3N4SA

Structure of csm1 c-terminal domain, p21212 form
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
112
structure length
98
Chain Sequence
NSEVIKDLYEYLCNVRVHKSYEDSGLWFDISQGTDYSIMDYKLGFVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSLNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monopolin complex subunit CSM1
publication title The Monopolin Complex Crosslinks Kinetochore Components to Regulate Chromosome-Microtubule Attachments.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 25
structure length 98
sequence length 112
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3n4sA00
3N7NA 3N4RA 3N4SA 5KTBA 3N4XA
chains in the Genus database with same CATH superfamily
1QGNA 1IVRA 2VMVA 1RVUA 3PJ0A 4OYTA 1RV4A 2GMUA 5DJ9A 5EUEA 4IXZA 1TOEA 1SZUA 4W1XA 1QJ5A 2HZPA 4CXQA 3FVSA 1Z7DA 3JW9A 3PDBA 1ARTA 4ZLVA 1ARHA 1WYVA 1CZCA 2VI9A 5HDMA 1W7LA 3N4RA 2W7JA 3K7YA 1DJEA 2D66A 1AJSA 3M5UA 2OKKA 1YJZA 2D63A 1YOOA 4CVQA 3HLMA 3HL2A 2QMAA 4JEWA 1GEWA 1CQ7A 1TARA 4XEWA 4KYOA 3E6GA 2PB2A 1OHYA 1AY4A 3B46A 2Z9VA 3EI5A 1MLZA 1BKGA 1S07A 1CL2A 2CJGA 4F5MA 3TFTA 1AMQA 3FFHA 1AKAA 1AAMA 1IX8A 2KFPA 4GSAA 1MLYA 2W7EA 1BW0A 1IBJA 2W8WA 4E3RA 4GDYA 4KXKA 1D2FA 4R5FA 4PFFA 4IW7A 2QA3A 3T32A 3RCHB 3FDDA 4TN4A 3N75A 3VK2A 5HXXA 4NOGA 3BCXA 2VYCA 3WGCA 4GEBA 4XJMA 3WLXA 4ZM3A 2R5EA 5E3KA 1TOJA 5EAAA 1V2FA 2HORA 3PD6B 1CL1A 1IAYA 2AY2A 2FQ6A 1ZOBA 2EGYA 4ZSWA 1C7GA 1BJNA 1JS6A 2X3LA 3FRKA 5JAYA 3DODA 4XAUA 3DXWA 4E1OA 5EIGA 1V72A 4GE4A 4JEVA 4ITXA 2R5CA 2HP2A 2CSTA 4L0OA 1RV3A 2O1BA 3LVKA 3ZRQA 5F9SA 1AICA 4M2MA 2C7TA 2CANA 3NYTA 4WYEA 3WY7A 5G4JA 1AMSA 1X28A 2VMYA 4UQVA 2CH2A 4J8LA 2AY8A 4Y0HA 1CQ6A 1H1CA 1YIZA 4W91A 4M2KA 4RKCA 1CQ8A 4W1WA 3BCAA 2QBTA 4IXSA 2VMXA 3CQ5A 1LW5A 1XEYA 1J32A 4U2HA 1VP4A 4W1VA 1AY8A 1GC3A 4F4EA 2G6WA 1SZKA 3BV0A 4IYOA 3ASBA 3DR4A 2EZ1A 3A9ZA 1QITA 2CINA 3N0LA 5EUDA 4F5FA 2CB1A 1MAQA 3AEPA 1IJIA 3BWOA 2W7MA 1BJOB 1AHXA 1AKBA 3E2ZA 2YKYA 3JWBA 4HVKA 5BJ4A 2ZYJA 3PDXA 3NU8A 1UU1A 3N5MA 5G2PA 3VOMA 2RFVA 5K8BA 1X2AA 2VGUA 3LVLB 3N4SA 3OP7A 3RBLA 3AV7A 2GSAA 4LNMA 3KGXA 1M0OA 4ADEA 1YNUA 4ZASA 2O0RA 4WXFA 3PDBB 2VGSA 1WYVB 3R9AA 2VLHA 2WKAA 1B9HA 1GBNA 1IX6A 1W7MA 3CBFA 1S0AA 1B5PA 3HQTA 2W8VA 4ATPA 5FT5A 1MDOA 1N31A 1BT4A 4MY5A 1S08A 4PFNA 1M32A 3MEBA 3HDOA 1N8PA 3BN1A 4F5IA 3DYDA 3P1TA 1ARGA 1TOIA 4MSOA 3G7QA 3QHXA 2DOUA 2BWPA 2OATA 3G0TA 2AY5A 1ARSA 2W8TA 1PMMA 1ASBA 3CAIA 2JJFA 3DC1A 5FT8A 1O4SA 4EB7A 5G2QA 1YJYA 2QLRA 1T3IA 3GETA 2HOXA 3R4TA 4M2JA 1ASEA 3AOVA 4WYGA 4DBCA 2OGAA 1AKCA 2VIBA 3NX3A 1DJUA 4MQRA 2W7LA 2WK9A 1KL1A 2EH6A 3QN6A 1BJ4A 2D7ZA 3DXVA 3MAUA 3ZZKA 1LW4A 2JJEA 3DZZA 1WYUA 1X29A 3A9YA 1CS1A 3HVYA 2AEUA 3L44A 3PGYA 4R2NA 4F5JA 4F5LA 3ATHA 1AHFA 2VMPA 1U08A 3LV2A 2YKUA 3Q8NA 4JEZA 4AH3A 1GEYA 4DGTA 3RI6A 4WP0A 1QZ9A 3BS8A 2ZSMA 1VJOA 2BI1A 8AATA 1ECXA 7AATA 2W7IA 4CXRA 5G09A 1CJ0A 2FKIA 3IHJA 4WLHA 1QJ3A 1UU2A 2VMTA 4ZSYA 1DFOA 1AMRA 1AX4A 2R0TA 1EJIA 3NRAA 4WYCA 1MDXA 3FZ8A 5EIGB 3FTBA 4DQ6A 2JG2A 2R5CB 3BWNC 1TOGA 2F8JA 3FQAA 3BWNA 4LNJA 3ELPA 3MAFA 3GZDC 1B8GA 3FD0A 3GZDA 4OMAA 2W7FA 4AOAA 2JISA 2BYLA 2XH1A 3B1EA 3GR9A 2BI5A 1DGDA 9AATA 1I41A 1ASMA 1M7YA 1YAAA 2ZC0A 3I16A 4FFCA 4ITGA 4MQQA 1G4VA 1LC7A 3GBXA 3JWAA 1ASAA 1IAXA 1KAFA 2AY6A 4BQ0A 1Z3ZA 2GB3A 1C4KA 2BI9A 4IYOB 1AHYA 2BI2A 5G4IA 2DGMA 2YCTA 2VGVA 3E2FA 3H9XA 3EIBA 2EO5A 4AZJA 2CJDA 2PO3A 1GDEA 2ORDA 1PFFA 2W7HA 2CJHA 3N7NA 1AHEA 3I4JA 3TCMA 4PVFA 2AY4A 4A6TA 3FVXA 4RLGA 4RJ0A 2AY9A 4LW4A 3WCOA 1J04A 1JS3A 4IX8A 2OQXA 2CY8A 3DRDA 4UHNA 1LC8A 4XK1A 3AEMA 3ECDA 2ZY5A 3K28A 4AZKA 2CFBA 2GMSA 4XQ2A 3VK4A 2FM1A 3EUCA 1W23A 3DR7A 2Z9UA 2R2NA 4R5ZA 3TQXA 3D6KA 1M4NA 2JJGA 3EZSA 1WYTA 2HUFA 3GWPA 2VLFA 1RVYA 5M46A 4H63Q 3LG0A 4LNLA 3QBOA 2BKWA 3W1HA 4HF8A 1O61A 3FCRA 1W3UA 2C44A 4OT8A 1G7XA 3USFA 1ZC9A 5I92A 4JF0A 2BI3A 4AO9A 4WYAA 1O69A 4ADCA 1LK9A 2ZJGA 1D7UA 1SZSA 3FFRA 3GSBA 3NU7A 2V0YA 1GC2A 3A2BA 3CQ6A 2PB0A 4GE7A 4F5HA 3A8UX 2AY1A 1KMKA 4U1TA 4N0WA 4JF1A 2Z1ZA 4XJOA 4UOYA 2O7CA 4A0GA 1AIAA 1ASNA 1M6SA 2ZSLA 2A1VA 3F6TA 2JGTA 1WYUB 1X0MA 2Z20A 1ASGA 1TOKA 2DGKA 1D7SA 1KKJA 1ORDA 3EI7A 1G4XA 2YRIA 3H7FA 3HBXA 2ZY3A 2QB2A 4TMRA 4ZAHA 1OXOA 4WYFA 5EUNA 3EIAA 4GE9A 5HHYA 3AELA 4OCAA 5E5IA 2CH1A 4BA5A 1E5FA 1SFFA 4LC3A 4BMKA 2Z9XA 4ADBA 1AJRA 1B4XA 3PIUA 3FKDA 2FNUA 1MDZA 1SVVA 3UE8A 1B9IA 3MC6C 4JEXA 3ISLA 1XI9A 3MAFB 1AJSB 3GZCA 3MC6A 3RUYA 3DU4A 2BIAA 3BC8A 2D64A 3K40A 3TATA 4Q75A 3VAXA 1WKHA 2YCNA 5AX8A 2D7YA 3E9KA 3UWCA 3FDBA 1QIRA 2YRRA 1EQBA 4A0RA 4EFFA 4WB0A 1MAPA 2W8JA 3UAKA 2WK7A 1BS0A 1AHGA 2GQNA 3A9XA 2WB6A 1B5OA 2DGLA 2HOZA 2W7GA 2VMUA 3JTXA 2W7DA 2BHXA 3AENA 3QGUA 4W8IA 4A0HA 4K2IA 1WSTA 4RITA 3QM2A 4MKJA 3F0HA 3ASAA 2VMNA 5G0AA 5E4ZA 1JG8A 1S06A 2EZ2A 2JJHA 1DKAA 2VMRA 2DR1A 1V2DA 3NNKA 3I5TA 1MGVA 4PIWA 2E7JA 1I29A 4ZM4A 1GC4A 2QSRA 2VMOA 3RQ1A 3II0A 4UHOA 3VP6A 4A72A 1C7OA 4CBRA 2OGEA 3MBBA 4WBTA 3BCBA 3F9TA 4ZDPA 2ZY2A 2FNIA 2D65A 4Y0DA 2VGZA 3FQ7A 1LS3A 1TATA 3WZFA 3ACZA 1FG7A 2X8UA 1FC4A 2YHKA 4KAMA 1IUGA 4EU1A 5DX5A 1ASCA 4WYDA 4GRXA 1AMAA 4BHDA 1UKJA 4Y0IA 1M0NA 3ZRPA 3AEOA 3WX9A 4XJLA 1DJ9A 4WLJA 4P7YA 2EPJA 2EYQA 3WKRA 2YKVA 3FVUA 1QISA 5EQCA 3ZZJA 3N4XA 3FQ8A 3NDNA 2Z1YA 1I43A 4W5KA 4P3MA 1YJSA 2TPLA 5D95A 2VMSA 2HOYA 4RKDA 1C9CA 1S09A 3KGWA 2VMZA 2ZY4A 4QGRA 2V1PA 2NMPA 4A6UA 2BWOA 2X5DA 2XBNA 3WGBA 3E2ZB 3OKSA 4EMYA 1OHWA 5D5SA 1ASLA 5FT4A 1LKCA 2BIEA 3NUBA 1TASA 5TF5A 1D7VA 1SF2A 1ELUA 1GCKA 2D5YA 2Q7WA 2C81A 4ZDOA 1V2EA 5C6UA 2QB3A 3AEMC 3EI6A 1ASDA 5DB5A 4IY7A 1JF9A 1C7NA 3AATA 2E54A 3LVMA 4ADDA 1G7WA 4K2BA 4F5GA 4ISYA 1ELQA 3VK3A 4ZWVA 2WK8A 1PG8A 3B1CA 3HMUA 4B9BA 2CTZA 4A00A 3AOWA 4R8DA 1VEFA 1BQDA 5BJ3A 1W7NA 4B98A 2AY7A 1DGEA 2C0RA 1GC0A 3PAAA 2HUIA 5DJ1A 2Z9WA 2DKJA 3RBFA 4A6RA 4EB5A 1BJWA 4CBSA 4WB0B 1DTYA 3B1DA 4F5KA 1OHVA 5IWQA 3LWSA 1C0NA 1LC5A 4H51A 4IXOA 4OTLA 2VMWA 4RM1A 4ATQA 3AENB 3JZLA 3WCNA 2FYFA 3NUIA 2HUUA 4FL0A 4E3QA 3LY1A 1D7RA 5M49A 4WXBA 5EFSA 4ZWMA 1YIYA 1OATA 5KTBA 2ZUKA 2VI8A 2HP1A 2VGTA 5J8QA 1BQAA 4OC9A 4RIZA 4RAEA 4WD2A 1ZODA 2AATA 4K05A 1GD9A 2BWNA 2E7UA 1WKGA 2OKJA 1FG3A 1IX7A 2YKXA 3BB8A 2YOBA 4JEYA 5FT6A 3L8AA 3RCHA 1N2TA 3MKJA 3MADA 1KMJA 4OBVA 5EAVA 3QPGA 3P6KA 1I48A 1UU0A 3E2YA 4MQPA 4LW2A 1AY5A 4ZDLA 3W1JA 3PD6A 4AO4A 3PPLA 4BA4A 1GEXA 1O62A 1TPLA 2VMQA 3FZ6A 2X5FA 1E5EA 3NTJA 5M4BA 4OBUA 1SPAA 3QI6A 2AEVA 2D61A 4A0FA 2E7IA 3WKSA 2VIAA 4MKKA 1AAWA 2AY3A 3CQ4A 3GJUA 1OXPA 4Q6RA 3B8XA 4Q76A 3AEJC 3KE3A 3AEJA 3COGA 3FZ7A 4E77A 4UHMA 1KL2A 1CZEA 1EG5A 1H0CA 4WXGA 3PA9A 3TFUA 5M4DA 4I8AA 3W1IA 3ZRRA 1M0PA 2YCPA 3EI9A 3NYSA 3LVJA 4O6ZA 2G7JA 2FN6A 1P3WA 2W8UA 3NYUA 1PMOA 2BYJA 3EI8A 3FSLA 1AIBA 5F8VA 1M0QA 1ARIA 3KKIA 1ASFA 2W7KA 4RJYA 2VGWA 2DKBA 3ELEA 3HT4A 1KKPA 3E77A 3EZ1A 4Q31A 4XJPA 1BJOA 1WYTB 1Y4IA 4J5UA 2Z61A 3G8MA 2ZP7A 4K2MA 2BIGA
chains in the Genus database with same CATH topology
1QGNA 1IVRA 2VMVA 1RVUA 3PJ0A 4OYTA 1RV4A 2GMUA 5DJ9A 5EUEA 4IXZA 1TOEA 1SZUA 4W1XA 1QJ5A 2HZPA 4CXQA 3FVSA 1Z7DA 3JW9A 3PDBA 1ARTA 4ZLVA 1ARHA 1WYVA 1CZCA 2VI9A 5HDMA 1W7LA 3N4RA 2W7JA 3K7YA 1DJEA 2D66A 1AJSA 3M5UA 2OKKA 1YJZA 2D63A 1YOOA 4CVQA 3HLMA 3HL2A 2QMAA 4JEWA 1GEWA 1CQ7A 1TARA 4XEWA 4KYOA 3E6GA 2PB2A 1OHYA 1AY4A 3B46A 2Z9VA 3EI5A 1MLZA 1BKGA 1S07A 1CL2A 2CJGA 4F5MA 3TFTA 1AMQA 3FFHA 1AKAA 1AAMA 1IX8A 2KFPA 4GSAA 1MLYA 2W7EA 1BW0A 1IBJA 2W8WA 4E3RA 4GDYA 4KXKA 1D2FA 4R5FA 4PFFA 4IW7A 2QA3A 3T32A 3RCHB 3FDDA 4TN4A 3N75A 3VK2A 5HXXA 4NOGA 3BCXA 2VYCA 3WGCA 4GEBA 4XJMA 3WLXA 4ZM3A 2R5EA 5E3KA 1TOJA 5EAAA 1V2FA 2HORA 3PD6B 1CL1A 1IAYA 2AY2A 2FQ6A 1ZOBA 2EGYA 4ZSWA 1C7GA 1BJNA 1JS6A 2X3LA 3FRKA 5JAYA 3DODA 4XAUA 3DXWA 4E1OA 5EIGA 1V72A 4GE4A 4JEVA 4ITXA 2R5CA 2HP2A 2CSTA 4L0OA 1RV3A 2O1BA 3LVKA 3ZRQA 5F9SA 1AICA 4M2MA 2C7TA 2CANA 3NYTA 4WYEA 3WY7A 5G4JA 1AMSA 1X28A 2VMYA 4UQVA 2CH2A 4J8LA 2AY8A 4Y0HA 1CQ6A 1H1CA 1YIZA 4W91A 4M2KA 4RKCA 1CQ8A 4W1WA 3BCAA 2QBTA 4IXSA 2VMXA 3CQ5A 1LW5A 1XEYA 1J32A 4U2HA 1VP4A 4W1VA 1AY8A 1GC3A 4F4EA 2G6WA 1SZKA 3BV0A 4IYOA 3ASBA 3DR4A 2EZ1A 3A9ZA 1QITA 2CINA 3N0LA 5EUDA 4F5FA 2CB1A 1MAQA 3AEPA 1IJIA 3BWOA 2W7MA 1BJOB 1AHXA 1AKBA 3E2ZA 2YKYA 3JWBA 4HVKA 5BJ4A 2ZYJA 3PDXA 3NU8A 1UU1A 3N5MA 5G2PA 3VOMA 2RFVA 5K8BA 1X2AA 2VGUA 3LVLB 3N4SA 3OP7A 3RBLA 3AV7A 2GSAA 4LNMA 3KGXA 1M0OA 4ADEA 1YNUA 4ZASA 2O0RA 4WXFA 3PDBB 2VGSA 1WYVB 3R9AA 2VLHA 2WKAA 1B9HA 1GBNA 1IX6A 1W7MA 3CBFA 1S0AA 1B5PA 3HQTA 2W8VA 4ATPA 5FT5A 1MDOA 1N31A 1BT4A 4MY5A 1S08A 4PFNA 1M32A 3MEBA 3HDOA 1N8PA 3BN1A 4F5IA 3DYDA 3P1TA 1ARGA 1TOIA 4MSOA 3G7QA 3QHXA 2DOUA 2BWPA 2OATA 3G0TA 2AY5A 1ARSA 2W8TA 1PMMA 1ASBA 3CAIA 2JJFA 3DC1A 5FT8A 1O4SA 4EB7A 5G2QA 1YJYA 2QLRA 1T3IA 3GETA 2HOXA 3R4TA 4M2JA 1ASEA 3AOVA 4WYGA 4DBCA 2OGAA 1AKCA 2VIBA 3NX3A 1DJUA 4MQRA 2W7LA 2WK9A 1KL1A 2EH6A 3QN6A 1BJ4A 2D7ZA 3DXVA 3MAUA 3ZZKA 1LW4A 2JJEA 3DZZA 1WYUA 1X29A 3A9YA 1CS1A 3HVYA 2AEUA 3L44A 3PGYA 4R2NA 4F5JA 4F5LA 3ATHA 1AHFA 2VMPA 1U08A 3LV2A 2YKUA 3Q8NA 4JEZA 4AH3A 1GEYA 4DGTA 3RI6A 4WP0A 1QZ9A 3BS8A 2ZSMA 1VJOA 2BI1A 8AATA 1ECXA 7AATA 2W7IA 4CXRA 5G09A 1CJ0A 2FKIA 3IHJA 4WLHA 1QJ3A 1UU2A 2VMTA 4ZSYA 1DFOA 1AMRA 1AX4A 2R0TA 1EJIA 3NRAA 4WYCA 1MDXA 3FZ8A 5EIGB 3FTBA 4DQ6A 2JG2A 2R5CB 3BWNC 1TOGA 2F8JA 3FQAA 3BWNA 4LNJA 3ELPA 3MAFA 3GZDC 1B8GA 3FD0A 3GZDA 4OMAA 2W7FA 4AOAA 2JISA 2BYLA 2XH1A 3B1EA 3GR9A 2BI5A 1DGDA 9AATA 1I41A 1ASMA 1M7YA 1YAAA 2ZC0A 3I16A 4FFCA 4ITGA 4MQQA 1G4VA 1LC7A 3GBXA 3JWAA 1ASAA 1IAXA 2AY6A 4BQ0A 1Z3ZA 2GB3A 1C4KA 2BI9A 4IYOB 1AHYA 2BI2A 5G4IA 2DGMA 2YCTA 2VGVA 3E2FA 3H9XA 3EIBA 2EO5A 4AZJA 2CJDA 2PO3A 1GDEA 2ORDA 1PFFA 2W7HA 2CJHA 3N7NA 1AHEA 3I4JA 3TCMA 4PVFA 2AY4A 4A6TA 3FVXA 4RLGA 4RJ0A 2AY9A 4LW4A 3WCOA 1J04A 1JS3A 4IX8A 2OQXA 2CY8A 3DRDA 4UHNA 1LC8A 4XK1A 3AEMA 3ECDA 2ZY5A 3K28A 4AZKA 2CFBA 2GMSA 4XQ2A 3VK4A 2FM1A 3EUCA 1W23A 3DR7A 2Z9UA 2R2NA 4R5ZA 3TQXA 3D6KA 1M4NA 2JJGA 3EZSA 1WYTA 2HUFA 3GWPA 2VLFA 1RVYA 5M46A 4H63Q 3LG0A 4LNLA 3QBOA 2BKWA 3W1HA 4HF8A 1O61A 3FCRA 1W3UA 2C44A 4OT8A 1G7XA 3USFA 1ZC9A 5I92A 4JF0A 2BI3A 4AO9A 4WYAA 1O69A 4ADCA 1LK9A 2ZJGA 1D7UA 1SZSA 3FFRA 3GSBA 3NU7A 2V0YA 1GC2A 3A2BA 3CQ6A 2PB0A 4GE7A 4F5HA 3A8UX 2AY1A 1KMKA 4U1TA 4N0WA 4JF1A 2Z1ZA 4XJOA 4UOYA 2O7CA 4A0GA 1AIAA 1ASNA 1M6SA 2ZSLA 2A1VA 3F6TA 2JGTA 1WYUB 1X0MA 2Z20A 1ASGA 1TOKA 2DGKA 1D7SA 1KKJA 1ORDA 3EI7A 1G4XA 2YRIA 3H7FA 3HBXA 2ZY3A 2QB2A 4TMRA 4ZAHA 1OXOA 4WYFA 5EUNA 3EIAA 4GE9A 5HHYA 3AELA 4OCAA 5E5IA 2CH1A 4BA5A 1E5FA 1SFFA 4LC3A 4BMKA 2Z9XA 4ADBA 1AJRA 1B4XA 3PIUA 3FKDA 2FNUA 1MDZA 1SVVA 3UE8A 1B9IA 3MC6C 4JEXA 3ISLA 1XI9A 3MAFB 1AJSB 3GZCA 3MC6A 3RUYA 3DU4A 2BIAA 3BC8A 2D64A 3K40A 3TATA 4Q75A 3VAXA 1WKHA 2YCNA 5AX8A 2D7YA 3E9KA 3UWCA 3FDBA 1QIRA 2YRRA 1EQBA 4A0RA 4EFFA 4WB0A 1MAPA 2W8JA 3UAKA 2WK7A 1BS0A 1AHGA 2GQNA 3A9XA 2WB6A 1B5OA 2DGLA 2HOZA 2W7GA 2VMUA 3JTXA 2W7DA 2BHXA 3AENA 3QGUA 4W8IA 4A0HA 4K2IA 1WSTA 4RITA 3QM2A 4MKJA 3F0HA 3ASAA 2VMNA 5G0AA 5E4ZA 1JG8A 1S06A 2EZ2A 2JJHA 1DKAA 2VMRA 2DR1A 1V2DA 3NNKA 3I5TA 1MGVA 4PIWA 2E7JA 1I29A 4ZM4A 1GC4A 2QSRA 2VMOA 3RQ1A 3II0A 4UHOA 3VP6A 4A72A 1C7OA 4CBRA 2OGEA 3MBBA 4WBTA 3BCBA 3F9TA 4ZDPA 2ZY2A 2FNIA 2D65A 4Y0DA 2VGZA 3FQ7A 1LS3A 1TATA 3WZFA 3ACZA 1FG7A 2X8UA 1FC4A 2YHKA 4KAMA 1IUGA 4EU1A 5DX5A 1ASCA 4WYDA 4GRXA 1AMAA 4BHDA 1UKJA 4Y0IA 1M0NA 3ZRPA 3AEOA 3WX9A 4XJLA 1DJ9A 4WLJA 4P7YA 2EPJA 2EYQA 3WKRA 2YKVA 3FVUA 1QISA 5EQCA 3ZZJA 3N4XA 3FQ8A 3NDNA 2Z1YA 1I43A 4W5KA 4P3MA 1YJSA 2TPLA 5D95A 2VMSA 2HOYA 4RKDA 1C9CA 1S09A 3KGWA 2VMZA 2ZY4A 4QGRA 2V1PA 2NMPA 4A6UA 2BWOA 2X5DA 2XBNA 3WGBA 3E2ZB 3OKSA 4EMYA 1OHWA 5D5SA 1ASLA 5FT4A 1LKCA 2BIEA 3NUBA 1TASA 5TF5A 1D7VA 1SF2A 1ELUA 1GCKA 2D5YA 2Q7WA 2C81A 4ZDOA 1V2EA 5C6UA 2QB3A 3AEMC 3EI6A 1ASDA 5DB5A 4IY7A 1JF9A 1C7NA 3AATA 2E54A 3LVMA 4ADDA 1G7WA 4K2BA 4F5GA 4ISYA 1ELQA 3VK3A 4ZWVA 2WK8A 1PG8A 3B1CA 3HMUA 4B9BA 2CTZA 4A00A 3AOWA 4R8DA 1VEFA 1BQDA 5BJ3A 1W7NA 4B98A 2AY7A 1DGEA 2C0RA 1GC0A 3PAAA 2HUIA 5DJ1A 2Z9WA 2DKJA 3RBFA 4A6RA 4EB5A 1BJWA 4CBSA 4WB0B 1DTYA 3B1DA 4F5KA 1OHVA 5IWQA 3LWSA 1C0NA 1LC5A 4H51A 4IXOA 4OTLA 2VMWA 4RM1A 4ATQA 3AENB 3JZLA 3WCNA 2FYFA 3NUIA 2HUUA 4FL0A 4E3QA 3LY1A 1D7RA 5M49A 4WXBA 5EFSA 4ZWMA 1YIYA 1OATA 5KTBA 2ZUKA 2VI8A 2HP1A 2VGTA 5J8QA 1BQAA 4OC9A 4RIZA 4RAEA 4WD2A 1ZODA 2AATA 4K05A 1GD9A 2BWNA 2E7UA 1WKGA 2OKJA 1FG3A 1IX7A 2YKXA 3BB8A 2YOBA 4JEYA 5FT6A 3L8AA 3RCHA 1N2TA 3MKJA 3MADA 1KMJA 4OBVA 5EAVA 3QPGA 3P6KA 1I48A 1UU0A 3E2YA 4MQPA 4LW2A 1AY5A 4ZDLA 3W1JA 3PD6A 4AO4A 3PPLA 4BA4A 1GEXA 1O62A 1TPLA 2VMQA 3FZ6A 2X5FA 1E5EA 3NTJA 5M4BA 4OBUA 1SPAA 3QI6A 2AEVA 2D61A 4A0FA 2E7IA 3WKSA 2VIAA 4MKKA 1AAWA 2AY3A 3CQ4A 3GJUA 1OXPA 4Q6RA 3B8XA 4Q76A 3AEJC 3KE3A 3AEJA 3COGA 3FZ7A 4E77A 4UHMA 1KL2A 1CZEA 1EG5A 1H0CA 4WXGA 3PA9A 3TFUA 5M4DA 4I8AA 3W1IA 3ZRRA 1M0PA 2YCPA 3EI9A 3NYSA 3LVJA 4O6ZA 2G7JA 2FN6A 1P3WA 2W8UA 3NYUA 1PMOA 2BYJA 3EI8A 3FSLA 1AIBA 5F8VA 1M0QA 1ARIA 3KKIA 1ASFA 2W7KA 4RJYA 2VGWA 2DKBA 3ELEA 3HT4A 1KKPA 3E77A 3EZ1A 4Q31A 4XJPA 1BJOA 1WYTB 1Y4IA 4J5UA 2Z61A 3G8MA 2ZP7A 4K2MA 2BIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N7N A;  3N4R A;  3N4S A;  5KTB A;  3N4X A; 
#chains in the Genus database with same CATH topology
 1QGN A;  1IVR A;  2VMV A;  1RVU A;  3PJ0 A;  4OYT A;  1RV4 A;  2GMU A;  5DJ9 A;  5EUE A;  4IXZ A;  1TOE A;  1SZU A;  4W1X A;  1QJ5 A;  2HZP A;  4CXQ A;  3FVS A;  1Z7D A;  3JW9 A;  3PDB A;  1ART A;  4ZLV A;  1ARH A;  1WYV A;  1CZC A;  2VI9 A;  5HDM A;  1W7L A;  3N4R A;  2W7J A;  3K7Y A;  1DJE A;  2D66 A;  1AJS A;  3M5U A;  2OKK A;  1YJZ A;  2D63 A;  1YOO A;  4CVQ A;  3HLM A;  3HL2 A;  2QMA A;  4JEW A;  1GEW A;  1CQ7 A;  1TAR A;  4XEW A;  4KYO A;  3E6G A;  2PB2 A;  1OHY A;  1AY4 A;  3B46 A;  2Z9V A;  3EI5 A;  1MLZ A;  1BKG A;  1S07 A;  1CL2 A;  2CJG A;  4F5M A;  3TFT A;  1AMQ A;  3FFH A;  1AKA A;  1AAM A;  1IX8 A;  2KFP A;  4GSA A;  1MLY A;  2W7E A;  1BW0 A;  1IBJ A;  2W8W A;  4E3R A;  4GDY A;  4KXK A;  1D2F A;  4R5F A;  4PFF A;  4IW7 A;  2QA3 A;  3T32 A;  3RCH B;  3FDD A;  4TN4 A;  3N75 A;  3VK2 A;  5HXX A;  4NOG A;  3BCX A;  2VYC A;  3WGC A;  4GEB A;  4XJM A;  3WLX A;  4ZM3 A;  2R5E A;  5E3K A;  1TOJ A;  5EAA A;  1V2F A;  2HOR A;  3PD6 B;  1CL1 A;  1IAY A;  2AY2 A;  2FQ6 A;  1ZOB A;  2EGY A;  4ZSW A;  1C7G A;  1BJN A;  1JS6 A;  2X3L A;  3FRK A;  5JAY A;  3DOD A;  4XAU A;  3DXW A;  4E1O A;  5EIG A;  1V72 A;  4GE4 A;  4JEV A;  4ITX A;  2R5C A;  2HP2 A;  2CST A;  4L0O A;  1RV3 A;  2O1B A;  3LVK A;  3ZRQ A;  5F9S A;  1AIC A;  4M2M A;  2C7T A;  2CAN A;  3NYT A;  4WYE A;  3WY7 A;  5G4J A;  1AMS A;  1X28 A;  2VMY A;  4UQV A;  2CH2 A;  4J8L A;  2AY8 A;  4Y0H A;  1CQ6 A;  1H1C A;  1YIZ A;  4W91 A;  4M2K A;  4RKC A;  1CQ8 A;  4W1W A;  3BCA A;  2QBT A;  4IXS A;  2VMX A;  3CQ5 A;  1LW5 A;  1XEY A;  1J32 A;  4U2H A;  1VP4 A;  4W1V A;  1AY8 A;  1GC3 A;  4F4E A;  2G6W A;  1SZK A;  3BV0 A;  4IYO A;  3ASB A;  3DR4 A;  2EZ1 A;  3A9Z A;  1QIT A;  2CIN A;  3N0L A;  5EUD A;  4F5F A;  2CB1 A;  1MAQ A;  3AEP A;  1IJI A;  3BWO A;  2W7M A;  1BJO B;  1AHX A;  1AKB A;  3E2Z A;  2YKY A;  3JWB A;  4HVK A;  5BJ4 A;  2ZYJ A;  3PDX A;  3NU8 A;  1UU1 A;  3N5M A;  5G2P A;  3VOM A;  2RFV A;  5K8B A;  1X2A A;  2VGU A;  3LVL B;  3N4S A;  3OP7 A;  3RBL A;  3AV7 A;  2GSA A;  4LNM A;  3KGX A;  1M0O A;  4ADE A;  1YNU A;  4ZAS A;  2O0R A;  4WXF A;  3PDB B;  2VGS A;  1WYV B;  3R9A A;  2VLH A;  2WKA A;  1B9H A;  1GBN A;  1IX6 A;  1W7M A;  3CBF A;  1S0A A;  1B5P A;  3HQT A;  2W8V A;  4ATP A;  5FT5 A;  1MDO A;  1N31 A;  1BT4 A;  4MY5 A;  1S08 A;  4PFN A;  1M32 A;  3MEB A;  3HDO A;  1N8P A;  3BN1 A;  4F5I A;  3DYD A;  3P1T A;  1ARG A;  1TOI A;  4MSO A;  3G7Q A;  3QHX A;  2DOU A;  2BWP A;  2OAT A;  3G0T A;  2AY5 A;  1ARS A;  2W8T A;  1PMM A;  1ASB A;  3CAI A;  2JJF A;  3DC1 A;  5FT8 A;  1O4S A;  4EB7 A;  5G2Q A;  1YJY A;  2QLR A;  1T3I A;  3GET A;  2HOX A;  3R4T A;  4M2J A;  1ASE A;  3AOV A;  4WYG A;  4DBC A;  2OGA A;  1AKC A;  2VIB A;  3NX3 A;  1DJU A;  4MQR A;  2W7L A;  2WK9 A;  1KL1 A;  2EH6 A;  3QN6 A;  1BJ4 A;  2D7Z A;  3DXV A;  3MAU A;  3ZZK A;  1LW4 A;  2JJE A;  3DZZ A;  1WYU A;  1X29 A;  3A9Y A;  1CS1 A;  3HVY A;  2AEU A;  3L44 A;  3PGY A;  4R2N A;  4F5J A;  4F5L A;  3ATH A;  1AHF A;  2VMP A;  1U08 A;  3LV2 A;  2YKU A;  3Q8N A;  4JEZ A;  4AH3 A;  1GEY A;  4DGT A;  3RI6 A;  4WP0 A;  1QZ9 A;  3BS8 A;  2ZSM A;  1VJO A;  2BI1 A;  8AAT A;  1ECX A;  7AAT A;  2W7I A;  4CXR A;  5G09 A;  1CJ0 A;  2FKI A;  3IHJ A;  4WLH A;  1QJ3 A;  1UU2 A;  2VMT A;  4ZSY A;  1DFO A;  1AMR A;  1AX4 A;  2R0T A;  1EJI A;  3NRA A;  4WYC A;  1MDX A;  3FZ8 A;  5EIG B;  3FTB A;  4DQ6 A;  2JG2 A;  2R5C B;  3BWN C;  1TOG A;  2F8J A;  3FQA A;  3BWN A;  4LNJ A;  3ELP A;  3MAF A;  3GZD C;  1B8G A;  3FD0 A;  3GZD A;  4OMA A;  2W7F A;  4AOA A;  2JIS A;  2BYL A;  2XH1 A;  3B1E A;  3GR9 A;  2BI5 A;  1DGD A;  9AAT A;  1I41 A;  1ASM A;  1M7Y A;  1YAA A;  2ZC0 A;  3I16 A;  4FFC A;  4ITG A;  4MQQ A;  1G4V A;  1LC7 A;  3GBX A;  3JWA A;  1ASA A;  1IAX A;  1KAF A;  2AY6 A;  4BQ0 A;  1Z3Z A;  2GB3 A;  1C4K A;  2BI9 A;  4IYO B;  1AHY A;  2BI2 A;  5G4I A;  2DGM A;  2YCT A;  2VGV A;  3E2F A;  3H9X A;  3EIB A;  2EO5 A;  4AZJ A;  2CJD A;  2PO3 A;  1GDE A;  2ORD A;  1PFF A;  2W7H A;  2CJH A;  3N7N A;  1AHE A;  3I4J A;  3TCM A;  4PVF A;  2AY4 A;  4A6T A;  3FVX A;  4RLG A;  4RJ0 A;  2AY9 A;  4LW4 A;  3WCO A;  1J04 A;  1JS3 A;  4IX8 A;  2OQX A;  2CY8 A;  3DRD A;  4UHN A;  1LC8 A;  4XK1 A;  3AEM A;  3ECD A;  2ZY5 A;  3K28 A;  4AZK A;  2CFB A;  2GMS A;  4XQ2 A;  3VK4 A;  2FM1 A;  3EUC A;  1W23 A;  3DR7 A;  2Z9U A;  2R2N A;  4R5Z A;  3TQX A;  3D6K A;  1M4N A;  2JJG A;  3EZS A;  1WYT A;  2HUF A;  3GWP A;  2VLF A;  1RVY A;  5M46 A;  4H63 Q;  3LG0 A;  4LNL A;  3QBO A;  2BKW A;  3W1H A;  4HF8 A;  1O61 A;  3FCR A;  1W3U A;  2C44 A;  4OT8 A;  1G7X A;  3USF A;  1ZC9 A;  5I92 A;  4JF0 A;  2BI3 A;  4AO9 A;  4WYA A;  1O69 A;  4ADC A;  1LK9 A;  2ZJG A;  1D7U A;  1SZS A;  3FFR A;  3GSB A;  3NU7 A;  2V0Y A;  1GC2 A;  3A2B A;  3CQ6 A;  2PB0 A;  4GE7 A;  4F5H A;  3A8U X;  2AY1 A;  1KMK A;  4U1T A;  4N0W A;  4JF1 A;  2Z1Z A;  4XJO A;  4UOY A;  2O7C A;  4A0G A;  1AIA A;  1ASN A;  1M6S A;  2ZSL A;  2A1V A;  3F6T A;  2JGT A;  1WYU B;  1X0M A;  2Z20 A;  1ASG A;  1TOK A;  2DGK A;  1D7S A;  1KKJ A;  1ORD A;  3EI7 A;  1G4X A;  2YRI A;  3H7F A;  3HBX A;  2ZY3 A;  2QB2 A;  4TMR A;  4ZAH A;  1OXO A;  4WYF A;  5EUN A;  3EIA A;  4GE9 A;  5HHY A;  3AEL A;  4OCA A;  5E5I A;  2CH1 A;  4BA5 A;  1E5F A;  1SFF A;  4LC3 A;  4BMK A;  2Z9X A;  4ADB A;  1AJR A;  1B4X A;  3PIU A;  3FKD A;  2FNU A;  1MDZ A;  1SVV A;  3UE8 A;  1B9I A;  3MC6 C;  4JEX A;  3ISL A;  1XI9 A;  3MAF B;  1AJS B;  3GZC A;  3MC6 A;  3RUY A;  3DU4 A;  2BIA A;  3BC8 A;  2D64 A;  3K40 A;  3TAT A;  4Q75 A;  3VAX A;  1WKH A;  2YCN A;  5AX8 A;  2D7Y A;  3E9K A;  3UWC A;  3FDB A;  1QIR A;  2YRR A;  1EQB A;  4A0R A;  4EFF A;  4WB0 A;  1MAP A;  2W8J A;  3UAK A;  2WK7 A;  1BS0 A;  1AHG A;  2GQN A;  3A9X A;  2WB6 A;  1B5O A;  2DGL A;  2HOZ A;  2W7G A;  2VMU A;  3JTX A;  2W7D A;  2BHX A;  3AEN A;  3QGU A;  4W8I A;  4A0H A;  4K2I A;  1WST A;  4RIT A;  3QM2 A;  4MKJ A;  3F0H A;  3ASA A;  2VMN A;  5G0A A;  5E4Z A;  1JG8 A;  1S06 A;  2EZ2 A;  2JJH A;  1DKA A;  2VMR A;  2DR1 A;  1V2D A;  3NNK A;  3I5T A;  1MGV A;  4PIW A;  2E7J A;  1I29 A;  4ZM4 A;  1GC4 A;  2QSR A;  2VMO A;  3RQ1 A;  3II0 A;  4UHO A;  3VP6 A;  4A72 A;  1C7O A;  4CBR A;  2OGE A;  3MBB A;  4WBT A;  3BCB A;  3F9T A;  4ZDP A;  2ZY2 A;  2FNI A;  2D65 A;  4Y0D A;  2VGZ A;  3FQ7 A;  1LS3 A;  1TAT A;  3WZF A;  3ACZ A;  1FG7 A;  2X8U A;  1FC4 A;  2YHK A;  4KAM A;  1IUG A;  4EU1 A;  5DX5 A;  1ASC A;  4WYD A;  4GRX A;  1AMA A;  4BHD A;  1UKJ A;  4Y0I A;  1M0N A;  3ZRP A;  3AEO A;  3WX9 A;  4XJL A;  1DJ9 A;  4WLJ A;  4P7Y A;  2EPJ A;  2EYQ A;  3WKR A;  2YKV A;  3FVU A;  1QIS A;  5EQC A;  3ZZJ A;  3N4X A;  3FQ8 A;  3NDN A;  2Z1Y A;  1I43 A;  4W5K A;  4P3M A;  1YJS A;  2TPL A;  5D95 A;  2VMS A;  2HOY A;  4RKD A;  1C9C A;  1S09 A;  3KGW A;  2VMZ A;  2ZY4 A;  4QGR A;  2V1P A;  2NMP A;  4A6U A;  2BWO A;  2X5D A;  2XBN A;  3WGB A;  3E2Z B;  3OKS A;  4EMY A;  1OHW A;  5D5S A;  1ASL A;  5FT4 A;  1LKC A;  2BIE A;  3NUB A;  1TAS A;  5TF5 A;  1D7V A;  1SF2 A;  1ELU A;  1GCK A;  2D5Y A;  2Q7W A;  2C81 A;  4ZDO A;  1V2E A;  5C6U A;  2QB3 A;  3AEM C;  3EI6 A;  1ASD A;  5DB5 A;  4IY7 A;  1JF9 A;  1C7N A;  3AAT A;  2E54 A;  3LVM A;  4ADD A;  1G7W A;  4K2B A;  4F5G A;  4ISY A;  1ELQ A;  3VK3 A;  4ZWV A;  2WK8 A;  1PG8 A;  3B1C A;  3HMU A;  4B9B A;  2CTZ A;  4A00 A;  3AOW A;  4R8D A;  1VEF A;  1BQD A;  5BJ3 A;  1W7N A;  4B98 A;  2AY7 A;  1DGE A;  2C0R A;  1GC0 A;  3PAA A;  2HUI A;  5DJ1 A;  2Z9W A;  2DKJ A;  3RBF A;  4A6R A;  4EB5 A;  1BJW A;  4CBS A;  4WB0 B;  1DTY A;  3B1D A;  4F5K A;  1OHV A;  5IWQ A;  3LWS A;  1C0N A;  1LC5 A;  4H51 A;  4IXO A;  4OTL A;  2VMW A;  4RM1 A;  4ATQ A;  3AEN B;  3JZL A;  3WCN A;  2FYF A;  3NUI A;  2HUU A;  4FL0 A;  4E3Q A;  3LY1 A;  1D7R A;  5M49 A;  4WXB A;  5EFS A;  4ZWM A;  1YIY A;  1OAT A;  5KTB A;  2ZUK A;  2VI8 A;  2HP1 A;  2VGT A;  5J8Q A;  1BQA A;  4OC9 A;  4RIZ A;  4RAE A;  4WD2 A;  1ZOD A;  2AAT A;  4K05 A;  1GD9 A;  2BWN A;  2E7U A;  1WKG A;  2OKJ A;  1FG3 A;  1IX7 A;  2YKX A;  3BB8 A;  2YOB A;  4JEY A;  5FT6 A;  3L8A A;  3RCH A;  1N2T A;  3MKJ A;  3MAD A;  1KMJ A;  4OBV A;  5EAV A;  3QPG A;  3P6K A;  1I48 A;  1UU0 A;  3E2Y A;  4MQP A;  4LW2 A;  1AY5 A;  4ZDL A;  3W1J A;  3PD6 A;  4AO4 A;  3PPL A;  4BA4 A;  1GEX A;  1O62 A;  1TPL A;  2VMQ A;  3FZ6 A;  2X5F A;  1E5E A;  3NTJ A;  5M4B A;  4OBU A;  1SPA A;  3QI6 A;  2AEV A;  2D61 A;  4A0F A;  2E7I A;  3WKS A;  2VIA A;  4MKK A;  1AAW A;  2AY3 A;  3CQ4 A;  3GJU A;  1OXP A;  4Q6R A;  3B8X A;  4Q76 A;  3AEJ C;  3KE3 A;  3AEJ A;  3COG A;  3FZ7 A;  4E77 A;  4UHM A;  1KL2 A;  1CZE A;  1EG5 A;  1H0C A;  4WXG A;  3PA9 A;  3TFU A;  5M4D A;  4I8A A;  3W1I A;  3ZRR A;  1M0P A;  2YCP A;  3EI9 A;  3NYS A;  3LVJ A;  4O6Z A;  2G7J A;  2FN6 A;  1P3W A;  2W8U A;  3NYU A;  1PMO A;  2BYJ A;  3EI8 A;  3FSL A;  1AIB A;  5F8V A;  1M0Q A;  1ARI A;  3KKI A;  1ASF A;  2W7K A;  4RJY A;  2VGW A;  2DKB A;  3ELE A;  3HT4 A;  1KKP A;  3E77 A;  3EZ1 A;  4Q31 A;  4XJP A;  1BJO A;  1WYT B;  1Y4I A;  4J5U A;  2Z61 A;  3G8M A;  2ZP7 A;  4K2M A;  2BIG A; 
#chains in the Genus database with same CATH homology
 1QGN A;  1IVR A;  2VMV A;  1RVU A;  3PJ0 A;  4OYT A;  1RV4 A;  2GMU A;  5DJ9 A;  5EUE A;  4IXZ A;  1TOE A;  1SZU A;  4W1X A;  1QJ5 A;  2HZP A;  4CXQ A;  3FVS A;  1Z7D A;  3JW9 A;  3PDB A;  1ART A;  4ZLV A;  1ARH A;  1WYV A;  1CZC A;  2VI9 A;  5HDM A;  1W7L A;  3N4R A;  2W7J A;  3K7Y A;  1DJE A;  2D66 A;  1AJS A;  3M5U A;  2OKK A;  1YJZ A;  2D63 A;  1YOO A;  4CVQ A;  3HLM A;  3HL2 A;  2QMA A;  4JEW A;  1GEW A;  1CQ7 A;  1TAR A;  4XEW A;  4KYO A;  3E6G A;  2PB2 A;  1OHY A;  1AY4 A;  3B46 A;  2Z9V A;  3EI5 A;  1MLZ A;  1BKG A;  1S07 A;  1CL2 A;  2CJG A;  4F5M A;  3TFT A;  1AMQ A;  3FFH A;  1AKA A;  1AAM A;  1IX8 A;  2KFP A;  4GSA A;  1MLY A;  2W7E A;  1BW0 A;  1IBJ A;  2W8W A;  4E3R A;  4GDY A;  4KXK A;  1D2F A;  4R5F A;  4PFF A;  4IW7 A;  2QA3 A;  3T32 A;  3RCH B;  3FDD A;  4TN4 A;  3N75 A;  3VK2 A;  5HXX A;  4NOG A;  3BCX A;  2VYC A;  3WGC A;  4GEB A;  4XJM A;  3WLX A;  4ZM3 A;  2R5E A;  5E3K A;  1TOJ A;  5EAA A;  1V2F A;  2HOR A;  3PD6 B;  1CL1 A;  1IAY A;  2AY2 A;  2FQ6 A;  1ZOB A;  2EGY A;  4ZSW A;  1C7G A;  1BJN A;  1JS6 A;  2X3L A;  3FRK A;  5JAY A;  3DOD A;  4XAU A;  3DXW A;  4E1O A;  5EIG A;  1V72 A;  4GE4 A;  4JEV A;  4ITX A;  2R5C A;  2HP2 A;  2CST A;  4L0O A;  1RV3 A;  2O1B A;  3LVK A;  3ZRQ A;  5F9S A;  1AIC A;  4M2M A;  2C7T A;  2CAN A;  3NYT A;  4WYE A;  3WY7 A;  5G4J A;  1AMS A;  1X28 A;  2VMY A;  4UQV A;  2CH2 A;  4J8L A;  2AY8 A;  4Y0H A;  1CQ6 A;  1H1C A;  1YIZ A;  4W91 A;  4M2K A;  4RKC A;  1CQ8 A;  4W1W A;  3BCA A;  2QBT A;  4IXS A;  2VMX A;  3CQ5 A;  1LW5 A;  1XEY A;  1J32 A;  4U2H A;  1VP4 A;  4W1V A;  1AY8 A;  1GC3 A;  4F4E A;  2G6W A;  1SZK A;  3BV0 A;  4IYO A;  3ASB A;  3DR4 A;  2EZ1 A;  3A9Z A;  1QIT A;  2CIN A;  3N0L A;  5EUD A;  4F5F A;  2CB1 A;  1MAQ A;  3AEP A;  1IJI A;  3BWO A;  2W7M A;  1BJO B;  1AHX A;  1AKB A;  3E2Z A;  2YKY A;  3JWB A;  4HVK A;  5BJ4 A;  2ZYJ A;  3PDX A;  3NU8 A;  1UU1 A;  3N5M A;  5G2P A;  3VOM A;  2RFV A;  5K8B A;  1X2A A;  2VGU A;  3LVL B;  3N4S A;  3OP7 A;  3RBL A;  3AV7 A;  2GSA A;  4LNM A;  3KGX A;  1M0O A;  4ADE A;  1YNU A;  4ZAS A;  2O0R A;  4WXF A;  3PDB B;  2VGS A;  1WYV B;  3R9A A;  2VLH A;  2WKA A;  1B9H A;  1GBN A;  1IX6 A;  1W7M A;  3CBF A;  1S0A A;  1B5P A;  3HQT A;  2W8V A;  4ATP A;  5FT5 A;  1MDO A;  1N31 A;  1BT4 A;  4MY5 A;  1S08 A;  4PFN A;  1M32 A;  3MEB A;  3HDO A;  1N8P A;  3BN1 A;  4F5I A;  3DYD A;  3P1T A;  1ARG A;  1TOI A;  4MSO A;  3G7Q A;  3QHX A;  2DOU A;  2BWP A;  2OAT A;  3G0T A;  2AY5 A;  1ARS A;  2W8T A;  1PMM A;  1ASB A;  3CAI A;  2JJF A;  3DC1 A;  5FT8 A;  1O4S A;  4EB7 A;  5G2Q A;  1YJY A;  2QLR A;  1T3I A;  3GET A;  2HOX A;  3R4T A;  4M2J A;  1ASE A;  3AOV A;  4WYG A;  4DBC A;  2OGA A;  1AKC A;  2VIB A;  3NX3 A;  1DJU A;  4MQR A;  2W7L A;  2WK9 A;  1KL1 A;  2EH6 A;  3QN6 A;  1BJ4 A;  2D7Z A;  3DXV A;  3MAU A;  3ZZK A;  1LW4 A;  2JJE A;  3DZZ A;  1WYU A;  1X29 A;  3A9Y A;  1CS1 A;  3HVY A;  2AEU A;  3L44 A;  3PGY A;  4R2N A;  4F5J A;  4F5L A;  3ATH A;  1AHF A;  2VMP A;  1U08 A;  3LV2 A;  2YKU A;  3Q8N A;  4JEZ A;  4AH3 A;  1GEY A;  4DGT A;  3RI6 A;  4WP0 A;  1QZ9 A;  3BS8 A;  2ZSM A;  1VJO A;  2BI1 A;  8AAT A;  1ECX A;  7AAT A;  2W7I A;  4CXR A;  5G09 A;  1CJ0 A;  2FKI A;  3IHJ A;  4WLH A;  1QJ3 A;  1UU2 A;  2VMT A;  4ZSY A;  1DFO A;  1AMR A;  1AX4 A;  2R0T A;  1EJI A;  3NRA A;  4WYC A;  1MDX A;  3FZ8 A;  5EIG B;  3FTB A;  4DQ6 A;  2JG2 A;  2R5C B;  3BWN C;  1TOG A;  2F8J A;  3FQA A;  3BWN A;  4LNJ A;  3ELP A;  3MAF A;  3GZD C;  1B8G A;  3FD0 A;  3GZD A;  4OMA A;  2W7F A;  4AOA A;  2JIS A;  2BYL A;  2XH1 A;  3B1E A;  3GR9 A;  2BI5 A;  1DGD A;  9AAT A;  1I41 A;  1ASM A;  1M7Y A;  1YAA A;  2ZC0 A;  3I16 A;  4FFC A;  4ITG A;  4MQQ A;  1G4V A;  1LC7 A;  3GBX A;  3JWA A;  1ASA A;  1IAX A;  2AY6 A;  4BQ0 A;  1Z3Z A;  2GB3 A;  1C4K A;  2BI9 A;  4IYO B;  1AHY A;  2BI2 A;  5G4I A;  2DGM A;  2YCT A;  2VGV A;  3E2F A;  3H9X A;  3EIB A;  2EO5 A;  4AZJ A;  2CJD A;  2PO3 A;  1GDE A;  2ORD A;  1PFF A;  2W7H A;  2CJH A;  3N7N A;  1AHE A;  3I4J A;  3TCM A;  4PVF A;  2AY4 A;  4A6T A;  3FVX A;  4RLG A;  4RJ0 A;  2AY9 A;  4LW4 A;  3WCO A;  1J04 A;  1JS3 A;  4IX8 A;  2OQX A;  2CY8 A;  3DRD A;  4UHN A;  1LC8 A;  4XK1 A;  3AEM A;  3ECD A;  2ZY5 A;  3K28 A;  4AZK A;  2CFB A;  2GMS A;  4XQ2 A;  3VK4 A;  2FM1 A;  3EUC A;  1W23 A;  3DR7 A;  2Z9U A;  2R2N A;  4R5Z A;  3TQX A;  3D6K A;  1M4N A;  2JJG A;  3EZS A;  1WYT A;  2HUF A;  3GWP A;  2VLF A;  1RVY A;  5M46 A;  4H63 Q;  3LG0 A;  4LNL A;  3QBO A;  2BKW A;  3W1H A;  4HF8 A;  1O61 A;  3FCR A;  1W3U A;  2C44 A;  4OT8 A;  1G7X A;  3USF A;  1ZC9 A;  5I92 A;  4JF0 A;  2BI3 A;  4AO9 A;  4WYA A;  1O69 A;  4ADC A;  1LK9 A;  2ZJG A;  1D7U A;  1SZS A;  3FFR A;  3GSB A;  3NU7 A;  2V0Y A;  1GC2 A;  3A2B A;  3CQ6 A;  2PB0 A;  4GE7 A;  4F5H A;  3A8U X;  2AY1 A;  1KMK A;  4U1T A;  4N0W A;  4JF1 A;  2Z1Z A;  4XJO A;  4UOY A;  2O7C A;  4A0G A;  1AIA A;  1ASN A;  1M6S A;  2ZSL A;  2A1V A;  3F6T A;  2JGT A;  1WYU B;  1X0M A;  2Z20 A;  1ASG A;  1TOK A;  2DGK A;  1D7S A;  1KKJ A;  1ORD A;  3EI7 A;  1G4X A;  2YRI A;  3H7F A;  3HBX A;  2ZY3 A;  2QB2 A;  4TMR A;  4ZAH A;  1OXO A;  4WYF A;  5EUN A;  3EIA A;  4GE9 A;  5HHY A;  3AEL A;  4OCA A;  5E5I A;  2CH1 A;  4BA5 A;  1E5F A;  1SFF A;  4LC3 A;  4BMK A;  2Z9X A;  4ADB A;  1AJR A;  1B4X A;  3PIU A;  3FKD A;  2FNU A;  1MDZ A;  1SVV A;  3UE8 A;  1B9I A;  3MC6 C;  4JEX A;  3ISL A;  1XI9 A;  3MAF B;  1AJS B;  3GZC A;  3MC6 A;  3RUY A;  3DU4 A;  2BIA A;  3BC8 A;  2D64 A;  3K40 A;  3TAT A;  4Q75 A;  3VAX A;  1WKH A;  2YCN A;  5AX8 A;  2D7Y A;  3E9K A;  3UWC A;  3FDB A;  1QIR A;  2YRR A;  1EQB A;  4A0R A;  4EFF A;  4WB0 A;  1MAP A;  2W8J A;  3UAK A;  2WK7 A;  1BS0 A;  1AHG A;  2GQN A;  3A9X A;  2WB6 A;  1B5O A;  2DGL A;  2HOZ A;  2W7G A;  2VMU A;  3JTX A;  2W7D A;  2BHX A;  3AEN A;  3QGU A;  4W8I A;  4A0H A;  4K2I A;  1WST A;  4RIT A;  3QM2 A;  4MKJ A;  3F0H A;  3ASA A;  2VMN A;  5G0A A;  5E4Z A;  1JG8 A;  1S06 A;  2EZ2 A;  2JJH A;  1DKA A;  2VMR A;  2DR1 A;  1V2D A;  3NNK A;  3I5T A;  1MGV A;  4PIW A;  2E7J A;  1I29 A;  4ZM4 A;  1GC4 A;  2QSR A;  2VMO A;  3RQ1 A;  3II0 A;  4UHO A;  3VP6 A;  4A72 A;  1C7O A;  4CBR A;  2OGE A;  3MBB A;  4WBT A;  3BCB A;  3F9T A;  4ZDP A;  2ZY2 A;  2FNI A;  2D65 A;  4Y0D A;  2VGZ A;  3FQ7 A;  1LS3 A;  1TAT A;  3WZF A;  3ACZ A;  1FG7 A;  2X8U A;  1FC4 A;  2YHK A;  4KAM A;  1IUG A;  4EU1 A;  5DX5 A;  1ASC A;  4WYD A;  4GRX A;  1AMA A;  4BHD A;  1UKJ A;  4Y0I A;  1M0N A;  3ZRP A;  3AEO A;  3WX9 A;  4XJL A;  1DJ9 A;  4WLJ A;  4P7Y A;  2EPJ A;  2EYQ A;  3WKR A;  2YKV A;  3FVU A;  1QIS A;  5EQC A;  3ZZJ A;  3N4X A;  3FQ8 A;  3NDN A;  2Z1Y A;  1I43 A;  4W5K A;  4P3M A;  1YJS A;  2TPL A;  5D95 A;  2VMS A;  2HOY A;  4RKD A;  1C9C A;  1S09 A;  3KGW A;  2VMZ A;  2ZY4 A;  4QGR A;  2V1P A;  2NMP A;  4A6U A;  2BWO A;  2X5D A;  2XBN A;  3WGB A;  3E2Z B;  3OKS A;  4EMY A;  1OHW A;  5D5S A;  1ASL A;  5FT4 A;  1LKC A;  2BIE A;  3NUB A;  1TAS A;  5TF5 A;  1D7V A;  1SF2 A;  1ELU A;  1GCK A;  2D5Y A;  2Q7W A;  2C81 A;  4ZDO A;  1V2E A;  5C6U A;  2QB3 A;  3AEM C;  3EI6 A;  1ASD A;  5DB5 A;  4IY7 A;  1JF9 A;  1C7N A;  3AAT A;  2E54 A;  3LVM A;  4ADD A;  1G7W A;  4K2B A;  4F5G A;  4ISY A;  1ELQ A;  3VK3 A;  4ZWV A;  2WK8 A;  1PG8 A;  3B1C A;  3HMU A;  4B9B A;  2CTZ A;  4A00 A;  3AOW A;  4R8D A;  1VEF A;  1BQD A;  5BJ3 A;  1W7N A;  4B98 A;  2AY7 A;  1DGE A;  2C0R A;  1GC0 A;  3PAA A;  2HUI A;  5DJ1 A;  2Z9W A;  2DKJ A;  3RBF A;  4A6R A;  4EB5 A;  1BJW A;  4CBS A;  4WB0 B;  1DTY A;  3B1D A;  4F5K A;  1OHV A;  5IWQ A;  3LWS A;  1C0N A;  1LC5 A;  4H51 A;  4IXO A;  4OTL A;  2VMW A;  4RM1 A;  4ATQ A;  3AEN B;  3JZL A;  3WCN A;  2FYF A;  3NUI A;  2HUU A;  4FL0 A;  4E3Q A;  3LY1 A;  1D7R A;  5M49 A;  4WXB A;  5EFS A;  4ZWM A;  1YIY A;  1OAT A;  5KTB A;  2ZUK A;  2VI8 A;  2HP1 A;  2VGT A;  5J8Q A;  1BQA A;  4OC9 A;  4RIZ A;  4RAE A;  4WD2 A;  1ZOD A;  2AAT A;  4K05 A;  1GD9 A;  2BWN A;  2E7U A;  1WKG A;  2OKJ A;  1FG3 A;  1IX7 A;  2YKX A;  3BB8 A;  2YOB A;  4JEY A;  5FT6 A;  3L8A A;  3RCH A;  1N2T A;  3MKJ A;  3MAD A;  1KMJ A;  4OBV A;  5EAV A;  3QPG A;  3P6K A;  1I48 A;  1UU0 A;  3E2Y A;  4MQP A;  4LW2 A;  1AY5 A;  4ZDL A;  3W1J A;  3PD6 A;  4AO4 A;  3PPL A;  4BA4 A;  1GEX A;  1O62 A;  1TPL A;  2VMQ A;  3FZ6 A;  2X5F A;  1E5E A;  3NTJ A;  5M4B A;  4OBU A;  1SPA A;  3QI6 A;  2AEV A;  2D61 A;  4A0F A;  2E7I A;  3WKS A;  2VIA A;  4MKK A;  1AAW A;  2AY3 A;  3CQ4 A;  3GJU A;  1OXP A;  4Q6R A;  3B8X A;  4Q76 A;  3AEJ C;  3KE3 A;  3AEJ A;  3COG A;  3FZ7 A;  4E77 A;  4UHM A;  1KL2 A;  1CZE A;  1EG5 A;  1H0C A;  4WXG A;  3PA9 A;  3TFU A;  5M4D A;  4I8A A;  3W1I A;  3ZRR A;  1M0P A;  2YCP A;  3EI9 A;  3NYS A;  3LVJ A;  4O6Z A;  2G7J A;  2FN6 A;  1P3W A;  2W8U A;  3NYU A;  1PMO A;  2BYJ A;  3EI8 A;  3FSL A;  1AIB A;  5F8V A;  1M0Q A;  1ARI A;  3KKI A;  1ASF A;  2W7K A;  4RJY A;  2VGW A;  2DKB A;  3ELE A;  3HT4 A;  1KKP A;  3E77 A;  3EZ1 A;  4Q31 A;  4XJP A;  1BJO A;  1WYT B;  1Y4I A;  4J5U A;  2Z61 A;  3G8M A;  2ZP7 A;  4K2M A;  2BIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...