP4L 4NZ8A 3QEHB 4LB8A 1X7TA 4RH4A 4U1GC 1UATA 4FQHA 1JNHB 3DIFB 4AEHH 5J6GB 5IW3A 4ZPVA 4F4XA 1XF5A 2YYAA 1DBKH 2F54A 2YUXA 3GBMH 3V4SA 1CDYA 5HYJA 3HG0A 3AG1B 1KG0B 1O7DE 2P5PA 4NN5B 2GBTA 4NZRL 1D5IH 1WZKA 3QYMA 4HWBA 1PKOA 4WD3A 4NO2B 1W72L 1YNLL 3CPLA 2H3NB 1TU2A 5K9JH 4JMXA 5CJOH 4YQXH 5EOTB 5DJXA 5D4HA 2R7EA 4KJYA 1CCZA 1CDUA 2EDYA 5J1AB 5KJ4A 1E8YA 4X7DC 1NBVH 2VPQA 1PSKL 1CG9B 2O30A 5ENWA 2C9RA 2VDKL 4HG4J 1JF1B 2CMRH 4QRRD 2HJLB 3PGFL 3ZSTA 3FT1A 5ELIA 5IYCG 2AGJL 5HHNB 4XPBH 1A3RL 3MNWA 2NR6C 1XF3A 1V5JA 1CTOA 2ZCHH 4Z7QF 1ZGLP 1RXLA 3EOYG 3MUUA 4CBPA 3JVFC 1XGRB 4JY6A 2IFGA 5KN5B 1BZEA 1GO3E 1QATA 3S3PA 3GSNB 1CDBA 2PETA 3WAKA 2IANE 2X4OA 4J4PA 1SVBA 1U8PB 1EXUA 4LL1A 1G7JA 2X12A 5BQ7B 1MQKH 2VDQB 4MCZB 2XG5A 3QH3B 2CIIB 3VFUA 1QFHA 3F7QA 3S5LG 5KT5A 4PRID 2IPTH 3A23A 3QJOA 1JDCA 2QQNH 1BM7A 4PGDB 4OLYH 3GBDA 5F1IA 2FHCA 2O6EA 5I74C 3F3HA 2NLJB 2OSXA 5FHBL 2NY4C 4HZLA 4O02B 2AU0A 1IBYA 1BZ7B 4PPTA 3RVUC 4IRKA 2XKNB 2XCAA 4WFFD 3ZMEA 1IB5A 3OVUB 4UMGA 3D05A 1NAKL 3HZ3A 3L6FB 1K4CA 2YUVA 4H20L 2ICES 3P4OA 5IP7G 4YDVA 4X98B 1E40A 4K73A 4J3WA 1JPTH 3QUML 4YXLH 1YY9C 3D25A 3E80A 3DYPA 1JGVL 2W8CA 3P3RA 4H0HB 4L9LC 4A6YL 4APXB 1ZLVK 3NZ8A 5JIMA 3E9TA 1FVDB 3LQAH 3IDGB 4ECVA 2Z92B 3CXDH 1WF5A 1ZDQA 2J7LA 2VN6A 3JWDL 3PDOA 1UM5H 1VSCA 2WQAA 3CX5J 4N8CL 2RF4A 1GGBH 4L05A 1HQRA 1G6RA 1MZYA 3VFOA 4YEFA 2LU7A 4O3RA 1IAIH 4PJXF 5GJSL 4A2BA 2J3SA 4DN4L 3IN2A 1B0RA 2P48B 2G0KA 4IOFD 1E7VA 2ILLA 5GRVL 1UT1A 1RZIA 3G6AA 3B8SA 4H2CA 3MROB 1LWRA 5F1KC 1IEBB 1SYSB 4WDIB 2O61B 2QMKA 1LVEA 1DVFD 3KGSA 1NGYA 4DUVA 3D0LA 1FKAH 3V6JA 4RRPM 2AQSA 5F7WC 4F7EB 2R51A 4IS6B 4XN1A 2Z4TA 2E7DA 3NFPA 2Q8AH 4ECUA 5DEFA 2A83B 2APSA 2KPNA 1P7BA 3OKOB 5D1ZD 5GGUA 5GS0D 2APWA 2IALB 4MNQB 2O5ZL 3QZ8A 4EAEA 2KLSA 3GIMA 1WYJA 2W60A 1DBJL 3DARA 3MV01 1RZ8B 1G1CA 1K8DA 2E2IA 1BX2A 3DA0A 5AOIA 2EVGA 4L8DA 5ID1B 2Z0BA 4WCYH 2YEQA 1JTOA 4LQ1A 2NYYD 5IT2H 3MXWH 4HUXA 1CF8L 1T20A 5CGTA 1PMYA 5EO1B 1B4JL 1SJEB 2ATKB 1K83A 2PWHA 2EUWA 4XBEL 1M4KA 4M7LT 4UQ2B 4AYSA 4JQVC 4FYQA 1BLNB 1J1PL 4PRDB 1FIGL 2NNCA 2J5LC 2ZOLB 3HPLB 1AP2A 3IBOA 4YZFE 2WAQA 5A2AA 3SKUD 3BESR 3DHJA 3T0EE 2HVQA 3C8HA 5KFEA 4WW1A 2ZOUA 1EO8H 3O9WC 4D8PA 1FYTD 1HKLL 4LGRB 2AW2A 5JPMB 3QVAA 4ILDA 4U1IA 2VMEA 4WHCA 3KLQA 2BNQB 1XNQH 3LTVA 2ZXEB 4Z0XB 4KV5E 3BP6B 2H6PA 3VFSA 4E0RA 4LSUH 4FQ1L 3QCVL 3ZTJH 5D1QE 2EIEA 5C5JA 3BLBA 2D0GA 4LARL 4GP5B 1MPAL 4U1NA 3TYGH 5HV6A 1N34H 1UUNA 3FCBA 1TWCA 1JPGA 1PAMA 2R2EA 2XX0A 3CV5A 4PW3A 3M9OB 4OGQC 4YSQA 2OJEA 4NM8H 4NS0A 5FR3A 3V4PL 1T89C 3QG6A 3CH8A 1TKWB 4WI6A 2LTQB 1JZ7A 4PSRA 1ORQB 2CAKA 4NKQB 2I5YL 1LTXA 4PY8I 1YSOA 3BUTA 4E9RA 1WT5C 1S9YA 4FQCH 3UZVA 3HI5L 3UEQA 3PNRB 5LBVA 3ZKND 1MRCL 2I69A 3BC9A 2FPIB 5DUJA 4EZKA 1SXSA 3CSBA 4AI7A 1PZAA 3HRPA 5IHHA 3H3KA 3ABGA 5KT7A 1GSAA 1NCJA 5L88H 1F3RB 4XN2A 3PP4L 4Z5RA 4YPJA 3FU9A 3X3FH 2H6OA 2BIOA 1JI1A 3TYFA 4AUJA 3WHXB 5LGJA 3SDCC 5MERB 4TUUA 1CL7I 2V9UA 4BFBD 4BDVB 4TNVK 3BEVA 3IU3A 5KT3A 1P9MA 3FCSB 3GXNA 1HNGA 1MJ8H 2VRQA 1M0WA 1J5CA 3FQXA 3CLFH 5IBLD 3UTQB 1RHHA 2QVMA 5KVDH 2FR4A 3BA9A 1A25A 5T1JA 1A6TB 4L4VB 3W39B 2B0SL 1VB9A 2W8LA 2AITA 5HJ3B 3VI4E 3TIEB 3Q3GA 2V4RA 3QUZD 3UYRH 3EDFA 1V55B 4PB0H 4TF4A 4YGAB 3L4UA 2DY2A 4KUCF 5GGRY 5FDWA 4KHXH 2YD4A 3BW9B 4N2BA 5C0BB 1WFJA 3KR3L 1TYRA 5I6XB 4DUZH 4A7TA 1A6UL 2J43A 1P7KA 3L3DB 2DWXA 4OSUL 4XGZB 2LT9A 2EE0A 4H26B 4JFZH 3F7VA 5EHFA 5C8JA 5KT6A 2F19H 4ZUVB 5G4MA 3EJYC 4WV1C 1NIDA 3QXWA 4HUCA 1OAYL 3K81A 1QFUH 3QUYD 4G8FA 5KG6A 1OT2A 5I23A 5KFXA 3HAEG 5DRZB 1UWXH 2CHNA 1IKNC 2I60L 4PJ9C 5LL6b 2XIGA 4A3JG 1Q9OB 5E8DL 4JCMA 1QSFE 2QGBA 2BHZA 1JD7A 3P0GB 4KU1A 5EZIL 5E2TL 2WGXA 1JCVA 3J8F7 4FLOA 5I1CH 1UB6A 3RVTD 1N6QL 4ZMXA 3QJRB 3PCYA 4R84A 3DECA 1LQSR 4QWEA 3FB6A 1AQKH 3DYMA 3N0AA 2PR4H 3ZSSA 5EDXA 2W0PA 1PLAA 4Y16A 3BN3B 3KW7A 4UQ3A 2VXUH 3B2VH 1ZVSB 4YIQB 1UJTA 5A16A 2D7MA 4FTVB 4PWKA 4R2GC 2ZXGA 4QRAA 4UZSA 1DUZA 1RZPA 1LE9B 4NSKA 4GSDH 4Q4IA 5F97E 1DO6A 5EZLB 3I02A 4HHWA 3ARBD 5D9SB 3TIDB 4PRAB 4LCWE 1S2EA 4MTMA 3APDA 5BRPA 1FORL 5IBTL 2XZCH 4FAAB 5B22A 2CALA 1RZQA 4NI3A 2JJVA 2EDBA 4W9EC 4YL4A 4Q9BA 5TTRA 5DZPA 4PLNC 4ZMQA 2R56H 3TJEL 2ZCKL 1A3LH 1Y1WG 2COVD 1PZ3A 4N25A 1NC4B 5EU6E 2GY5A 4FFWD 1GZPA 2X1XR 5H8DA 1KBLA 3F00A 4GEJA 5DT1L 1KCLA 1XH1A 3KPTA 4PJEE 1B6SA 2IH3A 3ELAT 1F1GA 4E42B 3C60D 2FB9A 2EIMB 1JE6A 3OPUA 5DJ2B 4EBEA 3S2AA 1QNZL 3CFDB 3S8FB 2B5IB 2GI7A 2XZZA 1UD4A 2XICA 2VCOA 1ZT4B 3GFUA 3P77A 5BRZB 4NN5C 1CMOA 4PI0A 2Z91A 1JGDB 2O26U 1Z9LA 2D2OA 3OTOH 2FT8A 1IT9L 2HLEB 5JOEA 1V3KA 5JQIB 2E6QA 4XVJL 2J5WA 3V4VH 4X6BB 1ONQA 1U8JA 2GBAA 4LSSL 3WTUA 3LWBA 4UCRA 3AXLA 5DJAA 1CDJA 3FSOA 2C8NA 3BGAA 5LDUA 1A6ZB 1ZHLA 1ZAGA 4S1QH 4RFNB 4MV7A 5CP7B 2O6FA 3GK8H 5DUPL 5I30H 4K8RC 5DEGA 2EYRB 1WAAE 3GO1H 3D2UD 1WH2A 1RVFH 5D8DA 1YY8B 4HU2A 3HB3D 5AVTB 3SHSA 2WLYA 3AU1B 5F3BA 2HX9A 2NY5L 4I55F 3BO8A 1M05A 2QSCH 4TNFA 4NP9A 4FADA 3WO1A 5C6TL 3QDGB 4JG1H 1NCWH 4HXAH 5ESAA 1DO5A 4JM2A 4YSPA 4LNRB 1I8IA 1QTPA 1T1YA 2NU7B 1Q1JL 2QR0A 2DQHL 1M57B 3ZIYA 1YECH 4JJOA 4P48A 4H8VA 5GZND 4UM8B 5HDWA 2IGFL 2F5AH 2FPGB 2SODB 5E6SB 4BFNA 4S1DD 1H3PL 1S7XA 2BRRL 5G5DA 2XWXA 4MNGA 3OKKA 3KBHE 3QXAB 3X17A 5LJYH 3HOYG 1T80A 4E41B 2B9AA 4BCYA 4KKCC 1J12A 4L8BB 3LP8A 4KK8C 5ICXB 1P84J 2LVEA 2OQJB 3LNDA 1ACCA 1AKJA 5I16A 1JTTA 4J3BA 5DVKA 1T7XA 3T08A 2BNRA 1BF5A 3AW5A 4R8UA 4LOVA 3AGVA 4KH2A 4EIBA 4QRRB 4YFEA 4BM7A 4QXUH 4YHYB 1H15B 5I1LB 2EVIA 5C1PA 3IF1A 4AQ1B 3MFHA 2VLKD 3ILDA 2AXJA 4WTQA 5FV1L 1PX8A 1WZ1L 4G9DB 5B39A 5CLZA 4DZBA 1N12A 2PO6D 1MJUH 2BWIA 1A14L 4Y2DA 3X11B 1MLCB 3E2HB 1LL1A 2ENPA 4N1HB 3ZRFC 1RJYA 1UYWH 1M7XA 4MAUH 4ZG1A 4GRLC 4P05A 4DKAA 5E6RB 1D7BA 4LLDA 5AB0A 1DBAL 4ECZA 1NSNL 3X3GH 4XVUD 5BXFB 5IVXA 2IIJA 2PP8A 3ZHFA 1WWCA 1P4UA 2V5MA 3BWUF 4PRIB 4YDNA 2D3JA 1OD7A 1RU9L 1GW0A 4G1MA 4XAKD 4G3YL 2OMWB 4YH6A 3MLSH 1X7QB 3QHZH 2DEWX 2D03L 3KMDA 1C8PA 2B1AH 3IXTA 4NKOB 4EDXA 4FS0A 5F7EL 1KBGH 1QLEL 1YNTA 1U8IB 2YD6A 1I85A 1OTSD 2WTFA 5BVJB 3VXSA 3KPNA 2IPUG 4RX4A 2KZWA 3ES6A 2IGTA 5H94A 1X9LA 4PJCE 1TVHB 5LB1A 1YAZA 3M17B 1WIPA 4MJIA 4NENA 3WTWA 1SJHA 3M7FB 6FABL 4Z95H 5D7SH 2AQ2A 4X7SH 2X7LA 1AGFB 2Y07L 2FSEB 3ARVA 4BQCA 5DXWA 4PRNB 2XXMB 2VJ8A 4IMKA 1AS7A 3QB7C 2M05A 3AVEA 2R1WB 3ARWA 5JPMC 4L3EA 3UYPA 4YR6B 1T5XB 2CW7A 3IJ9A 15C8L 5DHVH 4JO5A 1UG9A 4ZFOA 2HT2D 2OYMA 2X4RA 2XXFA 1P4IH 4WFGD 2GTZA 1XF2B 2YBRB 1DVFB 4ZNEE 4X4YB 1OGTA 5KSUB 4LIQL 1L6ZA 3GXFA 3BP5A 3C2AH 2ZYSA 4MD5B 3VRIB 2ED8A 3TJHC 4FKEA 4FJYA 2RBLA 1M9WA 3VMNA 1OQXA 4M5TA 2Z8SA 3KXFE 5SV4A 1L0QA 4I89A 5C2UB 2CRYA 3QZWB 1PCXA 1F42A 2DQCL 1RIHL 4FX5A 5DF0A 5K5YA 1F8TL 1IL1B 2D0FA 1AIFB 4HT1H 2LTQC 3ZIMA 1MCSA 4H8QA 3SYAA 4GW5A 4C56D 4PP1C 5H35A 2Q7NA 2X89D 3W5MA 5EBMA 2UYLA 4YSCA 1Q0YH 1SQMA 2EC9U 4NQDE 4YHLL 3G6JB 3U1SH 3FQYA 2XV0A 4JB9L 3HC4H 5C08D 2F6AA 2R23A 3LN4A 1A9EB 4X6CA 3FCUB 5A7EA 2R85A 4JKKA 4ZDHB 1OZTG 3VH8A 5EZOL 1AXIB 1K9TA 3K4ZA 4LIQE 2DWSA 4YDKL 5EMYA 3ZE0F 1CQIB 2GJZB 5HGAA 4LF6H 4QAWA 1CXLA 4L48A 4XNDA 2OR9L 3L54A 1YQVH 1FYTB 5AWNH 4PJAE 1CJYA 3MOAH 1KJ9A 5KT2A 4MJ6A 3APFA 1JDAA 4I50F 4M6ML 1W93A 3GINA 5F72S 2V7NB 3NDZE 1THCA 4GKLA 4F7TA 3SE4A 3EJCA 4ED2A 2MHAB 1UKQA 2VDLB 2BMKA 2A7BA 3COOA 3H85A 4Z3HA 1KT2A 5I6XC 1JX4A 2IWFA 3PABA 2CM6A 1BLIA 5I71B 4OJCA 1TF4A 2G9HB 2VXSH 1I7RB 3FPYA 3GSXA 1X9NA 1YPZB 1KCUL 2NZ9D 4MS8C 4RCAA 1R0AH 1CDGA 3LEYH 2JA8G 5HYIA 4ZTOH 3QK0A 3HW7A 4O9HH 3PHOB 1KOAA 5SWQB 2XN0A 3EDKA 9PCYA 4ZS6D 4EUPA 4Z7OB 1RUAL 4TVPD 2WLJA 4XVTH 5AB9A 5J2TF 3QS2A 2Z34A 3SE3C 4B3VA 3WJMB 3QXVA 4RIRA 3ALXA 3QPQC 1XCXA 1I53A 3CDZA 3UABA 5B4MD 2WUBH 2JCWA 5IFAL 5C07A 1M6OA 2R0LL 2VMFA 2LOEA 1C12B 1MCWM 4PJBF 4UOW1 2IG2L 3T6WA 2JQMA 3GRBA 4KJQD 5BO1H 2P5WE 3AAZA 1N5AB 2B4CC 4RUCA 3IJYB 3TA3D 4U6HB 2DI8A 5DZNA 5FUZL 4KX9A 2IQAA 3OSVA 5DCCA 4DTGH 2VM9A 1II4E 3FRPB 3VD0A 2R4RL 4CC4C 3QUZB 3L5JA 3DMMD 4LO9A 2YAOA 2CHXA 4JFXB 5DD5L 3VPBA 3U79A 1JFQH 3QQDB 3BWAB 1FZJA 2WQ8A 1TAEA 3NGDA 3QGVA 2VC2B 1DBMH 3EJZC 1UM4H 3DTXA 2C1OB 1AJ7H 2MTAA 1X4ZA 4HC1A 1AO7E 2VOBA 1CGWA 3AWGA 5GJTH 2ZWZA 4AE0A 2V4QA 3DX6A 3VXUA 4EGQA 2YGQA 4ZXBA 3O4LA 4F57L 2WTRA 5DVLA 2APTA 2XCPA 4UB0H 4N6QA 1RD6A 4LH6A 1W0WB 3X14B 1SVZA 2R9HD 5E0FA 3QUYB 1IOVA 2UVWA 3EYUH 1ZVHA 2FJFB 4BQBA 1U8LB 3G5ZA 4CADA 1HESA 2AFNA 3II1A 1MHPL 4CRPA 2FNWA 4FA6A 2OMYA 4F93B 4RWHA 1HHGB 4HXBL 1CO1A 3WTTA 5DR5L 4ZMYA 4OCYH 4BY1G 2BQUA 3HRZA 5ESVB 5TPWH 5D7IB 2QHLA 3TPUA 3DV6A 3CVZA 4QXGL 5J2UF 2B5IC 4FQLH 3J80W 3IFNL 1CR9H 2K78A 4JUZA 4NZUL 3T0AA 2CO6B 5I6NA 2MNWA 2RD0A 3MRKB 3FB7A 1GHFH 4XNQA 2Y5TB 3FQUB 3DRTB 3MV8D 2VIRA 1TNMA 3RI5F 3DHMA 3FTYA 4BWTA 1B04A 1ZS8A 3D0VA 5HGGS 5I1GH 4DGVH 2NX5A 2XN2A 4R26H 2XPGB 1ADWA 2VZ3A 4NPYA 4A1RA 3QRFM 1FO0A 2PMZA 2VMDA 2O03A 5TFSH 5C0EA 4MX7A 3DX0A 2JF1A 3U9PL 4RFNC 1WA0X 1EO5A 4H0GA 5L2KD 1MFDH 2RMNA 3N0PB 3QWNA 4B0MB 1UNNC 1CLVA 1G1YA 4DT2A 3E1F1 1F1DA 1MWAB 2ID5A 4UTBH 3DKHA 5TF1L 3WGVB 3WS3B 1W80A 2AEQL 1JPFA 2FZ3A 1U58A 4XPAL 2ZTBA 4WHDA 1QSEE 5JXEA 2C7FA 1MAMH 3LH8A 1ACXA 5JR1H 1SFOA 3PWJB 4H8WC 2WOYA 3HNVH 3GHEL 2I26N 1WSCA 5F9OL 3L17A 3EKCA 1K5WA 3B37A 4WEBH 3GMNB 4HH9A 3GKWL 3C60B 3KPMB 3M88A 4M8RA 4QJ3B 5FPRA 5ACLA 4PDBA 4PV1C 5DDHB 2ALAA 3QQ4A 2X9WA 5FWQA 3W11D 2EO1A 2GJ6D 3LEXA 1DCEA 4Y9CA 5CBAA 2AV1B 3V5DB 2BH0A 3QS3A 2ICEA 5ANHA 4JCWA 3U9UA 5SWSD 1UXSA 3LQZB 1UC6A 1XD0A 4IQHA 5IB4B 3ABKB 3I4NG 4JZOB 4IYKA 3WNLA 3P30H 3WLBA 1FVCA 1VERA 3TBWB 3ALPA 5DS1A 3NIDE 1GPOH 2MRYA 2BSRA 5DS8B 1J11A 1L5GB 1ZHQA 1WV7T 3MVSA 4PJ7F 4PGCB 3B2UD 3L9RB 1CD1B 1SHWA 2FO4A 1KCVH 2AJ3A 2GABA 1MNUL 1MVUB 1IC5H 4G6ML 4JGUA 4YHYC 2C7UA 4AQ1C 3EGXB 3VFWA 3O2VL 4JJ5B 2OJZL 3RDTD 4V1DE 4QEGA 4GUOA 2FATL 1TJIH 3D2UB 3SQBB 5FFOA 4AITA 4MQ7A 5F96H 4MTEA 2AEOA 2V7HA 1TSHA 3HB3B 5KG1A 4GFTB 2KQMA 3E2HC 2QFPA 3VE0A 1LE5A 4Q52A 1LO3L 1FYHB 4NPJA 3I75B 2VH5L 1Z9PA 3FU8A 5F88A 2HG5B 4UT9H 2GEQA 4IMLA 3SKOA 2VN3A 4NJ9H 1UZ8B 1ZDSA 1CFBA 2G4EA 1A7QH 2QHRH 3CXHK 4DV2H 1A8ZA 4UQEA 2XFXA 2G60H 1I9IH 5FCUH 3CZEA 1MF2L 1AZNA 3U1QA 2ITEA 3WEXA 5TF0A 4A93G 4YHZH 2ICWI 3DURB 4MMXB 1AGDA 2CGRL 5IP4A 2QJDA 3QPXL 5KFAA 4MA7L 2JJSA 1JKJB 4HIIB 3CC5A 4JO2L 2CBPA 2FK3A 4HYKA 3KPSE 3PPSA 1IILE 4QY8B 1S7RA 3AGWA 3JTBA 4IOSD 3C0FB 5B39G 2X53A 3SE7A 2FJGB 1QVOA 3CFBA 4U6YA 1J1OL 4O2CA 1X5AA 4ZOAA 2VLKB 2VQ4A 3G6XA 5AD0A 2NU8B 2YS6A 1RPKA 3OR6A 1S4IA 1AHWB 2PO6B 4QKXB 1J5OH 4WSJA 3V6BR 5FPIA 2BIMA 4NUGL 4UYPA 1OLLA 1FL3A 4IOFC 5EBGA 4HDIB 2F53A 2VERN 4NN6B 3E7JA 2X6VA 2B59A 3DJSA 1W16A 3IDJB 5KYXB 4ZMAT 3RIKA 1B9KA 2P8MB 3SDXB 1DVFC 2XA8H 2X4NA 3GTGA 3EGDA 2OR8A 2ZNXA 1H6EA 1JV5B 3K72A 3S8WA 4RB2C 1E2VA 5DMIL 3GHPA 1IE5A 2JSFA 5DJZB 5HYFA 4DL6A 3V6ZA 1GKOA 4AIZB 5BVPH 5GS0C 2X3BA 2ZWKA 3QEGH 4I5BB 1U92B 1JNNH 2HN7B 2ZNWA 3GZPA 2Q3ZA 1ECZA 2ZE0A 3FQ2A 3KYAA 3LRGA 3N9GH 4N90E 2APFA 3LKOA 4HS8H 1RZJC 4YJ2F 3MODL 4K8RH 4JI2H 4G2AA 4NHUB 3PW5A 1ZXKA 4XCEA 2K1MA 2YPKA 3NIFE 4AMKL 1ETJA 4G80B 5KFFA 3NIGB 3ZZQA 2PPCA 5CIPB 3BKCH 2NYYC 2J1ZA 4MA3A 4NRYA 4UDUB 3OXRA 4OM0H 4PJIB 2MOQA 2K45A 4J3OD 3SB3A 1DE4B 2BVQB 4PJXA 2PYEA 3QR0A 4B7IA 3P2TA 1DANT 4YHHH 4BZ1L 2PF6A 4JO1L 4TUOB 3MJ8B 5LCVL 3V0WH 2VDQH 4DR5H 5EN2B 2EIDA 3N42F 1UJ3B 5KBPA 3V5KB 2HKFL 2GUYA 1QRNE 3BJ91 3U7WL 3NEOA 3D39E 4YGVB 4Z7VE 5F8QC 4LH7A 4MJ2A 1DLFL 4OD2A 3L4CA 1HAUA 3ZMRA 5B21A 4DP6X 4NWTH 2DPKA 2E7HA 3TIIA 1UD2A 2MCMA 5I66B 4MB3A 1F45A 1TTBA 2WYOA 4JFYA 3P2DA 3WNPA 1CXFA 5TQ0H 3U6XS 5ILTH 2DEYX 2OMVA 2X6CA 5F7BA 1HEHC 4IEFA 4C5BA 1HYRC 5HGHA 1HSAB 2WO4A 4HQQH 4ZSOB 4F8OA 4R96A 2YRBA 3CSFA 3GJFH 3OAWA 4MSWA 1Q9WB 4TV3A 5IMKB 3JRWA 4R4BB 3HI6H 3REWB 1WQVT 4HX1B 3BAYA 4CDGC 5I1AA 2R93A 4ZW7A 2JA7A 3QFGA 1I3GH 5DMYA 5I6PA 1F5WA 5E8NA 3O6KH 1HXYA 2W07A 4JR9L 2EIBA 5J0BA 3CCHB 2XETA 3LKNB 4I4WB 4X99A 4FQJL 1XB3A 3FXIC 5I71C 5IFHL 1Q9KA 2VXVH 2YA2A 4PV9B 4ES8A 1U3NA 3SE8H 4LNVA 2XNAB 4KKBD 3S5ZA 3NK4A 5ECJE 4C56B 4DK3A 3II3A 2VYRE 3ZKNC 5KJ7E 2KMWA 1DVYA 4X4ME 3HZMA 3EDDA 2QV4A 5TDPB 5D1PA 2BVPB 2YPLA 3AUWB 3QULB 1A4JB 3V8CA 5C08B 2VDOH 3P4MB 1MUJA 5F9JA 5KFIA 1BF2A 3GTLA 2LGNA 2PYFA 1C16B 3QDJE 1U8OB 3DO7B 3QNYA 2YXMA 4GS7B 3QZOA 4ODUA 4Y2OB 1DQTA 4WUKL 4MAZA 1EMTL 1J5HA 4QHUA 1SMAA 4QW9A 3WNOA 3CVHA 1KXVC 4GLXA 2GSMB 3OB8A 2VB5A 2CQYA 5KG7A 3H4FA 5IBLC 5KG2A 4LBEB 1QASA 1SFHA 1WBYA 1Z3GL 2Q20A 5GPRA 2ZP8A 2C9UA 3IEAA 4M7ZB 1BVLB 3H0GA 1JZDC 3QUZC 2OAAA 3ZL4H 5IQ7H 1MOEA 2H0PA 2AABL 1XF4A 2R29H 4J1UB 2QBWA 1I1AD 5A40E 3ORJA 4FBTA 1QBMH 1WLHA 3MN8A 4KI5D 3ZDXB 4YBZB 2ASLA 4R8WL 1C1EH 4OZFB 2I9LA 1P4BH 1FFTB 1U4FA 3H7BB 3D4GA 1KV7A 3JV6B 4WSGA 2XN9A 5E7FA 3HR5A 1EEYB 3KWUA 2HFTA 2VABB 4Y1AD 3H4HA 1ICTA 2DQ6A 4JN1H 3GSUA 3S96A 3ARUA 4EUPG 1WUNT 3FUHA 4PHZA 4WK4B 5EPMB 4RMVA 3DX9A 2WZPA 3VMMA 3R0MA 1CGVA 2MWCA 2X4SA 3SYCA 2UY7B 5C9JB 4RDQF 3QUYC 4PEEA 1J05B 5IHBA 3TWCL 4HJJH 4Y19A 4BGLA 4M8VA 4F92B 1L0XA 2FD6H 2L8AA 3OZ9H 2WBJA 3CDCA 4Y4FD 5IMMB 3SGJA 2EUZA 3CPUA 3GTVA 2L4OA 3L3KB 3A0OA 1KYDA 2ZIDA 2WO3B 3RVTC 5DUBA 4YSDA 1Q94A 3CN2A 1MFVA 1U8QA 4JGJA 1L0YA 1DJIA 4YMPA 1IJ9A 1G7HB 3VA2C 1LDSA 1HR0H 3LIZL 5E2WL 2DQMA 5I6OA 2E75C 3TA3B 3VXRE 5T3XL 3QRGL 2IAMD 3TVMA 2D0HA 3SGDI 4PTTB 4YY3H 4PUBL 2OLDA 2YQ3A 2XZAL 4M48H 3DMMB 3TGXA 3FUKA 5FK9A 1XL4A 4HJEA 4HEPG 2NXYD 2EXWD 3TTSA 1MAKA 4OZIF 1GAFH 4GG6B 2BJMH 4ZTEA 2X0VA 3F5WA 1KB9J 2X10A 3F58H 3G9AB 1KTDB 3EO9H 3VXNB 5HJBA 5IQMA 4LSPL 5JHDE 4L3FA 5I1EL 4MXWL 4LU5H 4F37F 4CMHB 2BNUA 3FCTB 3FQ4A 3FU7B 5JH7F 1AGEA 2B2XL 3RTXA 1NBYB 3CD4A 1J8HA 1JXDA 4JS7A 2FMAA 1KCWA 4KDTC 4Y2LA 4U6XB 2ZCLH 5JOPE 3A4EA 1IC7L 4FFWC 1F58L 3P2BA 2VDRH 3Q6FB 4OGYL 4B3MH 3CHRA 4JYAH 2UZIL 3F62A 1ZK5A 3RWDA 5T3XE 2YARA 4OZGE 5EUKA 1KGWA 1TVDA 3FO2B 2YFOA 3C60C 3Q43A 5CGYD 5IP9G 3RB6A 2AJSL 2FWLB 4HALA 2IAND 3DK0A 3BE1L 3ZX1A 4A7VA 3U4AA 4ZI7F 3VW3H 1YEEH 3LRMA 2QPUA 3JYCA 3RGVD 3UP6A 1FAIL 3QIUA 2VQEH 3JT2A 3AMKA 1BZ9A 1DQQA 2Z93B 3OTTA 1KLGA 1B2WH 2XRAL 3MV8B 3TBSB 1KZYA 1UADC 4QGTA 5EA0L 4L4TE 4LEOA 3WUWG 1I1YB 2HLAB 3VI3E 4NBXB 5I8KH 5KOMC 2AJYH 5E2UL 2VN5A 2WXQA 1XGUB 1DEEB 5I6KA 3US9A 2NQDA 1BBJA 1PEWA 3T65A 5L2KB 2HVJA 4HPYH 2DQUL 3HN5A 3UFIA 4Y89A 3V4VA 4BZYA 3NJXA 3QDMB 4BFKA 3PWLB 3IFPB 3MGTA 1J9QA 3N1FC 3HB3C 3QA3A 3MWDA 5FYLH 1AG6A 3MO1A 4M7JH 4O3PA 1PLBA 5E2VL 5IG7A 4IRJA 2R1XB 2XYBA 2JKXA 1OW0C 5IV2B 1J86A 1R3KB 1YEDA 4P8QA 2B4CH 1N67A 2N56A 1DJXA 3GSQB 3MLRH 5DZ9A 3ZE2E 4RVBA 3MV7A 3RGHA 3MRJB 2EVJA 4B3RH 4HGWA 1FE8L 1VENA 4YXHL 4RNRB 1T2QL 1GXEA 2H8PA 4ONOA 2VLLB 2WOBA 1OWTA 1SQ2N 4S1DC 5DD6B 3HS9A 4G8EA 1MCPH 4GEIA 2DWTA 2VLRE 3SKNB 2WQRA 3OAZK 1S7TA 5I1DA 1IJNA 2GJ6B 2W0KA 4HIXL 5L2JA 1ODAA 4GXFA 4I0PD 4KTEH 5C0FA 3QUXA 4MMXC 5SWSB 2BIPA 2HKAA 3KM2A 4KO5A 2O6CA 3N3EA 3SOBL 3DI3B 5LAXB 2RR3A 1BMWA 3WIIH 2KHAA 4JFFA 3UDWA 4AGPA 1LO4H 1G7QA 3VTAA 1OGAE 4I2XA 5FJ8G 3BQUD 2R2HA 1BVKA 4Z7WB 5EUOE 1QBBA 3K5SA 3TBYB 4O3SA 5J9PA 4DP7X 5FO9B 1YO4A 4XCNB 4XPGH 2BY1A 3RDTB 3BQ0A 1V51A 5C97A 1Z1WA 1CE1L 3B8YA 3SYOA 5F89A 4OZHE 1AHWC 1W91A 2PO6C 3QJSB 4DP1X 3VRJB 4HJGA 4Q14A 3UROR 2JLPA 1V05A 2HJFA 2WAHA 3WSQL 4AJYV 5D71H 4QWDA 1NEZB 4KJPD 4FQXA 4NN6C 4BFIB 2YKLL 3DDFA 4EF3A 3K6DA 1BPVA 1LGVA 1X5JA 2EDQA 1IGYB 2CKBL 3AT9A 4XVUC 1QR1B 2DQGL 5K59F 2E3VA 3T0ED 4F5CE 3KL5A 1EYZA 3N6XA 2DBLL 4LLQB 1DJSA 1TMCB 4X9GA 5FHAH 1PBYA 5IGXH 3OBAA 1PLGL 2Z3FA 2R82A 1AR2A 5BR8H 2DWDA 5F0JB 3KPRE 4H13C 5E1AA 1SBSH 3MRDA 1NGWB 5TE6L 4P9HL 1DDTA 2CGYA 3NSJA 1OTSC 1MCOL 1O5DT 5D1QD 3ABMB 4KK9C 1F4YH 2WVVA 4WK0B 3Q05A 4OIBA 3TA4D 4AG4H 4A7SA 4NO0D 1GGUA 1ZGLB 3MJFA 5A6LA 3A6CH 4DOHE 5E08H 4O00A 5FKPA 2K4WA 3T4YA 4NKMA 4H8WH 3SZKC 1MFMA 1W9XA 4YUEL 4HNVA 1UJ3C 3R4RA 4XI5D 4L3CB 2OPCA 1AY1L 4KO9A 3RIAF 2BWDA 3UG5A 5L9XA 5HHME 3DPBA 1H8NA 4KGLA 3RILA 4DL2A 3FH8A 4HFUL 1VFAA 4JDTL 1IBGL 1FGNL 4MVBD 5CP3H 2GFBA 1L0PA 2WZ0A 5FM5M 1KC5L 3N91A 1FVEA 1L6PA 1XBDA 2L7JA 5BPFA 3GMPB 1JK9B 4LOFA 1N8ZA 4P5MA 5DQ9B 1K72A 3ZKQD 1HYSD 2HT2C 5EV7A 5KVFH 1XGPB 5DJ6B 5SWZA 4MDIA 1R3LA 3ZDZB 5F3HB 5HYSA 4M4RB 5D5MF 4EEYA 4CL7A 4GXVL 3WO4C 1PQZA 3D18A 5JOFB 3H55A 4P2QA 5TH2B 3H53A 1BIHA 3MMEA 4ENED 4EOWL 1U8MB 5DHVA 3IS0X 3ZN6A 2NY2D 3BSHA 3D51A 3HG1E 4KY1L 4M00A 3QFJE 2ZSWA 3A21A 1S03G 3DSFL 4PJHE 5GHWH 5DQJB 3BAJA 1QBLL 4XO5A 1VEPA 4NWUL 2EILB 5KAQF 2WGNB 4W9KC 3A6BH 3MRHA 4ZW3A 3FFCA 2NR6A 3TESA 4ZX3A 4GRWE 4TQHA 1P7QA 1RUQL 1ZHKB 2VQUA 2D7OA 1QA9A 1YNKH 3KDPB 1XVSA 1TNNA 2N3JA 2PTUA 2WB1E 5I1KH 2FIKB 4GS7C 2A9CA 3RWEB 2F1EA 4O58L 4Y9GA 1KYOJ 4FHBD 4MZRA 2NUAB 1U3YA 4JDEA 4V11A 3W2DL 5DGAA 1TJHL 5AKVA 1T7VA 4LLUA 1QSVA 4WFEE 2R93G 1KBWA 4OH2A 2VLME 1QSFD 2VDNL 3KPOA 4UUJA 3RPIB 4F33A 2JA7G 4JO4L 1FHGA 4PV8A 4G9FA 2CKZB 4ZTPL 5F21B 4DL4A 1M7JA 4M7ZC 1I3UA 4HWBL 3MNZA 3CMGA 5FXCH 4NEHB 2VDMB 3BFOA 1J7VR 3ZTJG 2EEAA 3IJEB 3CQQA 3F05A 4OGXH 5DVMA 1MHEA 3HFMH 1XSJA 3LZLA 3TWYA 1M3JA 3D4CA 4BINA 2YD7A 3Q5TA 3ZKSD 3QFDB 1SXNA 3D07A 3W1ZA 6TAAA 2NZ9C 4RISH 4WKZB 4L9LA 2FBJL 1NFDB 4LPWA 4GKOA 4P5KB 5C09A 4AM0B 2OMUB 3MCLH 4AQOA 4NP4H 1BDYA 4NQSA 4FMKA 1FPTL 3S34L 4ZS6C 4LCWD 3LS5L 2ADIA 5I8CA 4CMMB 4MMYA 4BKTC 3N1GC 4DKFL 5JQHC 2JMRA 3EOAA 5E8OA 2CA3A 3RU8H 4HS6B 3UPRB 5DRXB 1KJ8A 1I4FB 5E9AA 4X66H 5B4MC 1HKFA 4LVHB 4PBXA 5DWUH 4Z76A 3W9DB 1NFKA 3G6JF 3DUSA 5AKRA 5EU6D 1EDQA 2PCPA 3IMWA 3OKMA 2G2RB 4Z1PA 4JI7H 3H0GG 4FLHA 4KKRA 4TSAL 3N43B 2I27N 4KJQC 4UNUA 5DU7A 5AVRB 1RZJH 3BCFA 3IDNA 5IR1A 2K6WA 5ISZA 4N26A 3VFRB 3TA3C 1JZ8A 1KELL 4WY7L 2GKIA 2W94A 3K2UH 5HVHB 3RWJB 1MRDH 2X4TA 3X1EA 4D94A 4BZ2H 2YXFA 5CWSB 1CU4H 2RQ8A 3HCVA 3U7AA 2YSSA 3DMMC 3NJVA 3W9EB 4BJLA 5TDNA 5JDSB 4LLYA 1I1AB 4NCC2 4YBQD 5T5FH 3VG9B 2HH0H 3P0VL 3HLAA 2EEFA 2JNZA 2Y6SD 4TQRA 1GJWA 2WCGA 2ITDA 4Y1AB 5ADPH 2NY6D 3GUTA 3O45B 4CMHC 1I9EA 4Z7UB 1AI1H 1KZQA 3HZVA 2XSKA 1KN4L 3CHPA 3OAUH 2ZWNA 4ONGH 2NY3B 4WRLA 5AW5B 1EZSA 3LPPA 4B53A 5FW8A 3OV6A 5BRQA 3CMOH 4M5ZH 1ZLWK 1Q1PA 5J11B 5AVUB 5I8EA 1R3HA 3GMRB 4HKBB 4F8NA 4PJBA 4QYOB 4JPIA 1D5XB 3BH9B 5D2NE 1YPZF 3MGOB 2F2HA 1A1OB 1U8HB 3OGCA 4XMVA 1TCRB 2R8SH 1GGIH 2J20A 3ASOB 2YKKA 1O75A 1M2VB 4Y4FB 2VM4A 2GQHA 1OSZB 1EZVX 2NT0A 4OJAA 3O9WA 3TNMA 1OB1B 1T7YA 2F8VA 4Z7OF 1QLFA 2VDLH 5JO5A 2BS8A 5F7NC 5B38G 4FEIA 4X8CA 2V58A 1KLUA 1G0XA 3WIFB 5CA1F 5FYKL 1T1XB 2BSTA 3JV0A 2CM5A 3PWPD 3V5HB 3L81A 3KYNB 3EJJX 3O11B 3PREA 4PS4H 1A1NB 3PE9A 1D6EA 4D3CH 3R5FA 1UASA 2R0WH 2WNKA 4NQEA 3NSDA 4K71C 2NXYB 2VMCA 4OLUH 2HLFD 5INCB 4OIAA 4U1JA 3WEBA 3MR9A 4R7RA 1ZSHA 3HI1B 5CLTA 1T89A 1AHKA 4UINL 3V0GA 1EAQA 4AJVA 2LFEA 5FB8A 1JPEA 1WT5A 1K85A 4Q9RL 4AC4A 3UGXA 4CN6A 2E7LA 4LCYB 4KNTA 3T1FA 2N7BA 2NY7H 3TZVD 4NHCH 3CFJA 4LRIC 2Y24A 1DHKA 3I12A 4OFDA 1FZKA 5H2BA 1W6LA 1CURA 1REIA 4E36A 3IB4A 3BDYH 3B5GA 1YC7A 3FBKA 4BFFA 5FYKE 5I18L 1E8ZA 2NPLX 4WI3A 4UTBA 4XAWH 1KEGH 4LF8H 1TQBB 3U0WH 3SDCA 1I1RA 4ED6A 1A21A 1FFNA 2SEBB 1ZLSH 4YDJA 1FZOB 5E2JA 2IANB 5I28A 4K23H 4P2RA 1RUKL 2JTYA 2VC2H 4Y2NA 4YHPB 5BQDA 4RMBA 3RGVB 2XG4B 3W11C 1W72B 1UXWA 3LB6D 4M1DL 4QRPE 3B3BA 4H1LB 5D7IF 1UGNA 2DJ4A 3E9UA 1E6OL 1JFHA 1V27A 2VDPL 5BUAA 1LHZA 3T2OA 4J0MA 4BUHA 4RMQA 2VDKB 5C2BL 4FG0A 4I48B 3RKPA 3KHLA 2DQDH 3JVGC 1M71A 1ZTXL 3B2UC 4TKWA 4U1LA 3WFBH 4CKQA 3L9EA 1J8RA 1S7QA 2BP8B 3T3PF 4BFGA 3SI8A 5KVMC 2OJ1A 1VCBC 4HKJA 3RDTC 4YX2L 1KCRH 2JKRM 4NFBA 3FQWB 2YWYA 1T22B 4WV1A 1WA2X 4P2CG 2EH7H 5BW7C 5I1IH 3MCKB 1UOVA 1GSMA 3KPQA 2ZZUT 5L8LB 1QPPA 3VQLA 1IKNA 4Y0GA 2WANA 4PJ9A 3MDJA 4YB8B 5DYOA 1AQMA 1DEDA 3MOBL 1TCMA 3U0TB 2ZOTA 1NMAL 5IJVA 1OF2B 4XB8A 3FMAA 1JSYA 5DHYB 1I7NA 2RFXA 1IEAB 3D48R 3RRQA 4RB1A 5FO8B 3V95A 4BH7B 3T0DA 1T3FB 4JI6H 2HUHA 2J1WA 4GAGH 3UEZA 1M2OA 1UB5A 4P4RA 1WJ3A 3DO3A 4J3SA 4MWFA 3VFNB 3PVXA 2Y69B 4JAMA 2X2UA 4HKXB 4ZT1A 5CJBA 1ZTXE 1EZLA 4PJ7A 1JWMB 4I0PB 4UT9A 1LEIB 3NZHL 5L7XL 2JI2A 1S5IH 1G7MA 2P24B 4MMZB 3OKEA 4HWEH 3LSOA 1I7TA 1NINA 2X28A 4PJ8D 5CU9A 2HRLA 1MWAH 1FGVL 5JNYA 3QUMB 4GMSL 5K9QG 1XCQB 3OJDA 4JREB 3VVVA 2VR7A 4LFHG 5KYUB 3TCXA 1VEOA 1FNFA 1Z9SA 3JWNC 3OKDA 5DD3L 3KXFD 2H1PL 5D1XA 4JI5H 3BQUB 4OJFL 4FQIH 4HIEB 5E99L 4FNLL 5CBEA 4LF9H 2EDOA 3GSWA 3D34A 1OY3B 1TVBA 3TINA 3ECBA 2VJ0A 1B4RA 2NW2B 4OLWH 3TLRA 4A2DA 2XFGB 1ZIAA 4TSBH 3VD5A 1A7RH 4NQDD 1TWHA 1JYXA 4EYIB 2GTWA 3U6XA 1CK0H 3WLWD 2YZGA 4UQBA 1JNHA 3AITA 1WUZA 2RB8A 4DP0X 4NGHL 1NM4A 3CVBA 4KMTL 3DIFA 5J6GA 4OQTL 4G82A 2Y1YA 1AMXA 1Z9MA 2JK5A 1OP3H 3T0EB 3LEVL 3Q0HA 2YQGA 2Z7WA 3IE4A 4OLZL 1IRAY 4X7TB 3CFKB 4ODHL 3W5NA 2EDJA 1CXHA 1KG0A 2QTVA 4OCXL 2QPEB 1HWWA 4N2LA 4QXVA 1VGKA 3OC8A 4NO2A 5SX4H 4IHOA 3RTQD 4WWKD 4KKZA 1KLFA 8FABA 2IDQA 1NCAL 2H3NA 2X4PB 4UCTA 3FO9B 1HNXH 3LZNA 5KZCD 1Q72H 3DK2A 3FC8A 1T7ZA 1KWKA 3BT2L 3K1KC 1I3RB 5D1QB 3N85L 3K8KA 1QP1A 4KZ0A 1CG9A 5B3JE 3GLAA 1DTUA 1JF1A 3EYSL 3QR2A 4NO0B 2BP0B 2HVRA 2WXHA 5J6HB 4J3OC 3CHXA 2V3EA 3X1GA 5HHNA 4CUCA 1B88A 2D3LA 1WWBX 1S78D 2ZICA 2E7CA 3L7EB 3G6YA 3RHWF 2AJUL 1PX3A 1MDAA 2CO1A 2J8HA 5T33H 1XGRA 1Q9LB 1DQDH 1MN4A 1E9PA 5JA8B 3FO0L 5LBGA 3NA4A 2OH2A 1ANUA 5C44G 3GYRA 1KTLB 1A7NH 3QQNA 3GTQA 1ML0A 5BQ7A 3CUPB 4MCZA 1Z5HA 3QH3A 3RV3A 2CIIA 2WXNA 2D7QA 1N5YL 2KLRA 4NBYB 3H56A 2P47B 2W6ZA 2ODHA 1KGCE 4PGDA 1P53A 3AM8C 1UOLA 2NLJA 3NCFB 4MB4A 43CAB 3UTSE 4L8CB 5DQDL 2F8OA 2P5WD 4O02A 1BZ7A 3GXUB 3SDXF 3WKMH 2XKNA 2C2RA 2R39A 2NY2B 3FHAA 3RL1B 1BFVH 4XP6L 3L6FA 2X88A 1KB5L 1VZIA 3V4PB 2VSDA 5T3ZL 4X98A 3NSYA 3GJFA 1XGZA 5T1MB 4XNYL 3R19A 4KKBC 4WK2B 4WIQA 4G6JH 3OC5A 5A6IA 4APXA 1SXAA 2AI0H 1N3NB 3EYFB 1FVDA 4LE8A 3IDGA 5ALCL 2BSBA 2Z92A 3UGEA 1AO7D 5JYLA 3US1A 1H9DA 3K5IA 1QRKA 1C5BL 3UZQB 1WGOA 3FO1B 2UUCH 1QYGH 2P8PB 4DETA 5KFGA 3MRRA 5DC9B 4LMYA 2YPVH 1A6VL 4ZODA 1V7MH 4IRDA 1JHKL 3B9KD 1IGJB 1T0NB 3LH2L 4L37B 4XMPH 4AYBA 4LVHC 5EBWB 5A2FA 4GRLA 3MROA 3FQRB 4CSZA 4DEUA 1EJOL 1SYSA 1NGXB 4WDIA 5IQ9B 1QSFB 2O61A 4HJ0D 3QYCA 4AVIA 1RQ5A 3G5XB 2WY3B 1QHQA 1IC1A 2WN3A 1RJLB 4IS6A 4F7EA 5T3ZE 5HVHC 5CIPH 1P8LA 2PN1A 3LPGA 1BQKA 2AK4A 3OKOA 1XCTB 4OFQA 2ERJB 1UOKA 1G0DA 2IALA 4MNQA 1I1AC 3C6LA 1ASQA 1HXKA 4L1KA 3DVNB 3MFFB 4KI5C 1Y0LB 1ED3B 1AFVL 1RJPA 3VG9C 3GI8L 1RZ8A 3NPSC 1H6FA 3BQVA 2QQLH 3LPWA 4LASL 4AYFB 5ID1A 1B6RA 3JT0A 1ZS2A 2NDFA 2UXBH 2KDYA 4A2AA 2FO1A 4X5RA 2F7RA 2R29A 2YA1A 4DFIA 5EO1A 2ATKA 2NY3C 3SQRA 3TX4A 4F58H 4IKJA 1H8SA 4UQ2A 2O6PA 5J11C 3NABL 2E9IA 3Q2WA 3MRQB 5IMLB 2R8GA 1BLNA 4LCWB 3BKMH 1WD8A 4FDWA 3PL6D 4PRDA 2ZOLA 1KNOB 3HPLA 3C5ZD 3INOA 3MNVB 3MLYL 3K3QA 4GJTB 5D72L 4Y4FC 4MNGE 3I85A 4HD5A 3ULUD 4JHAH 3V0JA 1JD9A 3F85A 1GW6A 4HETA 1UWEH 4K0OA 4NKDB 1QSED 2J6TA 3EPIA 4KRMB 5JPMA 2F08A 2ZSVB 4E9XA 4NXSA 3QWRA 3UTOA 3V6HA 3EUUA 4HHAB 3MA9H 1RULH 3QT2A 2YAPA 4P46D 4JN2B 3UMTA 4PY7B 3DTDA 1U3HD 4PJEB 5HHVL 2BNQA 3RIFK 2R7MA 4HCRL 2EEBA 4Z0XA 3BP6A 1WFIA 2JA5A 2HTKD 4MCNA 4GAJL 4OUOA 2FX7L 4M7LH 4ESKA 4QHLB 1TQVA 1O7DC 2NXYC 2EXWC 5D7JB 4EO5A 4ZPTB 4X4KA 1E2WA 2WNGA 3VO0A 2F58H 1WPCA 1JWUB 2WUCH 2HFFB 2P80A 4FQ2H 2XZQH 2XIDA 5E94B 2EDNA 1T0MB 1XTLA 1TKWA 5IOPB 4QRQA 5KBMA 4YWGH 1ORQA 1SLUA 4MQTB 4OU3A 2NY6B 3EOTH 1WR2A 1XIWD 3EF4A 1NAML 1WRFA 3A67L 4YL9A 1XV8A 4QKTA 5CN1A 3VFTB 4PS8A 2Y2TA 3QZPA 4UU9B 3SKMB 2J73A 3H6AA 3O6MH 4V1DD 1O0VA 1MQ8A 1BZQK 5C0GB 1CFMA 1F2QA 2X44D 4LOUD 3OZKA 2IMWP 1F0LA 3NG5A 3WHXA 4ALAL 3HNTL 1OO2A 5CGYC 2IDCA 5MERA 3LHAA 4BDVA 3MXVH 5BOZG 3B2MA 3FCSA 1KFGA 4OZIA 3RGVC 4O4YL 4ECNA 4IKIA 3W39A 5F70A 5HJ3A 3PWPB 2W59A 2D9QB 1SEBA 5EWIH 3TIEA 3IMVA 5GRYA 25C8H 1KC7A 2CBMA 1FH5H 3K2IA 3VACA 3ZE1E 5KW9H 3NCWA 4MJIE 3PXLA 3Q9PA 3NCJH 1QR4A 3NTCL 1G7PB 1OF0A 4RESB 1AGBB 4TVPH 4XGZA 4FRWA 4I4TF 4H26A 1G0YR 5JUEH 3KPSD 4WKXA 2BFVL 4LCIL 3OUZA 5IESL 3VXPB 4ZUVA 3RE0A 1I1CA 2J71A 5CKGA 4GG6F 2FJUB 3HC0B 1RK6A 4ODSL 5DRZA 3TZVB 4EIUA 3NJNA 2JKTM 1Q9OA 5FM4A 3SE3A 2JJTC 4BHUA 4Z7NE 5CZVL 1L9TA 1UWXK 4TVUA 1YEFH 4Z8FH 1DQMH 3T3MB 5F3FA 5KFMA 1F00I 1RFDH 2A4CA 4LLVB 4KZCA 2GBUA 2C3VB 3CSPA 3EXLA 2ADFL 5IB1B 5I8OL 5EO0B 5BV7L 5TDOB 4UIKH 5IIEB 2ALWA 3CLEL 4I0PC 4JANB 5K1NA 1DANU 3UADA 1ZVSA 2HG0A 4CC4A 4H88H 1YEIH 4YIQA 1EV2E 2WHVA 4FTVA 3BEWB 3ZKMD 3DBXB 2KUTA 1ZY9A 4AGQA 1KY7A 4J28A 4JREC 2O72A 4IBVA 4N90D 1LE9A 2V17H 5EZLA 4X6CE 5D9SA 3BQUC 3TIDA 1M0TA 3G5YB 4PRAA 4PRBB 1U6AL 3CFCL 3JWDC 1N26A 4XC3L 4LEXL 4JGNA 5A2CA 1DN2A 3J7HA 3SBWC 4HBCH 3P4NB 4JCLA 1DQLL 2J2ZB 4OTXL 2KS0A 4PJCB 3HR6A 3V7MA 4OI8A 5TE7H 1WGVA 3DX3A 4JDZB 4TMPA 4ADIA 3WFEL 3LNFA 4E9LA 3VD3A 3D4ZA 4PD4K 7TAAA 2L7UA 1NC4A 5HHXH 2FJSA 2OW6A 2PCXA 1JXKA 4TUJA 5KS9F 1T94A 2AGPA 2C2DA 3V0AC 2XTLA 3QHFH 1QRND 2BQRA 3D39D 3LZFH 1T7WA 4E42A 5DJ2A 3T0EC 5CGMA 4W9CC 3CFDA 3WXVL 1OANA 4O5LL 2DMGA 2APBA 3MUGB 2NXZD 4KHTL 5B1AB 4XYMB 5C0DB 3NA9L 2LW3A 4LSVH 1QLEB 2Y2WA 1OTUD 4HK0B 4OI9A 2AQQA 3GIVB 4FNSA 3CDFA 4KH9A 3FB8B 3DSNB 1VF5C 4YE4L 3O2WH 1E67A 1S7SB 3BAKA 4PJ8B 2DQJL 5D1QC 4LCUB 4D7BA 2FLRT 3CVIH 3ZZLA 2F7PA 3HTLX 4Z3TA 3LMJH 1H3TA 4HC1L 4KK6C 4AEIL 1A6ZA 5DYFA 1XEUA 5CP7A 4AGOA 3FZUD 4C4KT 2B63G 2EYRA 4NN7B 5HYEA 3PAYA 1NZRA 3DWTA 3L9YA 4XI5C 1IQWL 1YY8A 4BY7G 5A1AA 4ZZFA 5ABAA 3UFXB 3IGUA 3AU1A 1OPOA 5ID0B 3L4JA 3F6IA 3QO0A 3GTMA 3BKJH 4MVBC 2B1HH 3QDGA 4OCRL 5DTFA 4Z7WF 3L5XL 3O3EB 1QUNB 5AKTA 3WTXA 2FLNA 3GMQB 4NQDB 4LNRA 4YJ3F 3ZW3A 3UJIH 5CM1A 2R0KH 4DF9A 1A5FH 4N0YH 1E4WL 3U4EB 3VM7A 1BQUA 3QDJD 3VYOA 3UJJL 5LYJF 4GKSA 1KJMB 3RB5A 2J6UA 2OCFD 3DV4A 4UAOB 4W9JC 1GGTA 3CK0L 4JFSA 4W9FC 5CS7A 4LDLB 1NIAA 4G5ZH 1CE8A 5EORL 4E41A 4PJAB 3ILPB 3IAGC 2KYIA 2IAAC 4L8BA 1G5AA 4KNSA 4WZ9A 3DX7B 5ICXA 3RTQB 4ENEC 3AS2A 4WWKB 2HJKB 1Y1UA 2OQJA 5IZ7A 4N5ED 2NY2C 3B7TA 1AE6H 3MRIA 3HC2A 3I50L 5KZCB 2EDLA 4ANUA 2YN5A 4UCFA 5LMUH 1FO0L 2EXSA 2Q3XA 4D9RE 1YN7B 1U9KA 1VFMA 2AGOA 4QRRA 1SHXA 1ID2A 2C9QA 4WVRA 4UQAA 3BRDA 1H15A 2LFGA 3DYOA 4FLSA 5I1LA 4AQ1A 3D09A 1RK5A 2FB4L 1UQSB 3CX5K 1R24B 4G9DA 5KSBB 4W6WB 5K2MA 3M9MB 3RNKA 1E4JA 5EDWA 1RHFA 1XL6A 3GXDA 2AQNA 3T71A 1J10A 2UUAH 5C3LD 3PRZA 5D5MA 1RZKL 4UZUA 4YSSA 4L29A 4HWZB 1X44A 1B0GB 4JZNB 4U3HA 1N6VA 2P7TB 3KS0J 5BXFA 2HA1A 2G4GA 4LOEA 4EG0A 1RK0B 4PRIA 4RQQA 4RUAA 4M8UA 2YD0A 4EMZA 2IFFL 3WGUB 4DO5A 4UT6H 1OWWA 1X7QA 1FDLH 2ERJC 4AK2A 3JWNH 4NKOA 4AEHL 4AIEA 3K91A 4EBCA 3LKQB 2E86A 2P5WB 3K4AA 4L9DA 2MCG1 5KFDA 3S4SB 3VXRD 3ZDZF 1KIUB 5TK2A 3KHRA 4XMWA 2AXWA 3BUPA 3GBML 4A7QA 4OLXH 5BVJA 1SN5A 2FX9H 2MTPA 2AJVL 1A9VA 4QPEA 1A4AA 5JIPA 2KZKA 4F3FB 5FGSA 1CFTB 4Q9QL 1FNSL 4U3XA 2Q5BA 1TVHA 2CD0A 3DI2B 2D3VA 4UOQA 4WSKA 1MWOA 1OSPH 3MLZH 1C7TA 3MACL 3PWUB 1T83C 1G4RA 1AO7B 1WAEA 4Z3IA 5J13B 5MENA 1NBVL 3DHPA 4LAQL 5JHDD 2OP4H 4XMZA 4UV7H 5HTSA 4NUPA 4B9GA 1OE3A 4MHHG 1AGFA 2G5BB 2FSEA 1FNAA 2OULB 4HSAC 3ARYA 3RJQB 4ED1A 4DGIH 4J3OF 1T4KB 4QCIB 4PRNA 3B9KB 4XPBL 3WNIA 5HSFA 4WGWB 3L2NA 4F80A 5A7BA 3TASA 5JOPD 5LQBL 1VRSA 2ZUYA 4YR6A 1IE4A 1T5XA 4P3DB 1BWMA 1SDYA 4JHZA 2HFEB 4GYBA 5L4JA 1D2PA 1SXCA 1L9MA 1XF2A 2YBRA 1DVFA 1WS7A 5T3XD 4UZGA 4NI6A 4NQXB 2FGZA 3FJTA 4P3WA 5KSUA 4M1GH 4X5XB 1HNZH 1DR9A 2R7NA 4OIFA 3HC3H 4ETQA 12E8L 3H0TB 4RFOL 3HOVG 3VRIA 4H4NA 4FABH 4DZ8B 4WI2A 4OD3H 5D7JC 2Z1PA 4YBQC 1RUPH 1GMEA 4QRTB 1IC4H 1KN2H 2WTPA 2HX8A 1LEKA 3OMNB 3WEOA 1JZHA 3AY4C 3V6FB 1I82A 1KIQB 4G7SB 1MAJA 1IL1A 1HN1A 2OK0L 4L4TD 2P0AA 1AIFA 2XQYA 5AW1B 4BZ2A 2NY6C 3GLDA 3SEPA 2DKMA 3SGEI 3PW0A 2GJPA 2WSDA 3ZLQC 4JI0H 4B9YA 1R47A 1GYUA 1IKOP 5T5FA 4HLEA 3G6JA 1QHPA 1U2CA 3DGGB 4L1DA 4X9HA 3VU2A 1H6TA 2N0MA 4YXLL 1A9EA 4LHUG 2TRHA 2YRLA 2UX7A 4PREB 3TV3L 3C5ZB 3T1YH 1EFXD 1U8NB 4IJTA 3HJ0A 4TLTA 4WI8A 2GJZA 4M02A 3T8MA 1ZLEA 5AB2A 3LQAL 4MD4B 4G8GE 3CXDL 1FLRL 5KVEH 1FYTA 2JA5G 1QSEB 3UC0H 1RUMH 3QEUB 5CEXB 5KBLA 1WVZA 1TTFA 1LJMA 3ARZA 5F9AC 1GGBL 4X62H 1HAWA 2YK1H 2IH9A 5I9QB 2BIIA 1D5BB 1IAIL 4P46B 4ZD3L 5KOVC 1U3HB 2V7NA 3S5YA 5DG7A 4RDQG 4OCLC 4NNPL 4EXKA 2MFNA 2MHAA 2VLRD 2XKSA 3GZKA 3N43F 3MRLB 2FP4B 3N50A 3IS1X 1XGYL 1OGSA 1T03L 2HLFC 5C0ND 4MV9A 4IU2B 3MOQA 3LYRA 5F7MC 3FMGH 2YA0A 2G3ZA 2G9HA 4ECWA 5DSCB 1I7RA 4R4FL 1YPZA 4CN1A 4PVLA 2DH2A 3V0FA 1KBPA 4QOKD 2FQGA 3NIDB 1XIWB 4MJ4A 1RLWA 1CPUA 2Q86A 2QKSA 4KI5F 4W6YB 2NY5C 1OGAD 1NCDL 5E9NA 3PHOA 5SWQA 1KXQE 4C57C 1MJJA 1TO5A 2PW1A 1MW3A 2P44B 3DIDA 1SMDA 2GIMA 3EJUA 4WCYL 4K94L 2EJ1A 2Q8BH 3DETD 4C4UA 5IT2L 4NC0B 1RH8A 3MXWL 2X2IA 4LHJB 4V1DB 4XPFH 4Z7UF 3WJMA 3R5HA 3ARXA 5I5RA 3NSCA 2J6WA 3U2JA 5JW3H 1JV2B 1EEZB 2XWDA 2CU9A 2FAUA 5CJQH 4YHKH 3I74A 1KXVA 3FTUA 4L0YA 1U2HA 1MZZA 4G6KL 4F4ZA 2F68X 3H54A 4DP5X 1KEML 1N5AA 3IJYA 4J3TA 3LB6C 4AC2A 5IW1B 4JQXC 3F83A 3W0WE 4O4LF 2FWOB 3QUZA 3BAXA 4PP2B 2J8OA 3FU5A 4JFXA 4R7DB 5EIIB 5KBNC 2UVRA 3QQDA 4PJXE 3BWAA 3T4AB 4JRXA 4M6OL 1GCYA 4FFYH 4MYPA 3FN0H 5C0AB 5HBBA 3KPRD 3I6GA 1FFOB 4XH2B 3KYMB 1IAOB 2IDTA 4LSUL 4AOFA 4RAZA 2QVIA 4ICWA 1MFCL 3L1FA 4KC3B 4Q6IA 3SPGA 4FFZL 4DW2L 5AW4B 4N2EA 4D0CB 4KJWC 3BUIA 1PZBA 3KPSB 2C9PA 3HVNA 1CGYA 4EXPX 3TH4T 3HS0B 3ROOB 4FNUA 1S8DB 2CJSA 2GJRA 2IOOA 2WLLB 4NO5B 3OHXB 1W0WA 3QXDB 3X14A 5DQGA 4JFQB 2RJMA 3QUYA 4NM8L 1ILSA 4A2EA 2FJFA 1U8LA 4ES9A 1C5CH 2JELH 3GXMA 5F9LA 3HE7D 2PW2B 4FQCL 1HHGA 1NCGA 5HHMD 4OD1H 4BD4A 5ESVA 1TFHA 5CLWA 4YFLI 5D7IA 5GRWA 2VR3A 4X0KB 3U9WA 4BSWB 1MCEA 3B7SA 5DC0A 2IPKA 5IK3B 2BC4B 1QOKA 4OBRA 3IJHB 5L88L 2NZ1A 3W56A 2NQ3A 1T1ZB 2ICCA 3SYQA 3MRKA 2OSYA 2Y5TA 4DO4A 4B9IA 3FF8A 3FQUA 4BE5A 3DRTA 4MZ3A 1X6LA 4RNMA 5FLVA 2Z4QB 4XHJC 1SY6H 1OCWH 3CSYA 3MNDA 1CFQB 2Y7LA 1E4EB 2V9QA