3N43B

Crystal structures of the mature envelope glycoprotein complex (trypsin cleavage) of chikungunya virus.
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
336
structure length
335
Chain Sequence
NVYKATRPYLAHCPDCGEGHSCHSPVALERIRNEATDGTLKIQVSLQIGIKTDDSHDWTKLRYMDNHMPADAERAGLFVRTSAPCTITGTMGHFILARCPKGETLTVGFTDSRKISHSCTHPFHHDPPVIGREKFHSRPQHGKELPCSTYVQSTAATTEEIEVHMPPDTPDRTLMSQQSGNVKITVNGQTVRYKCNCGGSNEGLTTTDKVINNCKVDQCHAAVTNHKKWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVIMLLYPDHPTLLSYRNGEEPNYQEEWVMHKKEVVLTVPTEGLEVTWGNNEPYKYWPQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 envelope glycoprotein
publication title Glycoprotein organization of Chikungunya virus particles revealed by X-ray crystallography.
pubmed doi rcsb
source organism Chikungunya virus
molecule tags Viral protein
total genus 63
structure length 335
sequence length 336
ec nomenclature
pdb deposition date 2010-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2400 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n43B03
2.60.40.3200 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3n43B01
3.30.1490.280 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3n43B02
3N40P 3MUUA 3N44B 3N43B 3N41B 3N42B
chains in the Genus database with same CATH superfamily
2VC2H 3VI4A 2DB8A 2DICA 4ELME 2G5BA 5E1QA 1CVRA 4G3YL 4YBLB 1XMEB 3NJVA 1CFNA 4PJHB 5DGRA 5EDXA 5IB4A 2M1KA 2N1KA 4XNDA 3BRDA 2R8HA 1NCUA 3LKRB 3ORJA 4LSTH 4TQIA 3TQ1A 4HDIA 2F0CA 2IDCA 3OLGA 3OWRA 5T1LB 3PLYA 4ZO7A 1S6NA 4A3CG 2CCVA 4LCCB 2HJLA 1B88A 1ES0B 4ZDHB 3D07A 1WBYB 4M48L 1XCXA 2QPSA 1Q0XL 2GJ6D 5FKPA 3A4AA 4C57C 2XIBA 1NMAH 1AKJA 1QSFA 2WZPD 3WN5C 3LZFL 4NO3B 4IRZA 5DK2A 2UWEA 5DMGD 1CLVA 3ZDZE 2I7OA 2QSQA 2VLJE 4I5BB 3WEAA 1GYAA 4NC0B 4NZJA 1NSNH 5EOCJ 3QDJE 5A6MA 3SYOA 4JKPL 4X9YA 5DJCA 3BZFB 2HG5B 3KZ8A 4MAYC 2X4OA 5KFLA 3DMMD 4OBSA 1IGFH 4QF1B 4WFED 3IF1B 1Q94A 1V3MA 2DZDA 3QJTB 1AZVA 4DL5A 2IMNA 3ZTNH 3FC8A 5C0IA 1LP9B 4S1DC 4GKKH 4I48A 4BXXG 3KGUA 4TUJA 2H8PA 1N6QH 1ZLSL 3DO4A 2HA1A 2DQUL 1DDTA 4EI5B 2XGQA 4QOKB 2OR9L 3HMXL 3ETSA 3VXQA 3NGBB 3D05A 1WBZB 2AW2A 4YR6A 5JHLH 1QRNB 3EGDB 4WHCA 1KN2H 2N3JA 2IP4A 4LFHG 4QKXB 1PKQB 4NT6B 4AYBA 3QORA 5IQ9B 3BLBA 4PRPE 5EZJA 4AWJC 2CIIB 5KVDL 5EHFA 3ECWA 3QR0A 4YLBA 5DJAB 1OSZA 5C08D 4MZRA 3RGVD 4DNLA 3NEEA 5LNDA 3VX0A 5DLFA 2FB4H 3C5SA 4KKQA 4JV2A 4Q2ZB 2WC7A 4Y4KD 3V8OA 3PN1A 4HQQH 4WW2B 5DEFA 4UQ2A 3ULUH 1HZHL 5CINH 4HJJH 4U6YB 1TSHA 3TBVB 3FQ4A 1YEEL 2WBKA 3IM1A 1MCLA 3ME0A 2EVFA 1O5PA 4F3FA 1UWFA 1UWYA 1LEIB 1CC3A 3SBRA 4OKVA 3TCTA 5AZ2H 1A9BB 2MCAA 5EZIH 3PCYA 4Q6IA 3FTUA 1YEIL 4OJDH 3VWJD 3KM2A 2ZXDA 1IBYA 4CC4A 3NPSC 5KYYB 4UDUA 2FEEL 2OYLA 1X5LA 2QZ5A 4OSUH 1AR1B 4HAFA 3FHQA 4ZPVB 2ZICA 2IFGA 4L2LA 1O6TA 1WZMA 1UEYA 4IDJL 4F8TA 3RWHB 4ECZA 3ARPA 2VMEA 4NZDA 3TEWA 1DLHA 4H88L 2X4QA 2DLTA 4YHOH 1KXHA 3UABA 3QHZL 4Z3IA 5BRQA 1JV2B 1FZJB 1QKZL 1QSED 2CDGA 3CVHA 4JRFA 4FZEL 4AH2B 1MG2C 2BHUA 4CGTA 1WBXB 2VTFA 1ESOA 1CE1L 3TX4A 2FJGB 2XFXB 1GTFA 4WFFD 4C5BA 1YHPA 2Q0ZX 3II3A 1EO8L 4I1PA 4DQOH 3NJKA 4UANA 3FT4B 1JXKA 2Q3ZA 1BAGA 1I8KA 2DWSA 3WIHL 2CRYA 4QT5B 3UADA 3PP3K 4NUGL 2ODHA 3TM6A 4P4RA 2PPFA 2XWBB 1GOGA 4CGUB 1NGQL 3IFNL 4JFUA 3SDAB 1NBVL 4NXSA 4UBDC 2R15A 4FTVB 3FW6A 1JF6A 3DX7B 4XMPL 2OAAA 4R90L 3V0EA 2IAMD 4Z7WE 2JF1A 1FNLA 2A83A 3KPSE 3X1EA 4PRDA 2GB2A 2R7EB 4TN9A 5I1KH 2P9RA 3R23A 4GKJH 4PRBB 1CIUA 2PWDA 3QFGA 2WXNA 3KXFD 3KR3H 1PZ5B 5EOTB 3PWJA 1W9XA 3OKDA 5I1DB 5ANME 4NCC2 3KLDA 1SEQH 5LQBH 4APXA 4ECNA 1AMXA 4AT6B 4CL7A 3X14B 5I0VA 4RB1A 1V8HA 2C3GA 3GSXB 3T3PF 3UTQB 1AO7A 4PGBB 4WO4B 1WFOA 3L3JB 3NFPA 4X6CE 3V4UH 4TNWF 4UQ9A 5IP4A 4N2IA 4UQAA 3W39B 5JIIA 4A2EA 4GRMA 1L9MA 3ROOA 1RKRA 4LMYA 1LK2A 5I8EA 3WO4C 4A6YB 1MFDH 5FV2A 4OM0H 3EYQD 5C0AA 2NNAB 1T83C 1IGML 2D4DA 4HIIA 4Q14A 2NW3A 3H85A 3L2MA 1TZIA 3JWDC 4QJ4B 4HJIA 4WY7H 3RNKA 4XMTA 3C5ZA 3CQPA 2P47B 2YQGA 2QLVB 4EN3A 1BZ9B 3ALWA 2NY7H 4A2DA 1NGWA 5ITBL 5KJRL 3PFUA 2H1PH 4XCCL 4UIMB 4YDIL 4YUEL 1WPCA 2NYYC 1OF2A 3GSWB 3UIZA 4X42A 1IBBA 2HRHA 4U1KA 1OGAB 1JNHA 1F6FB 3DARA 4ATWA 2AGQA 5L9DL 3T9WA 5J6GB 5F9LA 3GTTA 1OWTA 3M07A 3Q1KA 1GY1A 2IQ9L 4Q43A 2QKIB 3GHEH 4PLJD 4FQHA 3TO4B 5HTSA 4G1MA 5JQ6H 1SDYA 3C6SB 1AGFB 1F8TL 4YPGA 1PW3A 4AV0A 4OZIA 1LO4H 1XD1A 2V2XA 3G7TA 3HG1E 3HUJE 5I6MA 2XI9A 4CSSA 3RTQD 4ZQIA 4PP1D 4U1GC 5CM1A 1MFBL 5JXAH 2A6DA 5IVXE 1PYWA 5BZZA 1U8MA 3UQ8A 4NM4L 3I3BA 4GBXD 1JJUA 1HNWH 3WNMA 1GSMA 2HT4C 3P11L 5CJQH 3UGXA 4JKKA 3S36X 2IGFL 2G9HA 4HSCX 4PGEB 1UXWA 2F08A 2NXYD 3SKJL 2FJFA 2ZYIA 3N04A 1J8HA 5MENE 4OZIF 1BWMA 1G5AA 4NJ9H 2ZYHA 4IBZA 2GUYA 2MKLC 5LCVL 2MCPL 1TTCA 3U0WL 4H44C 3F05A 3W56A 5BOJA 5KSVA 1I1FB 1MJ7L 2W0FB 3TEYA 1INEH 4WTXA 4HFWA 5H35A 2OPCA 3VD0A 1ZGLM 4DH2A 1UD4A 2VERN 2CKBH 3CFCH 5C0DB 4F1SA 3DRQB 1CG9B 2OMXB 1UZ6F 1FZKB 4IRKA 2QGDA 2PPAA 3QFJD 4DK5A 2NSQA 3WE6B 3ELAT 3ES6A 2OJ1A 1U3HD 3FZUC 3RI5F 3F6IA 2DWDB 3DHJA 4F7TA 4RA3A 3CPLB 4YXHH 3IDUA 1ZS8B 2A9ML 5E8EB 3TBSB 2ZP8A 2PWEA 5BJTA 5FCUL 3KPLB 1H15B 2X6MA 3IDMA 3B7RL 5BS0D 1OE3A 3L13A 4BFJA 3P40A 2HLEB 3ZT7A 4MXVF 4JJHA 4UQDA 3OKOA 4UTAA 3Q6FA 1SXZA 1JZ3A 4YQXL 4E2OA 2G0LA 2ESVA 4LOEA 5ESAB 3ARBC 2HPTA 4EDXB 4EVNB 4X7TB 4FC3E 3WIFB 4HCGA 3MV7A 2IOOA 3T0ED 2EC9U 5AL0A 3FOLA 2ED6A 5ERWA 4OQ1A 1ZT1A 3SCMD 1G94A 4RFEA 4Y5VB 3NP3A 3TZVC 3ZRSA 4CC6A 1X5GA 2HJWA 3ZO9A 3GWJA 1OD9A 1QD0A 1N64L 2X9ZA 4MDJB 5GGQH 4CILA 1TDQA 3APDA 4PJ9C 3IXTA 1YC7A 3QJOA 1WG3A 5DS2A 3T8VA 3O2WH 5TE4H 3AITA 1IE4A 1BGXL 5LMUH 2DQ6A 5IJVA 2ADGB 3U9TA 4PJ8C 4F4XA 2Y36H 3GMQB 3VTAA 3DX0A 4BWTA 3NJNA 5EPMA 1EHXA 1DUZB 3AREC 1DO6A 2YMTA 3SPIA 2ICWJ 4K5LA 4EZLA 2LHAA 3P4LA 1P0SE 1HU8A 1CL7H 4UUJA 1S7TB 4Z3TA 2A9NH 1F4YH 5IF0A 1XF3A 1KTCA 4K7PY 1N2RA 5FR3A 2BW4A 2HUEA 5C1MB 1UGKA 5IROC 1UENA 3O4LE 1FG2A 3PL6C 4FFWC 2XX0A 4LIQH 4RISL 1M05B 4ANWA 3PVXA 1E2ZA 2WSKA 3ILQC 1IGTB 1PD1A 4FERA 4GUPB 3RVXC 1M9SA 1QTPA 2ZM6H 1JVOA 2DQFA 2OXHA 2JKXA 1RZKC 3F00A 3FO2B 4FYQA 1A6WL 1CK0L 3MFHA 1TVBB 1ZANH 1CBJA 2W38A 5KS9E 1MCIA 3AC0A 4RU9A 1P4IH 2AEIT 3QNYA 1NOFA 1I9JH 3BP4B 3TEXA 1DSWA 1DQLL 1NCAL 3VSQA 3MRJB 4NOFA 2V9UA 3ZL4L 4Z7NB 1BQHA 5HHNA 1JHKH 1T1ZA 4IRSA 5AD0A 1IE5A 5EWFA 5E94A 2O5YL 1S7QB 1EHNA 2O6DA 2UX7A 4KK8D 1U4EA 4JMXA 2DLFH 2N56A 2YHGA 3OZ9L 4BZ2A 4F7KA 1KOAA 1MJJA 4ZW8A 3WO3B 3M8OH 3VA2C 4MTMA 2V0AA 3QQ3A 4A93G 1BQLL 3BN9D 3U4EB 1JDEA 4M4PA 3WDIA 4XB3A 3K91A 3LSOA 4JZJA 2OQJA 1LO5B 1D5RA 1WICA 1YPZE 3CLEH 4MNHB 1HSAB 3BPLC 1AYOA 2BS71 1RIVL 3CWGA 4HA1A 2ZE0A 3FN3A 4RFOL 5CJOL 4DERA 3TIEB 3LRKA 1E4GT 3GIJA 2X44D 2VXVL 1BD2E 3EOBA 4LF7H 3O4OC 4MX7A 5TDNB 1N5AA 4OLWH 2Z0BA 4AEEA 4YB8B 1GW0A 2Z8VC 2AQ4A 3Q8FA 5DFTA 1KIUB 1MCDA 3LRSA 3QUML 5MEQB 1DBML 1MF2L 3RYMA 1FNFA 4IRJB 4JYAH 4YO0B 1Y1DA 3LQMA 4ZXBC 1KLFB 5C97A 4IHOB 4YHLH 4J6RL 1E43A 5H2BA 3MRMB 3O6KH 5FDWB 3LTVA 5HGBB 2ASJA 1XGZA 2FLPA 2I60L 4NRZA 4WK4B 2XPZA 1MIMH 3JXAA 2XD4A 4L29B 2AK1H 3AWEA 5JXED 1BX2A 5GS1A 1MFEH 1CGUA 3W9EB 2EXYC 3HKZE 5FCSH 3TTSA 1IAOB 2ZXCA 1XXDC 2A9AA 4I2XB 3WJLA 4M61A 4GNKB 2DQTL 3BCDA 4ZTPH 4QTHA 3DOSB 5DD0H 3HZYB 4XCYA 1PZSA 3A4FA 4YC2C 4PJ7F 3SJVE 1QHPA 1HAUA 4HD9A 1ZLWH 3KPQA 5IBLD 3IGKA 1NMCC 3UIYA 2YK1H 3IMVA 4V1DE 2CUHA 2TSBA 1OAYH 1W0YT 2HKFH 4PM1A 4R0LB 1ORSA 2VDOH 2X4UA 4Y4FC 1FZMB 1ZIBA 3FRPG 3LS5H 5DJ8A 1JZ2A 3QZPA 1B4RA 2AXWA 3JV0A 4PS7A 2NY5H 4U3SA 4GW1B 4J9PA 1OB0A 3CSPA 4Q0XL 1URIA 4G9FE 4I55F 5D1XE 3GSNL 3RDJA 1PZ3A 2BJML 3KE0A 1S9FA 1KELL 4WWKB 1IBZA 4HH9A 1SY6L 4XMXA 2O5ZH 5GRVK 1BAFH 4YHPA 1NAMB 3BP7A 4Y16B 4N8PA 1EZUA 4Z7VF 4DPRA 3O0RL 1NICA 5LBSL 1RK0B 1T1XB 3AB0C 4GYBA 4RMTA 4TUOA 4EYHB 1R17A 4JDEA 5I1LA 2NTSP 3T1FA 5EF1A 4ZRGA 3DVNA 5LG1A 1BM7A 4N2HA 3CPUA 1L5GB 1BMWA 4FMVA 1QFWH 1AFVH 5L0QC 1M6OA 2OZNA 1YCSA 3QNXB 3V4LA 5HHPA 2F1AA 2W5PA 3PU7A 4MNQE 3HC3L 4QYAA 5AQ0A 4ZAKC 2J6TA 4TLKA 2QQLH 1MHHB 1RMFL 1OAZH 2RCSL 4NN6C 4NM8L 3RHWK 2CG9X 4TQEH 3V79C 2NUAB 3QZ7A 1F3DJ 2BOLA 5FO7B 4JDVB 1F11B 3X3FH 5JHLA 3UDWA 1HCFX 2YZ8A 3U9UB 4KJQC 5ALCH 4J9OA 5GGSB 1WTGT 2PTTA 1WWWX 1BIHA 1RUPL 2YXWA 4FQIH 5HGHA 5JHDA 2WUBL 3VB8A 1MRCL 3QXDB 3VA6A 2SCUB 1MCWW 1YEFH 2F7OA 4LNRA 5ESVB 5G4OA 2OCCB 2C00A 3GMNA 1G9ML 1Y07A 3MRGA 5GXBB 5J1TC 3LN4A 3VGEA 2CA3A 4Z23A 3TURA 4J12A 5KYUB 2PKDA 3VI4E 3B8SA 1KBBA 4GAFB 1CXIA 5DHVB 3M86A 3KLAA 1PFCA 3UTZB 4Z0XA 4RNNA 5HI5C 3BIKA 1MZYA 2ZUYA 5DHYA 1QEWB 5MEOB 1PSKH 2YD2A 3UXFA 5KAQF 4GLRI 3QDMB 3E9UA 2AGJL 2HFGH 3IS1X 5CZXD 4QYOA 4J3BA 3RWJA 4N6RA 1CO1A 3APFA 4AJYV 6FABH 2RF4A 4PJBA 4GI8A 1GYVA 5DD3H 2Q76B 3TJEL 2Q8BL 2OMZA 2WCPA 4OVUA 3U30C 3VXTB 4F7CB 3UFXB 4HISA 1D5XB 4Z78B 3QIBC 4YSEA 2Y7QB 2UWEE 1I82A 1AAJA 4XNZC 3GJFA 4AQEB 3JYBA 5KG7A 4PWQA 2J56A 2WP3T 3ULVE 2QPFA 3N1MC 3OKKA 4GKZB 4HC1H 3MR5A 3G6JE 2FJUB 2V58A 4NNXB 3IJYB 4A04A 2VRQA 3EPGA 4ED8A 3UTPE 1IAKA 4DGVH 3HZKB 5DSCA 3HC0A 3H7BA 2XBZA 5IKCA 1J9RA 1P84K 1ETZB 5E24E 4BSWA 1U8QB 3BN3B 3N43B 4E9LA 3IVKA 3BUYB 4IU3B 4ZG1A 4Z95L 5I1JH 4PW9A 3FQWB 2UZXB 4N90D 5I1CH 1VESA 3TTYA 4AMWA 3GXPA 1NIEA 3CK0H 2BZ7A 4K5MA 4A2AA 1OGTA 1CQIB 1P1ZA 3PXJA 4AIZA 3ZL2A 1BVKB 5AOJA 3L95B 5J13B 5GGRA 3OLIA 4YSUA 5IW6A 1I1AD 1ID2A 2COQA 2GHZA 2EDDA 2WB1A 3ATDA 2TAAA 3ARFB 1RZPA 1KIQB 3NGDA 1A21A 4TQ8A 2F19L 2R0ZL 3RA7H 3Q9PA 2YGVA 4AYBE 1D9KB 2FZ3A 1WV7T 2V17H 2IMMA 3RBEA 3DOHA 4WI6A 2DI8A 4M6ML 5KFYA 1NGXB 3UTTD 3L7EB 4D0BA 2X1XR 1UB6B 5AWNH 4JFDD 1G9NH 1NIFA 3EYOB 4OTXL 1MCCA 1AZRA 2ITDB 2WLJA 1X5KA 4MNGB 3S34H 5C2UB 3EFDL 1S5HA 3HNSH 2QT6A 4YBQC 2ERJB 1I3RA 4H8QA 1AI1H 2C3VB 5JDSA 4OT1L 3HE6D 4AYMC 1DJHA 5KANG 4LSPL 2APVA 1HIMH 3ZY7A 2FX8H 5C0GB 1IX2A 4UNVA 2R9HC 3NTCL 2WLYA 5KVEH 1NTDA 3GS4A 3OM3B 4MD4B 1PNDA 5FFGA 1MLCA 4JRXB 2FO4A 1OAXH 2W0PA 2OXGA 1YG9A 1JNLL 2H4EA 2KPNA 4KMQA 5IMKA 1IUZA 3FB6B 3VTMA 2HJFA 1HXYB 4G8IA 4W9EC 4H0LC 2FAUA 1QPPA 2NY4C 4WGVB 5B7EA 3IWUA 3IAQA 2A99A 4N0YL 1HQRA 4XP5H 3G9VA 2YW2A 2IQAB 4MJ6A 4UTBH 4R8UB 1I3UA 3DX8A 3SPHA 5LGJA 3MLRL 4MASA 2YRXA 4HUXB 1RJLA 4O2CB 5DRNA 1E42A 2YBGA 3OXRA 2GTQA 4KNQA 1JGDB 3VI3A 4BDVA 1E8WA 1ORQB 2D7MA 2E9BA 7FABH 1DQMH 5I30L 2YGOA 1TQUA 2Y24A 1A0QH 1SUHA 3QB7C 3K71A 1S97A 1YC8A 1OHZA 5E99H 3RY4A 2DEWX 3N1QC 4O9HL 1R3HB 3VRIB 4LCIH 3WTVA 1TQVA 3DOIA 3K3PA 1WFUA 25C8H 4EI5D 4P5MB 2Q7AA 4QOKD 4K3DL 4I77H 5MERB 4UAHA 4AQZA 4BK8A 2VAJA 5D7SH 1EANA 5C7XH 3PWLB 4FL4B 3U6XA 2BR0A 1CE6A 1H3TA 2UXTA 3IB4A 1N33H 1A4KB 3N50A 2DD8H 3Q5OA 4QTIL 5G4MA 3E9TA 3DTUB 3F6LA 2OYKA 3T0WA 3JWOH 1JRHI 1O7VA 1ULVA 2EYSA 5CWSB 3LJ3A 3QWOA 1K3ZA 4A3DG 3PNWB 1BMGA 5F9OL 1S7UB 1SEIA 1FL3A 5E70A 3S8FB 3R0MA 4J5VA 3C87A 5GJTL 1QYGL 4LVHC 2OJEA 1FH5L 2VDKH 3U83A 4LL4A 5KVGH 3GBDA 4ONFL 2XACC 1BFTA 1R0AH 3IN0A 3T3ME 2J6EL 1HWGB 1AO7E 4BH7A 4KAQH 5FGCB 2AXFA 3ZDXF 2GK0A 2NDGA 1H8LA 1IM3A 1MI5A 1W0VB 3PRZA 4BXSV 3GTLA 2I69A 2XA3A 4GO8A 5J6HB 1BEYH 4GXVH 4DCQA 1JVLA 2CKBA 3GLZA 4DGIH 4IMKA 3MA9L 2ASLA 3HNTH 5C0AE 4L3EA 2H0JA 1VGKB 1XH3A 2YU9A 3L3OB 3EF4A 4HWZB 4FHKA 4IZOA 4Y2OB 5GHWH 1FNGA 3RWDB 5MEPB 4P59L 3UJTL 1AS8A 1AC6A 4R4NC 2VA3A 3HAEB 4ETQA 1I7LA 5D7JA 1U6AH 2WNKA 2YXVA 3EO9L 4XAWH 1Z66A 3VXUB 3TU6A 2BOBA 3ILDA 5A2KH 4XN7A 1NCWH 3LHAA 4XCEB 5KFQA 4XC1H 2X70B 4KV5E 1BSIA 1ZCRA 4NZUL 5I19L 4J39A 4MAMA 1FVEB 3MBEC 3FQNB 1U8HA 2BY1A 1QP1A 1GMIA 1SGKA 1W0WA 5KSUA 3ZDYE 2GBUA 3RNQA 4N2GA 4O2FA 3V0JA 1CU4L 5I26A 3MCG1 1MWAB 2J2ZA 4OZIE 1PZBA 4TVPE 1FDLH 1KBGH 2AJYL 3LHPL 2VAAB 3MRNA 4MS8D 5CFHA 1TF4A 1NGYB 3QUYC 4KHTH 3HE7C 1JPTH 3WNJA 3DXAB 5H37G 4KNTA 3RVUD 3B2DC 2GJ6A 3CDGB 3PDOB 4DV4H 1JI1A 2WZPA 1A2YA 4L8DB 4W9HC 1ZK9A 4XBPB 3OKEA 1J8HE 5IHZA 4NKQB 1JGIA 5JW4R 3CZKA 3DJSA 3K72A 3DIDA 3SY6A 1MRFL 3BSGA 4HT1H 3ZKMD 2P5PA 2JKNA 1QFUL 5D1ZI 3AY4C 2R69H 3ZE0F 3QH3B 1JPSH 2ZOWA 4FCAA 3HB3D 3NAAL 4LLYA 3EOYG 4JFPB 2CO3A 3MO1B 5GJSH 5T5FH 5I8KH 3V0IA 2GCYB 3EFFA 3I2CL 2JVUA 4NUJA 3S8GB 3FOMA 4PJIA 3QUZD 4WO4D 1AZUA 4LSUL 5L2KB 3OQRA 1HILB 1U8IB 2JA7A 1P4LA 4NZTL 3V4VL 1PEWA 4I7HA 4JPIA 4Z0BH 1QVOB 3GV7B 3PQYE 2ZDGA 3HVNA 1NH6A 5I71B 4NLHA 3FBKA 5KFOA 4XP6L 1JUFB 4RLDA 2FWOB 3KH4A 4RQQB 1YEDB 3CMOH 3BUPA 2CO7B 4BKLB 4J28A 3T3PB 3LXAA 4NRXA 4YHKL 2C4FU 4UQCA 1RYRA 3PHOB 2AKRA 5EWGA 3CSTA 3FU5A 3U9SA 1CIDA 4Y2DC 2MCG1 2V5SA 2ESVE 3ML9A 2OR8A 3WAJA 3QFDA 1FLRH 5C08A 1KTDB 2MFNA 5AVQB 3RGVA 1K5WA 4NAMA 1E4XI 2CUMA 2R2CA 2PF6A 3MV7E 1TAEA 3WOVA 4G5ZL 4Y4KA 4IK6A 4JFVA 2YAMA 5KJ4A 1PF3A 3CZGA 3TO4D 4M7LH 4DP4X 5C9JA 1ZXKA 3K1KC 2WXMA 2WKOA 1ACXA 1HHIA 2F1EA 3WTYA 3EZ8A 4S1QH 3UC0L 3WLWC 2JNZA 5LAPA 2AJXL 4O5LH 5B7MA 2LLLA 3BAEH 1JBJA 3LNEA 1COBA 4U4IA 5DG8A 4HKZA 1CTNA 3FU8A 3V4PB 2JV6A 3VWJA 3W11C 3S88L 2R7ZG 2VN4A 3T2NH 3QJZA 4UINL 1P7KB 3U7WH 2QTEA 3QO0A 1FPTH 3MRDB 4YHZH 1EHLL 4I50F 3E8VA 4WFGD 4AGLA 1V10A 5DZVA 1L9RA 1XXFC 5D1QB 5GRVL 4MV3A 1X5AA 3VPBA 3MA7B 3KVQA 4B95C 3WS3A 2DQHL 3HLAB 5C0FB 3H42H 1KC5H 4DEPC 2NVXA 3ALXA 3C2SA 2BHFA 1A7QL 5FKAB 4A7VA 5LWYL 4HU8A 2W6ZA 1NCCH 3ECUA 4J9QA 2JJSA 1W8NA 3EYVA 4WQOA 2Q7YB 2I85A 1E6OH 2QEJA 3GBNH 1QSEA 4N1CA 4ZMOA 5D7IA 2J5LB 3BEWB 3H3BC 3BKJL 1EBPA 2F7IA 4JQVA 4ALAC 1X4YA 5CEZE 4KO5A 1NAKL 2DWYA 1IBKH 1EO7A 4KTEH 2VO8A 4QCIB 4G6KH 4N8VB 2BSTA 1TYEB 3LB6D 3Q1EA 5CMAB 3NZUA 1C16A 4FLRA 5HY9A 2XN0A 1W6LA 1ZK5A 1HS6A 4WEUD 3BRFA 1BLIA 5ICUA 1FCGA 2EDYA 3SDXF 3AS0A 3UO1H 3GYRA 3QNZB 3D2UB 3SGKC 5AVXB 5ICYA 3EYUH 2VM4A 4EMZA 5C6PB 4QAWA 3D2TA 2PP8A 4YDJB 5ACZA 3E6HA 3NZ8B 3CLFH 3IDXH 3BC9A 1AGEA 4ECSA 1U95B 2XG5A 2I9TB 1G84A 3S4SG 5TDPA 4RESB 1USZA 4CU6A 1SYSA 3HS0C 4ONGH 1IARB 1UYWH 3BVWA 3FFCB 3T5HA 1L0PA 1MXGA 1KGWA 5D1OB 2WJ7A 2FL5B 2WLNA 1TFPA 1A1NA 4LDLB 1EDQA 1BG9A 3KYMB 4BKSC 4FKEA 4WUKH 2QELA 2C8NA 3FUKA 4EZJA 3KXFA 2WYTA 1I4FB 1KYDA 1S8DA 4OQTH 5FECB 3NOIA 5I5RA 5IFJB 4RZCB 1QOKA 5C0JB 4MRCA 4J27A 4PSPA 2DWEB 4FFYL 1BDYA 4Q4EA 2WXFA 5F88A 1T20A 3UTSD 1CFSB 2BSSB 5FPOA 4I0PD 3VXOA 3O11A 2D03H 1LILA 1IT9L 3FO1A 3L6FB 4HLJA 1PK8A 2JJWA 3BO8A 4Z7AA 4ZUUB 4UCUA 3RWEA 2R1YA 5CAEB 2IPUG 3BHBB 1TKWA 2A6IA 1AZCA 1U91A 2DWCA 4LARL 2VUMA 2J8HA 1B2YA 4KJWC 1V27A 3WEBA 5I6NA 3PHQA 1E5UI 1N32H 3F5WB 3B56A 4NRYB 2C2EA 2UZPA 5IYCG 1JNJA 3PJLA 2VDPB 4U1IB 4QHMB 4G80B 2J57A 2AQSA 3KYKH 4EN2A 5JIPA 4XOEA 5KVFH 4HWNA 2AJVL 1QLFB 2EYTB 1AOHA 1ADQH 5IG7B 4ZMAT 4P5TB 3B37A 4RIRA 4N0CD 4DN4H 4ZMPA 1K6QL 3FQXB 5E03A 1H3WM 1SBSH 5KFPA 3EHBB 5I5JA 5JW4M 1DSFH 3DBXA 3RTQA 1IRAY 4N2FA 3U2SA 3ZMNA 3VD3A 3SYQA 3QZOA 5IUCA 3DPBB 5EMYA 4GBXA 1KLUB 3SGDH 1D5ZB 1URZA 1HQ4B 4BZ1H 5IVNA 3S2CA 4N2MA 1J1XH 5F3HB 5JR1H 4XXCC 4I18C 1ZXQA 1S3RA 2DMHA 2WDTA 4KO7A 5DO8A 3CZEA 4HC1A 4MAUH 3X13A 3MLTB 1YO4A 2BQRA 2WLMA 2VSCA 4TKWA 3ISWA 1AHWC 3FTGB 5AAWC 4DEWA 1CDBA 2NZ9D 3EZJB 1T5XB 2N7AA 4X9HA 2HRPH 4ZUSA 5DTFB 4Q9CA 3KALA 4GKSB 4O3OA 4L8BA 4PW4A 1S9XB 1HINH 2ZKXA 1B9ZA 3MRBB 4WDIA 2QSVA 3JZYA 1FAIH 1GKEA 1K3IA 2O5XH 2YD3A 5K9OA 1JWUA 3QFJA 1DTUA 5L1JA 1D5BA 3Q3GB 3RIKA 5AAWA 4DUWA 5IFHL 1U3HA 3WUWA 3VGDA 5FWQA 2KSWA 2NY3C 4IRJD 4BFFA 4KC3B 4C8XA 5B1CA 2EH7H 4IRZL 4M7KL 4AEIH 2EDLA 5EU5B 4A2GA 1VKXB 5B39B 1E5BA 4P57A 5FX3A 3FTSA 4MV7A 5JHDE 1L7TL 3ULVL 3UBHA 3GTNA 1N59A 4TPRH 5BS0A 4TNFA 2VERA 3JTSB 5F3BA 1HR0H 2PP9A 5EF0A 3R5FA 4L0PB 3NSFA 3U7YL 5I28A 4FQXB 1H9VA 5DQGA 4J3SA 1M7IB 2F2HA 3B2XA 1KG0B 1CI3M 1BG1A 3CBKB 4NZRH 2JH2A 4LLUA 4MAYD 5IJDC 2DLIA 3EO0A 3T0EA 4X6EA 3KAJA 3ULUE 2CMRL 1FCCA 1MFMA 2XIDA 1MCOL 1MXDA 3SCMA 3F7YB 3O6LL 4IKIA 2F5BH 1MAJA 4N8UA 4JY6B 2VDLL 2Z35B 4PJBE 2UZIL 4S1DD 3N42F 5TE6H 4C59B 3EUDA 1E28B 2HT3C 3DC0A 4KKLD 4QWWD 4ZFQA 5JIDA 5F7NC 4K7FA 4M4RA 3SQOH 5C1OA 1YY9D 4PY8I 2WBXA 4P3CL 3S3JA 3M1CA 2BC4A 4PJ7B 4PRNA 3P4MA 4O51A 4GAJL 4F7EA 2EUVA 2H41A 4ZFZB 1ZQ7A 1C5DA 3CZLA 1OXYA 4MMZB 4WWKD 4CVUA 1C5BL 2ATLA 3CVZA 3MTXA 5FM8A 4M7ZB 1NGZA 2J7LA 3RB0A 3A4EA 4ACTA 1AXTL 1DJYA 2YAPA 4UTBA 2AXGB 2L3BA 2O72A 3GM0A 5DGAA 1EXGA 3V0DA 3HN5A 2VE6B 1NCOA 4GQRA 5CGYC 4OZFB 3BWAA 2E8ZA 5D1XC 5ECJE 2R84A 1XF4B 5DUML 1JHTB 5F7DA 4DKFL 2MH4A 2YARA 3Q44A 1UB5A 3NJFA 4AXWA 5F21B 1IFHL 3WNIA 1RYSA 3BEVA 3QQ9C 2Y9RT 3EYFB 2WB1E 2E7LC 1B0RB 3CSYB 3AU0A 3MRCA 3OPZL 4Z7VB 5DRWB 1KXQA 1N12A 1KCVL 1KCUL 3MOQA 1HYSD 1CZ8L 1RZGA 1EEQA 4XXDB 1XGRA 4PJFF 3DGDA 1TZGH 2X4NA 3AACA 4WSJA 1CFVH 5EOCL 4WK0B 4MV8A 3GXIA 2QTVA 5HHVH 2EDWA 3ULSB 3VFOB 2YOCA 3KYNA 5DI8A 2BY0A 4G6JL 4K23L 2EAEA 1T7WA 5C8JA 3BG5A 3VD9A 1KIPB 1YMHB 2LTQB 1FO0L 1ZMYA 3OX8B 3HHSA 4KJYB 3VFUA 2F5AL 4XBEH 5E8OA 1NCHA 4ELKA 4X5WB 2PO6C 2J73A 4GW4B 4UTCA 5T1MA 2H2PD 3AXHA 5L4FA 3UERA 2AFNA 3Q6GL 4PEEA 3J2PA 1K8IA 1BLNB 2C1PA 3R06A 5HD8C 4ZOAA 4MHHG 1LE5A 1Q1JH 3QDMD 1M2VB 4I0CC 3O41A 4KQ4L 3RY6A 1SJHB 4CBPA 4DW2L 1F58L 3GRGA 1LO3H 1NBYA 4GP8B 4I3SH 3DV6A 5HYQB 3H4HA 4G83A 2W9EH 5A7EA 1E3XA 3B7SA 3VFNA 2P1YA 3HOYG 3LEVH 5E6UB 5HHXL 2HVQA 1YYMH 1ZE3H 3CX5J 3Q1SH 3IAGC 3T08A 2AV7A 3NACL 1MIEH 2FYYB 3P9WB 1VBHA 1AD0A 1TJIL 4Q89A 5DC0A 3V55A 2OJZH 1M6VA 3DX9A 2HYMA 4G1EA 4YZFF 4KZEH 3RB7A 2B2XH 1GGOA 1QABA 5E2JA 5DD5L 4E41D 4K94C 2RQ8A 4IJ3B 5JOPD 4FTDA 3VI3E 2WVVB 2VCOA 5JXEA 1D5MA 4F9LA 2JTDA 3MCYA 3D8MA 4NBYB 1U21A 1YJDC 3RG1C 1A6ZA 1J86A 2DPKA 3CNKA 1BZ8A 3V9FA 2X0SA 2Y7LA 2HLFD 4UQBA 2EIJB 1ERNA 3B1UA 2BMKA 5C3TA 1HEHC 3NJGA 1BJ8A 4XZ4A 5FGRA 5CEYA 3IAPA 1LE9A 2VXTH 2NX5E 2V5RA 1OAUL 4FNLL 3UZQB 3L2NA 1GOFA 4HPYL 1OAKH 3SBPA 3RIFF 4BIKA 1WCMA 1KF9B 3ARFD 3W5NA 5CZRA 3E1ZA 2AHIA 4FN0A 1D9KD 2NXZD 4N6QA 2XJKA 3MBXL 3KDPB 4RGNE 3L3HB 4OJYA 3L1FA 4TVUA 4W1TA 4UOQA 4XWOD 1WFIA 3V7AE 1BA9A 3BWUF 4MDIB 3AG4B 3PS6A 4B41A 3T0BA 3MV8E 1DJXA 4XX0B 1OCCB 2C9RA 1CFBA 3FU7A 3WL9A 1WSCA 3QORC 2FSEB 2VITB 3QXTA 1NJ9B 1P6FA 5C70A 2FH6A 3AXIA 1M0WA 1I8MB 3QG7H 3ESPA 3ZTJG 3SKMB 2IG2L 2NY1B 1O6SA 4UT7H 1WA1X 2ZT9C 1DVFB 1TCRA 2EIDA 4Z7QF 5DT1L 5BCAA 2VSMB 3UTOA 4CADA 1MCFA 3TCLB 2KL6A 4TVPL 3POCA 4RAUA 5SWSD 2BOCA 1U8KA 4KUCF 1VFAA 2NY0C 5DF0A 1LGVA 5I0ZA 1RP9A 1GZPB 3AABA 1FI8C 3BPOC 4L3EE 1U8JB 4OGYL 3BAAA 4YFDB 2J9GA 3BZ5A 5E51A 5HVHB 3PABB 4IBTA 1T66C 4FNUA 2C22A 2BNUA 3C75A 1EERB 4Q6IC 1JGEA 2F74A 3U82B 1E27B 5AYQA 4H13C 4HFUL 2BVOA 4CC4C 4AYFA 1S7SB 3NBNA 3QRGH 4A7SA 5F7FA 1T2JA 1U58A 2CXGA 4DESA 3G08A 5E2VH 4B60A 2V7HB 4AL8H 3VACA 5AOMA 4ECTA 2EKSA 3JV4B 4EDWH 4X64H 4ZOBA 2JB5H 1XH2A 2SEBB 4L8SA 4MKMA 4EF3A 1E5ZA 1UOKA 3OTTA 3H3PL 4G8GB 1DN2A 4AG4H 1F90H 2KKQA 5IT2H 1II4E 2UVFA 4UDTB 3MR6A 2WVSA 3QEGL 3OXSA 1LK3L 5D70L 2GITB 3L3IA 1LEKA 3V52L 4XNQB 4J8RA 3TIDA 3I50H 4HOZA 1DBKL 1BYPA 2Y1ZA 3H54A 4F58L 2AANA 2GJ6E 2XTJB 2Y06L 3KS0J 3M1BA 1NEZB 3JSNA 1R3IL 4UNIA 5IYZF 1N0LA 3ARZA 2IBZX 4ZK8A 2UUDH 4WWOA 4EZKA 1EK3A 1DVZA 1QWUA 4F33A 5MI0C 4UTAL 2CO6B 3MR9A 1QMUA 3DV4B 1TZHB 4ZJ9A 1DQJB 5IWLA 3B3IA 1DUYA 4BWSC 4BQCA 2VDNB 3OKLA 3QA3B 4AM0A 3ESOA 4WFEE 2GUOB 3HZ3A 3IEAA 5DG9A 1JTOA 4YSTA 3CFJA 4JANA 4CMHC 2K8MA 1NPUA 4MD0A 3FT9A 2GY5A 3K2IA 2ZWSA 1JV5B 4OVVA 5G4NA 3DO7B 3GEFA 4IMLB 3MYZA 4TL4A 4L0ZA 3ARBD 5ADPL 4LIQE 2DJSA 5D5MF 5D9SA 3GSQA 4WLCA 1IGIL 3HPLB 1L0YA 4G6AC 4LOUC 2GSMB 3WY2A 3SE6A 1XNQH 3Q2CA 4I7ZC 1MFCL 4PTTB 4B3SH 4G70B 4OFDA 4TTDD 3ZDXB 1XR9B 1GIGH 1CLYH 5KFUA 3W9DB 4J6IA 4ODSL 5T5NG 1A9EA 4HIXH 3UTTA 2V9QA 4UB0H 4K9EH 4JFDA 5F93C 4KKCD 3DSNA 3K7UA 1UD2A 3VXMB 4GSDH 2VDMB 3A6CL 3L5XL 1QFHA 4DP1X 4NWTL 1KB5L 2V59A 1QNZH 1JCKA 2DIJA 3C5ZC 5D4HA 2ED9A 4YOKA 4EN3C 5L7XL 2EEXA 2YPVL 4FQ1H 2WUCH 1MLBA 5IB3B 2Y07H 4YHIA 3BPCB 3V0VB 4PJHA 2H0PA 3HE6A 4MYWB 4NNYB 4Y1AD 1P69B 5E8NB 2B15A 4OQTA 4NN7C 5IROD 4HXBH 1SOXA 4FQ2H 3PL6D 4JW3A 1L9TA 2IH9A 2V5MA 1GSHA 5T1LA 5DVOA 4R3SA 2D7TH 4DL4A 4LCCA 3REWB 1KB3A 3DXAD 1CS6A 1ES0A 3IDJB 1FORH 1WBYA 2E6PA 3RWFB 1DJSA 3DJRA 5JW3L 4DR1H 2AITA 4UV4L 5LP6F 3UAEA 4NO3A 1BQHG 2R0KL 3L4UA 4Z5RB 8CGTA 2WN3A 4P5KB 4PRIB 2DBLH 3EDJA 3VH8G 5T1DL 2OFQA 3OHAA 4FXKB 1A3RL 5BV7C 5F7WC 2R56H 3H3VH 4BZYA 4FQCL 3BZFA 2HG5A 4CJ1A 2FH8A 2JIXB 2IPKB 1QSEE 4IU2B 5D7IE 2A4CA 3FKUS 4QF1A 1AYRA 4OD1L 3TO2B 3U9PH 3CHQA 1AZZC 2BXZA 2BX5A 3ET9F 4GXFA 1MCEA 2VH5L 4ENED 5FEBA 2BP5M 4ABUA 2K7PA 3MJGX 4G9DA 3RVVC 1LP9A 5C6TH 4WFFE 1T0NB 2GJZB 4I1RA 4NLAA 4PVLA 2VPQA 5KFTA 1OTSC 5E4AA 3OSNA 4MSWB 4PJ5B 4EI5A 3II1A 3CVBA 4QOKA 4GW5B 3ZE0B 3C8HA 3EGDA 2FX9L 2QSCH 2B16A 5K33A 2KUTA 2ROXA 4G43B 4DR6H 2OTWB 1UVQB 1F97A 4HGKC 1ADQA 5EEXA 1PVHA 4XHJD 3PWVA 4L2YA 2VUGA 3LP8A 4LKCB 1PKQA 4NT6A 2PPDA 1E65A 3G6AB 4L9LB 1HNZH 1IKFL 5IQ9A 4R7NB 2D73A 2VXSL 2X28A 3WIIH 1BYOA 43CAA 1ZT7B 3FHEA 1AQKH 2CIIA 5C8YF 2XQBL 4OZ4B 3ROLA 4DTGL 4JGJA 5I1IL 3RL2B 4JREB 1JPGB 1KJ2L 2WLHA 3QUXB 4U0RB 5DJAA 5FD5A 5DU7A 4AITA 4ZMZA 4UV7H 3T71A 2NYZA 3KXFE 5HPMB 4Q2ZA 4A68A 4TM9A 4BZ1A 1KTLA 2FRGP 2GQHA 4WW2A 1B0WA 1QW8A 1E2VA 1REIA 5TH2B 3OG4B 4GEJA 3TPUB 1AY1L 1KENL 1JZIA 1U92B 3SO5A 1A7NH 4U1MB 4A3GG 3CJJA 1SCUB 4YDKL 1QLEL 3RIAF 4X66H 1EX0A 2EXYD 1QBMH 2CO2A 2VQFH 1ET8A 5FOJA 5D7KD 4BRVA 1LEIA 2VISB 3MLXL 3I6SA 3VSUA 2X0UA 3FCTB 1A9BA 1IC4H 4JI1H 4L18A 1E5YA 2PCYA 3QWNA 4LSTL 2WANA 4PDBA 1OGSA 2W9DL 4LEBA 1NGPH 5DQJB 1LWJA 5CFAA 4ZPVA 4FG2A 4XH2B 3CBRA 1NINA 5D1QD 2VO5A 2XXMB 3IPFA 1TJHH 1GGBH 3RWHA 1NMAL 5CO1A 7PCYA 5D72H 4Y4FD 4ZMNA 2XN9D 1VSCA 3L9RB 5FK9B 1A14H 2OL3H 1B0GB 3NIDE 4QWBA 2VLKB 5E2UH 2Y5EA 4I87A 4P9HC 2WQRA 1NSNL 4GRWF 3PAUA 3QJVB 3F64A 2UY6B 4U6HA 4U49A 4AH2A 3BYYA 4HHGA 5I1HL 3BZEB 4KROC 3H0TA 2FJGA 3GRBA 3VGGA 4AQ8A 1AXIB 2IOIA 3ARTA 4MVBC 3U25A 1SBBA 1HTYA 2KLTA 4Y7OC 3FT4A 1PD0A 5I5MA 3HJ0A 3P9MB 5KG9B 5E2WH 3S5LB 2IANB 4ODHH 1QW9A 2IGLA 5I75C 2PWFA 4QT5A 3BUIA 1N6QL 2AJSL 1XDNA 1UD5A 5ID1B 3M4IA 4L4TB 3D2UD 5SV3A 2Q2UA 1T3FB 4NO5B 5JHLL 3LDBC 1BZOA 1O7DE 2XWBA 1KN2L 3FFDA 2J71A 3QBTB 1P1VA 4ZAKD 1N9PA 3CN0A 3MLVH 4WEBL 3DX7A 5KYWA 1NM4A 4KHPH 2R23A 1RZJH 3FFCD 3JWDH 3EXJA 4N20A 2ZG3A 3UZVA 3LNHA 2R7EA 4KJQD 3LXBA 5L4MA 1ZLUH 3IJEB 4PRBA 4IRSC 1V7NH 1PZ5A 1EQWA 3EADA 5EOTA 5ESQA 4X8CA 5DRZB 1JTTA 5I1DA 2NR6D 2R6FA 1K2DA 2BIOA 2Q87A 4AT6A 2W59A 4IBSA 3X14A 4ZMTA 4HQQL 2YSSB 3GSXA 3ULUL 1IKOP 1T0OA 3BKYL 4PGBA 4WO4A 1TO4A 1T89A 3I75A 3L3JA 5EU7E 3NESA 4JV1A 2EO9A 2YJQA 4LEOB 3W39A 4ADGA 1UNNC 1WE5A 1DQQB 1OM9A 4WI0A 4K5OA 1MZZA 4W4OA 3THMH 4JO3H 3TEUA 3QS3A 2B1OA 2IDUA 4KMTH 2F58H 4UT6H 5EZIL 5AZ2L 4HSAC 1CVSC 4A6YA 3N2JA 4ELMF 3L2PA 4R7DB 4ZYKB 4JHBA 1QBLL 5CIPB 4NQVA 4AK1A 2A38A 4OSUL 4JFWA 2M2DA 4R2GC 3SO3C 4JFED 5T33H 2R7MA 3SQBB 5AW9B 4AQAB 3BQ1A 3MHZA 2DPJA 5HGDB 3UOAB 4UIMA 5EZLA 4LQFH 2E7DA 1L3NA 1QUPA 5GGTH 1PJ9A 4YPJA 3U7AA 3STLB 5IMOB 5D1ZD 4ATTA 1AVAA 1PJWA 2ZKHH 1YEKL 5L2JB 2R2BA 3G5VB 3T0EE 4M93C 1NOAA 5DZNA 2X87A 4EZMA 1UJ3A 4U1LA 2QKIA 5E8DL 3CHRA 5FYLD 5GS1C 3TO4A 3FSZA 4M5YL 3VXSE 3GMOB 2R82A 4GB9A 3TBBA 3W0WB 1QI3A 2Q3AA 1OCWH 1HL5A 3AT0A 5JQWA 3MJ7B 3WJLC 5DO2C 3HCVB 3H2PA 5EU6B 5EZYF 3EHBD 2OSXA 3WHE0 2WD0A 5M94B 3P30H 5KVEE 1T0MB 3MJ6A 3E2HB 4MXQC 1GTNA 3LX9A 2CDFA 3P4OB 2J4WL 4AVJA 2XKUA 3WTXA 4DIXA 2LU4A 6TAAA 4ES9A 1LMKA 3IKCA 4O02B 3V5HB 3V10A 5E5LA 5F1IB 3ZUCA 3Q5YA 3P3YA 4HK3J 1NUGA 2K78A 1A4JB 5E6ZA 5F9WB 3MNVA 3SIKA 1JXJA 1SF5A 3L4VA 4HG4J 1I1FA 1MHPH 4JI6H 2XVGA 5I1KL 4EUPG 1T3NA 4MBRA 4RMUA 1OY3B 2W0FA 4HZ1A 4QJFA 2WOBA 4OR1A 2D3JA 4R97C 4F15B 3CZFB 5GZND 5C0DA 3CQQA 3F7VB 1KYOK 4GLRH 4ACPA 2GBTA 1CG9A 2OMXA 3DRQA 3U36B 2FEEI 5JHAA 3TBTB 1SEQL 4K73A 5DR5H 1YQVL 1M56B 3I02B 5E95B 4HYKA 5KTEH 3FO0H 5GSVB 3WE6A 2JEFA 1KXQE 3D3VD 1P5UA 3V4UL 5C0CD 3NCJH 2EXSA 4UNUA 3CN2A 3QYCA 1RI8A 1WO2A 2KZ1B 3CPLA 3HAEH 4M7JH 4PP2B 1ZS8A 5E8EA 4XCFH 1Z5HA 1U8NA 1KLGB 3DTDA 3FO9B 3TBSA 1QLRB 1A6UL 4HU2A 4UCFA 3Q8PB 5JLZA 3LEXB 2JCWA 3KPLA 5DZAA 1H15A 1MFDL 3BWSA 4OM0L 3SKOB 4X4MA 2G3MA 1J9QA 2A7BA 2CO4A 2O03A 3BD3A 5FUOH 4MLIA 3W37A 4ZI7F 4FQXD 4EXKA 3UG5A 1MUJA 1PIGA 2DI7A 4MB1A 4KRPC 2OR7A 4A3MG 1KPVB 5FYKU 2ZUXA 3NPSB 5F70A 4L3CB 3KDMA 1QQDB 2CQVA 4X7TA 3WIFA 4EVNA 1BIIB 2O6PA 3P0VH 2WXJA 4RFNC 4LHJB 5KVGE 3WXWL 4XR8C 2XC9A 2CJTA 1RK6A 3MRHB 3BDXA 4H2AA 1ZHNB 4Y5VA 5GS3A 5LO7A 1R6VA 4GO9A 1P4UA 1WS8A 2EDMA 3P77B 3V9CA 2V4LA 5EH1A 1G7IB 1MJ8L 1F56A 3GHEL 3UTSA 4CN6A 1KN4H 5FPIA 2HX7A 3WMSA 2DEYX 3F7LA 4I0PA 1RZKH 4ADJA 1OALA 4OUOA 1S7WB 4WCYH 4Q74A 3KWWB 2ADGA 4U0QB 1SQ2N 3K2KA 5E9DD 4A37A 3GTQA 3BOVA 3VXRB 1RUAH 3GMQA 3VFGL 2BSDA 4G7YL 4WZ9A 3OQ3B 1DUZA 1NAML 4ANVA 3V7AG 5AW1B 3BXNB 4PY7A 2OX5A 1SPDA 5CJQL 1A64A 5GSRA 3N42B 4XNXL 1S7TA 1KXTB 3NA4A 4FQQB 2FGWL 2ENPA 4PG9B 5AVRB 2WZ0A 4BY1G 3L3KB 3FK3A 4IBVA 2GYSA 3FMGH 4NJ9L 2OA9A 4JKWA 3T5KA 2E2IA 1M05A 1HVXA 1Y18B 4GUPA 1IGTA 1TVHB 2CH8A 3HHMA 3RTLA 3TF4A 4F1ZA 1JZFA 4Z7WF 1QZ1A 1UH3A 2HFFB 1QI5A 5F2FA 1T5WB 3FO2A 2P26A 3GNML 4LLQB 5KFWA 4CVXB 2FPGB 1TVBA 1M1XA 3FF8A 3ML8A 1UH2A 4LBEA 3UGUA 2ALWA 3H56A 5JW4N 2BCMA 3BP4A 3PG2A 1P5VB 3MRJA 5LGHH 4N5ED 2Z65C 1A8JH 4FZ8H 4MZ3A 4YXHL 4F37F 3WNOA 2QFRA 1E40A 1PLGH 4X6CF 4PB9L 2WYHA 2XIIA 1S7QA 3REVB 4AENB 4L3FA 4EXPX 2ZX8A 3FB5A 3GF8A 2H3NB 5CBAA 4XMKL 3T0AA 4Z8FL 4JHWH 4NN5B 4MJ5A 4TUKH 3IDIA 2WZAA 4PBVC 4FHJA 1VDGA 4LASL 4R4ND 5A2JH 5HBRB 4WTZG 4PJEF 4F8LA 2X2HA 1ZETA 1RUKH 3U4EA 2ZJSH 2ZCHL 3EJZC 4PJFB 4QR7A 2P44B 4AQ1B 4P99A 5EU3B 4FJYA 4NQDB 3IU4H 4MNHA 2GJPA 1HSAA 5DD6B 4A7QA 1C08A 1HHJB 1F6AB 2OSLB 3D69B 2QKSA 3TIEA 3V4PH 4FHBD 2BFVH 5IEKB 1SLWA 1GW6A 4XNMB 4YLQT 3RZWA 4JG0L 5KEZA 1Z2NX 5TDNA 2ALZA 1I1RA 4DV7H 3I6KB 3AS3A 2CSPA 5I66B 2IFFH 1KIUA 1JRHH 1ND0A 4YNYB 1XB6A 2RFXB 4NPJA 2PYFA 2X3CA 3LD8C 4IRJA 4YO0A 2FQFA 5L6YL 1UKTA 3JQOB 4IHOA 2EQDA 2Y6SC 3MRMA 5FDWA 1S9YB 4AKOA 2Y36L 5HGBA 1WISA 3ILPB 4J3OG 4YQWA 4YJ2F 1QFPA 2ASDA 1H0DA 2XWCA 3HUJF 4JAMB 1V51A 1RIUL 1KJ3H 2ATKA 2QJDA 5CJBA 2XWZA 3ZR6A 1CL7L 1GOHA 1Y6MR 3UYRL 5IVXF 3W9EA 4HS8H 5E4OA 1QSZA 2A9NL 3S8WA 4GAYB 2CM6A 1IAOA 1MQ8A 2H32B 4MJJA 4F7PA 2CHZA 3D1MC 3HZYA 5L9XA 4MAYA 2ZUQB 4FI7A 3SOBH 3AQXA 3UACA 2JA7G 4QRRB 1CR9H 2DS4A 4LIQL 4J9SA 5KFSA 3PW4A 2NY2B 3PIQA 2EP6A 2R7KA 4F7MB 2KZBA 1OK8A 2E5EA 4BUGA 2IV8A 3L5WA 3L48A 2Z6FA 4R0LA 1WFTA 5DZPA 1G1CA 4JHZA 1C1EH 5TJWK 3P0YH 4R8WH 3VM5A 1GLVA 3RWIA 5C09E 4PVBA 4YJ3F 2K3TA 4JFHD 5A2IH 3VDAA 1CLZH 1PMYA 4EOWL 4X8GA 3RURA 1NKOA 4W6XB 3HB9A 4YSSA 4WWKA 4RGNC 4XPHH 3RAJL 1XH0A 2DLFL 4KTDH 1OT2A 4QWAA 3M8OL 3CUPA 1RK0A 1T1XA 2NY1D 2RHEA 1ROCA 2X4RA 4N90E 3BVUA 1ZKAA 5TF0A 4G82A 2ROYA 1L5GA 3ZYIA 3FTXA 1W2KT 1KGUA 5DHEA 3B2MA 1GL4B 3CLEL 3QNXA 2XQ0A 2J12B 2ZF8A 4XTRC 3DJ9A 3GDCA 2R8GA 3MOAH 2NNCA 4OCXH 3MV11 4ZS6D 3U6RA 4IKNA 3HI5H 3BFWA 3KWUA 1MHHA 4CC5A 1VIWA 3QZWB 4BA8A 4LVNB 4WHDA 3VFSB 5BVPL 4OLWL 3HKFA 1KCRH 1HZKA 4BFGA 3QPKA 5FO7A 4JDVA 1F11A 3CX5K 4Z7QB 3VU1A 1PAZA 2LAGB 5F7AA 3U9UA 4ODXB 4AUUA 4Q8BA 3UTTE 5HPOA 5GGSA 3U4KA 4P4KB 4IMKC 3QXAB 3TZVB 2MNUA 5F7EH 1IOWA 3A6BL 4FGMA 1TSRA 1HKLL 2GBAA 2HJKB 4YHLL 4E0RB 3O6KL 1KB9J 4U3CA 3GB7B 4HKBB 5ESVA 1NANI 1ZHKB 4PRHB 2E27L 3BISA 4AUJA 3I9GH 3H2WA 1DLFH 2IBBA 3FQUA 1E9PB 1R5VB 2CPUA 2F53B 2AK1L 5KYUA 5D7JC 4YY3H 5FYLH 4ABQA 4A3FG 1GGCH 4PJ8B 4OJCA 1VAHA 2DQEL 3BQUD 1JSYA 1MFEL 4M8QA 4PJHE 3FYEB 3HW7A 3AS2A 4G8GD 3CHOA 5B4MD 1QEWA 4FG4A 3BA9A 2FT8A 1HI6A 3J7HA 4ZTPL 1Q0YL 3QDMA 5DD0L 1ML0A 1QFOA 4P9MH 2Y1AA 3HNVL 3UCQA 4U6TA 1ZHLB 2LGNA 2XTJD 4K3EH 3VXTA 3VFVB 4M03A 1D5XA 4Z78A 4A7UA 1CQYA 1OAYL 1NIDA 1EH9A 3RDTB 2VDOL 4AQEA 1JZEA 5KG4A 4AJVA 2UXVA 1UXSA 4GKZA 4JB9L 4J9NA 2F54B 2CNYA 3PAZA 2NY5L 3MMEB 4E41A 4OJAA 3HZKA 3JBG7 4YXLL 3KJ4B 1E4XH 5KS9F 2YMXL 1Q1PA 1U8QA 3BAYA 2GSIB 4G6ML 3BUYA 1D7FA 1UWXH 4IU3A 4NQCB 5DMGC 4ZSOB 2OL3A 2W1NA 4JFYB 5C4XG 2O5ZL 4MMYA 1OAQH 3FQWA 2UZXA 3T5WA 1J05B 5JQHC 1OPGH 3JT2A 2J1ZA 3B34A 4X4XB 3VGAC 5A3IC 4MV4A 4BFIA 4YK4C 3QIWB 1BVKA 1XFPA 3L95A 1SOKA 1R34A 5E7BA 3WYRA 3MCKA 4KKBD 5KVFE 1JTPA 2WB7A 4M1DH 2EDXA 4OLYH 1AJ7L 1AFVL 4C5AA 1ZD6A 2FX7L 3ARFA 1KIQA 3ZOAA 2QQNL 2RBLA 2ZX5A 1PKQE 2Z3FA 1D9KA 2VR3A 2FMAA 1YPZF 4IRDA 1CD1A 2VUOA 1OAZL 1K72A 5EZOH 4UAOC 4TQEL 3L7EA 4FLOA 4UM8B 5D5MB 2MPAH 2D2CC 4WU7B 3HI1B 3RX9A 3EYOA 2J43A 2D7QA 1WSST 3VXMD 4MNGA 2F8OA 2YUWA 1KGJA 2GPSA 2H0FA 4MXWH 2EH8H 3GHBL 4KJWD 1YEFL 3L4ZA 4L8CB 4K8RD 2C3VA 3JYCA 3LKOA 4ZXBB 1XF2A 1EGJH 5ETUB 2FIRT 3VXNB 1NFDF 5B22A 4KZDH 1CFQB 1ZS2A 3EDEA 2WO2B 3RGVC 5BPHA 1K4CB 3MFFB 4JFFD 3OUZA 4MA1C 4X8JA 3QDHA 1Q72L 1J9TA 4Y4KC 4D7PA 5I2IA 3HHRB 4MD4A 1PSKL 4AMKL 5SWSA 1OAJA 3AROA 1HNXH 3QS2A 5EF2A 1MPAL 1SZNA 1OIOA 2HFGL 4X7SH 2BP8B 2V3DA 2RIKA 2EIEA 3FB6A 6FABL 3O9WD 5EU4B 1ZDSA 1OE2A 1Q9KB 5DD3L 4PRID 7TAAA 2H0EA 2W7OA 3GBLA 4WVRA 4UT6A 3CVIL 5I6KA 3DX6B 2YPLB 5HDQH 3VWJC 2IQAA 4D8OA 3OB0K 2CK2A 5TPWL 4HUXA 2CCLA 2JIXD 4O2CA 1OPOA 1R3KB 1S78D 4HC1L 1JGDA 1NBZB 2BFGA 4QHPA 1JHLL 1BZ7B 1ORQA 4LPUA 2VJ8A 2JXMB 2ETWA 4HNTA 1C8PA 3HS9A 1JERA 2EDFA 3GILA 2W6OA 3WNZA 5BZDA 4GG6A 3BVNA 1R3HA 3AQDA 3KJ6L 4L4JA 1RFDL 5GGTA 3VRIA 2YS7A 2JJSC 4FXGB 4M5SA 4PJ5D 5AW5B 1LLAA 5IHUH 1BFVH 1J10A 3BT0A 2A9DA 4RA0C 3CK0L 4IOIB 1WEJH 3O6FB 3DIFB 3MGOB 3PWLA 1EDYA 1Z1WA 1WQVT 2B5IB 4JQVC 4PV1C 4RMRA 2HSIA 2YJLA 3OR7A 4NQED 2E59A 1A4KA 3HVDA 5A16B 3ULAB 2ZCLL 3AB0B 3QPXH 3IMTA 4JDTH 3W5MA 1FNEB 5K39B 4QUOA 1NWPA 5CWSA 3RA7L 3PNWA 1C7SA 2GKIA 2H1XA 1S7UA 3D7PA 4ODVL 5CSBA 2V17L 1T21B 4FLHA 2NY3D 5F6HI 2XZCL 3QUXD 4E42B 3WXVH 4YDLB 2XNAB 5AWNL 5FXCH 5KFIA 3KPNA 3B9AA 4KQ3L 3IDGB 4DL6A 1MFNA 2HAZA 3BUBA 3LXCA 4K3JL 2A77H 3S5ZA 4JGNA 3S34L 4K15A 3TWYA 2AEQH 1X5XA 3T6QC 2D31A 3HNSL 4FYSA 3U0PA 2Y0SA 4ZFFA 5C86A 1ZOXA 4FG6D 3C08H 1AI1L 5LB1A 4DOHE 2W6PA 1LD9B 2IBZY 5FV1L 4U1SB 5F6IB 3A3YB 1W0VA 3ARBA 4MCNA 1JYWA 5DGBA 2ICES 1HIML 2AEPH 3EG9B 2FX8L 4DFHA 1O9ZA 3E7JA 3GQCA 5GRYA 2BWDA 3VI4F 2RDJA 1MVUB 5KVEL 5AB2A 2B9BA 3U79A 1SDDA 1VGKA 3L3OA 4HWZA 4AZ8B 4Y2OA 1OAXL 3OF6D 3ZKXB 3RWDA 5MEPA 4WNQB 2XETA 3ZKQD 3GBML 4LHUB 3L5IA 2PR4H 1R24B 3HAEA 4PB0H 2RTTA 3AG3B 2Y5TB 3NJLA 1NUNB 2VLKD 5I6XB 2QGBA 4UOZA 5SX5H 2VSDA 2CJUL 3DURB 5BOPA 2H6OA 4KK6D 4XP5L 3EOAB 3EUUA 2JKJA 1BV8A 4WHTB 2A0LC 1ONQB 4J2QA 2UWEF 2X70A 3V5KB 2PVPA 3QIBB 1FVEA 1Z9SB 2B59B 1F45A 3ULVF 4LU5H 1E4WH 4M3JA 2EABA 3G6JF 4ODBD 1D6EB 1MWAA 2EXWD 4OB5L 4ONOA 4C54A 2P49B 3L3GB 2IAND 5E99L 4NPYB 4DV1H 4I13B 2VAAA 4Y1AA 4HGWA 5EG6C 2ZTBA 4R83A 3QUMB 4LCIL 1SYXB 4GRWB 3JV6B 5IROA 3MV01 4W93A 4YFLF 1NLBL 1NGYA 4I77L 4PMEA 3ABZA 4M1CC 4JN1H 2VQ4A 3MRQB 4PLJC 3DXAA 5C7XL 1JNNL 3QQ9D 2AQ3A 3DUSB 3CDGA 3PDOA 3BGMB 4HCIA 1DBAH 2I8CA 2WBWB 4HKXB 1LNUB 4WFGE 2C4FT 4HR7A 3JT0A 5BZWB 4JM0A 1KC7A 3O3AB 5E5MB 3QZNA 2GIYA 1J9SA 5CKGA 3RTQC 4PP1C 3POHA 2DKMA 2JQAA 5C0BB 5GRJH 5TDOA 1RUQL 3M6DA 2E8YA 1O7DC 2L4OA 4Y19B 1GXEA 2CWRA 3QH3A 3FXIC 3QZMA 2WTRB 2FT6A 4N24A 4TRPH 2UXDH 2VDKL 4DGYL 4JFPA 4O3QA 2PXYB 2NXYC 3MO1A 5DUBB 5KVGL 2GCYA 5DD1L 4N0FB 4M9OA 2AI0L 1Z9NA 4ZI8A 5L2KA 1HILA 1U8IA 4JRLA 3BAKA 5DC2A 5EA0H 1KJJA 3MREA 1B6SA 4HV8A 1BPLB 5AUMB 1W91A 1SHWA 3WI9A 4XI5D 4KAQL 5EBWB 5LYJF 5CD3B 2O1AA 5LHDA 3TN0D 4AJ0A 2ZOKB 2K0RA 4XBGB 1RZ7H 4LSQH 5D96C 1DHKA 1JUFA 4PG2A 2FWOA 4RQQA 4XC3H 1YEDA 4HLEA 5CSZA 5EU7C 1I8AA 2CO7A 4NHCH 1S5IH 3GSNB 3HNTL 1MFVA 4X4ME 4YDZA 4BKLA 3SKNB 2F6AA 3GKWH 2QVFB 1U3HC 1XZ0B 3FSVA 4YS4A 2DJMA 2VDPL 2R0LL 1X6NA 4O4YL 2C1OB 4QJ3B 1PG7H 5JPMC 4DR4H 1A7OL 4JUSA 1KTDA 1GVIA 3GSOB 3O2VH 4ELMB 4ZUTB 5J06A 1A0IA 4F27A 1OW0C 2YFNA 1IVTA 2BSBA 3VQ1C 1NCWL 2NDFA 2XWXA 1QSFD 5EWEA 5TE7L 2NY4B 4JVWA 4XC1L 2CK0L 5CBEB 3EYSH 1G9NC 1E9OB 1FVCB 4JRYD 3UTSE 1V05A 3O2DA 1AXSA 5EU6D 5CSGA 3VUAA 5CA0F 1FGVH 2J55A 4M5ZL 1FDLL 1KBGL 1A7PL 2BWQA 1DBBH 3T0EC 5A2BA 1SEBB 4QIRA 3V4PA 2GY7B 1CDYA 4S1SH 3SCMC 5T1JA 1THCA 1F4HA 1T6BX 1P7KA 2CPCA 4LHQB 5EOQH 3RPKA 3VFRB 4E9YA 4KHTL 4DL7A 2XWTB 3EBIA 3II2A 5D1QA 1JN6A 4JQIH 4Q7DA 3TWCH 4NC1E 3MA7A 4Y4FA 2XN9A 2CDEA 3LZOA 4NNPH 5CU5A 5IW1B 2HKHH 4KUZH 5BXFB 5FKAA 2AK4B 1E4JA 3G5YA 3FH8A 3VW3H 1FFPB 3RFCA 1DYZA 1EFXB 4ECUA 3FQYA 3BEWA 2CHWA 2R69L 5I15H 2JI3A 2CXKA 2Z34A 3L9EA 5F97E 2YFOA 4B7LA 5JNYB 2LR4A 4QHNB 5T5FL 1XGUA 2GT9B 2WZ6A 3O0LA 5CMAA 5AFAA 4YIQB 3S3BB 2AQTA 4DN3L 4N85A 2AJZB 2BRQA 2BQUA 4HJEA 1U8OB 4XXWA 3T3MF 1DFBH 2Y1VA 3QNZA 3D2UA 1F18A 1TZOA 3C8KB 2MKWA 4RMBA 2X2IA 1NCNA 3SGJA 5LXVA 2GABA 4YDJA 3H40A 2J1YA 4OGZA 3CMOL 4ZAKA 4MFHA 1ZJAA 1MQKH 1AH1A 4ETYA 4TLTA 5CP7B 4QNPE 5TQ2H 4KVNH 1T66D 3GD1C 4OF5A 1E8ZA 3FFCA 3GLDA 1ACYH 3GO1H 2QPUA 4FLSA 4PGCB 1AMYA 4JHAL 4K8RH 3T0XA 4Q8FA 4EIBA 1WC7A 3HMWH 2FL5A 4ICWA 3KYMA 2ID5A 2PWHA 2BDNH 4OV6F 1A5FH 4XPAL 1ZLEA 1EEUA 3HPJB 1WZAA 3JWOC 5C0EB 1I4FA 3H9YA 4KK8C 3IMWA 2FWLB 5IFJA 2NR6A 5EUOE 5C0JA 1W93A 4BRJA 4N68A 2DWEA 2YEZA 3OMZA 2PN1A 4YX2H 3GGWB 1XV8A 1CFSA 4M7LL 3MJ9L 3RL1A 1A8ZA 2VDQB 2MOVA 4CMMA 3TA3B 5C92A 3MFGB 4AK2A 2BY3A 4C56D 4KV5F 1JWMA 3L6FA 4KI5D 3DECA 3H9HB 3RY6C 3QHFH 1D2OA 1WHPA 4O5LL 4ZUUA 3VXRD 4M8RA 3ZDYF 1JCVA 3B43A 3CDZB 1KIRB 4UCVA 2VABA 2ISDA 1S7RA 4OIIH 1IC1A 1N0XH 1PLCA 1YMMB 2R39A 3PGCB 3Q9QA 2XV3A 3T2NL 5JMOC 3U7WL 2J20A 3VE0A 1YNKL 2EDRA 1G6RH 4JFEA 5HHME 3EJQA 3CCHA 4PJDF 2MHAA 4YWGH 1CFTB 2HB0A 1WZKA 3F5WA 3FL7A 2VRKA 3DYPA 3P3UA 3HFFA 3EH4B 1KC5L 3HE7B 2WCGA 1JVKA 1XT5A 3MLZH 5FFLA 3IBOA 3JSLA 2FD6H 3IN5A 1CGSL 3EGXB 4QHMA 5D1ZA 4HG4K 2XA8H 4G80A 5CR1A 2EEDA 4G8FB 1E6OL 5LXGL 5I9QB 5JXEC 5I1GH 4F9LC 1TMCB 5DEJA 2V4QA 3S37H 3MLWH 4G8EA 4GY4A 5IG7A 1XF5A 3UO8B 3FQXA 4M6AA 4G6KL 1KZYA 2ATPB 1YNTF 2PR9A 2NUTA 1EEYB 5DYFA 2CLVB 5IQOA 4PLKD 3Q05A 3TH3T 2V5TA 3DPBA 5IBLC 4Z7WB 3UO1L 5KFHA 4JQXA 3B5TA 1D5ZA 3EYUL 1HQ4A 1N67A 5KW9H 5L8JB 2RD0A 3W3BA 4Z7IA 3QAZC 5AW8B 1TT6A 3IDXL 1MN4A 1WYJA 4JVUA 2SODB 2XPGA 3MLTA 1UYWL 2WWMD 4KO9A 3TNNA 1SN0A 1T5XA 3FRPA 4X6CB 2WKLA 1W16A 3FQTB 3KPOB 4QXWA 5GIRA 3RJOA 4DR5H 1Q9LA 4GKSA 4YN3A 5CUSH 5GZNA 1I9IH 3V95A 3MRBA 4ZTOL 4WRLA 1JPFA 5EBLB 5B1JA 5B8CC 2WGNB 2NSXA 3LIZL 3DK0A 3LMJH 2GAZA 4PJEB 4UCSA 3Q3GA 5FOBB 4NWUH 2J6UA 4XE5B 3D3VA 1C12B 4Z3JA 4N22A 4B3EA 4JNXA 4H8UA 5EEVA 4TMPA 3W81A 5C0CA 4AZUA 4YLCA 4DAGL 1CUOA 2D03L 3NABL 2OZ4A 2DL2A 2D3VA 3VB9A 2W60B 1M71B 2X9XA 1OP9A 5K5YA 1BW8A 2NSMA 3G3LA 4ERSL 3ECBB 4UCTA 4NJAH 2HXAA 4J4PC 4JO8A 3JTSA 4Z3EA 5DMIH 2DTML 2IDTA 1GSAA 2IH3B 1A7RH 4HOWA 1G0DA 2JQMA 4QHLB 4OZGA 5ALBL 4A67A 4FQXA 4XNUH 1TWHA 4MA7H 1M7IA 3LRMA 3FU0A 5C0RH 3CDCA 1KG0A 1F4XH 4W81A 1U3NA 1PX2A 4HWEH 5EDSA 4TL5A 1QUNB 3QDME 4QRRD 1TXKA 3HG1B 3HUJB 1PKOA 3F7YA 1RY7B 2NY2D 3BDYL 2Z35A 1EGJA 1X9NA 3LRLA 4TSAH 2L8AA 3RVVD 4L8SC 2FR4B 3T2PA 3IE9A 1E28A 3NQIA 1HL9A 2PW1B 4YSRA 3U0TB 3N85L 4DN4L 3QJSB 1SBSL 15C8H 1RIHL 5E9DA 1FSKB 5CZXC 1DSFL 4UCOA 5ICXA 3T4YB 2YSTA 4H8VA 2DBJA 4E41E 4DO4A 4AC4A 3QEUB 5JOPE 4MMZA 5IB1B 5LUMA 3RJDA 1MFUA 1BXVA 4BZ1L 1KSRA 3MKKA 4B53A 5FDYA 1B6RA 4F4YA 2JA6A 1J1XL 4JVPA 4GKLA 5JR1L 3FS9A 2VR8A 3QW9A 4FNRA 1PY4A 2VE6A 3MRPB 2IO5A 5KG1A 5IWLC 3UPRB 1M9WA 4CVWA 3K3VA 3TESA 2ZAIA 2IA6A 5DJXA 5K9JL 4RGOH 1TEYA 1P53A 1UURA 2HRPL 2ZNWA 4XN9A 5IM7B 2BXYA 3LZRA 1NDMB 2WLLB 3CSYA 1SXSA 2G60L 4Z7VA 4ODWB 2O5XL 3D0LA 4Y1TA 1UA7A 2A9CA 1JXFA 1FZOB 4F80A 2Z31B 4LLMB 1JWSB 4XXDA 3CSGA 5CKAA 3QRBA 1XCTB 4P4KD 4ED0A 1SVBA 1ZTXH 3GZOA 3GLKA 4QRFA 3GIIA 5DQHA 2ICEB 3ULSA 4AEIL 3RTXA 2CHNA 1Q9OB 2EEFA 4GMTH 4MNGE 1IC5L 1KIPA 1YMHA 3OX8A 4KJYA 4PRHD 4K94H 4TPRL 3MXVH 2JB6B 2F53D 1HE8A 5ACLA 1R3LB 4Z1PA 5ILTH 4HUCA 1GZHA 4MA8H 2YPKA 4N2AA 4GW4A 1JZHA 1U2HA 1U4FA 3GI9H 2VXQH 1QO3B 5JYLA 4IJTA 1BBDH 2NNXA 1H6FA 1G7LB 3MR2A 2XWJB 3V4VB 1ZWIA 1BLNA 3MNZA 1M2VA 4NZRL 1SJHA 3AU1A 3BT2H 5SWSE 1EHAA 3FB8A 1KJVB 1QR4A 3IKKA 3IN2A 4NKMB 5F71A 5HYQA 3VD2A 3GTOA 1YLBB 1OP3K 3S3DB 4KROD 2JJVA 3CTTA 2R86A 4FABH 1CTOA 1U36A 3SE9H 2DMKA 4O02H 4N28A 5CJ5A 1L6PA 4B5EA 5GISH 5I82A 35C8H 2FYYA 3RDTD 1G7MA 4X7EC 3VPDA 1JF1A 2QVMA 2TSAA 4JFOB 4LCCC 2F54D 3SQOL 4CDGC 4QHKI 4M56A 3M9OB 1HEZB 1GGIL 1ZHBB 4GC6A 5KG0A 3TBWA 1HC1A 4JM4L 5KSAB 3MLPA 3B2UD 4OAWA 3T77A 4KKNA 2QPEB 1FL5B 3LMLA 1KPUB 3L1OL 2XKNA 3HG0A 2IALA 1EXUB 4OGXL 4GG6E 3K0YA 2DQCL 4WI7A 4TOYH 4PV8A 1KFGA 3QIWD 4LRIA 4ODTH 3T5JA 3UZQA 2Z92B 5BOZG 3G5ZB 5IT9W 5KS9B 4EGQA 2V7NB 3O6MH 1MNNA 1ZY9A 4PYGA 1NIBA 4JPWH 3T4AB 2FEDD 4M02A 4U6XB 1QPKA 4WENB 4EEQA 1T4KB 1XSJA 5E8PA 5A7BA 4ZQKB 3L3HA 5D4QA 3I9PA 1RAMA 4EI5C 2C9XA 1P2CB 5FHBH 2I7SA 3NGBC 1PLAA 2IMWP 3QR1A 3H4DA 3NCCB 4NYLB 3MXWL 5BPFA 2XZAH 3GMRB 3K6DA 4G6FB 3GTPA 4OUUB 4YHMH 1CFVL 32C2B 4R26H 2JELH 2BVQA 5HHVL 4FNPA 4XCNB 4N4YB 1SJVA 2VITA 4ED1A 1DANT 2PBZA 1TJGL 5KFCA 3MYJA 1TNNA 2VW7A 2Y0SE 3EDDA 3LQAL 1YPZB 1I8MA 3WFBH 4UOJA 3UPAA 3SKMA 3K6FA 5FGCE 3WFCH 4LB8A 3VJ6A 2IH1B 5AL8A 3TCLA 1ZLUK 1GYFA 4AM0Q 4WW2C 3TVMB 1CT8A 2HVKB 4BM7A 1IMHC 1GC1C 4PIBA 2BVPB 3CVHH 3L4WA 1DL7H 1Q1JL 2IJ0C 2YRLA 4LCWB 5AVTB 2X3AA 1GZPA 1DJIA 2OMBA 3E0GA 1U8JA 4JEGB 2W9EL 2I07A 4LL1A 3PABA 4JN2A 1NFDB 4R7LA 3SE7A 4PUBH 3K8KA 4QRAA 4KGJA 5DO2D 3ULUF 2AGOA 3Q01A 3C0FB 1I7UA 2LU7A 2YPLD 1HCYA 3O45B 1E27A 3Q1SL 3FTZA 1MIEL 3KD4A 3WLBB 4P8QA 4G3YH 1S7SA 4PJBF 1AR1C 4KZEL 3PWPE 1FYTB 1UACL 2B2XL 1FYHB 1SRDA 1NFAA 1T5KA 2CU9A 1ZVSB 2GPZA 5IJKA 4K2UH 1NEUA 4GKNB 3JV4A 1FN4B 3QNFA 3SJVB 2A4ZA 3BW9A 4MJ2A 4OCMC 3VSVA 1ECZA 1Q0XH 3A47A 3BQUA 3LH2H 3OJDB 1R9FA 2ZSVA 3EJRA 5TGBA 1EJFA 1XWVA 4G8GA 4Y1AE 4KTGA 2X40A 2A6JB 3O6FD 3VG0L 2O30A 4CUCA 4UDTA 5J2UF 3PY9A 1IILE 2CLZB 1YUHB 2GITA 1Z9PA 5T3ZL 1OV8A 2XVKA 3KVPA 3DXAE 3Q48A 4JPKH 5DS8A 1NEZA 5GS0L 3BD4A 3CFTA 4YAJB 4G9FB 5D1XB 3JUZA 4HS6A 3SBWC 5FW7A 3US0A 3RV4A 4OD2A 3RIFK 2EUXA 1MCKA 4I4TF 1EZ1A 4FQPA 1JX4A 2CO6A 1A6AA 4RUCA 2F7PA 4CU8A 2DYPB 3SGKA 1ASPA 2G3NA 3CZUB 3RVUC 1KZQA 2G75B 3SDAC 2GUOA 1HNYA 2OR9H 3HMXH 3DPDA 4ZW3A 3HBPA 4KPHH 1YEGL 4YHYB 3MRRB 1JV5A 3IDNB 5EIIB 1J8RA 1Z2KA 3ZKMC 3NH7H 6PCYA 3UJIL 3P1VA 2OTUB 4UT7L 4CC1A 2VDRL 3FN9A 3IT8D 5E9AA 4EBQH 4E5XB 3TJPA 3HPLA 3D30A 1HNFA 3K80A 3UZEA 1IC0A 2JKRM 3ZTJH 1ZPLA 4WO4C 4XP1H 1T89C 3IS0X 3KM1A 3T3PE 4MTEA 2X1PA 1OT1A 3A67L 4R6UA 4B9FA 4CAGA 4HUWB 1IQWH 4W4OC 3IJSB 2VN6A 2EDEA 3W9DA 5G2NA 4R7XA 1NCDH 3ILEA 1IEBA 3GM8A 1YEEH 3HRPA 1J5DA 3IGAB 5BO1L 1Z5LA 3VXMA 4IQHA 1WS7A 5JUEH 4H8PA 1CFNB 5ID0A 3WE1A 3UP1A 3HOXG 1A1OB 3PZPA 4N2EA 4HDIB 1HH9B 1KGYE 2CBOA 1OP4A 1VFMA 2YQBA 3V0VA 1IU1A 2JB5L 2YC1B 4YZWA 3PJNA 5D7KE 4NNYA 4N2BA 4R7VA 5FKPB 4IDJH 3MRIB 3B2PA 4GS7B 4LOVA 2HVJB 5AOIA 4JKLA 4AG4L 3QPQD 1F90L 2DQDH 4H40A 4JHVA 2QKIC 3IDJA 4RDQG 4CKQA 3TO4C 1L9OA 3I4MG 4PJ6A 3RWFA 2E7HA 3N91A 4JE0A 2HMID 4OZHA 1IGJA 1UFUA 3I50L 3G6JB 5I1EH 3O9WA 4RAVA 5D1QE 4FZEH 2H9GB 4IGBB 4Z5RA 1N5YH 4PRIA 3RZCB 2JKIS 2X4OB 4OF6A 1GH7A 5D7LD 5I16B 4O4IF 4L5FH 5LXTF 2XN9E 1CE1H 4FXKA 5FUCC 4FI6A 1Q94B 4GH7B 2V9RA 4X98B 5C0BD 4U1NA 2X9WA 2Z8RA 5ICZB 1KEEA 4Y19D 5C0IB 4UMSA 3HRZA 2JIXA 2IPKA 1TMQA 4IU2A 5F1NB 3WIHH 4TUJB 3C2AL 3TO2A 2PXYD 2H8PB 4GSQA 1ZLVH 5D6DA 5MHSD 1BJTA 2IBGA 4NUGH 2CKZB 2R7ZA 1DVXA 43C9B 3VXQB 1I3GL 2VDLB 1YAZA 2YD7A 2KI6A 1S4IA 2GJZA 3IFNH 4KK5D 1TPXB 3EJZD 3KLKA 2QDWA 1FAKT 4MSWA 4PJ5A 4IIZA 4LEXL 2AEWA 5KG3A 4GW5A 1S10A 2WGXA 1UGNA 4R90H 4S11A 1T03H 4GFTB 3PXHA 3MJFA 4JUZA 5AW2B 2R7LA 1CI5A 4G43A 5JHBA 1AGBB 2OTWA 1D7BA 1UVQA 2PCFB 2WXQA 3CD4A 3ISRA 4LLAA 4NQEA 3QCUL 4NLGA 3V0FA 1D5IL 4LPVA 3LB6C 1OSZB 4LKCA 1U42A 2R29L 1CICB 3G6AA 4L9LA 4XE0A 3GZQA 4EFEA 1WLHA 3PW5A 4R7NA 4BQ9A 5DZJA 5CHNB 3FFCE 3LZQA 2P46B 4OZ4A 3OHXA 5DEFB 1GIGL 1CLYL 1I1YB 3RL2A 1JPGA 2VUYA 3QUXA 5K69A 3BRGC 5F1OB 1MG3C 4LF8H 4HIXL 3ERXA 1CB4A 2XPYA 3WENA 4RMQA 4UB0L 5T3XL 1HK6A 4LCUB 5HPMA 4HX1A 4XMWA 2ZSWA 4P9HH 5J1SC 5D4JA 1L4IA 4WD3A 2ORBH 5E6RB 1HHGB 5TH2A 4YVUA 2NRDA 1CD9B 1U92A 2ITFA 4HLZH 4PI0A 4WI4A 3RFZB 4U1MA 1VFBA 3WDHA 1SVZA 4X80H 4W9GC 3TA4D 1IGMH 1AG6A 2WUCL 4JJOA 4K7PH 1PY0A 5IMMB 2VISA 1SLXA 2Y07L 4C55A 3S4SA 3FCTA 1F42A 1KBLA 2ITEA 3IGLA 1M7UA 4W4NA 4WWID 2R87A 5ITBH 4OIAA 4HXBL 4Y5VC 1Y6KR 4XCCH 1RZIB 4YDIH 1K4DB 4TQHA 5DQJA 1DLHB 4JY4A 4HPHA 3SI8A 4S2SA 1TFHA 4HAGA 5CEZH 1XL6A 1ZV9A 5JH7F 3V5DB 1FORL 3A21A 3OF6A 1FO0B 4I0PC 1CXHA 1XH1A 4ZMQA 4JFEE 3N06B 3CN1A 5L9DH 1I1CA 1E8XA 1OOWA 4NERA 4O2EA 3L9RA 3GMPB 3OB8A 3R8QA 4PH8A 5FK9A 4C2MA 1B0GA 2VLKA 3MROA 5IHHA 2AK4D 3ZYJA 2DBLL 1FFRA 5KFVA 2DM2A 3G6XA 5JTWA 1EFXD 5IB5B 5F1SA 4GLXA 1FH2A 5CEXB 4TS6A 4FU0A 2FB9A 4KU1A 1TQCB 3IDYB 5CCKH 5ENWB 3BZEA 2DDQL 5B1AB 4NC1C 1J5IA 5A43C 5FYLE 1DJZA 3TC9A 4BZ2H 2YGNA 2XQYK 5CA1F 2WAQA 5PCYA 2W8KA 4LSSH 5C6TL 2GJJA 5HV6A 3P9MA 3D6GA 5KG9A 2BHYA 2IANA 2IGFH 5D2NB 2OWOA 4HETA 1SYVB 3TYGL 3V0WL 3W2DL 2C26A 4AL8C 5J12B 4MCZA 4F2MB 3ARSA 3QARA 3ZZQA 4JMNA 4B9IA 3BAJA 4OH2A 1T3FA 4NO5A 4AUYA 4BA0A 2O61A 5LCVH 3U0WH 2A83B 2Q7NA 4J2XA 4PRDB 3L7FB 1I53A 1MJ7H 5SWQA 4N0CC 2X9YA 4ZZFA 1I6UA 4LO9A 2QQKH 4N8CL 3AXLB 4DP0X 1IAIH 4MCMA 3VRJA 3GS0A 1SJXA 3PWJB 4D9QD 2DZEA 1M53A 5E6SB 3ZHFA 1J1PH 1KFAH 1AQKL 4JR9L 1HWWA 1MAKA 5E08L 3S96A 3T3MB 1AO7B 3I9AA 4UZSA 1SMDA 1OP5H 3NFPB 3ZRFC 2XN2A 5DRZA 2AVFA 2KZWA 3GMMB 4X5QA 1E7VA 4GRMB 1UT2A 2A9MH 1J5OL 1IVLA 5DK3A 1XCQA 3ROOB 2YSSA 4NS0A 1LK2B 4UT9L 3AUWB 5I8EB 1JAEA 2E56A 4HK0A 4HYTB 3TA3D 3BD5A 3D3VE 1DQQA 1RV6X 3PW0A 1CGWA 1BHGA 5C0CE 2NZ9C 1IGCH 4B7IA 1TZIB 3F83A 3K8LA 5GQBA 1IC4L 3TN0A 4YQXH 2AABH 3C5ZB 5HDWA 4NO0B 1WVZA 1N4XH 5DRXB 3INOA 1VZIA 4F2FA 4JV0A 1YMMD 1FNHA 4KDVA 3WFDL 4Z18A 4YAKB 2Q8AH 3U9WA 1OF2B 2WLIA 1AQMA 4L3AA 2MOGA 3ARWA 4U1KB 3MGTB 1JNHB 4KI1A 3CU1A 4OZGE 3BGFC 1GGBL 4IRJC 5EBMA 4Y9BA 2B0SL 5D72L 5HGDA 4AQAA 1BM3H 2CIKB 1A14L 2OL3L 4G11A 4TYUA 5DDHB 4NBZB 3ZDYB 2NU8B 3RWCB 4Q58C 4G1MB 5IMOA 3STLA 1R5WB 1ICTA 4TQRA 3G5VA 4AMXA 1ASQA 1BGXH 1KGIA 3T2OA 4OZIB 1T36A 4AGPA 4ECYA 1LVEA 3KLLA 4J3OD 3GMOA 3E8UH 4K9EC 2VXQA 2I9LB 4PJDB 5FYJL 1L7IL 4JRYA 1U8PA 4APQD 1E5AA 2V5YA 3MJ7A 3NEXA 4POUB 1CWVA 1WIPA 3HCVA 3N1GC 3I6LD 5EU6A 5KFGA 5A3ID 4PTUA 2GBVA 1HESA 5D4IA 5AKRA 5E2WL 1ILUA 3D85B 5F7KC 4ODHL 2G9HB 1GR7A 4X2UA 4EJ1C 1UXWB 5E9DE 3VQLA 3P4OA 1N34H 2FJFB 4LDOB 1XB8A