3N43B

Crystal structures of the mature envelope glycoprotein complex (trypsin cleavage) of chikungunya virus.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
336
structure length
335
Chain Sequence
b'NVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDRTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 envelope glycoprotein
publication title Glycoprotein organization of Chikungunya virus particles revealed by X-ray crystallography.
pubmed doi rcsb
source organism Chikungunya virus
molecule tags Viral protein
total genus 63
structure length 335
sequence length 336
ec nomenclature
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2400 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n43B03
2.60.40.3200 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n43B01
3.30.1490.280 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3n43B02
3N44B 3N40P 3N43B 3N42B 3MUUA 3N41B
chains in the Genus database with same CATH superfamily
3L7EA 3KYNB 1JRHH 3S5YA 4ED3A 1M7UA 4QWDA 3G6JE 4PJ9C 4ELKB 3AXLA 3NZHL 4BFOA 3QDMD 1WPCA 3SDAC 3CCHB 5D5MB 4LHJB 1DQQA 3GMNB 1S7WB 4HCRL 3N41B 1CI3M 4PJFA 4RSVA 4U3CA 5DVPA 4F7EA 1VRSA 4I2XB 4N1CA 4LCUB 1WHOA 2I5YL 3H53A 3NAAH 3T2OA 4JHVA 1MJ8H 1TO4A 5DLFA 4P9HH 5A43C 4KTDL 3GRWL 3APNA 4H88H 1E7UA 4QTFA 3V9CA 5DMKB 1JPSL 3TN0C 4A3KG 4PBVC 3SKOB 2VT0A 1JHLH 1LMKA 2L4OA 4FF9A 5TQ0L 1HYRC 5I15L 2KSWA 2BQ3A 2FX9H 3HG0A 5IVXB 1M4KA 3KCPA 4G8GE 4TQIA 1ZEAL 1QFWH 5KT5A 4YBZB 5DJZA 4EN3D 4F80A 1S0OA 1SZNA 2XVKA 3S34L 3NFNB 2DLFL 4BYHA 1NFDB 2VR4A 2X7LA 3PDOA 3RAJL 3IVKA 5HJBA 2E5LH 4OCRL 2BJMH 2VITA 3VSTA 3RA7H 4Q6YA 3IETA 2PPDA 5FGCE 5IFHL 1IJ9A 3DMMC 4R0LB 3CXDL 4ZQKB 4M7LH 2FBRA 3VFGL 4BRJA 1J8SA 2DTSA 3FBQA 3OHAA 1J05A 4URTB 1PK8A 3G08A 2Y5TA 4XBPB 5JUEH 2V3DA 1MCRA 3B5TA 3WMPA 3V6KA 1J11A 1ZA3B 2QGEA 4GS7B 5EMYA 5KG4A 1I7ZA 4ADGA 2RA1A 4OFIA 3ZTDC 3F12B 3QCVH 5I75B 2HLAB 3MYJB 5H35A 3FUJA 5DK2B 4H26B 2PXYA 4H5SB 4PJDE 3JVGC 2NTFB 4M3HA 1CL7H 4AYBE 5FWQA 3DXAD 3MJ7A 4KMQA 3DX9A 5I47A 4R5VA 5T5NF 1JGEA 4ZFZB 2BPBA 2PYFB 4YP3A 4P23D 4CJ1A 3FT3B 4D0CB 1G7JA 5DZLA 2HKFL 1U2HA 1YPZF 2Z6FA 1RD6A 2ENJA 5T3ZH 5DJDA 2NNXA 2YUWA 2NLJA 2VDPB 2Q10A 1P6FA 2CAKA 3EHBD 2C1PB 4RAHA 4MA3A 4TRPH 2OYMA 1JI1A 4A2EA 3OB0H 2R7EB 4JRXE 3H0GA 1MF2L 1PKOA 4TPRH 4MCZA 5IK3A 4HKZA 5KVDE 2XWTA 1IRAY 3L4ZA 4JPVL 3T0EB 1IQWH 1BOGB 1S7UB 1AP2A 1TF4A 1HOCA 4GXVH 4NKDA 1U8LB 4PJ8D 2BHUA 2WWKT 4Q97A 4YO0B 2IBGA 3RGXA 3NSDA 3S35L 2AGQA 4KUZH 4P06A 5D4JA 4JM4L 3M6DA 5I8CB 4EGQA 4Q6IB 1SJMA 1UD3A 4RISL 5C0BD 4XMVA 5D6DC 2CMRH 1YNTA 1T7VA 4WW2C 3A67L 1JIBA 4HCRH 3ECBB 2YZMA 4DL6A 4LARL 1XXDC 4YHKH 1AH1A 4Y2OB 2I5YH 4KRMB 3VFSA 2ZAIA 1R24B 4KTDH 1MWAL 1YEHL 1U3ZA 3M1BA 5D7IE 3UAFA 2LU7A 4L48A 2G9HB 3TJHC 4XHQA 4UQ9A 2NY1B 4LPWA 5FV1L 2ZYSA 5TQ0H 3ARGC 5I15H 1R3LA 4KRPD 2V7NB 3X12B 4L2YA 2AXWA 4GSRA 4X6FB 2HJKA 3PGCB 4NBYB 4WV1B 4HU8A 3FQRB 2IQ9L 4IGBC 4AM0A 5KTEL 1RUAH 1MNNA 1CDBA 2MQ0A 5AVSB 4LSSL 3SPIA 3L45A 3MU3A 4GSQA 3GO1L 3A22A 4O02A 2JCCF 5F0JB 3BPLC 4APQD 5C86A 4Q14A 2VXUL 1P5VB 3FN0H 5GGRA 4WGWB 1GAFL 4RQQA 2WBKA 5KFMA 3BGMA 4U6HA 1WGOA 4NPJA 4P5MB 4XGZA 5IHUH 4W6XB 5SWZD 5IFHH 3CXDH 1RY7B 3VFGH 2R7ZA 5D1OB 4V11A 5CP3A 5HYEA 5F9AC 2W8LA 2ZG2A 5ESAB 3FCTA 4DL2A 4PRAB 4BZYA 1TSRA 4RAUB 1UURA 3CFDB 4QCIA 3C5SB 3W39B 1MHHB 3KYMB 5IW1B 5DD3H 3TIIA 1AZNA 2J88L 3TT3L 1RZ8B 3EKCA 3RWDB 3CXHK 4Q56A 4L0PB 3VXUD 1VFBA 4IHOB 5I5RA 2OULB 2MH4A 5HHXL 5F9OH 3JWDC 2JKNA 4WK4B 4GLRH 1Z2OX 4U6YB 1SJXA 2ATKA 1A6VL 1UA6L 5F1OB 3V4SA 4PJEE 3F84A 3V5KA 3D39B 1NC2D 2R85A 4MASA 2HKFH 5JH7F 1U58A 1B2WH 2PYEA 5ANMB 2PCYA 2VISA 5SWSE 3L1GA 4C4BA 4ELMA 4DJMA 1AFVL 3UTPD 3DUHA 3C5ZB 1J0YA 1ZLDA 2FX8L 5EFIB 2I07A 4POZC 2O93L 1YY8B 3MX0B 5B39B 5IGXL 1JD7A 5D2NB 1WS7A 3QEHA 4HS6B 1QLFA 3VWJB 5DRNB 4XBMA 3VFRB 2G30A 2LLGA 4LHUG 3VFMA 3SGDH 5BXFB 1JERA 3V4UL 1J8RA 2L0DA 4WHTA 2VW7A 4UQ3A 5DHMC 5JOFB 3MWEA 4JPVH 1IFHL 1ZLEA 3LV3B 3P73B 1F3JA 2ZXDA 3FQNA 4XXDA 3MUJA 4NFDA 2OMNA 3S35H 4MNGB 1QSFA 3EF7A 5E0QA 1CZ8L 4C56E 1JVLA 3DJSA 4JYAH 5KYWB 1D7CA 4RISH 2ID5A 3DJTA 2GI0A 3MRCA 3V6OA 2H3XC 3ETTA 2GJ6D 3IGKA 1QTYT 1YECL 4EZLA 1OTSD 3A67H 1RMFL 2C9SA 1MEXL 3DX7A 3ASWA 3MBWB 3AADB 4LARH 5FM5O 1P7QB 2R1WB 4D7PA 1S4IA 4MMXC 1MQ8A 4JDZB 1T94A 5KYNA 3UTZB 1BQHB 3T4AC 1MFNA 3WJLA 4FA8A 1MWAH 1YEHH 5GS0D 2DWDA 2NR6A 2IFFL 2Z31D 1J1XL 1XR8A 1IM9A 1MVUA 3JUZA 4B50A 1KB3A 1F18A 3Q5YA 3HE6D 4GRWH 5HY9B 5GSRB 4DVBA 4UCRA 1SGKA 1GYFA 4N0RA 2UXVA 4R8UA 4DPCX 1EAPA 2EKSA 2IADA 4R7LA 1PLGL 4X7CC 2IQ9H 3VNYA 1OP3K 1XF3A 4LSSH 1CGVA 3QWRD 3RTQC 1IOVA 3EH2A 1NIDA 4MMYA 5C0ND 2E47A 2VXUH 3F83A 2XX1A 1BSIA 4BDVB 3U83A 1BD2D 4OQTL 3OPUA 4TSBL 3HE7B 2DPJA 3I4NG 5KFEA 3RWJA 3UYPA 1NGYB 1ITCA 2C9XA 5MEPA 1KN2L 4GKNA 1AIFA 3WLWC 1C16B 4ZW6A 3E3QE 2VL5A 3WN6A 1N5AB 2IDFA 5T33L 1LE9A 1UD5A 1IBMH 2EIKB 4PJXA 2GUOB 1T7WA 4P46A 2JJUA 4YZWA 5I17A 1NIEA 5FFGA 1D5MB 4X99A 3TT3H 3WKQA 3P3RA 4PWFA 2NX5A 4DW2L 2Z7WA 5J6HB 3X3FL 2K4WA 1JF1A 1F02I 2IOOA 1ET7A 5HHXH 5H37A 4R7DB 5E9AA 3K4DA 2NY4D 3KM1A 4O3PA 2VA2A 1UA6H 3Q13A 2MEJB 1AGEB 5AYUL 1BAGA 5C71A 1A2YB 2A6DA 1NGWA 1JXJA 3GLAA 1KB5A 3SDDD 2VLKB 3RBGA 1QWUA 3DYOA 3QULA 4BSVA 4A3JG 1YEDA 4M56A 4OCYL 3RWGA 2DRUA 3BJ91 4FLOA 4HIHB 1IX2A 2TSAA 2ZCLL 3JZ7A 1E7VA 4EN2A 1AFVH 2I24N 1TT6A 2IMNA 3U48A 4Z3HA 2VUMA 2CHWA 3ZE1F 1KN4L 1JGLL 2ADGB 2FX8H 2R9HD 3OKLA 3IS0X 5F7KC 1CLVA 1KPRA 2DQHH 5G5DA 4BXSV 4RWYL 4HX1A 1JDDA 3TEXA 1VERA 1YEWA 1LEKB 3US1A 1YY9C 3CFCL 3V4UH 4P48A 4WO4A 3AM8A 2X6CA 4PD4J 1IFHH 1GA2A 3L5XL 1KC7A 3GGWA 4PJHB 5KVFH 1HFUA 4PRPA 4N5UA 3HR6A 5C0FB 3UXFA 4NZJA 5BS0B 5E2UH 3AREB 5FXCH 5D1XC 2LVEA 1C7SA 1IC1A 4YWGL 4BZ2L 1RJCA 5L1LA 1U2CA 4HEPG 1CZ8H 2JIXA 3BE1L 3QJTB 4JKPL 2NW3B 3EJPA 4JMNA 4QTIL 3TONA 1OGAD 2XQYK 4JHUA 5JQWA 5JPMC 2OMWB 2FEDD 1YECH 3Q2CA 4GW5B 4BY7G 4AQ1B 2F58L 2BNQD 2E4FA 1MEXH 3GBML 4FTVE 4H44C 3BA9A 1TAEA 3SBQA 2EDTA 3TEUA 1O9WA 1WWBX 2GBUA 3C6LD 4O4LF 1AHMA 2PNDA 3V5DA 4NN7B 1PGRB 3OWRA 4YDNA 1L0PA 2XETA 4U1NA 5EN2B 3KTMA 3IJ7A 1YNTF 1F13A 4LSPL 3OMIB 4RFEA 2IFFH 5E7BA 3RIFF 1J1XH 3B6SA 4J8RA 4EIZC 2WV3A 1MLBA 3BH9B 3ARDB 2B5IB 5JZ7C 2VNCA 3QEQB 3GSRB 1FLTX 3IAPA 2FKLA 3NJFA 3CZEA 1IKNC 3ZKSD 4U3HA 3PAZA 4X4MA 4JM2A 5DZPA 1KTDA 4JKKA 1SXAA 2VERA 3T0EC 4R7XA 4AE1A 4AIZB 3SKUD 2V5SA 2HTLC 5FO9A 5JYLA 3SDAA 4YSUA 3IB4A 4OIAA 4JO5A 1YYML 4RFNB 1FL3B 4AKPA 4YDVB 5KN5A 5ILTL 3BYYA 4G1EA 2W57A 4Q6IC 4AEFA 4TSBH 2UVVA 3ECWA 3BFWA 1RHHA 3ARBA 5D70H 3BZ4A 1ZS8A 2ITDB 1GZHA 2PWDA 4FJZA 4KQ3H 2I60L 5F9NA 1KN2H 1QTPA 4A6YH 1A14L 4I0PA 3DHUA 2K7QA 1XH3B 3HHMA 3GMLB 5IJVA 2QDWA 1H15A 1KJ3H 1NCDL 4HIIB 5AW2B 2VAJA 1WFMA 4FTDA 4ZMQA 5KSVA 1XQ4A 1RZIB 5E95B 3KBEA 4JFYA 2NY1C 4B5EA 4DW2H 3RZCA 4QKTA 3STBA 3X3FH 1A4KA 1ZS2A 3TBYA 1U4FA 4KI5C 4Z7UB 5F9WB 2DKUA 1DQVA 3RZWA 2E7DA 2EO9A 4OBRA 2FL5A 1X4XA 4FYSA 3SPHA 4UT6A 5D7HA 3O8XB 5AYUH 1WCBA 1Y1VG 1QOKA 1L5GB 2KYIA 3FCGA 2O26U 2KH2B 3K80A 4O2FB 4P2QB 4PRNA 5EIIG 4ZYKA 1L3WA 3RDTB 3FQ1A 4OCYH 3L4UA 2ZCLH 3FUHA 4R4NC 3ZDZB 3OAZH 5LAXB 4D9LL 4R2GB 2WB1E 4PIRF 5C0CE 5IHHA 1KN4H 4P3WA 1JGLH 3TO2B 3C60B 2GTQA 5C0JB 4K3DL 2IANB 2KZ1B 4RWYH 1EDHA 5SX4H 4JG0L 4MA7L 4NQXA 2QADD 3MGOB 2X2YA 4ELMF 5KFGA 5MERB 4PJ7B 3VQ1C 3VH8G 3JVGA 1NCBL 3QIUA 3CFCH 5F1NB 2J72A 4QAWA 1A02N 3L5XH 2CK2A 1R34A 1E9PA 4MAZA 3H0TA 2BIPA 4XB7A 4YDIL 3CVHH 1G4RA 3LXUX 4YWGH 4BZ2H 5BOZG 2H0EA 3MMEA 3BE1H 1Z9LA 2VXVL 2BP3A 2F7PA 5C08E 4OLYL 1X7TA 5A2IH 3IU4L 1J8HA 3OLDA 4DL3A 5IB3B 2Z8VC 5CWSA 2WLYA 3KM2A 3F7VB 5DS8A 2DIBA 3GBMH 3E2HB 1I6UA 3SYAA 3D12B 4XMUA 4GOSA 1J0IA 3DBXA 4Y4FA 2YBGA 4S1DD 1T3FA 2VMCA 2WTOA 2AXFB 3NCJL 3O3BB 1YPZE 5DEFB 5GGSY 1XD1A 4FFVD 1IFGA 1WZKA 4LSPH 4RBPH 1V3KA 1NM4A 2D31A 2X3CA 4JV1A 4GINA 4IDLA 5EU5A 3WHXA 4HKBA 2IOIA 3ZYOA 4X0NA 2D0HA 4L29B 1GIGL 3T77A 3FMAA 1QNZL 3VWJC 3MUUA 4JFEE 4JG5A 2VRKA 2QFPA 5AVRB 3N0PB 2VLRB 3CBKB 5C4XG 2TRYA 2DBJA 4WY7L 4LSVL 4M00A 5DQDL 3V7AG 2NY3D 3NCCB 4PGBB 4BFRA 3D50A 2APFA 3EBIA 2HX7A 3IGFA 1CGXA 1INQA 4ETQA 3D2UB 1EXUB 2DWCA 3QDJA 1YYMH 1WTGT 4ZMOA 2PCFA 5ILTH 1HJBC 1J9TA 1JZ7A 3S3SA 4JO8A 3SOTA 1WFOA 1W0YT 1G7QA 5DHYA 2H32A 2WNKA 4ISVB 3V4LA 4AVIA 3GI9L 1HU8A 2DQFB 4OF0A 3RB4A 3TURA 3CNKA 1N32H 5D1QD 2I60H 3EGSB 3BFOA 3GILA 2MQGA 3ARFD 1X7SA 3JVFC 4ECXA 1A14H 3MV7D 3SBWA 1XNQH 3OXSB 4OKDA 4HJEA 1JTTA 2JKSA 2ASLA 1HAUA 2APVA 1QVOB 4MAYA 1NCDH 4WQOA 1KBWA 4Y16B 3TGXA 2R93G 1PX8A 4ENZA 2QVIA 4Y89A 5IHLB 1F2XK 1B04A 2HVRA 1VFOA 1CYGA 3FB5B 4MMZB 4WI2A 5C0IA 2YEQA 1KTBA 1U8IB 3IFPA 4ODVL 3BP7B 4M03A 3T3PF 1ZHLB 4L1DA 4X4ZA 1AI1H 1EEZB 5JUMA 3OBAA 4AH2B 1J0HA 2J21A 5C09E 1NBCA 1N8ZB 4X9YA 2DYPD 3LRGA 4YLCA 2W94A 4IRJC 3GTPA 3LKNA 1ZVSA 1KZYA 1H3PL 4YQXL 2A73B 2C5DC 4JG9A 5CXPA 4HWUA 4D0DA 1KTRL 1WQVT 5GS2D 4D9LH 2OXGB 3H0GG 4AQ8C 5JIQA 3GRBA 1J0JA 1QATA 3DX8A 1B0IA 2J8OA 3AS2A 4JREB 4B60A 2A6JB 5TDNA 3Q2WA 5GRUH 4LF5H 2ORBL 4YSCA 3KBPA 1E28A 3Q6FA 1WZMA 2MKWA 3GXNA 4Y5VB 1UWXH 4D0BB 1NCBH 3KLHD 4FFYA 2W9AA 3QG6B 5HDRA 3TBTB 4P0DA 2MSPA 3TA3D 1H19A 4E0RB 4GIOA 2ZE0A 3FT2A 4GAYA 1EV2E 2H26B 5ISZA 1XTLA 3ZE0F 1A1MA 4Z7NF 4PV9A 2YAFA 3TZVB 1TEGA 1I8IB 5D2LE 3UC2A 2CRMA 5KFAA 4UBDD 3QRFM 1OSYA 1OHZA 2VXVH 4DUZH 5J13B 3Q2VA 3EYVA 4OJDH 4OLYH 1AKJB 3IU4H 3K74B 2R6FA 4JJOA 3Q06A 4DR6H 4TNGA 3IGUA 5IFJB 2W6NA 1B33N 3BGFC 2FPPB 4U7CA 5FA4A 2Z9TA 4LK4A 1IGFL 3UAJA 1IGJB 2NT1A 4XN1A 1PZ5A 3DOHA 2WVTA 2VDRB 5DA0B 3NCJH 3R0NA 4NQDA 1JHTA 4MCYA 3CGTA 3P3UA 1ZETA 4IU2A 5TGBB 5JHMA 2JI1A 3HFFA 4QYOB 3VMPA 4M7JL 5FYJU 4TL4A 5CKGA 5FJ8G 4GAFB 1GIGH 3EJJX 5KJ7E 4ED1A 1QNZH 1J86A 2OMTB 3MOAL 3JV0A 1T20A 2AVFA 1BYNA 3CZKA 4ACTA 5I1LB 5EZIH 2UYLA 1MIMH 1UB5B 4NQCE 4PJIB 5DYFA 2R7LA 5DC4B 3BIAX 5F96L 4LSVH 4ODXA 1KIQA 2DOCA 4F7TB 4LMQE 4MNHA 4MZRA 1YNLH 1VEOA 2NY2B 1Q0YL 4NUJA 2W7PA 1DQDL 1D6VL 1JZJA 5DHVH 3AREC 4N8VB 5DK0A 4RZRA 3ULUH 2IH1A 2MCAA 4PCKA 4JM2F 1X9QA 4MA8L 1CI5A 5EF3A 3MNVA 3VI3B 3L3JB 3DO7B 4JPSA 2YGVA 3WOVA 1OE3A 4B3SH 4G8GD 2CW7A 4DQOL 5FM5M 4HPHA 2W7OA 3HNSL 3ECVA 4YSEA 3UG3A 4Z0XB 5FPOA 3CLWA 4CMHC 4LP8A 2HX8A 3HI6L 2PWFA 4AYFA 2XICA 1MCQA 1OTUD 1VHPA 5IJDC 4M9UA 9CGTA 4FQHB 2H8PB 2HN7A 5H94A 2FK2A 2APTA 1EERB 4YGVA 3U4EA 1FIEA 4EMZA 3SGJA 3V6ZA 4QRSB 3P3SA 4NO0B 3L3KA 1MFEH 1U92A 4ODVH 1IGML 3S7GA 1VBGA 2XG4B 5FCUH 3RTQA 5DS1A 4BFKA 5I66B 5FKPA 3G5ZB 3RKDD 2KLSA 2WLMA 4PREA 2WCGA 5E1GA 2V0AA 5E5UB 2QFRA 3KYNA 1G7HB 3BAKA 1A4CA 3BH8B 1GZQB 4ELKA 2MRYA 3RFZB 2V9UA 4YQXH 3CCHA 3V6JA 5D5MA 1IU1A 1OB1B 4RFNC 3GIZL 3GMNA 1JZ6A 1KEGH 3I3BA 2FO4A 2QQQA 2FNBA 2FQFA 2Z65C 4I2XA 4LCUA 3WGVB 2CKZB 3RPIB 1RK1B 3H55A 3V4PB 1SMDA 3BRFA 3DUUA 2ORBH 4HFUL 2H45A 1JXDA 3HBLA 2ZYHA 2L7UA 1CQYA 3WAJA 5TK4A 5DMKA 2N4IA 5MEOB 1Q9LA 2ENPA 5T1MB 2WLIB 3SKOA 1BVKB 4YX2H 2WUCL 3L4CA 3FJTA 3T1HH 1OGPA 4OH2A 5IVXA 3K91A 4FZEL 4A2DA 4P2OC 1J18A 1CDCA 2EINB 4U1GB 1EGJL 4FLSA 4WLCA 3KHRA 5MI0C 5F9WC 3VSUA 1S2EA 2J20A 3GC3A 2Y7SA 3DPDA 3NFNA 4JRXD 3GV8B 1NFDA 1CFTB 2Y24A 1MY5A 3KPSA 3NCXA 4M6NH 1T7ZA 3BX7C 4TVPH 4AYEC 1HT6A 5GS1B 3ULVE 1U3HD 2E76C 1IGFH 4R0LA 4N68A 4PJGB 4ZQKA 5L2KB 1U8NA 4IRCA 9PCYA 2WZ6A 1HH6B 5CZXC 4MJHA 2FIRT 2NYYC 4XBPA 3IDYC 5DD5L 3ZKQD 3CMOL 3C60C 1ZA3A 3KW8A 3ZE1E 4KZDL 5KYYB 4M7JH 5J3HD 2JA7A 4X6EA 5D7JC 5F7WC 3PFUA 3F12A 1DJYA 2YARA 3MOAH 3R7RA 2HLAA 3MYJA 4F9PA 2HT2C 2UUAH 2LU4A 4H26A 3WFCL 3LJ3A 1N4XL 4H5SA 1PIFA 2QTEA 1XH2A 3HZMB 2NTFA 3L1OH 3TVMC 3PW4A 2XVBA 2W6PA 2WYIA 2ICWJ 3FFDB 1T36A 3KL3A 3TNMB 1T7YA 1J87A 1TENA 4JDVB 3HB3B 3QHFL 2VSMB 1SM3H 1Q0YH 5KSAD 1DQDH 2H6UA 4JL2A 1D6VH 3VM7A 4ZW3A 2PYFA 3HBPA 3FT3A 4D0CA 2P49B 2W60B 4MA8H 5EWEA 1QQDB 2EECA 1GPOL 4KOCA 2Y4SA 3PVXA 3BDBA 3FQYA 2JQMA 5JOEA 4DQOH 4PWIA 3BG5A 4HK3J 3E2HC 1AYOA 5HBRB 2C1PA 4AKOA 2WO3B 3G6VA 1E9QB 3HI6H 5C6WH 4LGPB 1NBZB 2R7EA 2IBBA 4OD2B 3UO8B 1F2QA 1W2KT 4FADA 1AGFB 2XI9A 3CFKB 2CBOA 3UCRA 1I8AA 4PR5B 4JZOB 4J23A 5GHWH 3T0EA 3KLQA 1N3NB 1S7UA 4ZMTA 3B34A 1U6AH 3EOAB 1U8LA 3RX5A 1KWGA 4YO0A 1VAHA 3DROA 3HOWG 3W0WE 4YUEL 4YFEA 1U21A 3DV6B 4Z7IA 3RL1B 4F15C 3VI4E 3TFBA 5I8CA 1MCDA 3V9EA 1MFUA 4Q6IA 2J1ZA 2XN9B 3VXSA 3OZKA 1GL4B 4Q45A 3CLFL 2FECL 2VDQH 1HIML 3GIZH 4MAMA 4ECWA 3OZLA 3MNZB 1NUNB 3GS0A 4Y2OA 3JV6B 2WWMD 5MENB 1JGDB 3QZWB 1E43A 4WWKC 1P4UA 2DJ4A 1CDJA 3DJ9A 1RZGB 4NQVB 4HFUH 4JI7H 5FK9B 4A7UA 4TUKL 2G9HA 4BFEA 3WO4C 4KROD 5FFLA 1CLOL 1N10A 5HHPB 3UEQA 4M7ZB 4F2MB 2XLLA 2FWOB 2V7NA 2J8UE 5SWSD 3TBCA 3X12A 4FZEH 4N0UB 1IGYB 1PJWA 3MV9E 4X6FA 3PGCA 4WV1A 1ZANL 3GXIA 4MMZC 4KFZC 5BRZD 3KNBB 3FQRA 4DK6A 5HP5A 2R15A 1EGJH 1IBZA 2YKLL 3B9KB 3DWTA 2EUWA 1YHPA 1ASOA 5EOCJ 5LCVL 2B1HL 4BRVA 1NCHA 3HZYB 1P5VA 1OCZB 4EI5B 3K2IA 4KO5A 1CDYA 1EH9A 5LGJB 1NKGA 4FD0A 1AO7E 2G3XA 2VM3A 4P5MA 2YMXL 4XVTL 4X6CB 1OSPL 3V9FA 3WEXB 1MW3A 4JR9L 5D1OA 2ZKYA 4RCAA 4MJ5A 4C56D 5DD5H 1A7BA 5B22A 1DEEB 3CMOH 3QCTL 4GRLB 25C8L 3ARQA 4PRAA 5ESAA 5FO7B 2IV8A 4KZDH 4FXKB 4RAUA 2KQMA 3CFDA 3KPPB 3C5SA 2JCWA 1MHHA 3KYMA 3VWKD 3W39A 5IW1A 1BWWA 3HOXG 4YBQC 3WNNA 1G0YR 1MDAA 1XNRH 4AYGA 3UQ8A 1RZ8A 3O6FC 2D0GA 2XV2A 4GQ9L 4ELME 3RWDA 5CJXC 1BXAA 5IVNA 2J57A 1N8OE 5AVZB 3VVVA 3UX9B 1Z3GH 4IHOA 3QHFH 4YE0A 4U6YA 1T6VN 4JRWA 2QSVA 4DEPB 4MV1A 3U9UB 1Z5LB 1L0XA 3D39A 3QDGE 4QRBA 1HHIB 2OMUB 3BSHA 1G84A 4R9HA 4PLNC 2DQCH 3AG1B 1GPOH 2JKXA 1S46A 5AEAA 1BG1A 1UASA 2UZPA 2FJFA 1E9OB 3C5ZA 2XVLA 5EDWA 5EFIA 3VXRB 1QSFE 1YY8A 3MX0A 5B39A 4OZIB 1OOAA 2ZXQA 5D2NA 1P4IL 5JXEA 5FPRA 4HS6A 3IRCA 1PX2A 5DRNA 3V6OE 2ZOLB 3VFRA 1CS0A 3MFFB 1HESA 3FK3A 2VWEC 1URLA 1DQJB 3LCYA 5BXFA 1BDYA 3DIFB 2CDEB 4FCHA 5AW0B 5JOFA 4WWNA 4YOKA 3MFHA 3NZUA 3P73A 3LV3A 4AW7A 4I9XA 4WI0B 2J7LA 4YUEH 2VO5A 2PP8A 1JF5A 3ZQ9A 4EBCA 3ARVA 1HHKB 1DUYB 5KYWA 5D4QA 2NY2C 3CLFH 4F8PA 3T4YB 1UM5L 2R7MA 5LBVA 1U8HB 1AOZA 2OR7A 4PJ6A 4FE9A 1AS6A 2VZOA 4FQXC 1YEKL 2CDGB 3MBWA 1K83A 3JWNE 1P7QA 2R1WA 3GI8L 5I5MA 3V6BR 3ELAT 3UTZA 5LB1A 3STLB 1BQHA 2XZCH 4J9MA 5D5MF 4ZO9A 1CE1L 3CUPB 3P77A 3T0DA 5CIPA 3AG2B 4TUKH 1S9XB 3FDWA 3N41F 1ZPUA 5CJBA 1I3UA 5HY9A 1E0OB 5GSRA 1DN2A 1CBJA 3BQVA 5KG6A 3AT8A 1PLBA 5DU7A 1DSWA 1ZANH 3Q1SL 3CFUA 1TWHA 1E2ZA 5DJAB 5AVVB 1WAEA 4DR4H 3PJSB 3U9TA 2YKLH 4P8QA 3QRBA 2WXHA 4Q8FA 2Z1PA 3T3PE 5IVXF 3FRPB 2LLNA 2X9YA 3QQ9D 1D5BB 1T5WB 3MWMA 3L4JA 2OSXA 4BDVA 3HS0B 3BQUD 3MACH 3QEUB 4ODSL 3S0PA 3HE7A 1MCPL 4XVOA 2NX5E 3RFZC 1S97A 4KX9A 2MCMA 4RU9A 2YMXH 4XVTH 1I7LA 5AD0B 1NGYA 1BZ9B 4XNUL 1OSPH 4XCYB 3NSXA 5DF0A 4UCUA 1C16A 5AUMB 4JFPB 1NFDF 2ZD0A 2WDTA 1Q94B 3ARYA 1GYUA 3QCTH 4ZXBC 25C8H 2BR0A 2JI2A 5BPHA 1BZ8A 2GUOA 4PY8I 1CFMA 1COBA 4S10A 5AVWB 1D5MA 5L4IA 4X5PA 4EFEA 4L3EE 5ENWB 3WTXA 3MV8A 4FTVD 4GQ9H 1IVLA 1D5RA 5J6HA 4PN6A 1QG3A 4IIZA 3BAXA 3C08H 2DLHA 3DHJA 2XWZA 2WP3O 4R7DA 2CKBL 1TJHL 2BVOB 5C92A 3GIVB 1S7RB 1AGEA 4A2FA 2FUTA 2MOGA 1A2YA 3ZE0E 4Z7NE 1GRWA 4G72B 2VLKA 5LLIC 3K3PA 3OJVC 3GEFA 4HLZG 5D1ZC 3T6ZA 2YRXA 3OLGA 2XVGA 3B5HA 3ATBA 3L2MA 4HIHA 4S0TD 2ZP9A 4GBXC 5IOPB 2YAHA 3V4ZA 4O3RA 3N6XA 4PRPE 2JA6G 1MELA 1S7SB 2ADGA 2X1XR 2DQJL 2NY7H 5GS1C 5HHMB 3IMBA 4RIRB 1WFNA 4RAVB 1P4IH 3AUVA 4A66A 1TSHA 4F5CE 2C2DA 3VCLB 3CHQA 4XXCA 3MRIB 1LEKA 4C5CA 3IF1B 1M53A 4KUZL 1JBJA 3VXMB 3ZTEA 4JDEB 5CN2A 2A38A 3L48A 5FCSH 3R5FA 4U0QB 5L4MA 3OTOH 1K72A 2EDXA 4PJHA 3FAWA 3ZGIA 4F4WA 5C0FA 5IT9W 3MJ9L 5BS0A 5L6YH 4M3KB 4Y5XC 3PP3H 3NCFB 4ECTA 1II4E 2BS8A 4HGWA 2QVFB 3ISRA 2NW3A 1RIUL 2R23B 3HB3C 5DGQA 2OMWA 2DM7A 4BQCA 4IOSA 1UM5H 4W6YB 4LVHB 4AQ1A 1J5HA 4QHUB 2RALA 1T5KA 2XN2A 1YEKH 1W8OA 1N59B 3IFNL 4X8CA 1L4IA 3OWEA 2XA3A 3GI8H 4X9FA 3WDJA 3WSQL 1A22B 5EN2A 3SN6N 1FFPA 4OB5L 1FN4A 3B56A 4NHCL 5E6RB 1MCFA 4HD9A 1O0VA 2Y2WA 1IMHC 1CK0H 1GYWA 4B3VA 2V5MA 2BY3A 2WCSA 3BH9A 3LSOB 3ARDA 4LMQI 4QWEA 3QEQA 4CMMB 3GSRA 5DFAA 4NOBA 3I9GL 2QMKA 4JL1A 4EQ2A 2I32A 4KTYA 2Z7UA 3Q1SH 3TL5A 3D0VB 4MB5A 5EO9B 2O6EA 3CH1B 3BW9B 1IAOB 3ESPA 3T1WA 2IXQB 4OI7A 2F53E 4QRPA 2EXYD 2I27N 3SD5A 4BQ8A 4TQRA 3O3AB 1FL3A 4YDVA 4H1LB 4ECRA 1B3IA 4ODSH 3ZT5A 5KFLA 4AZUA 2ITDA 3A23A 4KNUA 4D9RE 3AQZA 4XNUH 1BREA 3U30B 3H6AA 2DIAA 1BIHA 5I0ZA 3EG9A 1L7TL 2GKIA 3TIEB 1DO6A 4BFGA 1SPDA 2WXLA 2DWYA 1IKFL 3APCA 4NPYB 2WNGA 2WPGA 1TG8A 4HIIA 1GOFA 1P1VA 5C08D 1GC1L 3SDCB 2NCEA 1RZIA 4OLZL 5LUMA 3B2UD 4KXZI 4LLVB 4P2AA 3FCSB 4XXWA 1SMAA 2I87A 3PDGA 1F0LA 4PBXA 3GPEA 4Z7UA 4NUQA 1QMUA 4HOXA 2HHHH 2V2XB 3AGVA 2CKBH 1TJHH 2C9AA 5IHBA 3ZKMC 3O8XA 1ADWA 1EO8L 1L5GA 2WZ5A 3OLEA 1OD9A 4NJAL 4O2FA 4P2QA 1Q1JL 2BVPB 4QRFA 4JUTA 4OU3A 3RDTA 3G5VB 2EEAA 5IVOA 4KKLD 5LAXA 3EFOB 4EI5C 3TO2A 1JGUL 1XH1A 3TTYA 2DQJH 2WXOA 5C0JA 2IANA 3G6DL 4X9HA 2HFGH 2V6HA 4TUUA 4ANWA 1TIUA 3MGOA 4KV5F 3IMWA 3H9HA 3D18B 4RMUA 5MERA 4PJ7A 1J8HE 5F7FA 1LO2H 1VA9A 4FXKC 5F1NA 2IBZX 3QHTC 3D85B 2F5BL 5DJYB 5FDWB 3NBNA 1SUJA 2WXNA 3MJ9H 2O6PA 1QHQA 1WG3A 2BSEA 4ZAKB 5H2BB 1E4JA 2CPCA 4GXUN 1MJJB 3ZYJA 5ECGA 1D2OA 1RIUH 1K1SA 3G6XA 1U3YA 2WQ8A 2DL2A 1DBBH 1M7DB 5IB3A 2AQSA 4ECQA 4DEPC 5B3NA 1UXMA 1MCWM 4LP5A 4UQBA 1E5AA 1KBPA 3F7VA 4IKJA 3K2KA 1UNNC 4FA7B 1ORQB 4OX9H 1BM3L 1UA3A 2BC4B 3IFNH 3QUYB 5DZOA 5FLUA 2OYPA 1A9VA 4L4VD 1MFDH 5E8OB 4NWTH 5HHOA 3V2AR 2AXFA 2IAMD 3O3BA 5DEFA 3P4OB 5C09D 2ARJB 4OB5H 4PVLA 2X9WA 4ZOBA 2F54B 4LMYA 2IH8A 1FFQA 1R75A 3QDJE 6TAAA 3D51A 5L8KB 2EVFA 4L29A 2A83B 5E5MB 5C07B 1Y6KR 1T6WA 3MLTB 5B4MD 4DGIL 1A0QH 3WTSA 1C3OA 4MXQD 1ET5A 4PD4K 2IWEA 3ARXA 1OP4A 1OAZH 1LO4L 2VSCA 1ZXQA 4J4PC 5GS0H 2XHNA 4JRFA 2DMHA 4PGBA 2X28A 4K71C 1ZCRA 4Z7WB 1AKPA 4JZJB 4RNRB 3F8NA 3P30L 4OI8A 3W2DH 5EUKB 1R5WB 3D2UA 1YEIL 1E8ZA 3ZKXB 4TL5A 2WXPA 2PR4L 1XMWA 3PP4L 5BW7C 4DHLA 4CDGC 5TH2B 5KFJA 4PJ8C 2PW2B 3TJEL 3GWJA 5KAQF 3BAEL 3DO3A 2ZUYA 2NOYA 3ME0B 4OF7A 3EYUL 4ISVA 1D7DA 2CZNA 2DQFA 5DHXB 1JYWA 2JA7G 2UUDK 3CZUB 3I2CL 3IEAA 3G6YA 4HD5A 1L7TH 3ZKNC 3OXSA 1LDPL 4ZTOL 3QYNA 3F3HA 1IKFH 3FT0A 1EJ6A 3R7QA 1QVOA 4Y16A 5DQJB 5FOBB 1O5DT 3T6QC 2YRLA 3D52A 1GC1H 4JI6H 4OLZH 2FBOJ 3VE0A 3EJCA 1GGCL 4XNMB 1K3ZA 1TZ8A 4J7RA 4G80B 3OB8A 2YPKB 3FB5A 3B2MA 1U8IA 4KZEL 4GRWB 2X0SA 3BP7A 4G6ML 3D5OF 1ZHLA 1MCNA 1EEZA 4LCWB 4AMKL 2MNWA 4NC0B 4AH2A 3FHAA 1FLRL 1N8ZA 1UJTA 2YRWA 4N0CC 2CLRB 3DV4B 3R8QA 3LPGA 8FABB 1WCMG 5I6LA 1EO8H 2VDLL 4NJAH 4MS6A 1GGUA 4DZ8B 1Q1JH 1AD9A 2A73A 4J3OD 2J55A 4NQCD 3NJXA 4LESA 1W6WA 4Y4KD 5GRWA 1V54B 3QIBD 1UKTA 1QRKA 1S9VB 2C3XA 1X6NA 2OXGA 3I9PA 3R4DA 1GYAA 1S9WB 5ISZE 3Q05A 3WY4A 1JGUH 3ES6B 3QISA 3RP1A 3G6DH 4D94A 2A6JA 2E59A 1TWFA 1SCUB 2IFGA 5DT1H 1PZ3A 3OSPA 3JWOL 1W80A 4P9ML 4A2MA 4Y5VA 3PU7A 4D0BA 4YHHH 5CJXA 3Q44A 2LLLA 2CCWA 5F7MC 3QZOA 2OW6A 3IG0A 3BZEA 3TBTA 1H3XA 3QJRB 2XYBA 4E0RA 4XNDA 5I6KA 2ZG1A 2OBGA 1USZA 4LLDB 4BD4A 3Q6GL 3MRGB 4M8QB 1GS7A 2CA4A 4ZNEA 3H85A 3TZVA 1I8IA 3NVQA 2L7QA 3I6GA 2WIIB 5KSBE 3QUML 1B4JH 4JFSA 1AKJA 3KS0H 4GXUM 4PJHF 3M46A 3SKNB 3S3JA 2AQ4A 3RVUC 2WBJB 4R96B 1T4WA 5KBMA 1G9EA 5IFJA 2ZUSA 1N12A 3GUTB 3U7AA 4FM9A 1YO4A 3LMJL 2FYVA 3QORC 1IGJA 1LQSR 2HG5B 3S3PA 4Z77B 2ZKHL 2FSEB 3U79A 4KKBD 3GV5B 2Y07L 3QQDB 4JKMA 5TGBA 1I8MB 1ECZA 4QYOA 1ZHKA 1FCGA 1TKWA 1I4FB 2AQRA 2BIQA 4AQAB 4X80L 2OMTA 4PV1C 5KFUA 4QXVA 1Z32X 5BCAA 5I1LA 1UB5A 4PJIA 3TOPA 1OWRM 1N70A 2GSGB 1LO4H 3H3KA 3O0LA 3ZYIA 3MJGX 3Q8AA 1N34H 1KPUA 4U6XB 3B2VL 1EYZA 5DJ0B 2W0KA 4F7TA 5CGYD 1N7ML 3P30H 3NIDB 4LNRB 1SQ2N 5CILL 1YEIH 4E41B 1QKZL 1NUGA 3HI5H 4N8VA 1M7IB 2PR4H 3PP4H 1ZTMA 3P4LA 1DIKA 3G7TA 5I26A 3BAEH 1CR9L 3KGTA 4LDLB 3EYUH 3VI3A 3L3JA 1JVOA 1Z7JA 3AW5A 4PJ5E 3DO7A 2YS7A 3ARPA 3RF2A 1AOHA 1EEQA 3D1MC 2V3FA 2Y69B 5JIPA 2NZ1A 4MXWL 2ZKWA 2E2IA 5BRPA 2ZWLT 1HL9A 2KLRA 1HEZB 4Z0XA 1MI5A 1LDPH 4TMPA 3RU8H 3ZZSA 4ZMPA 1SRDA 1INEL 4ZMXA 1FH2A 3LNGA 3S96B 3LZRA 4FQHA 2H8PA 2GB2A 1ED3B 2X42A 4NIKB 2K4AA 3E6FB 4BA8A 1GGCH 1VGEL 5D5ME 4AIEA 1TYJA 1JZEA 3OMAB 4TSAL 1EZ1A 4QRSA 4NO0A 3QFFA 4KZEH 3ULVD 1TITA 5EBGA 3MLZH 2XG4A 4I2XE 4DH2A 1EZVY 5I66A 4AMKH 3G5ZA 1HXKA 1XB8A 1MW1A 3CN3A 1FLRH 4FS1A 5HYFA 5JPNB 1KENH 1G7HA 4UB0L 3BH8A 4DGWC 1GZQA 5DXWA 4Y8AA 2E5EA 1YNKL 3RFZA 5EEWA 2AV1B 4Z7UF 5ADOL 5GJTL 4GSXA 2DZEA 1OB1A 3O4OB 1JL8A 1LXMA 1OAQL 2DB8A 5IVXE 3MSPA 2KMWA 1PEWA 4XP6H 1XT5A 4DR3H 3RPIA 5LGYA 3L6FB 3VX0A 1JGVL 3V4PA 4MFHA 4E9RA 2DTML 3HG5A 4A6YB 4HG4J 4XWOC 4GO8A 1XFPA 3U30C 2FO8A 2LU5A 2D7QA 4Z7QB 1GTNA 1VGKB 3ZDZF 3L54A 5MEOA 5T1MA 2WLIA 3ZRCC 3UZEC 4KK5D 3KHLA 2W38A 3SDCC 3KE0A 3FCBA 3HPJB 2AEIT 4MB4A 2FQEA 3Q6GH 2YSSA 1EDYA 3HTLX 1JI2A 3E1F1 3I3DA 2FNWA 4PJ7F 5E2WL 2FH6A 4NAJA 3Q1EA 2YBRB 5I23A 5LBSH 4HSQA 5E8NB 3HOGA 3QUMH 1B0RB 4YJ2F 4X66H 5JIHA 1C1EL 2Y7OA 5D96C 1UD6A 3A5VA 3LEXB 3VTTA 2EXWD 3HXLA 1CFTA 1T22B 2CUHA 3B7TA 3H9YA 2JNZA 2R2EB 2WNXA 1I3VA 5D1XE 2Z91B 1AGBB 3LMJH 3QG7L 1TCRB 2EDQA 4PJGA 5L2KA 4NI6A 2YZNA 2ZKHH 1KIRB 1HH6A 4LCYB 4QWWD 1PJ9A 2HLFC 5F88B 3W0WD 4ANUA 4KXDA 3TASA 4XODA 3IJ9A 4E9VA 1ROWA 3AC0A 2KI6A 3MJ6A 5CAEB 3FH5A 5KYYA 2W6MA 2GPWA 1KGJA 1KY7A 3LNDA 4GFXA 4GMTL 4HJ0C 4X80H 4K5LA 4MKTA 4N85A 2ZOWA 2R9HC 4KVCL 4LH7A 4DP1X 3QYCA 1CF8H 1ZVNA 1FNLA 3HZMA 5DQHA 2K0RA 3BEWB 1QX1A 3RJQB 1YMME 3FFDA 2BSDA 5E1HB 1BVNT 3KCWA 3TNMA 3B2VH 3TYGH 4JDVA 2LABA 4YE4L 1N7MH 2CBQA 3LN9A 1LO5B 5I8OL 1KTLB 1UWGL 3CVHB 5B3JF 1MCKA 5DFVC 1QKZH 2JH2A 3QUZD 4M1CD 3BC9A 3HI1B 3L2PA 3QE5A 2OTWB 1X5FA 4UQEA 3T8XB 4EDXB 1MXGA 3LKQB 4U4BA 1CR9H 1QQDA 2P24B 3CN2A 1YEEL 2WC7A 3T0EE 3MV9D 1CFVL 4H13C 4B0MM 2B2XH 2FJGB 4MXWH 2R92G 3BLKA 2MNUA 2Z0BA 3QUYC 4N26A 2B20A 4WUUB 3VDAA 1H8NA 1E9QA 6PCYA 1INEH 4GT0A 4XPFL 4XMTA 1FVCB 4WSKA 3NQIA 2RCSH 1NBZA 3T65B 1EFXB 2DW5A 4N2HA 4X62H 4OD2A 5SX5H 5T3XD 5GRYA 1DLFL 1VGEH 1AGFA 3CFKA 3MBEB 4PR5A 4TSAH 4DP7X 4GG6B 1AO7D 3RAQA 3GTJA 4U1SB 1N3NA 2BS9A 5IW6B 3EOAA 1JYVA 1KJJA 3B9AA 4HMCA 2X05A 4QIWA 3DV6A 3RL1A 1OE1A 4LL1A 2EABA 4LQ1A 2XN9A 2UX7A 2C3VB 5DEGB 5KVEH 2OL3B 2VDMB 2WWNA 3RBEA 5DVMA 5BV7L 1YNKH 2DMKA 5KANI 4UOZA 5GJTH 5KZCD 3ZKXC 4KI5E 4LLMA 4CW1B 3LKPB 1OCRB 3MNZA 5CCKL 3AG3B 4ZMNA 2NCMA 1NLDL 3JV6A 5MENA 1JGDA 1MSPA 2Y1VA 3QZWA 4LLAA 1ZGLB 1J9QA 4RAYA 2DTMH 4NQVA 5IIEB 3V0WL 4AYSA 5FK9A 1GSKA 3NPZB 3QDGD 3EJZC 4IR1A 1R3IL 4A63A 5GS2H 4OTXL 5C6PB 2ZIDA 3D48R 5HHPA 5KG5A 5JXAL 4F2MA 2Z92B 4P04A 5D93B 2FWOA 2ZUWA 3CSGA 3WFEL 2OJ1A 4N0UA 1FNHA 1IGYA 4WNSA 2JKWA 4Q9RL 3L95B 3KNBA 5DD6B 2DJSA 3NJLA 2ARJQ 4RSYA 1G9ML 1QSFD 5FYKL 1QLEH 2W9BB 4B3EA 1KC5L 3B9KA 1RPKA 3N06B 5EZPA 2VLME 1TTAA 4P3CL 4JI0H 4ELDA 2RHEA 1ETA1 4NUPA 1C1EH 3CZJA 3IPFA 4ZUTA 3HZYA 1TOXA 2PP7A 4LFBH 3LQAL 4J3OG 4EI5A 3KDMB 5DK3A 5LGJA 3ORQA 3VYNA 2EE9A 5BUGA 2AK4B 2NXYD 3KL5A 4LRNL 1KJ2L 4P99A 1DVXA 3QG7H 2YZ1A 3GZKA 3PWUB 3PREA 4HUUB 4X6CA 4NEHB 2ZUVA 3WEXA 1B4LA 5TDPB 2OAAA 3UACA 2XG5B 1M3JA 1DEEA 1MN4A 3RWIB 2IPTH 1XIWB 1E40A 4GRLA 4PWJA 3JWOC 4QD2E 5FO7A 3ZT7A 4FXKA 3L3OC 1QRNB 3KPPA 4J3XA 3VGAB 1IM9D 1PZAA 1F4AA 4GMTH 4K7PL 3RVXC 5I18L 3A6OA 4NKQB 5DGRA 4XVUC 5ANME 3S5LB 4KVCH 4KV5E 1KXHA 4KDWA 2X89D 2IDUA 4H8WL 3BUQA 3LKOB 4JN2B 4XI5D 4HMEA 1DN0B 2Z35A 1BVLB 2HKAA 2ZX5A 1BZOA 4H20H 4H0IA 3BA8A 3QNZB 2XIBA 4A7QA 1FGNL 4IMKA 4PJIF 3RLSA 1Z5LA 3U9UA 3KALA 3M4IA 3RWHB 1HHIA 2OMUA 4P4KC 5EU6B 4W9LC 2Y23A 1A47A 3MOBL 4OZ4A 3BAIA 4UAOB 3U6XS 3SO3C 2WBJC 4M1DH 3MFGB 1E9OA 3TIDB 1X7QB 3KPOB 3VXRA 4MNGE 3KDPB 2JKIS 4OZIA 3DDFA 1CLCA 5EWIH 4LFHG 3N42F 3VI3F 2NXZD 1FI8C 3EOBB 1WT5C 2ZOLA 4N1EA 3MFFA 3N0AA 1DQJA 3CZGA 1VBHA 1ACYL 2CDEA 3DIFA 2CXGA 5D7LB 4PBDA 5IMLB 2JKJA 3L7FB 3MAWA 2I80A 1YZZA 2I9TB 1OTTD 4YR0A 3OR6B 4M6OL 4NCC2 2H41A 3MLUL 4WI0A 4IRSB 4X9GA 4WGVB 4HIXL 3GM8A 1FDLL 1HHKA 3QVAA 4HCIA 3EBHA 5DD0L 4LLWB 4Z3JA 1DUYA 4EUPH 5LXVA 5LL6b 1W72L 5BV7H 3T4YA 5ID0B 1U8HA 1OW0C 4LIQL 4QRRB 1XSJA 1XR9B 4L3ED 1QASA 4U1JB 1T80A 5B7FA 2VA3A 1IVTA 5EBLB 3M86A 2QQNL 3L3GB 2XZAL 5CCKH 3VD7A 2DMBA 4L4JA 3UIYA 5DUPL 5CEZE 1GH7A 2XPZA 3CBJB 4HOZA 3V8CA 3N8DA 5TPWL 1MHPL 3STLA 1Z9NA 3AAZB 3Q8FA 4DAGL 1AZZC 5A3ID 2WQUA 4AL8L 3KYKL 3CUPA 3L4VA 3LN4B 3V0WH 3Q2OA 1AD0B 1S9XA 4JKNA 1CXFA 3FTGB 5D1QC 1N6VA 1X5KA 4XX0B 3HAEH 4WO4D 4WTZA 5JXAH 2AFNA 1BLIA 3V0GA 2YPVL 3WFEH 2UX6A 2WQVA 3I02B 2OH2A 5C97A 5DLLA 4AK1A 3D9AL 4Q9RH 1NM9A 4DP9X 5DJAA 3HZVB 5JW4R 1G9MH 1E5YA 2FK9A 4RGNC 1A66A 2NNFA 1KC5H 1O7VA 2JIXD 2YXVA 2EE0A 4P3CH 4GH7B 1MRDH 3D3VD 4I1RA 1TQTA 3MNDA 3FRPA 4PG2C 1D5BA 1T5WA 5JPNC 3HS0A 3QEUA 4F3FB 3HOUG 4Z23A 1KULA 2OTUB 4DO6A 3VRJB 2DQTL 1GLVA 1KJ2H 2DM3A 4CGTA 5IYDG 5AD0A 3HC2A 1KJ9A 2OX5B 1BZ9A 3L5WB 4XCYA 4ZSOE 5AUMA 4IJ3B 4JFPA 5E2VL 4FLRA 1Q94A 5F1IB 2HKHL 4BY1G 5DMIL 5J2UF 2RMNA 4K7PH 2UXDH 3LPFA 4FQIL 2VLKE 4PJGF 4XO4A 4B9PA 1MREH 5I18H 5IF0B 3TO4C 4DV6H 1SLXA 3QZMA 3OUZA 5ENWA 5IT2L 1BJ1H 3C87A 5D6CB 4DT2A 4APMA 1KFAL 2VOBA 4L5FL 4WCYL 4C57C 5HYJB 1H8SA 3GIPA 4PJ9D 4O58L 4OD1L 3QRGL 3U46B 2BVOA 3SDAD 4UM9B 3GIVA 1U95B 1S7RA 3T0VA 4B7LA 3CJJA 2JA5G 1LWJA 4J2QA 2OSYA 2HB0A 4DEUA 4MTMA 3CDYA 3DHMA 2EYSB 1BM7A 4S0HA 4HUMB 4KVPA 4WIQA 5IQOA 4PJHE 2AI0L 3FYIB 5BS0E 3O4LB 1S7SA 2WGXA 2YPLB 3QSKB 4PCYA 1MCBA 2B1AL 2F53D 4FXGA 4RAVA 4P57B 3TN0D 2BY1A 1H6EA 3PW7A 1OSZB 3VCLA 3KVQA 4APXA 4KNQA 2P46B 4TTDC 3GFUA 3IF1A 4ONOA 4BV1A 5LXGL 3VXMA 1ACYH 1OVZA 4JDEA 2YAPA 1RZPA 3AU0A 3WENA 2IH3B 4KMTL 1PLCA 4D9RD 3GMRB 5CJ8A 2BRQA 3KPRA 1SJHB 1J0KA 3A6CL 3QXVA 1XVSA 4J6IA 4M6OH 1IBBA 3MLUH 1C08A 4HIXH 4ZI8A 4FG2A 2FJZA 1FDLH 3FQ4A 5DD0H 1HZHL 2R23A 3TQ1A 3FUDA 2QELA 3RB5A 2UWEB 3RBSA 3GF8A 3BUPA 4WBNF 2F08A 4Z7VB 2C35B 3DMMD 4QHUA 3QEQE 2N0KA 3EBGA 5AW8B 1DCLA 2QQNH 1N59A 2YU9A 2VR7A 4CSSA 3ZHDA 1XEDA 3NZSA 5DUPH 4QHPA 2CNZA 4KJPC 3EJQA 5EPMB 5TPWH 1MHPH 4ZDHA 5K9OB 4DAGH 1ONQB 3KYKH 4O5LL 3DX0A 4LQFH 3CZFB 4NM4L 4EBEA 1FORL 3EJSA 3LNEA 5K1JA 1CIDA 4Q58C 1OAYH 4O2BF 3HMXL 1DO5A 3LSOA 4UT7L 3PS6A 5DZVA 1R4XA 4CMMA 1U4EA 4FQ2L 4NN5B 2ZX8A 4YDKL 2JLLA 2YPVH 2RACA 4B27A 3TEYA 1S8DB 5GGTL 2R8IA 1XB6A 4AV4A 7PCYA 2K70A 3PHQB 3IBEA 2W0PA 1MAML 3D0VA 3CFJB 3D9AH 1JZGA 1XSKA 4BFFA 4CJ0A 4DKEL 4XCEB 3WTWA 3UTTB 5EO9A 2LV4A 2VDOL 5IESL 5K9QG 1IAOA 4MCMA 1WAAA 2IXQA 3ZDXB 4F9LC 4LE8A 3MJFA 4UTAL 1A21A 2XA8L 5F7UA 3SQOL 2GEQA 2JEIA 3P2BA 1XCQB 3O3AA 1J8HD 4H1LA 5IJBC 3RVTC 1SFOA 4HA1A 2CM5A 4N2KA 2R27A 1M6OB 2DQTH 1JGIA 2VDQB 3MRBB 3W9DB 1QWHA 4PGCB 4CVUA 2BP8B 1B90A 4FNLL 3CSBA 3TIEA 3QFJB 4QIRA 4NPYA 1A3ZA 4DPAX 5I71B 4QAMB 5DMIH 2CXKA 4P2QE 4RFOL 4FQIH 5FAAA 3QO1B 2CPUA 2F6AA 4X6CF 5CGMA 2YD8A 1HJCA 4JZNB 1F1AA 4LLVA 2FTAA 5IT2H 1J5CA 3FCSA 4FG0A 5JHDB 5IKCB 2D3LA 1KFAH 3GBLA 3ZDZE 3M17B 3MUGB 5JHBA 1XMQH 3QK0A 4WCYH 3X11B 3FQXB 1G9MC 5A6MA 2IANE 4RMBA 1W6LA 2EUZA 4O58H 2V2XA 2BZDA 3D05A 3MTXA 3QRGH 5JHAA 1KIUB 3BAWA 3WFBL 3QDJD 1JLLB 1ZAGA 4PJ7E 2N0MA 7CGTA 1TDQA 2BVPA 3LQAC 4KWUA 1ETZB 3JYCA 1HDMB 4FL4C 4N2NA 4XOBA 4JHWL 5E9NA 1B6UA 3G5VA 2HX9A 2VRAA 2WLLB 4IRZH 2X6BA 3IBOA 3EFOA 1XCTB 2SEBA 1E6OL 2MFNA 2JVUA 4WENB 5D7KE 2R8SL 3IGLA 4KPHH 4N8UA 3TJHD 4ANVA 3BLBA 4U33A 4NQUA 2B1AH 3BFQG 1M9WA 3GSNL 2J5LC 3ARGD 3JSNA 2YLHA 3BUYB 3D18A 1D9KB 3QS3A 2CO4A 2ITCB 5JHLL 1MW2A 4PJAB 1L9SA 1W9XA 5LXGH 4DK5A 5F7NC 3SJVA 1ZV5A 1RVFH 2C7UB 4IGBD 4OZIF 2GY5A 3D85A 3G6AB 2YXMA 4KMTH 1C5DB 4H8WC 4NERA 5DJYA 5FDWA 1ILUA 1TYRA 3A6CH 1XF5B 3GKWL 4ZAKA 2QK4A 3ZLQC 5H2BA 4YJZL 1MJJA 2R4RL 1CBVL 3SGKC 5FGBC 1J10A 5KBPA 4UNVA 2PKDA 4LHUB 1HZHH 4YZFF 4F50A 3EOTL 5LHDA 1FO0L 5E8DL 1M7DA 2WAQA 2AZAA 2A1WH 3WBDA 5K59F 3B1TA 4R26L 3IDNB 3OAWA 3TTSA 1ORQA 5AVYB 2BC4A 2PN5A 2VLRE 3QS2A 3W11C 3DYPA 1H0DB 1RZJH 5E8OA 1RZFH 2QSTA 4UAOC 2XZZA 4YXHH 3WO0A 2DYSB 3P4OA 3SD2A 2ARJA 1HTYA 3LXBA 2F54A 4X9IA 4NM4H 3A4DA 1FORH 4HUKB 2XQYA 3DX4A 2X1WL 1H8OA 1A1OB 2A83A 4ODHL 5E5MA 5C07A 1DBKL 5I0WA 4UT7H 1MH5B 3MLTA 3OSKA 3AACA 4FQ2H 1KYAA 2PETA 5GGTH 4U1KA 3KLAB 3L3DB 3GSVB 1CDHA 5ISZD 1VLXA 3N2JA 4PBWD 4KZCA 2MCTA 3I9IA 5IESH 1VACB 2VDOH 4JZJA 4RNRA 2O61B 2LW3A 4PDBA 1LMIA 1R5WA 3AQYA 3CC5B 5EUKA 1FYTB 4UTAH 2OMVB 2DQUH 2MTPA 3N40P 3MV01 5TH2A 4B96A 3KWUA 2PW2A 5DVNA 5J1TC 4PRDB 3ME0A 1SLVA 4RA0C 1U93B 2ZJTA 2XV0A 3EYFB 3CQPA 1OD7A 1F4WH 4HS8L 4POZD 4KK6C 5JW4N 2XJKA 4YK4B 1XCWA 4M9PA 5K9JL 4ECNA 5IROA 2AAVA 3OZ9L 3S3DB 1H6UA 5HGAA 4AL8C 5IG7B 5CLXA 4P3DB 5FOBA 5DQJA 3QDMB 4LOUC 3MRKA 4QRTB 4ZTPL 2I8CA 1MWAA 1P4LB 2QGDA 1I94H 4RFOH 4K94L 4DGYL 5DGBA 2EDJA 4G80A 1ZSDB 2YPKA 4V2CB 4IHBA 2WTRA 1DVUA 3NN8B 2Q5BA 1KYDA 3WN5B 3AZUA 4LLYB 2AGJL 3QUXB 4LCWA 4FHKA 2GTZB 1NDTA 4LBEA 5I1DB 2BCMA 3WG7B 2CLRA 3DV4A 3WFBH 8FABA 5IWAH 1E2WA 4MS8C 2DICA 1NCAL 2A4EA 3BCFA 3PWPE 5DVKA 4O4HF 3ROOB 3RWFB 4LCIL 5DG8A 4JHWH 4WKXA 1O7SA 4XP9L 1S9VA 4TQEH 1DJGA 2R2CA 1E6OH 1S9WA 4FKKA 1I9JL 3WIHA 5HDWA 3ES6A 1WGVA 4X2UA 3K8MA 5EV7A 2FLBT 3GSNH 3BT0A 3KLKA 3EDFA 1UH4A 3WL9B 2YD1A 1S0MA 5JHLH 2P8PB 5I28A 1NANI 4OKVB 3T2NL 4NBZB 4ED2A 1KXTB 2CUAA 1E5ZA 4I18C 4JFFD 4PJ5D 3RX8A 4FKEA 2ISDA 3EFFB 4MXVF 1NDGB 4JG1L 3U9PL 3MRGA 3RTQD 2AQ3A 4M8QA 3GKWH 3LHPH 1M9SA 1UQSB 4K7PY 5IOKA 1S78C 5F6IB 2R4RH 2WIIA 5ACLA 3EOTH 1FO0H 3BD3A 4J9KA 2FEEI 3SKNA 5E8DH 1T0PB 2VXQA 1WBZB 3DI3B 4JQXA 5KG0A 2ATPB 2WBJA 4R26H 4R96A 2ZCKL 4J3UA 4Z3FA 2W9EL 3WJMB 3WMQA 1OIOA 4PJIE 3WLWD 4DR5H 3T5JA 3N9GL 3O11B 2HG5A 4IIQC 4Z77A 3KGRA 3UIZA 2UUCH 5I1HH 3UEZA 2FSEA 4NM8L 4J2XA 3QQDA 4P23B 4FQLL 1I8MA 4YSQA 2CJUL 3QNYB 5TDOB 3TPUB 5KYXB 1I4FA 4ODHH 5AW7B 1DTUA 1WFJA 1Z66A 4XCFL 4AQAA 5KFRA 1N67A 2DI7A 3C8HA 3VI3E 4OZFG 2WCPA 1EXGA 2VDNB 4H40A 4MA1C 4PLJC 3ZUNC 4EIUA 3EHBB 4XHJC 1JDCA 3CTTA 5I30L 5D7SL 2H0JA 2Q7NA 1DFBH 4U6XA 2P26A 5DJ0A 1NSNH 4LNRA 4RMVA 5EEUA 1DBMH 2J2ZB 5CCHE 1OW0A 4E41A 2EDEA 2IVFC 2A5UA 2XY1A 1M7IA 4CSTA 1CXEA 2ZWSA 4YFLF 4XX1E 2DH3A 2CHXA 2QR0B 2ODHA 5L4FA 4JI4H 2Y2YA 1DYZA 3DTXB 3UPCA 3W1ZA 2VZ1A 3AS0A 1WAAF 3DK0A 2QPUA 1I1AB 1PPIA 3DGDA 1QW8A 3VUAA 2GK0B 4K3JL 5K9JH 3MGTB 3OZ9H 3FU8A 1HEZA 4JVPA 3SOBH 3CVBA 2QKIC 2OSLB 4MSWB 5JW4M 1YY9D 2ROXA 3LEYL 4ZTPH 1L3NA 2W9CB 1J9CT 1VESA 3S96A 4K94H 1ED3A 1KTKE 4PP2B 1OHQA 1ZTXE 4DGYH 5CLYA 5L8JB 4HV8B 2EDLA 5C70A 4Y2DB 1B2YA 1MW0A 3BJLA 2KL6A 5D1XD 5B8CB 2KS0A 2ED7A 4PS3A 1V05A 4OJFH 5JW5B 1L9PA 5KBNC 3NSFA 4N1HB 5LGKA 4YPJA 3CFIC 4PG2A 2KDGA 5JPNA 2VUKA 3D06A 2OYKA 3HIZA 1I1RA 1NCAH 2VN7A 4KRPB 5I8EB 2AV1A 4EXPX 4GQPH 3Q2NA 3HC3H 4LCIH 1FAKT 4CSPA 1D7BA 3MRQB 4IS6B 1SN5A 1K5WA 1PU0A 1OARH 1YMMD 3IJEB 2IBKA 1I9JH 4OT1L 3L6FA 3TEZA 3KG5A 1L9QA 2GIXA 4A6YA 1WR2A 4GT7A 5JZ7D 5EIIB 1AJ7L 1VGKA 2HLEB 2XQBL 2IP4A 5F7YC 3IMUA 3B2DC 1DVFC 2YD2A 4IRDA 4O00A 2B14A 2YUVA 3T2NH 3O41B 5I71C 1S7XB 1CT8B 4NT6A 4AX3A 4B41A 4DUYH 3T0ED 1SOKA 2NW2B 3CU7A 3HPJA 3RY5A 2BVYA 1JDAA 2HTLD 2WW8A 3H7LA 4PJGE 4Y2NA 2Q6WB 5L2KE 3RGBA 4C59B 2YQGA 3NGDA 1FVDB 3P4MB 3TNNA 2EYRB 5GZOC 2YBRA 1KCVL 1HE7A 5E8NA 3ISYA 1B0RA 3VH8B 1DDHB 4X6DB 5D71L 3SE6A 4ZQIA 5KVMC 3LEXA 4JPWL 2UUBH 4GMSL 1T22A 5LNGA 2JI3A 2R2EA 2QT6A 4UTBA 1BXUA 1WP6A 3PXLA 2Z91A 1J48A 3N9GH 1TCRA 15C8L 3ARWA 3NGBC 5A40E 4ONFL 4U2YA 1KIRA 4LCYA 5F7BA 5F88A 1U9KA 4HH9B 3RY4A 1U0QA 1UHVA 4NM8H 4PJFB 5FIEA 3PZPA 2EP6A 4FQLH 3O6LL 2ALWA 2CJUH 1RU9L 3TESA 2NY1D 5KFXA 2GJJA 2YA0A 4XCFH 3VXTA 2QL1A 1U8OB 1KEEA 2YD9A 3PHAA 2YN5A 4KI5D 3DPBB 4NP9A 5E4EB 4PRIE 2MOQA 4K2UL 4HULB 3BEWA 4GUCA 5I30H 1AR1B 4MD0B 5D7SH 1J88A 1AQMA 1RZKL 5DFWH 5JW3L 1ASQA 5CFHA 1LO5A 1KTLA 3CVHA 4PWGA 3MLWL 4WD3A 3AWGA 3HI1A 2OTWA 4R4ND 3T8XA 4A7SA 4EDXA 4MRCA 3LKQA 3MRMA 3EF4A 2P24A 3I9AA 4Z7WF 2HFFB 1TYEB 1BZ7B 3TU6A 4PLKC 4XYMB 3Q01A 2FJGA 1FZMB 4XAKE 4RETB 4L05A 1SN2A 2DAVA 4WUUA 3G9VA 4AV5A 2VLMD 2COVD 2XN9E 4A68A 4CUCA 5CFAA 1J05B 2J6SA 3J81W 3VFUB 4R7RA 3T65A 1EFXA 5J06A 1TR7A 4F8LA 2P5EE 3MBEA 4YVUA 1CE6B 4XYLB 5F7HA 3MO1B 4GG6A 5DDHB 4R6UA 4AQYH 3SPGA 4U1SA 5IW6A 1SOXA 3K2MC 2QSQA 2W70A 1UWEL 3FKIG 4OGAC 1UD4A 4QPEA 1F3RB 4WU5B 2X1QA 1WEJL 4DGUA 1JZ8A 5DEGA 4I7HA 2OL3A 4TVSa 4UIMB 1RUPH 4W9FC 2R87A 5GISL 4F2ME 3ILDA 4CW1A 3LKPA 4IZOA 2JEJA 1WH0A 4N0UE 3QWOB 4X5LA 2P5WB 1PD0A 2Y06L 2ZXEB 3V6FB 2V3EA 1ZGLA 3KWXA 2XNAB 3BVXA 3I4MG 4YK4C 3DVGB 4KHTL 3CXFA 3A24A 2HA1A 4NS0A 1I1YB 3VWJD 4DP6X 4Q43A 1AJ7H 1JV2B 3QR1A 2XQBH 2MMXA 4K94C 3QIWC 3CSYB 4KDVA 4UQ2B 3N1GC 1H5BC 2Z92A 4TLUA 3Q0HA 1GW6A 3MCG1 5AB2A 2CJ3A 2IAAC 5IK3B 1RCYA 5FB8B 2OJZH 4BWUA 4XZUB 2EZ0C 5DD6A 3F2LA 3U1SH 4IKNA 4LEBA 3HC0A 2W9BA 1HOCB 4RMWA 1KCVH 4NKDB 5B7EA 5AAMC 3WN5C 2CDFB 3QUXC 1BF5A 4LRIA 5D71H 1DQLL 4G6FB 4JPWH 4GMSH 4ZX3A 3ESMA 5T14A 2QZQA 3KDMA 2B1OA 3UZQB 2JKRM 3IYLW 4OCWL 4WUKL 1H9VA 1P7QD 2AK4A 4S2SA 5DUBB 3PWUA 15C8H 4HUUA 4MJ6B 3X1FA 2NY4B 4LEOB 4MJIE 4ONFH 5PCYA 4AEEA 5TDPA 4V1DE 5D8DA 4AGNA 3DVFA 1BQRA 2XG5A 4HG4K 1IGTB 1X9RA 3CDFA 2DMCA 1XIWA 4TQ8A 3RWIA 3SDDB 4GY4A 4B9IA 1RU9H 4HUNB 5FHBH 1V7NL 3CHRA 1RK6A 3HB9A 1ZK5A 5LN8A 4M9OA 3S5LA 1XDTT 1BV8A 4HAKA 3CV5A 4Y19D 2UVWA 4KXZH 4K2UH 4OZHB 5CEZD 3R23A 1Q9OB 3LKOA 3SGKA 2B63A 4IRJD 4JN2A 1DN0A 3BJYA 1RZKH 1BVLA 2G0KA 2YRPA 5JW3H 4OZIE 2WQXA 5SV4A 4XMXA 3QNZA 3TF4A 3MLWH 3L4WA 2BS71 2HWZH 2WBWB 3CDCA 2A74B 3RWHA 3ZHLA 4A7TA 4MB1A 1XHHA 4NXKA 1BMWA 3NZ8B 1FGVL 4YZFE 4LBAA 1AHKA 3NIDF 1SOSA 1HWWA 5E2JA 4O02L 3TIDA 1TJIL 3KPOA 4I77H 4OUOA 4OUUA 4YC2C 5HJDA 2D7PA 3CK0L 4L1SA 5E6IB 1JCVA 2X6AA 2NUAB 3T8MA 3MQIA 3EOBA 3GPSA 4HKXA 4HXBH 3FTXA 5JOPE 1CCZA 4Y1SA 1OM3L 1BJ8A 1H3GA 3BCDA 3FCTB 2ZTBA 5D7LA 3CVZA 4AK2A 1M0TA 4HJJH 5IMLA 3SYOA 1D5IL 3L7FA 4NUGL 1RJRA 2ZX7A 2B3RA 1Z9OA 2VR8A 3ZL4L 1ZJAA 2I9TA 3A6BL 4TF4A 1UWEH 4DL7A 3GHEL 2Y1AA 4IRSA 4FP8L 5B4MC 4IKIA 3BIKB 5KVGE 5BRQA 4RAZA 5CBAB 1VFBB 4MV7A 4KXAA 2UXGA 4LLWA 3HC4L 3UBXG 1G43A 5FO2A 3TWCH 1KDIA 2Q87A 2Z0UA 3ULVH 2VLKD 5ID0A 1P9MA 2R0WL 3D0AA 4QRRA 1URZA 3MJ8B 1XR9A 4U1JA 5GISH 5KUMA 3S36X 3U1QA 2VQFH 4ECUA 5EBLA 1EA9C 4NZRH 3V5KB 3L3GA 1R1CA 2AQQA 4G8FB 4Y5YB 2PYEB 2Y06H 2VISB 3EH5B 4RB3C 4GAAA 4GUOA 1T66C 1VFUA 3C09B 2ALZA 1I1AC 1EO5A 3AAZA 2HYMA 3QJXA 1DQML 3SE8L 3MC0A 3CC1A 4Z7OB 1UM4L 4KHTH 1IBGL 3LN4A 3SE9L 5KT7A 3ALXA 1ADQA 5TQ2L 2MCPL 2HVJB 2V9QA 3FTGA 4X50A 1MJ7L 2QPFA 5DVLA 4AQEB 2D9QB 4ZFOB 4Z78B 3PXHA 2I7OA 5I16B 1RJYB 5LXTF 3CN1A 1AHWB 4Q74A 3UJJH 4WDIB 1T0MB 3I02A 1AVAA 3BT2L 4Z7QF 4NO3B 4NN6B 3ARED 2AJUL 3HZVA 2WXIA 3DI2B 4OZGE 3ARSA 3IWVA 1F3JB 4TQHA 3C9NB 1GXEA 1GW0A 4DV1H 1UOLA 1CF1A 2QHLA 1JPST 1K8DB 5C2UB 1DQLH 43CAB 4LCCB 1GOHA 1MNUL 2HPTA 2WXRA 3LZQA 4BUHA 2OTUA 4FEIA 4IWXA 4WUKH 3Q43A 3UGEA 3VRJA 2FPIB 3VDBA 2OX5A 3L5WA 4LFCH 1IC4H 4AWJC 1SEQL 1WD8A 2ZNXA 2W6QA 2J5WA 1T89A 1JUFB 5F1IA 1AXTL 2LAAA 2EDRA 4XPGL 2P42B 1BQ5A 1KBVA 3AROA 1HNYA 3PXJA 5DMJB 1BNCA 3AYHB 1V7NH 2ZM6H 3GLDA 1WWCA 3APFA 4OF5A 2NDGA 5IF0A 1JDBB 4CC6A 3QEQD 4RMRA 5CZVH 4U1IB 1NCOA 5D6CA 1N56A 5DJXB 1V55B 4PY7B 4ZW7A 1RLBA 4JFTA 4RDQG 5HYJA 1TQVA 2EO1A 1E5CA 1UM6L 4UTCA 5HHME 2GSMB 1PG7X 4RZKA 2EDOA 2K1MA 2ZT9C 2P44B 3BDXA 5E99L 3U46A 4UM9A 2P3YA 4MXVE 2C1OB 3SCMB 3WIAA 3D09A 3QEGH 4ZPVB 1XF3B 4M5ZL 5HXMA 3VXME 4W93A 4YHYB 3FH7A 4Z8FL 2EYSA 3ALPA 1FGVH 3Q9PA 4KKAC 4B3RH 4ES9A 4RB1A 4FI7A 3I6LE 2DKMA 3QT2A 4O02H 2X4TB 4XPHH 3O4LA 4HHGA 3U6XA 4DPRA 1T0OA 3CK0H 1JYNA 2YPLA 3ATFA 3X17A 1ZHNB 3UERA 4P57A 1E6JL 1IE4A 2UVFA 5HVHC 4N2GA 1PZCA 5BZXA 1OM3H 3BWSA 4XBEH 1X9UA 3OKNB 3WNZA 4NLGA 4P2OD 3VGHA 5CP3H 2IH3A 3MXVL 1D5IH 4XC3L 3SY0B 4NUGH 2QYZA 3GMRA 4PAZA 1SJHA 4DR1H 1PTZA 1CTOA 4N86A 5DC9B 3GHEH 2ARWA 5I5IA 4IWYA 2H1XA 3HKZA 4CU7A 2J4WL 1G6RB 5DC2A 4GG6F 2D7TL 1UACL 3RE0A 3FF7A 4MD5B 2UXFA 4U0RB 2YJQA 4P2QD 2UWEA 3J2PA 2R0WH 3PWJB 4LPVA 4Z95H 5BO1L 4Z7VA 5A2JH 3RDTD 2IWGA 3H8NA 3FN9A 2DM4A 2A6DB 3BP5B 2NY3B 5CZXD 5KT4A 2B4CL 2O5YL 2NYYD 1O75A 2QEJA 3IJSB 4U4IA 3RB7A 3SE7A 3C60D 2ICWB 5EPMA 3SE8H 1KB5L 3BKYL 2VAAB 1WAAE 5K9OA 5D7JD 1EAQA 3HNTL 1IBGH 3SE9H 3NEEA 2VIRB 5TQ2H 3CZFA 2HT2D 2MCPH 1JIHA 1PFCA 5HGGS 5DMYA 4LOEA 1MJ7H 2W81C 3NJHA 2NT0A 1IC7H 2E86A 4BQBA 1S7TB 3TVMD 2RFXB 4GAGH 3B7UX 1VCBC 2JTYA 4MQ7B 1NFAA 3AU1A 1JCKA 3ARFB 1ZLWH 1S8DA 2BCKA 3VD2A 3BT2H 1TO5A 3PHQA 5D7KD 3CFJA 2AJUH 3UTOA 4XCEA 2OK0L 3UTTA 3T6XA 4HK0B 1NGXA 2WZPA 4ZNCD 4YSDA 5EUOB 2PXYC 3B5GA 1ZGLM 1QNIA 4JCWA 5K2MA 1XCQA 1SDDB 1JJUA 1MNUH 5T1LD 1SN0A 1X6LA 3ALWA 4UANA 4BCYA 4KJWC 1P1ZB 5GIRB 1M6OA 4MHHG 3MRBA 2Z93B 3W9DA 2FCBA 4PGCA 3SKJL 2C9UA 1TWGA 3NJJA 1GKEA 1PZSA 1A3RL 1AXTH 4J6RL 3AG4B 4XPGH 3ZDYF 3FXIC 2CHNA 1IM3B 3NTCL 5EF2A 4F33B 1JFQL 3NESA 1DHKA 3QO1A 4UYPA 3IU3A 3K1DA 3OLIA 1GS6X 2KLTA 1GCYA 5JHDA 3B6SB 5IKCA 2VLRD 3AABA 3M17A 5LMUH 3MUGA 5GZOA 1A7RL 3X11A 3NRPA 5E94B 3FQXA 3MVSA 5AOMA 1PKQB 3VMOA 3EH1A 4JAMB 1KIUA 3UH8A 3EADA 5KG7A 1QLEB 3ERXA 3V52H 5DG7A 2P4AB 1T03L 1I50A 1D5ZA 4ANXA 2BRRL 3BHBB 4JY4B 3JWNH 3LVTA 3RUGE 4DP5X 1RK5A 1ETZA 1HDMA 1KYUA 2O72A 4KJYB 4Z8FH 3WEMA 4EIBA 1JPGB 2WLLA 4LHQB 1IC0A 3RWCB 1YUKB 1XCTA 4UM8A 4DO4A 4YSPA 5AVUB 3IDXL 3RNKA 1CLZH 1MHCB 2ZF8A 5E23A 4E5XG 2EXWC 3FL7A 2IJ0C 1E6JH 3I74A 4F7PB 4YMPA 1JPTL 3BUYA 4ZD3L 1D9KA 3E7JA 5JQHC 2ITCA 3FU6A 1KJMB 3GSUB 4PJAA 3VG0L 1HL8A 1EJFA 2C7UA 1KLGB 2XWJA 2MPVA 5IBTL 5CLTA 3G6AA 1C5DA 4XC3H 5IHZB 5BMVF 1CLYL 2H0FA 3SGEH 5BMFL 1XF5A 4FQQB 4Z76B 1DANT 5IYBG 2FIKB 4K4KA 4RGOL 4K9EH 1EJOL 4XTRC 3SQRA 2F54E 1HOEA 2D7TH 2X4SB 2SODB 4LHUA 5I1AB 1YAZA 3K8LA 3OAUL 3VXQA 2NUTB 5FX3A 5C07E 2ERJB 1DJSA 5DLGA 1WCBB 2WLJA 2A74C 2XFGB 1QZNA 1T3NA 5H37H 3W5NA 4I5BB 4ZYKB 2B4CH 1U2YA 1H0DA 4UT6L 3KXFE 1E5UI 4D3CH 4Z7WE 3F7PC 1HE8A 1KB5H 2G5UA 2C00A 2A6IB 4YBQD 3AXIA 1R3HB 2FB9A 3Q8BA 3BVVA 5E6IC 1A1OA 2QDVA 3PWPD 1A6UL 1FZOB 1MH5A 4ODWB 2PMZA 2O30A 3V0HA 4C2MA 3LRSA 1D6EB 1B9ZA 3FQUB 3LIUA 2FE3A 3GSVA 4R97C 2BP5M 4OLXL 2OK0H 1BJMA 4MA5A 5AW9B 1VACA 4GLXA 4AITA 2O61A 4S1RL 3CC5A 3NSCA 3BN3B 1FYTA 1ZPLA 1BFTA 2IF7A 1UT2A 4KTGA 5FPIA 4Q7DA 2JFCA 3AS3A 3GMMB 2ICES 4PG9B 1U91B 2ZSWB 4PRDA 5FGCB 4LB8A 2ZUXA 4A2GA 1U93A 2MPAL 4YL9A 4ZBJA 4E4TA 3NRQA 5LDUA 4ZX4A 3SKJH 1UADC 5E51A 1CFNB 4K8RL 2CO6A 4DEWA 3ZMEA 3MA7B 1A3RH 1YQ2A 5CBEB 3PQYE 1ETJA 1CTNA 3A4AA 3ABGA 4FNQA 4J6RH 2L3BA 4Y4FB 5IG7A 3QDMA 4QRTA 4AM0Q 1QLRB 1RKRA 3VMMA 3C09C 1JFQH 1P4LA 3CN4A 3WY2A 3LB6C 4I0KA 1M57B 5C1MB 1VZHA 1G9NC 4IBZA 5C0RL 1ZSDA 3B43A 4HCFA 4UCOA 3NN8A 2FD6L 1XF2A 3VPDA 3GTMA 1A7RH 1AHWC 3WN5A 1WFUA 4LLYA 3QUXA 2NY2D 2GTZA 3EDDA 4XWGH 3LZLA 5I1DA 4L4TD 3K6NA 1GY1A 3NG5A 1T03H 5J1AB 1HX0A 4FQXD 2BRRH 2ZZUT 2DKSA 3V0AC 5K9KB 1F11B 3RWFA 5B1CA 3RGVB 5B7MA 3FCUB 4ABWA 2JEGA 4KK9C 4N2FA 3AMLA 2H32B 2WYHA 3FPYA 3GYRA 3IDXH 4EN3A 3S37H 2R2HB 2XCLA 5CZRA 3ZHNA 3ABKB 3UJTL 3OQ3B 1JPTH 4BFIA 5I74B 5I1EL 1NC4D 3WL9A 4ZD3H 1P84K 4NZFA 1EANA 4MAYB 4XNBA 4HC1A 1U3HB 2VL4A 4OKVA 1F41A 3VG0H 4DR2H 1KXTA 2X41A 2WXGA 4NO0D 5IBTH 3WJLC 1XGYL 3EFFA 3LD8B 1NDGA 5BMFH 2NR6C 2K8QA 1QI4A 1UQSA 4UU9B 2G0LA 2K6ZA 1UXSB 1MDTA 1UC8A 4AGPA 1R3JB 2ZP0T 5C0AB 3JWNC 3OAUH 5D8JL 1WBZA 2IWFA 3HG1B 2ATPA 3W38A 4D9QE 2C9PA 4XI5C 4HVBA 2ZYIA 1QACA 3EYOA 3A0OA 4YVNA 3O11A 3GLZA 3AWEA 4UT6H 2N01B 1QFHA 3DURB 4IBYA 4ZXBD 5CCJA 5KSAB 2UWEF 5D7IB 2XWRA 4Z7VF 3NIDE 4P23A 4U1MA 3CVCA 2GPZA 4KKCC 4QXWA 4HQQL 4I1PA 2W6OA 3U0TA 2JELL 2ZG3A 3QNYA 5TDOA 1GSAA 3C8KA 3TPUA 4G59C 5KYXA 3FDSA 3MR5A 4F7KA 3DDGA 1A6UH 5DRXB 2PP9A 3GRGA 4C8XA 1TVHB 2OR8A 2VMEA 2RAMA 1KYOJ 5AVTB 5C0GB 1GSMA 4JQIH 4H4NA 1LO0H 2HRLA 1RK0B 4OGXL 5E2TH 4OLXH 2VDKL 4P46C 5JQIB 2Q76B 2YXFA 1ZHQA 3M8OL 5DO2C 1LWRA 5D1ZD 5FA3B 1KFGA 4M5TA 1NBQA 3D33A 4GFTB 3JWDL 1H3UA 1RZ7L 2QR0A 1CURA 1KBGL 3DTXA 4U0RC 4BH8B 2MPAH 4LDCA 2XWDA 3ZDXF 1NAMB 3F85A 1NFIB 2B4CC 1I1AA 2FX7H 2XOTA 5L2KD 2GK0A 1TPXB 3MGTA 4K8RH 4LSDA 2BY0A 1ICTA 3D34A 2OSLA 4MSWA 1HN1A 2B0SH 1USQA 2XKSA 3TV3L 3BESR 3RX7A 1U8JB 4G8AC 3T5WA 2AQ2A 2W9CA 2A0LC 4PP2A 4IU2B 5D55A 4HV8A 5C0RH 2A9BA 4Y2DA 4AGLA 4IHJF 2N59A 2FD6H 2GTWB 2LVCA 2YC1B 3LH2L 2HAZA 3QJHB 5B8CA 4JCLA 2P7TB 2XXMB 3TV8A 2W9DL 3GTTA 4YEFA 4H8UA 3TP4A 5JW5A 3E9TA 3HB3D 1WO2A 5AOKA 5KFDA 4WFEE 4AYDC 3ZX1A 1KMGA 1Y07A 3BVUA 3VD1A 3AM8C 1KIQB 2WMPB 4Z7QE 4HUWA 1F6AB 2DBLL 1MCIA 4GC7A 5I8EA 3TXAA 3JAMW 1JZ4A 5HGBB 5D4HA 5BRZB 4PRID 3MRQA 4IS6A 3EGXB 5DD1L 2D2OA 4N0FB 4A3FG 3IJEA 3UOAB 4OM1L 3IJ8A 5I8KL 3GXMA 2R56H 4G70B 2FGZA 2OS7A 4YBLC 4FQPA 3LAFA 3VW3L 4YR3A 1Y1VA 1NPJA 2XXCB 2JQZA 2Y5EA 5FW7A 2BLFA 2XZQL 5EIIA 2J73A 4BCZA 5I1EH 3ULUC 3TH3T 5DO8A 4KVNH 3E6HB 3WHE0 1KXVC 1CVSC 1V3MA 3LPPA 3O41A 1S7XA 2VR6A 4U1LB 3GIIA 1FG2B 2F1BA 1GJWA 2NW2A 1YLBB 4P5SA 3V4VB 2Q6WA 1FNSL 4XAKD 1NEUA 3BZ5A 1ECYA 2GHZA 3U4EB 1EZUA 1FVDA 2WVSA 4DOHB 5JLZA 2WP3T 3VMNA 1KWKA 2W88A 3S97C 2XN9D 1EHAA 3FOMB 3VH8A 3SPVB 4X6DA 4YSRA 5D8JH 5CS7A 3W5MA 4JM2C 1IB5A 5F9LA 2P5ED 1RL1A 1YMHA 3CBRA 2FLLA 2WK2A 4YR6B 1UFGA 1HILA 3QJVB 1BJTA 4N5EC 1BQLL 3HZKB 4FNSA 3EPIA 3T1FB 2A4CA 5J8OA 2FO1A 3QJZA 4HH9A 1QW9A 2FO4B 2B16A 4WI8A 4F93B 4KK8C 1NC2A 3JTBA 3KPTA 4HQQH 3ARBC 2JELH 4CAGA 3B37A 2EDMA 1GZHC 2E6JA 3DUUB 4LOFA 1U8OA 4I0PC 3IMRA 4XR8C 3OPZL 3DPBA 4G8EB 4HYKA 1HSAB 1Q9LB 4PFEA 2BWQA 4MD0A 3ZKMD 4OGXH 1ZMYA 2VDKH 3S36L 4QF1B 3DF7A 5GONF 4WUUE 3SIKA 3MRJB 3RB6A 3BPNB 4A39A 1FQ9C 4JI8H 3RZCC 4I55F 2D8KA 2H6PB 2WO2B 1S3KL 2COQA 3PL6B 2RGVA 3NP3A 3JWDH 4HBQA 2XWEA 4ED8A 1RZ7H 5D72L 1OKEA 1KBGH 4EI5D 2DIKA 4GG6E 2HFFA 4PCTA 1BZ7A 1R19A 1MCLA 4MNQE 4TS6A 2BHZA 2H3NB 2LTQB 5BVJB 1FZMA 3KPSB 5F97E 3ILQC 2AU0A 1KBBA 3O2VH 4O4IF 1C8PA 1U8NB 2GJRA 3VA2C 3TV3H 1MFBH 4QDGA 3VFUA 2M8XA 5EEYA 4QLRA 4DUXA 2Q7AA 3WKML 5IWLA 4HPYL 1CE6A 3O9WB 5AQ0A 5IQLA 3MO1A 5DDHA 4KHXL 4LASL 4X6EB 3T3MB 2DYRB 3KEDA 3VG9B 1JVKA 1ZV2A 2AP2A 2BDNL