3N4WA

Crystal structure of an abridged ser to ala mutant of the mature ectodomain of the human receptor-type protein-tyrosine phosphatase ica512/ia-2 at ph 7.5
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
87
Chain Sequence
EYGYIVTDQKPLSLAAGVKLLEILAEHVHMSSGSFINIAVVGPALTFRIRHNEQNLSLADVTQQAGLVKSELEAQTGLQILQTGVGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the mature ectodomain of the human receptor-type protein-tyrosine phosphatase IA-2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Receptor-type tyrosine-protein phosphatase-like N
total genus 25
structure length 87
sequence length 87
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2470 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3n4wA00
3NP5A 3N4WA 3N01A 4HTJA 2QT7A 3NG8A 4HTIA
chains in the Genus database with same CATH superfamily
3NP5A 1U0HA 2VKZG 4HT7A 1ACMB 1RWUA 4LRFA 3TJAA 1WC6A 2BJ3A 5GADI 1NJWA 2M3DA 4DF8A 4FKYA 4RW7B 1BQXA 2KJVA 4Y65A 5CQGA 2N82B 5E3RA 2G9OA 4PAAA 5CYQB 1SV5B 2R7QA 4G1QA 4QWCA 5E2QA 1OY8A 3HJFA 4GC7A 3N79A 3GSDA 4ZPDA 3F56A 1M5SA 4RZRA 2KL8A 2E66A 2BJEA 4M5IA 4DXLA 4F50A 2HIQA 1PCAA 2OP5A 4CDIA 4YY3J 2L3MA 2LQBA 2GV1A 2JFDA 3IBCB 3CE8A 3DLHA 1O6XA 2B9WA 3T5HA 3TO8A 2AYGA 1HYSA 2AGOA 1Q81T 2VKRA 1VBKA 3MM6B 2YXLA 2RUSA 3B6BA 3JAMY 1UETA 2Y3YA 4I2PA 1NCLA 3CCWA 5E3QA 4ZDNA 1SV5A 2Q6BA 2EKYA 3AHPA 2E5HA 5J1PA 1RT7B 2B43A 2DEJA 2LMIA 1FJEB 4G3IA 1Q1KA 3OTEA 2B9YA 2E7XA 3FBCA 5ETOA 2RDJA 4L72B 1U4BA 1N33J 2DNKA 2JC1A 2OKQA 1LWEA 3FBBA 4R25A 2W9BB 3TARA 4N41A 3G9CA 3QJJA 3E51A 1KOOA 3A4TA 3HF5A 2JVRA 2VICA 3QAUA 2CZ4A 4L6V3 4OX7A 3JTNA 3GG0A 4URGA 4DS4A 3PJWA 4KHRA 1NKCA 2OPPB 3PO4A 4P52A 1BE4A 4C9DA 4OZ1A 3IS9A 3Q23A 2VA3A 1VBXA 1I5OB 3CJQA 5C24A 2DNQA 4WK3A 3MMCB 1CSJA 3TEHB 5DDOC 1JLGB 2OGUA 2UUTA 1F0XA 1JLFA 2V8VA 3GR0A 1FDDA 1RK8A 4HHHA 3Q2SC 1HI0P 1R3NA 4QBUA 4RNNA 2I5JB 3G82A 4O0IA 5GAHI 2QYGA 2OFGX 3GCXP 2FVPA 1Y00A 1U09A 2F5GA 1IUJA 2XZWA 2IM3A 3ZTPA 5F8GA 4DFPA 1HNZJ 5HL7Q 3LAMA 4RUHA 4DL4A 1S7HA 4KTQA 2R7WA 1HWIA 4NLYA 1RAAB 1RISA 2WHOA 2CQ2A 3VAGA 4MTPA 2VG6B 1EIYB 3PVXA 1K1SA 1FO1A 3H5SA 4UY8T 4PUOB 3J7AN 3IMQJ 3DLGB 3HHKA 2DVIA 2J8SA 4I6AA 3K0JA 1PIEA 3GFHA 3K5LA 2YKAA 2WSEC 1OSDA 4YDXA 4PPZA 4EMDA 5B0BA 2KI2A 1NK0A 4NXNJ 1HBNA 1HNVA 2POKA 3OL7A 3HULA 3UPFA 2FTRA 4ICLB 1S12A 2FC8A 4OZJA 4JYAJ 3K2YA 5ETVA 3KJFB 4DCPB 3SV4A 2OO4A 2DGVA 2JLEA 5B0AA 2XO7A 2ZBCA 2DNMA 2G0IA 4DLGA 2O66A 1HMVA 1E6YA 3PFEA 4L3KA 4Q8EA 1S1XB 3EZOA 1U2CA 1SPBP 2HLTA 4P71A 3U1MA 2XHWA 1KFDA 1S6UA 2JH3A 4FP9A 3EXCX 4QWEA 3KHLA 1UP1A 4NXMF 1PSDA 2EW9A 4CNZA 1Q16B 3EPGA 2IYGA 2MHNA 2CUYA 3M2UB 2YBVA 1R8CA 5A0YA 5KT7A 4A8KA 2YKMA 3MFIA 2ZVIA 2CJKA 1CLFA 2FJEB 1K73T 2GAGC 2W9BA 1FVQA 4W98A 4K4VA 2CFXA 1H2VZ 3Q83A 4EBDA 2OEKA 2QGFB 1LFWA 1UFKA 3ZZRA 3M9MB 2F8HA 3O6QA 3ZFVA 2YH0A 2LU1A 4LR9A 4RKUC 5DO2A 1U1OA 3LP0A 5K5MA 5B0GA 5AE1A 1FESA 1A6LA 2LXFA 4AFFA 2CDQA 3BQ2A 1XK8A 5D4NA 1EHWA 1FDNA 2V6AA 3NEKA 5HVHA 1SXLA 5KG7A 1XJWB 1HFEL 4TYAA 1NSKL 1FFWB 4ES3A 2BMBA 2KT5A 2M8HA 3CJ2A 2QMUB 4CLUA 2VU5A 4DR2J 2KM8B 3DRRA 3HD2A 3R1HA 2CQGA 2I6WA 2C3PA 4MIAA 4IG3B 5E33A 2UVUA 3D6MB 2KYZA 5A6WA 1O8BA 4RLEA 3EDRB 4DZDA 1U1QA 2X3GA 1KRPA 1YRXA 3CD6S 2Z2LA 3SYZA 3FZBA 1YBUA 3CJ8A 4M5DA 3VAJA 2ZH5A 3KLHB 3RAMA 2HGNA 2V9KA 1SKUB 2J0WA 4KFBA 4U96A 1VRTA 3J80Y 2CQHA 4LF4J 1J5OA 1SVDA 5ETQA 5KFRA 1S6QA 3DDIA 1WC0A 2E5GA 2ZVSA 3SCLE 1X9MA 1A0OB 4M5GA 3VR1A 4DPXA 4J9PA 3D1QA 3GILA 1VRQC 4A8OA 2E1MC 1SJ3P 3Q8SB 1TFYA 4RX6A 3EX7B 1RWMB 1B4SA 1ZS6A 1M5HA 4EZ9A 2Z2YB 4Q7AA 2B6AA 4PEOA 4ELTA 2GHPA 3EGWB 4OYOA 2FVSA 2N3OA 2RQKA 3I4HX 5KT3A 4C11A 3H4DA 2NREA 3BKUA 1S0OA 1EQ0A 5J1EA 3IA0A 5I3PA 3V2UC 2FVRA 3AQPA 4NLWA 4F4XA 3OW2R 4EYHB 1HA1A 1V6HA 4IH7A 5BYSA 3BSAA 4LBHA 3BSNA 4PQUB 3PW4A 1RCOB 4TU8A 4WXWA 4O4GB 3A3OB 2KFZA 3C3LA 1HD0A 2HHVA 1EARA 2BANA 2COLA 4URSA 4C8NA 4TKTA 1H7WA 4ZVEA 3TOQA 1GEHA 4ZA1A 1JB0C 2VBZA 5HMWA 4ILLA 1VC0A 4I2PB 1KVJA 3US5A 4U8YA 4OJ3A 4H4OA 2ZDPA 3OTBA 4Z2XA 3DHWC 1H7XA 4CT8A 4DR2F 4M95A 1P1LA 2AGPA 3HXMA 2CG4A 4X66J 2GA7A 3D9BA 3GYXB 3HM9A 2CNLB 4IOBA 3LP2A 4OYIA 1WI6A 5E0OA 5E3PA 3W7BA 5C25A 3UNGC 3CVKA 5EHHA 2MZRA 3R5AA 4OYBA 3CUNA 4WKRA 2KT3A 2VH7A 2YKNB 3OD2A 3WDOA 2HWTA 4R8UB 2MEWA 2OD4A 2G2ZA 4FXWA 3CJRA 2R3VA 3JTOA 5M2UA 1UJ5A 2AX0A 4Q44A 4HTIA 2IAJA 2XY5A 3IN5A 5C24B 2HHWA 3R97A 3CC7S 4PG5A 2GJIA 2DHAA 4J9KA 1EP4B 1F9HA 2FC9A 4K8RA 4DV7F 1TL3B 2X1GA 3OBIA 3UFCX 5AT1B 2ZKUA 4AL6A 1S6QB 2W4PA 1DURA 1YJ9S 1J5OB 1RA7A 2K06A 1NHVA 2RS8A 2KVQE 3QQCD 4DV3F 3RW6A 5H9FK 3OVBA 4OHYA 4A8MP 1GX6A 2IBKA 1TKTB 1XERA 1UEVA 2CG8A 3L95X 2PFFB 1HNIB 1S6OA 2C1EB 3SFGA 1TAQA 2MXYA 4B3OB 3H40A 2LDIA 1WG4A 2JVOA 4P7TA 4LSLB 4E98A 4ECZA 3KJVB 1HNXF 4MKVA 4B3SF 1K0VA 3KOAA 2J9EA 3RB3A 1IKWB 4TY9A 5GAHU 4OI1A 4GC6A 1VK8A 3HSJA 2FZCB 1JJ2R 4K4YA 1R0CB 2KXHA 4X64F 3CJTA 3M8QB 4FZVA 2A6OA 2XGPA 4O3PA 3DOMB 3DOKB 1N5QA 3C46A 1R8PA 2A1BA 3U1LA 4ZLPA 3NBPA 5KAKA 3N6NA 4RWXA 2QSWA 5F0UA 2GO8A 2J8AA 5HQMA 4L3NA 2G2OA 2MHEA 3FCWA 4QWDA 2AQ4A 1VQ9S 4U7UK 3NCRA 4NXMJ 2HFUA 3ILJA 2QL9B 2RT3A 2VBYA 1VJWA 3M8RA 1W2IA 1ZA1B 3ENVA 4BLGA 1APSA 3QWUA 1YHQS 3JQKA 1MLAA 4DPYA 3Q89A 3OTOJ 3QFHA 4QQBA 1VQ7S 1FRHA 2XZDB 3KMQA 2ASLA 2BDPA 2B56A 2ZE2A 1SL2A 1KLMB 3JQJA 4K2XA 3GIJA 3CCVS 3G4SS 4DX8H 3GWCA 2HFZA 1L3TA 1WDTA 3H20A 1ZTWA 4LVNP 4JBCA 5K8MA 1HQ2A 1FD8A 2MZQA 2HNYB 3HSZA 3VAHA 1Y10A 3MEDB 3HKZD 4KGZB 3KLVA 4EO8A 1M5VC 2HQIA 2CQ1A 3PEHA 4ZJQA 2ADCA 2HFNA 2RNEA 4RNFA 2DPIA 4EUVA 3UNYA 3DLEA 1M1KT 1WC1A 1NHUA 1VQPS 4DR6J 1FD2A 3CO0P 3QYYA 2HS0A 1U02A 5CD4A 1TAUA 2QLBB 2WOMB 3ZTOA 1MMNA 2WCXA 4AT1B 3MM5A 3O8WA 4RW8A 4JI3J 1DHMA 1YZ6A 2PC6A 4YN3B 4QIVA 2IA0A 4V19X 2MQPA 2I0XA 4G65A 3OUYB 3EZUA 3KK2A 2MGZB 4FYDA 4DQRA 3QATA 1HW8A 3PKMA 1GH8A 2KHCA 2E1CA 1TVRB 4N8OA 3W61A 2VD3A 2B9XA 2DHGA 2J76E 3O5TB 2JLGA 5JUMA 3TQ1A 4WFXA 1P1TA 4CO2A 2BKNA 4DOZA 3IO1A 1CG2A 5KG2A 1UA0A 3N28A 2NUHA 2MQMA 3R6LB 3RRHA 1ZH5A 1HI8A 3FGVA 3A12A 4Y34A 1ELOA 4LSLA 2K1RB 3UD5A 2R2SA 2ZH7A 1VIXA 2APOA 4UY85 3RBXA 4HH0A 1FDAA 2IDLA 3LALA 4LUBA 4NXNF 3LPYA 3ETMA 1FEEA 3CGIA 3EJMA 3KK2B 2EC0A 2V69A 3R7SB 2MKIA 3M6UA 2HBQB 2AYBA 4LF5J 3SI8A 3K8WA 1JXLA 3OHBA 5CD4H 4X4RA 3S6EA 1R89A 4DX7A 1XQIA 2MYFA 5KG5A 4IG0B 2VG5A 1KTVA 3JSYA 2C3MA 1GMWD 4AL7A 3W66A 1OMSA 4J91A 3ZZOA 3JS9A 2OPQB 4OZ5A 3THPA 3UN3A 4FBTA 2G1DA 2R2RA 3BPDA 2NUUG 4CWBA 4XPEA 1QSSA 4DQPA 1JWWA 1LW0B 2RMLA 1HBMB 5HLFB 1D8ZA 2ZWPA 1NDCA 1RT4A 4JOUA 2FYXA 2F40A 2GGPA 3U02A 4DJBA 1KFSA 5HP1B 2AJ0A 4OHXA 5AXLA 4ZCLA 3FCHA 5FLXY 1JNRB 2MZ1A 1RHJB 3QT6A 4RU9A 3DLJA 3PX4A 5D4LA 3QGHA 2HNDA 4TQRA 1FFGB 2HEKA 5CCMA 1YTYA 1G3OA 1P27B 2HVEA 1YRTA 2HHUA 3M6WA 1TL7B 3QT5A 4TQSA 1WF2A 5IS2A 2OI2A 4DV5F 2IDEA 3LWLA 2F3JA 2VC0A 3T5JA 3KLFA 2D3O1 4B9LA 3KLEB 2OD6A 1U7LA 3LP2B 3MZIA 2EFNA 3I9V9 2N3LA 4B08A 5BR8J 7AT1B 4IO9Q 5J2QB 4LR8A 5DGAA 2HVIA 1VJQA 3IWXA 1NH8A 3OLBA 1BXNA 3QIPA 3BGOP 2AX1A 1NK7A 3CMQA 4XAKA 2CDRB 5A8RB 1VBZA 3W9HA 2BV3A 3GYGA 4WKYA 2RQMA 3PYEA 2I9SA 2BA9A 5RUBA 2BQUA 1WKLA 2JEJA 4ER8A 3A8KA 2NSBA 2ASJA 1U1MA 4LF8J 2DRAA 3NG8A 2W7OA 4YB7A 3BH7B 3BSOA 2BVZA 5EWFA 2IJFA 4RW4B 5I3UA 2FLLA 2VPWB 2MSTA 2ZUGA 4NASA 1SBRA 1SQGA 2WVDA 2MY7A 2NXUA 4MIBA 4CI0B 1DJ0A 1G6BA 2AJFE 5FD1A 1TKZB 4H4KA 3V6KA 4K50A 3ENQA 3A8JA 3UWTA 2AW0A 3H2UB 1TK5A 4GKKJ 1ZZNA 3K5MA 1XMQF 3QJPA 1AW0A 3RU0A 2ILZA 1RADB 4HDGA 5EUHA 1IBKF 4OI6A 1U49A 3SCKE 2W24A 4ETXA 2XZTB 3MR2A 1QY7A 2ZEJA 3EGNA 1KR4A 4QIGA 4F3MA 4ES2A 4ETZA 1GTEA 3PXGa 3SCIE 3M9OB 3BO2A 1FDBA 2M0GB 5KFDA 2V94A 3RTVA 1X9WA 3QRRA 3PX6A 1DQ8A 4TNOA 3AB2B 1NB2A 1RBAA 4FYXB 1LNQA 3HZGA 5IV4A 3R2CJ 1RHKB 3NOGA 1FRXA 3N5FA 2BE2B 5AXKA 1K9MT 4H4MA 4EGLA 2LQJA 2KRRA 2K7KA 5CXTA 3FDSA 4ZCIA 1FXLA 5ETNA 4DI6A 2F63A 3MCOA 4B3RJ 1ICEB 3PRVA 1N5VA 3QPIA 4O4RA 1EKRA 2RS2A 3QRQA 4YHHJ 2A10A 2B9EA 2F9DA 1PAEX 1TL1A 2HNDB 4I2QB 4OJ1A 1WG5A 4ZVQB 2OAUA 4DZ6A 3CDBA 4JB8B 3A8EA 4OYZA 4XK8C 4R5PA 3OTOF 1JLFB 4DV2F 1B64A 2K3IA 2HAIA 3CB4A 1IM4A 1YBAA 1TKXA 2OSRA 2FHOB 3M6VA 3MWBA 5KOWA 5KT6A 1N5YA 3FQKA 3BPSP 3GTYX 4ZCKA 1Q8KA 3TYTA 4Z7CA 2RILA 3HFKA 5DDQC 2UUCF 2GQCA 1JKHA 4Y2CA 1GFWB 2FHMA 3DMJB 1B7YB 3CDAA 3JTPA 4ILRA 1FRIA 2B7BB 3IG1A 4OHZA 3HPOA 3V81A 4ELVA 4FF3A 2AJ4A 1MN7A 4F0KA 4N8NA 1RBLA 3QWPA 2ALZA 4B9NA 3UI3A 3Q8QB 2C2DA 4DL7A 3I0RB 1I51B 2IA6A 3HVRA 2XBPA 3ULHA 3CWJA 3H2LA 4XDCA 3VGVA 2KG0A 3CCLS 1QLNA 5EDWA 5HJXA 3W64A 3OL6A 4Y6IA 5KFTA 4LIRA 1UL3A 2BACA 1X5PA 3GIIA 1T05A 2BUNA 1TKZA 1WTFA 3KKFA 4F0HA 2XMTA 4CO3A 2CJAA 2YWGA 2CZ9A 3C6TB 3MEKA 5L39A 5KFWA 2R8GA 2XM3A 3D28A 3D3BJ 4WWSA 4NA1A 5J2PA 5G4DA 1NM2A 1QTNB 1MROB 4Y2IA 3PR4A 1XMOF 1UW9A 1ZBTA 3NWRA 4ZHRB 3UDCA 5D4OA 1WSRA 4NX9A 5ETSA 2CPIA 1XR6A 5F8NA 2BZ2A 3GE9A 3I5CA 2DHXA 3KFWX 2RU3A 2R7RA 1SKSA 1RYRA 4IOAQ 1YVFA 2VF3A 2DCUB 2DNRA 1IJFB 2J9DA 2DXEA 1S5ZA 2OPRB 2ZOMA 4C8ZA 2DGTA 1JJHA 1FRMA 2PMHA 3FBFA 4N7TA 3T1HF 1CC7A 4J9OA 1RTHA 1Q86T 1HNXJ 2XLKA 2R7SA 3K59A 3BKTA 3DLKA 2J7KA 1D09B 4ZOSA 5B0FA 5KFFA 1WTBA 1X8DA 5THWA 5FJ4A 3X1LB 2ATCB 3MGJA 3QO9B 4F4KA 2W2NP 4OIXA 2X51A 4F04B 4GKJF 4YOEA 2MPUA 1AB8A 3AD9C 1NPPA 3F0NA 1HNZF 3S7RA 2EFOA 4R5PB 1GQEA 3MUTP 1DARA 2AIRB 4HI1A 4X4VA 2O67A 1ZAWA 2Z2ZA 4EZ6A 3LWMA 2XQCA 3HLUA 4KY3A 1IM6A 1W25A 1H74A 4M5HA 4LFCF 2R7VA 2HS4A 4B9SA 2W1BA 2KB2A 3NGDA 3MMCA 2MLZA 2VOPA 1FNOA 4KC5A 5L38A 2QSFA 3PKYA 2MLYA 4ED7A 2PDAA 1C1CB 3D6FB 3IS9B 3UDEA 4F67A 1KTQA 4ZLNA 5C7PA 4LVOP 3MXHP 3DDNA 5HP1A 5MAOA 2FJWA 3ILIA 2QLJB 5E3AA 3MPUB 3Q2TC 4M5DB 1PJ5A 1CJKB 1EETB 2IHR1 2D9OA 4HH1A 4JV2A 5D3GA 1TL4A 2VG6A 3THVA 2GO9A 4ZPVR 1H3DA 1B7FA 2IAJB 2AEFA 3IRXB 2XYPB 3E8OA 1EAYC 1YK9A 2JOQA 4QR1A 4ZS6A 1EP4A 2AKWB 2P5VA 2HBYB 4DMZA 3KLFB 3L7PA 4OX9F 5AE3A 5EX3A 2I38A 4Y2KA 3GSIA 4IKAA 1IR2A 1I1GA 4AQYJ 4ED8A 2PEHA 3PG9A 5M2RA 2MZSA 2FY1A 2GMLA 3CCRS 4C2MA 3NWGA 2W2QP 4S0MA 1O5JA 1SUQB 1S1TA 2OHDA 2VPYB 2YKPA 2YNFA 3IBWA 1VBYA 2AZ3A 4CIOA 4IRCA 4P7VA 2OEJA 4UOHA 1N56A 3MPDA 3V6DB 4KPCA 4NEYA 4DSKA 3KG1A 3CULA 2DGSA 3A13A 3V6HA 4ZCMA 4F4AA 3G8SA 1RQ0A 1MMDA 2BANB 4MIWA 5LT5A 4DR4F 4ZN1A 4I6YA 5D0GA 4YB6A 1YI2S 1K0TA 3HKWA 4NLQA 2J6TA 4B9MA 1AFIA 2FY8A 2KO1A 2LCWA 1F60B 4JI6F 1RAGB 4WFBQ 4WP9A 2B5JA 3DI6A 1WOSA 4U95A 3BO3A 3I87A 2NYHA 5H9EK 3B4MA 2VIHA 2YKNA 4JV1A 3ILOA 3V5RA 2RHSB 1TL5A 2V68A 3HHDA 1TTHB 1AROP 2EVZA 2IIHA 2L9DA 3KNGA 4DR1F 4FF1A 1MU2A 3CJ5A 1FT8A 4OYXA 3RYLA 2KJWA 2MZTA 3SFUA 3H42A 5HROA 3TX8A 3SBMA 2CQBA 3BM7A 1S49A 3N4WA 2FHJA 4RBUA 4E2FB 2W25A 4K4WA 4C4WA 3KJQB 2YWHA 3GJSB 3L09A 3Q8PB 1RT5B 2H1YA 4DL5A 2WBMA 2R7UA 1NDKA 1J27A 2BM0A 5CABA 2HZAA 3U27A 2JEFA 4NCAA 1ITPA 3C6TA 4CLFA 1NJYA 4LRAA 2CJBA 4WFAQ 4HEA9 4X65F 2P9GA 2HFVA 4PUOA 3RJMB 3H5XA 5KFEA 1HBOA 4LQ3A 1KHVA 1WACA 3DU5A 4CT9A 1HBUA 4O0NA 5C2GA 3R5GA 2NPFA 3L9ZA 1R0AB 1FRKA 1KWMA 3THTA 4RNMA 4ZKAA 1UEUA 2OPSB 5DGBA 3V81B 4LFAF 1OY9A 1XMQJ 2VDHA 3HHLC 4BWMA 5FLXU 1JLCA 4IFVB 4XTTA 3CCES 1CQMA 4F2RA 4U9RA 3MHYA 3KJVA 2YX4A 1PC4A 3BB5A 4L75A 5LXYA 5DM7Q 4QIWD 4ZVUB 3BGUA 3GV7B 1WOOA 4L76A 7FDRA 4B9TA 1G1XA 2QFIA 2ZD1B 2UXDF 1LQ9A 2JFKA 1NK4A 3FEXB 3VAMA 1AA1B 3UW1A 1J5EF 1Y0HA 2HYIB 4LF8F 1SUQA 2YNFB 4ZVSB 1T05B 3OSPA 1ULRA 3FSYA 1C1BA 3H8YA 4OZ3A 4ECQA 1XNQJ 1T11A 2CKWA 2NQPA 1HR0F 4DX5A 4WFNQ 1N5SA 3V4IA 3MECB 2FLOA 4ZVFA 5MLCV 1TV6A 2JWNA 1IR0A 1NSPA 1HWJA 4FXVA 4NYZA 2Z30B 1KC8T 3K5PA 1XNRF 1L3KA 2Q1LA 3T1AA 1FX2A 2YKOA 5DDPC 3H25A 2CA9A 1TU0B 1Y11A 5ADZA 1ZAVA 3BN7A 3I0SB 1OYDA 4U67Q 1SL0A 3VHQA 3M1VA 3E01B 1X4CA 3VALA 3UCZP 2CNNB 2PIIA 4KV8B 2HNYA 3VQSA 3TANA 1YJWS 2FQQB 4O23A 3KLGA 5KFCA 3R1LA 1NNDA 2R4FA 3ZNUA 1HWKA 2RUGA 1RABB 3ITHB 2ACMA 1T8EA 5A76A 2RQCA 2HKEA 1B0VA 1WELA 2OLWA 3MEDA 5L9NA 1JLEB 2AZ1A 5J2MA 4JI0J 3BV8A 2GJ2A 5JVHQ 3MD1A 1TUGB 2N4DA 4IQMA 3MURP 1BC6A 4H4OB 2HAFA 1HQEA 3AA9A 3HCXA 4A8FA 3M2VB 4Q45A 1U25A 4YQWA 2WB4A 3MEGA 4RW7A 5HMYA 1REVB 4OV1A 2YKQA 1FWLA 4Q8FA 1U6BA 1XTZA 2HQFA 3GG1A 3T1YJ 1WHVA 2HS3A 1S1WB 4JI1J 3D0GE 4FN5A 3VF0B 4YR2A 3BDPA 1WEYA 4F02A 2CPXA 3R6GB 4TYBA 2E1RA 2W2PP 3CO9A 3HHEA 1X4FA 2R8JA 2DR5A 2LQ8A 2JJ4D 4C8KA 1BQMA 2E9RX 1REGX 4ZVHA 1VI7A 2HK2A 6FD1A 5IQ6A 3MM7B 2ZH9A 2FIUA 4IFYB 3M32B 2VQEJ 3BREA 5CAAA 3VAIA 3TJ9A 4NYPA 3MCMA 1RTJB 2WVBA 3MEGB 2B6AB 5KFGA 4X4NA 3NLCA 2Q3PA 1GMVA 5M2PA 5AXNA 1PBAA 3SCJE 1RHUB 2EC2A 5ETMA 3IR5B 4B3TJ 2J0SD 2L9WA 3PYGA 4FPRA 4QPTA 4WIIA 3ZTRA 2VG7A 2ZD1A 4B17A 2XNRA 1B3TA 3CMES 1HNIA 4WIQA 2ZC3A 1EQMA 1RTIB 2K7JA 3CJKA 3EZ5A 4Y0FA 1UZDA 1VQLS 3ENAA 4KAIA 3PEJA 5LMNJ 1ZM2A 2IY5B 1AT1B 4LF1A 1UA1A 2Y1JA 1WC3A 4P72A 2QA2A 2YNHB 5E5NA 4CYUB 1VHFA 2IVMA 3GLJA 4MH8A 4ALZA 3CXCR 5I42A 3UVJB 3C15A 4D3GA 1JKHB 4ECXA 2PA3A 4Y00A 2Y1RI 2DGWA 2UUWA 2W9CA 5F8MA 2XMAA 3KYLA 3DRSA 2UU9F 4EEYA 2QZ8A 3OR1B 1VQ4S 1HQUA 2LQ5A 1NPKA 1BLUA 4FKXA 5DM6Q 4ILMA 5CHCB 1RJJA 2DO0A 3I5BA 2MQQA 2P2CB 2NR0A 1IWGA 1LWFA 2N7CA 2ROEA 4CYUA 1IKVB 5L9XA 4C0HA 1J2VA 1WI8A 3DXBA 1CJUA 5T7LA 4C0OC 4DHVA 1HKAA 1ZAXA 3JSMB 2HHHJ 4PG7A 2QA4S 3UD4P 3T5KA 1X5SA 3H98A 1UFLA 4TY8A 5HI7A 2M4MA 5HMZA 4OI4A 2OELA 2VQEF 1SJFA 2DO4A 2H48B 4RW4A 2YNIA 4WU2A 1U0HB 1VISA 1XWLA 3MPWA 4MFBA 3GFZA 2XI2A 3KHRA 1VQSA 2B4OA 3DC2A 5ETRA 4JUZA 5DQIA 1RAJA 3PCOB 1H98A 4ZPBA 3OV7A 2XS2A 2XLIA 3FEZA 4X4UA 4I7FB 2LXUA 4PG4A 2QYCA 2GQQA 2LQ9A 2JNJA 3I9ZA 2Q66A 2EBEA 2GC8A 5C5JA 3T5LA 4A8XA 3FMWA 5T7LB 3CCSS 2VPXB 5GAEI 1FVSA 3RGIA 2WVCA 2VB6A 3A1YG 1NPRA 2JLFA 3MEEB 3SDEB 3OQ2A 2BM1A 3FRZA 2QA1A 4EI2A 2OJ3A 1U26A 5KFLA 4HLBA 3ZTSA 3T9ZA 1BY9A 4QIFA 3HT3A 4P2FA 3TUPA 3PRBA 3VTIA 3Q8RB 2QG9B 2U2FA 2LXIA 5K9FA 2DHHA 1VLYA 3SIPB 2DB1A 2XCPA 3T1HJ 1F2GA 1R0BG 1SJ4P 1VK3A 1G7CB 1UTAA 2KM8C 4NLGA 5CA5A 1FI4A 6FDRA 4J9NA 1YX2A 2ZH2A 3I56S 2W7PA 4NZ6A 4ECVA 1QDUB 4HL9A 5CZVA 2FJXA 2YNHA 4IRKA 2CJQA 1KLMA 1U6FA 3BEGB 4E8UA 1RLCL 1VRUB 3LUYA 1YG0A 5DG8A 4DV6F 1RT6A 2KRBA 3TAPA 3K8VA 1Q53A 4NOHA 3ZO7A 3UO0A 2OMOA 4WZQA 4G6VB 3ISNC 1FE4A 1FX4A 3V4IB 2XI3A 4JI8F 4DSIA 1CEZA 3TQEA 4K7QA 3AA8A 1T03B 4PZVA 2GFFA 2CAJA 1B0PA 2ZUAA 4JI2F 4DQQA 3DRSB 1U1PA 4KKOB 2QN6B 4A4JA 4QCLA 1F3FA 3W1YC 1HLWA 3D3CJ 3QJLA 4X4SA 3M7VA 3DU6A 3E2EA 1S77D 1FJ7A 4LRCA 1MMLA 3ETOA 3JQMA 3PFOA 1P9YA 2H51B 3E01A 2P9EA 1CS4B 2ZDOA 4AYBD 1TR0A 2RB7A 1KQKA 2W4CA 3BH6B 2J5AA 3I0SA 4ZP7A 1RT4B 5LL6d 4G1IA 1VC5A 1RGVA 2VFUA 3ITHA 4QZVB 3BO4A 1URRA 2E9TA 2UVWA 2V2QA 5KFJA 4CLZA 4DV4F 2VQFJ 3I0RA 3PTWA 1QAIA 4RUBA 4F7VA 1DFDA 4WJBA 2GW8A 4KO0A 5KFZA 4KKOA 1N6QB 3UR0A 1LW2B 2EFVA 3MAQA 2XG8A 2JZ5A 1H2TZ 1VIOA 3OUYA 1V3ZA 3NGUA 2K2PA 2UXDJ 5F9NA 4X4OA 1RTIA 3RR8A 4PXCA 1SJQA 4WFZA 2NYIA 4GMKA 1UAWA 3RR7A 1OYEA 3I96A 3GV5B 2Y8YA 3DXSX 4K4ZA 2MLXA 3AY0A 5B09A 4RW6A 5SZTA 3EDQB 3LQVA 1UWBB 1ZA2B 3AOBA 3IGNA 4J9VA 3TX0A 1N88A 1B99A 4NZ0A 2BRKA 4NLOA 5KFYA 1EX8A 3W5YA 1HMVB 2FHJD 1IVZA 3DI6B 2D3UA 2RDDA 2HVDA 1WSVA 3GPAA 4GVBB 4PWUA 4USHA 5GAGU 3FQLA 2C3OA 4Z37A 4A8QA 1SH0A 3MM7A 3KUEA 2OSQA 1H0HB 5HBMB 3OLAA 1GNKA 4IYQA 4J5OA 2O5DA 1UVKA 4N47A 4DBQA 4CH1A 1ZYQA 2XNQA 1RWKB 5A0YB 1FRJA 1HIYA 2NSCA 2LEBA 2HVHA 1NK5A 1T9YA 2G13A 2DT9A 2EFGA 4ANCA 1Q0NA 2Z58B 1JJCB 2KG1A 1VQ5S 4I6WA 1W7WA 3PHTA 4LFCJ 1GAOA 3G82B 1NSAA 1AUSL 5KFBA 1T3NA 2K3KA 2RRNA 1CJUB 4RO0A 5JXSA 4QW8A 3JSMA 1S48A 1M5KC 4Q0BB 2C2MB 2AD9A 5L1IA 1JXEA 2R2UA 3G71S 3J81U 2Z0GA 4K4XA 3D1OA 4K5SA 1RWXB 4CO0A 5J1EB 2RD5C 1HNWF 3MMBB 1M90T 1QAYA 2OMLA 2WSCC 5KFHA 3FFIB 4LFAJ 1GK8A 1R8AA 2DGOA 4P9SA 2J9DE 3ADAC 1RKJA 2IJNA 3FKBA 3GCWP 4X62F 2J0XA 1YJTA 2MQOA 1L3UA 2SXLA 5DZ7A 1RTDA 5EN1A 2FVCA 4K2JA 2KHDA 4NLTA 2LA4A 3IR7B 4PCQA 4BS2A 3C15B 2G0JA 3W60A 2M7SA 4DCJB 4DQIA 2XS5A 1X7VA 1PYSB 2EBGA 3OR1A 5JVGQ 2J6UA 1SJRA 3GJQB 2OIHA 4USJC 2BJ9A 1RHRB 4ED3A 4YFUA 4K0KJ 1E6VA 3J7YI 4YB1P 4U7UD 4ZMMA 2DR8A 1YIJS 4CM2A 4NLSA 1Q78A 3CD7A 2B3TB 1NZAA 3RUBL 4B3MJ 4CCHA 2R7XA 3KK1B 1GTHA 2CNOB 1K8AT 1Y4ZB 3P4UB 4PR6A 4LFBJ 2DXDA 1JLQB 2ATLA 1T9VA 2LP4A 3OR2B 5KTQA 1DZ5A 4U6PA 3OSNA 1I3OB 1D1UA 4J9UE 1SIZA 4ZJOA 3OXLA 2R7TA 3DOMA 2DH8A 1NUEA 1Y5NB 2QFJA 4K0KF 2DJWA 2OPSA 2GIQA 3MF5A 3PJXA 2AYMA 3V4MA 2RRAA 1IBLJ 3QRPA 4ERDA 3QGIA 5IT4A 4BWJA 2BYCA 4DPWA 1HHQA 3MCSA 2GHVC 3L7UA 4CTAA 6AT1B 4KGXB 1RT2A 1S6PB 3LP0B 2CPHA 4M5JA 1SJ1A 4X84A 1U24A 5EWGA 1KBRA 4UUXA 1IBLF 1S79A 3QIDA 5AE2A 1T7PA 3KDNA 3LGNA 1WF0A 4H4MB 2IVFB 1IQZA 1EB0A 2VV5A 2XB2D 5GMKa 1LWEB 7FD1A 5KT2A 2OEMA 4ZLLA 2ZHBA 5HO4A 5D77A 2CJYB 2X1FA 2CJXB 2HHXA 1VHIA 1KVIA 2MZJA 3FZ2A 3H2VE 1CPZA 4O44A 4DFMA 2RSQA 4Y2MA 1MU2B 1S1WA 4R0EA 4LSZB 3R5BA 5D8HB 1N0UA 1HQUB 2NZCA 5HK4A 5HROB 2HK3A 2ZBQA 1VQOS 4JI1F 3NOCA 3WHIA 5DRKA 2HBRB 2IM2A 1RT1B 5HAOA 3AB4B 4YB5A 5KG3A 5H9FJ 1F5AA 2DNGA 4LQ9A 5GVQA 1U48A 3EVMA 3M8YA 3TEGA 2QLFB 4IQXA 3V6JA 4IRDA 3PX0A 2MDAA 1S57A 3DDKA 9ATCB 5A8KB 2F8EX 5J2MB 3PV8A 4OLOA 1FHTA 2ZE2B 1U0SA 5H9EJ 1KEKA 2A6MA 2E29A 2YH1A 2Z2MA 2LECA 3HSGA 4OZ0A 4ECWA 2YWWA 4B3SJ 4ZIVA 2ALYB 4KIAA 2QC3A 4KHMA 4PPDA 4A8YA 1H2UX 2HNZB 2ZH4A 5I3UB 4DR5J 5A8RA 1M5OC 1UWAA 1S0NA 1Q7LB 3QIPB 3WC2A 1WDDA 4EFAC 1MROA 1PYTA 5KT5A 3HFVA 5J2QA 3B54A 4RNHA 4DL2A 2YQ3A 1RXOB 1S7IA 1SKWA 1DLOB 1VGYA 4DR3F 2NXCA 5GMDA 4I0WA 2AU0A 4PQUA 1FNMA 2UVRA 4A8SA 1DTQB 3M8WA 5IT0A 3W3SA 4J9QA 3CCTA 3HDSA 2HQCA 1R27B 3IRXA 2RHQB 2RJZA 2GVDA 4IDKB 1FTCA 2MKHA 3D4JA 2BEFA 2VL1A 3IRWP 1B70B 3KWMA 2E7WA 1HPZA 4FYVB 4HR2A 4PYDA 5ETKA 4CM0A 1S97A 2F4FA 3TZZA 4EO6A 3N5BA 4J9RA 4OJHA 4MK9A 1QUVA 2UXBJ 5KFNA 2DY9A 1GT8A 1EKSA 1CJTA 3TUZC 4DSEA 2GCFA 3RB6A 4YEAA 1D9AA 4ZPWR 3KHGA 5KOXA 1DQAA 4FVMA 5KFQA 5K20B 3ZZUA 4B02A 4CP5A 3Q24A 3K17A 3GQCA 2UP1A 4WBFA 1WEXA 2KH9A 1L3VA 4IDKA 2EK1A 1N36F 5D0HA 1U2FA 4MAKA 4HTJA 2ZJQQ 1SC6A 2ZITA 2JSXA 2F4VJ 3UN5A 4TY8B 3FK4A 4P2XA 4DR4J 1LV5A 2CQ3A 3LPEA 1RAFB 4OYPA 1TK8A 3D54A 1F1BB 4QJVA 3R7NB 2DRDA 4PXBA 1HL6A 1RT7A 1TFWA 2BW2A 2VBXA 4KGVB 1R8BA 5CYJA 4YR3A 2F1FA 2FLPA 2GIRA 1OWXA 3DOLB 4BDPA 2R9LA 2WONB 4O3RA 2D9PA 4C48A 3KJNB 3I5AA 5IC4B 4JI5J 3OTDA 1N54B 1M1GA 1NU4A 4HKQA 2DNNA 1VYAA 4QYZK 2V63A 4A48A 4P2MA 1YKWA 1H38A 5KFKA 1DQ9A 1FKOB 1F6TA 3EWGA 5F9LA 4F4ZA 3PO5A 2DIVA 2B0GA 2HNZA 3FJ2A 4V19J 4NE9C 3SXLA 1UVIA 4AXJA 2BJ7A 3BKFA 3C8YA 3PRDA 4UW2A 4X4PA 1TUWA 2DNOA 1VC6A 1U6ZA 3CT9A 3RBDA 1XMOJ 5CYQA 3FSIA 3NNAA 4WZMA 2XY6A 2WOMA 2HMIA 5EWEA 5J2NA 1KSPA 4LR7A 4NLRA 3M2UA 3NS7B 1S6PA 3IGVA 4CRJA 1GMUA 2I5JA 4OI2A 4O3OA 2JRSA 4CLLA 4DU8A 3JB9k 3NBPB 4X65J 4IOCQ 4BC7A 1DRZA 5T41A 1OIAA 2Z8QA 3E3XA 4DV3J 3T1YF 2KTQA 4HACB 3P8BB 3NCQA 4OQJA 4V1Ak 1JLBB 2IRXA 2B4PA 3MMAB 3G6YA 5LMNF 2BOPA 2VG7B 2E7VA 1I94F 1RACB 4OYWA 1U1LA 1WKJA 2VJVA 4JYAF 4CLTA 1WC5A 2I2YA 1BQNB 2MKJA 3PZPA 1LXJA 3F41A 5T14A 3L7OA 5J2NB 4ED5A 2B7CB 4P74A 2UVVA 1XIQA 2V2VA 3SQOP 3K89A 4UZCA 1UPMB 2VHGA 2HBZB 1UVMA 4O4GA 2B51A 3TAMA 5I42B 1RDRA 3Q0AA 2VG5B 4NLXA 1OQ6A 2QE5A 4DSJA 3S01A 1XR7A 4IG0A 3R8YA 1Q82T 2IMWP 1IKYB 4P73A 4Z7YA 5JMNA 1R8HA 4PG6A 3GB0A 1QSYA 2V2ZA 1RT2B 2G4BA 4FYYB 2N7YA 3BGRA 3UQSA 3WX8A 4ED6A 4NRUA 1HW9A 4E0DA 4I1TA 3EVOA 2ZM6F 3K58A 1XNRJ 2IVYA 2AMCB 2LKZA 2VBWA 2E5IA 3M4XA 3J7Z5 3HJVA 4ENOA 1NK8A 1Q79A 2DGXA 3MDFA 3EYZA 2YPZA 1T0TV 5B0CA 1LWFB 3D67A 5SUHA 2ZC4A 5IWAJ 3L4BC 4IH5A 4WPAA 5HJYA 4ECTA 3TVZA 2VFRA 3HI9A 2UUBF 3SQGA 3QSYB 1RWVB 5IT9Y 3HX9A 1ZZFA 1YSJA 1KP6A 4F0MA 3NGSA 2HZCA 1TVRA 1S72S 1H72C 5LMUJ 3U1NA 4NCBA 1E6VB 2IM0A 1Y7PA 4DR1J 3ICLA 2MGZA 1YZ7A 3SEOA 2BABA 3BBFA 2HVZA 3O1LA 3QLHB 5KT4A 4RU2A 1MNEA 3WC0A 2DISA 1UZHA 2ZM6J 3MCNA 3MM8B 4NLUA 3R27A 4F4YA 4LF7J 2XY7A 3RG6A 1TMJA 1RT3A 2LEAA 3RB0A 1QAJA 1YQHA 1JMTA 2D69A 4IH6A 4IR1A 4LF6F 4M5LA 4DUYJ 5HBMA 1T94A 2Q43A 2AEMA 1FF2A 4I4BA 4ZPTR 2BKPA 1IBCB 2Z56B 1DAXA 1CJKA 2UUAF 1AZSB 2PE8A 2KVIA 4ECYA 3MTKA 1CJVA 1VQYA 3MMAA 4OV6A 2W7AA 3I55S 1E6YB 4LBPA 5KFXA 2Z4PA 2LFVA 1VQMS 2RU9A 2RQ4A 3FBEA 1N0VC 3MR3A 1BQNA 4DUTA 1RHMB 2BW7A 2FZGB 2RKIA 2Y1LB 4DX6A 4W90B 4MMOA 2QA4G 3GZ7A 1X5TA 3DLBA 3POTB 2U1AA 1OJ4A 2C2ZB 4H4KC 2BX6A 5KFPA 2DYAA 4UOGA 4YS2A 1C0TA 2MKSA 2BQRA 2DGQA 4USIA 4WXOA 2VODA 1IR1A 2NZ4A 3TJ8A 4K4SA 1K47A 3CW2C 4JI0F 5HMXA 3C19A 2Y0SD 2VFVA 2PEBA 4XDDA 2AWZA 2HGMA 3TVKA 1MWQA 4PG8A 2KXNB 3KK3A 2C42A 2P9CA 3R5CA 4HT5A 4F8RA 1G4CA 1Q5YA 4HI2A 3UD3P 1A7GE 3SSRA 3H59A 2JEGA 1V5VA 1WHYA 2M70A 3DGPB 3I82A 1PKUA 3MOZA 3C16B 3LF0A 4Y28C 4MYTA 1OPIA 2H4YB 3WZ0A 4FNHA 1JQGA 2EPIA 3IFEA 3KG4A 1N4LA 2BJ8A 1VR6A 2FJDB 3LTOA 4RJVA 1NAQA 3NS5A 3CCZA 1PBUA 1WOPA 2DH7A 3ELHA 3DKDA 1WEZA 3DRRB 2JC0A 1VQNS 1FJCA 1UVNA 1IN0A 2DHSA 1U45A 3RZAA 3QBCA 2ASDA 1HNVB 2BXJA 2CPJA 2GJFA 1NMEB 5AJ3F 2XTJP 2ZNZA 3OR2A 3QZ8A 1R6YA 4F2SA 2ZHOA 4GO5X 1TKTA 4ZVTB 1Q4RA 1NZ8A 4EK2A 2KFNA 5IT9U 4JI2J 4LRBA 4KO0B 2VPZB 2DGUA 2OPPA 4L73A 3M9NB 4DV2J 1KLNA 5F3TA 4F3QA 3NY0A 5CYMB 3F44A 1Q7YT 2BE7D 1YJUA 3A8IA 4RUAA 1RT3B 2PGCA 3D1HA 1D3WA 3PACA 3Q86A 4IO1A 2QIFA 5ETLA 3MM8A 3TVYA 1HBUB 4C8LA 4R8UA 2V50A 2DR7A 4DF4A 4A8WA 4Q5VA 3R3TA 1IBMJ 2GHWA 3ZZTA 4C97A 3RAQA 3QZ7A 2LYVA 2B8QA 4OFZA 2KN4A 2FGOA 1FKAF 2IBOA 2JHEA 2ZWOA 4I67A 2ILYA 1RA6A 2CPDA 1NLKL 2RKIB 1HPZB 1ZM9A 4DPOA 1KDNA 3M8ZA 1EJ7L 3GR1A 3MAAB 5E41A 2ACYA 4WTYA 3LAKA 3QFWA 4NA3A 2CPFA 4DN9A 4C98A 2V0NA 3AFGA 2HMIB 3PW5A 2FVQA 4NCGA 2QRRA 3NKYA 4USWA 1NO8A 1XN9A 3H5UA 3UE2A 3ZZ0A 3HFZB 3TR5A 4C3KA 4CZCA 3AAWB 3AJ2A 5F8LA 3PY8A 1F9EB 2L08A 3CD0A 1KQFB 2OPRA 3TAQA 2UV8G 4DL3A 1FKPA 3N9UC 4LF9F 2UXCJ 3FEYB 2PT0A 3VGSA 3KK3B 2HQ3A 3OTCA 4LT6A 2KDOA 3DLKB 3BSCA 4CLYA 2EKNA 2ZH1A 4ANEA 1JLAB 2AGQA 4ZVPB 4NEZA 2XMVA 3NAHA 2JEIA 1TELA 3G8QA 4X4QA 4JI5F 1RTDB 2DRBA 4J90A 4K4TA 1X4HA 1IKVA 1T95A 5F41A 2LU2A 1X5OA 3J81Y 3OVAA 1OS5A 4ZPAA 2FJBB 2R42A 2RF2A 3OFFA 1BHNA 2DNZA 4J37A 4JI7F 3M2RA 2FHKA 1T9UA 2IJRA 3EGZA 5KG4A 3KHHA 1PILA 1JLEA 1GMWA 1X31C 4TXSA 4JV5F 4F3OA 3MD3A 3NGRA 1V9OA 3P5TL 4U8VA 3SV3A 3FMBA 3WIVA 2AJQA 4I7FA 2WW4A 5IWAF 4X2BA 1SH2A 1FNXH 5HVFA 1LWCB 1S1VB 1LKZA 2EI5A 3I32A 5BJRA 1ZM4A 3CJ4A 2NXJA 5F8IA 1T02A 2HWHA 3MPYA 4X62J 3OL8A 4ED1A 1JK9B 4WFYA 2A0FB 2B4VA 5L1JA 3KNAA 2P8IA 2LLZA 4DCOB 4LF2A 4LRDA 1N32J 1SH3A 2HFSA 4OZNA 2DNPA 2ZKTA 2CQ0A 3UDVA 3OFEA 1QJHA 2VONA 2ZZNA 4JV5J 3LANA 3D6TB 1BWEA 5L46A 1UEKA 4UQTA 1YRUA 2M88A 3FC9A 2FD2A 1CULA 1IKWA 2V8DA 2GQ2A 2ZBPA 3LGHA 4N77A 4CTAB 2R8KA 4N76A 3TWZA 1UWBA 1V3SA 2ZZMA 4RUCA 3IP0A 3HHNB 2HLUA 4R0JA 1QVGR 4PQAA 4AL5A 2MB0B 2WB1D 4TLQA 3VWSA 1RI7A 4ATNA 5A8WB 1LXNA 4LSNB 1T9TA 2VC1A 4P2SA 5GADU 4QPXA 2GVZA 4ZK7M 4OHVA 1MW7A 2I1RA 1X4BA 2JDJA 2R7OA 1IXKA 4KV8A 4WU3A 4XO0A 3J7ZT 5I4MA 3G96A 3UR3C 4NI2B 4ANDA 5LOQA 4MKBA 4CO4A 1PJ7A 1FA0A 1IKYA 4ZVGA 3B8HA 2LA6A 1IJEB 2FDNA 5IFMA 2V34A 1R31A 2CPYA 2YPYA 3AT1B 5DDRC 2ZBRA 1X4GA 5HQ8A 4GKJJ 2MSSA 1C1BB 1S99A 3M2VA 3M8PA 1WUUA 3Q22A 1X4DA 3M8SA 5KG1A 3DRPA 2NLWA 3LP1A 5A2QU 4KH0B 2HRYA 2VFTA 1Q5VA 1X0PA 1HD1A 2WBRA 3OT9A 3LO3A 5L1KA 2E5LJ 2V4JA 2XSJA 1WC4A 2ZOFA 1ZETA 2W01A 2HQGA 2WAQD 3NCPA 5BYQA 2CXEA 4NL5A 4LF4F 1RE1B 4NMLA 2ROPA 4ECUA 2YNGA 1CQNA 3BN4A 4OYAA 1A9NB 1N34F 5DZ6A 1QTMA 1VRTB 4DUZF 2FJVA 1WG1A 3MM5B 2VOOA 4KFBB 4NYOA 1MSWD 1S9EA 2QO3A 5F3ZA 1WHXA 2XO6A 3BR9A 2BOAA 2MY8A 2F65A 3AJ1A 3CEDA 3NGTA 3PDNA 1FCAA 4MK8A 1NXIA 4XIUA 4USKA 4JV0A 1TL7A 1QE1A 4ID5A 1FKOA 1C4CA 4GVBA 2GNKA 1YWXA 2YWKA 2AF6A 2DNHA 3EXYA 3PYDA 2ZJRQ 4DV4J 1FJGJ 5C42B 3KLIB 4JI4J 1SC1B 2CQ4A 4UZBA 4UTGA 3HT0A 1T9WA 3H7HB 2KFYA 1UJ6A 2D74B 4DS5A 1OY6A 4FNIA 1O51A 2QL5B 5DQHA 4KHPJ 5E7OB 4UT4A 2V8HA 3O3LA 2DTJA 3AODA 2DH9A 4H54A 3TA2A 2VA2A 1KOHA 1KHWA 3WIUA 3OXFA 1QAXA 5D0RA 4I2QA 1HNWJ 3UVJA 2UXCF 1ZTTA 3JSBA 2EXUA 3WX4A 2I8EA 4JI6J 3BJYA 4O3QA 1V3RA 3LOUA 3SZ2A 4LF6J 3EM1A 3MAHA 4WYLA 1JX4A 5CCLA 5BYRA 3IAM9 1RHQB 4NI2A 1YJNS 2B8PA 4MK7A 4PYAA 4YHHF 2XMUA 3ZXWA 3KMSA 1S10A 1KVKA 2ADBA 1RWOB 2FUG9 3G6XA 5F8HA 1LK7A 3DOKA 1S4FA 2YKMB 1XC9A 2CVIA 5DG9A 4DFKA 3SSSA 2NXNA 1MWZA 2V8GA 3M8QA 5LMUF 3ONQA 3LGMA 1Z2ZA 1IKXA 3QLHA 2FZKB 3FFIA 1C4AA 4EWTA 4DV0F 4WF9Q 4OI0A 2AJ1A 5K8PA 3R5DA 4Y3CA 4Q43A 1N5TA 2F7VA 5IOLA 4ZITA 4RR5A 1RT1A 1SQFA 4C8MA 2IRYA 2Y1IA 1F5BA 1AZSA 1JLCB 4IFVA 3SMZA 1Q95G 1UJ4A 4QWAA 2V2KA 5K8NA 3PYFA 1RAHB 2MJUA 2E1PA 2DY1A 3MI7X 2ASYA 2EG2A 2R2TA 1YDLA 1RTZA 4DWIA 3DLGA 3JYTA 4RNOA 3HHLA 2AV5A 2YNGB 2H4WB 3QMQA 4HVZA 2W8LA 2Y9HA 1UPPA 1Q8IA 3CJ0A 1CC8A 2NXEA 3U7JA 4CH0S 5D3GB 2FPHX 2V67A 1EETA 2C2KB 2YVSA 4NZ7A 3PR5B 3P5BP 3BDEA 2HFOA 3P6YC 1C0TB 4M5MA 2H54B 5KFIA 2JX2A 2KYXA 2XEXA 4HHJA 1X9SA 4Y2AA 2MQLA 1N6QA 2XYGB 3P49B 4JI3F 3D66A 4M94A 3EPIA 1N8RT 4M5NA 2A2DA 8RUCA 2LEPA 5GMEA 4EBEA 2BBEA 1BUXA 3TZXA 4DV7J 1SKRA 1N32F 3OFHA 5C42A 4DR6F 2HRUA 4C3LA 1MG7A 1WF1A 2W9AA 2EG1A 1D9FA 3CF5Q 4RWWA 4EBCA 1DY3A 4DR7J 3C6UB 3N6LA 3TA1A 4PXEA 3RB4A 2FLNA 5I3QA 1AXQA 3KLGB 1FFSB 1GX5A 3OL9A 5K8OA 5ETPA 3M1VB 4KQZA 3ZTQA 5F8JA 2WVEA 1T03A 2N4CA 3PW0A 1GXLA 1XR5A 2E9ZA 1Q8BA 4YP3A 2DK2A 3HP6A 1U1KA 4CLSA 1U8SA 3O2IA 2VJUA 1SCJB 2HURA 3P96A 4J7CA 5KFVA 3VZHA 4BBYA 3DLLQ 1UVJA 5CH7B 3NMRA 1JIHA 1LK5A 1TQLA 1RZMA 4AXIA 2CQCA 8ATCB 2H5IB 4KT0C 3SQGB 3RBEA 4MKYA 4WYWA 2ZH8A 4ZP6A 4DSFA 2M5YA 2EEYA 1VQKS 4IR9A 4OZ2A 1FWKA 3R7BB 4C7QA 2AEJA 4X4TA 2W9CB 2G0CA 4QW9A 1WWHA 1FXDA 1TUVA 1WJ9A 4O3NA 3D2WA 8AT1B 1AYEA 3FNNA 4OHWA 4IFYA 2F4VF 2MQ8A 2WONA 1T9XA 2VUGA 2OPQA 4OI3A 5D78A 3MMBA 3BZQA 2CNKB 3W2WA 2IYIA 1BQMB 2YWFA 2CQPA 3KLIA 5K14B 3H4BA 4DR3J 3GP9A 1HBMA 2KU7A 3B4DA 4ZVRB 2L41A 4PWDB 2J7WA 1NH7A 1R0AA 3IC1A 5GAEU 3KLHA 3A3NB 3OVSA 2AYEA 2CVEA 1HBOB 3N6MA 3P3DA 5KG6A 3W2VA 2PSZA 4BCAA 3OXGA 3VGTA 3EUNA 4ZLJA 4YY3F 1RAOA 3G2XA 4ES1A 3MM9B 3KTQA 1BGXT 2HZVA 1FRLA 2CPEA 3CPWR 5HVGA 2Q79A 4C11B 4QU7A 1TL3A 2M9KA 3DFEA 3VV2B 1HYSB 2VDIA 4KYZA 4L74A 4ED4A 5LJ3Y 1UCNA 2DITA 3NNHA 3AOCA 2UV8A 2F8MA 2WK4A 1YJVA 2IMOA 3SDEA 2K1RA 2CQIA 4ZJLA 2QLWA 4HACA 3PJ9A 4KR0B 3ENWA 4HDHA 2YQ0A 3TW0A 9RUBA 4OX9J 3FUYA 2Z57B 4N5SA 1YITS 2J9CA 2NS1B 3ET6B 4FYWB 1IKXB 4B3OA 4DU7A 4N56A 3BGFA 2V8PA 5G0RB 3TA0A 1UW4A 2ZBIA 3B82A 5B7WA 2A2CA 2FGCA 3VAFA 3BBCA 1IBMF 1KKHA 2DPJA 4X66F 1WHWA 5LJ5Y 3DGPA 3QT8A 1TV6B 2FJAB 1D0EA 2PA8D 3WBZA 3BGLA 4NCGB 3R2DJ 2HPUA 2YY3A 1I6JA 2GIFA 2HHPA 4G1PA 4ITSA 4TN2A 3DMJA 4Q2MA 5BXIA 4JI4F 4QU6A 3V6DA 4NRTA 1S1VA 4OX8A 3ISZA 1PYOB 4WCEQ 3LP1B 2VFSA 1JLGA 3HVTB 1NRKA 1B0TA 3FRYA 5G0RA 3T6JA 5H1SV 4DSLA 3NL0A 1S59A 3W63A 1HHSA 3GU0A 3VQTA 3GIKA 1C0UA 2R8HA 3MOJB 2V5HG 3ZZYA 2OTJS 2GMHA 3W9IA 1MWYA 1UKUA 2X7IA 2M52A 3AJDA 3GMGA 4FS2A 1Z4UA 3K5NA 3C14A 1MN9A 3CCMS 1M5PC 2WTFA 2ZFHA 4A46A 5IXUA 3N0VA 2B5JB 3MR6A 2IFXA 4OLPA 3CC4S 4OL8A 4NA2A 5C2CA 2HG4A 3BQ0A 1RYSA 3UDLA 3W2VB 3ZNJ1 4CLPA 2QX0A 2ERRA 2HRTA 3CDWA 2BJDA 3CJSA 1RWWB 3H0PA 4ICLA 3GV8B 1FXRA 3CMAS 4FF4A 2DCLA 2W4DA 3HD1A 2MTLA 3B78A 4KBIA 5A2QY 2E5LF 2O3DA 2QV6A 4LSNA 2ZJPQ 4GRSA 1P6TA 3HO1A 3NRBA 3VCDA 4QR0A 1OO0B 5HANA 3DHXA 2KZMA 1LWCA 2EFQA 5HN0A 2GX8A 1N52B 3BF4A 3D6HB 1Y3KA 5IZHA 4LF5F 2VZ9A 4OYMA 4EYIB 2BRLA 4DV6J 3NXZA 3ZC4A 2XYHB 2D3ZA 4ELUA 4I69A 1PC5A 3I31A 2R8IA 1QSLA 3NMAA 1LWXA 5LSLA 3G6VA 2NCKL 3MAAA 3ZZPA 3PIOQ 4ECRA 4JI8J 5DLFA 3JAMU 1DLOA 1TMMA 3D68A 4I56A 1FTRA 2ZNYA 4KGMA 1VLOA 4YMEA 1YBTA 1RP5A 3AXMA 1TK0A 1HWLA 1Z2LA 2EWHA 3M05A 2YQ1A 1UMJA 2BQ3A 1NK9A 2QJ3A 2W8KA 2M8DB 3IM9A 3A3PB 1RLDA 1S9FA 4F25A 4FDFA 3NAIA 4TU9A 4F26A 2C22A 1K1QA 2MQNA 1HI1A 4RL1A 3DRYA 2FB0A 5K14A 4BHQA 4CQ1A 4ZIWA 2E5JA 1XMBA 3IBFB 3W8GA 1V5IB 2P6TA 2MJNA 2QL7B 3CTRA 2O1PA 4DLEA 2LDYA 2RDIA 1T3OA 1XNQF 1N33F 4IG3A 3I4PA 1LOUA 4EU0A 2MKKA 1CBKA 4LJMA 1N48A 2NPIA 3ILLA 4LF7F 1FK9B 1XEZA 5IM0B 4RPFA 2X3DA 5KFUA 2YTCA 4CH7A 3RW7A 3IWLA 1M1HA 4P75A 3SSQA 3QO9A 2D3OR 2ZZTA 1VOMA 4NLDA 2CADA 3KDOA 2G2YA 3AD8C 3C66A 3MR7A 4IUFA 3HVAA 4G1QB 3DYAB 2DKOB 2H9ZA 4WK1A 1U1NA 2PO4A 4YUDA 3DN9A 2PI4A 4BC9A 4FXDA 3KXDA 3NGKA 5JJBA 2OUGA 5ETTA 1I94J 4MFBB 4P10A 2YNIB 1UFWA 4ED0A 3WQPA 1SB6A 3HZEA 4J9LA 3ET6A 5D6GA 3KLEA 2V4QA 1IBKJ 5DLGA 3VVTA 5AJ3J 3GIMA 3TRGA 1X0FA 4DR7F 3OFGA 2XMMA 3N01A 4UOCA 3T6BA 1F3VA 1YJRA 4ID8A 4MKAA 5DS7A 4QYZJ 3TUJC 1ROFA 2ZHAA 1REVA 4UOFA 4LBIA 2X1AA 4AD6A 3BYPA 3DNCA 3NNCA 4DEZA 2XWXA 1SI9A 4KRWA 1N34J 3AH6A 5D0EA 4DR5F 2K8GA 3S1TA 1AUDA 3C6UA 3GJRB 3RRGA 1RAIB 1PGZA 1YJ7A 1RB0A 2GZOA 3MM9A 3D7SB 4ZP9A 2Y0BB 1IQTA 4Q0BA 2LVWA 1RU2A 1YLXA 3HHLD 4AE5A 1FJGF 3KUGA 2WVFA 1P8GA 4KE5A 3MECA 2BE9B 4KGKA 1PJ6A 1S1UB 2HW3A 1DTTB 3G6ES 2HGLA 3PNIA 1NK6A 1Q8LA 3GIRA 4RW9A 2ROGA 1FWPA 3GYNA 4WE1B 3VVUA 2MMYA 4LIWA 4WTOB 4ZN3A 1X60A 3BR8A 3CCUS 5DG7A 4X64J 1S0VA 1ZM3A 3O44A 4FPIA 3AD7C 2XMWA 1OSCA 2IPOB 4NLPA 3J80U 1DBDA 2HSEB 4KSEB 2V4JB 2XSJB 2AHOB 3AQOA 3LA0A 4DG1B 2Q6CA 4MYUA 1N36J 2OTLS 1HQEB 1WD6A 2DXFA 4CO1A 2E44A 3OHAA 1C1CA 2ABYA 4C6AA 1P9QC 1ZPVA 1S4EA 4CLKA 2WW8A 4K4UA 2QTWA 1NSQA 1DTTA 4URQU 1JLQA 3W8PA 5AXMA 1CS4A 4B9VA 1Y5IB 4KB7A 1C2PA 1RCXB 4F36A 2C28A 5DETA 1FEHA 2KXFA 1NKEA 1KD1T 4B3MF 1JXVA 1VDHA 3DGVA 1S9EB 4OX6A 5IQQA 2IC3B 3CIZA 4B9UA 2UZAA 1NHKL 4AUKA 1LW2A 4OMFG 1QE1B 4ID5B 4USMA 3TZYA 3W5XA 3MUMP 4C0BA 4FBUA 2RVJA 2ZOGA 1NBEB 1SC3B 1WKKA 3DLEB 4OJGA 5LM7E 3S8SA 1RBOB 5KFMA 2PN6A 4PWWA 4KHPF 3CDEA 3T19A 4DFJA 3W62A 1VS3A 2BJ1A 1U47A 1O0PA 1G2EA 1TZ0A 3BBBA 2C2NA 1NJZA 2HHHF 2UUCJ 2O01C 3CIMA 3PW2A 2HHSA 1CJVB 4DUZJ 1SC4B 3FCVA 3BYRA 3MUVP 4WP3A 4YR0A 3IAS9 2X1BA 2DR9A 3EMTA 2YX1A 4YDDB 1ZOTA 2PFDA 4NWBA 1URNA 1X4EA 1FE0A 3QT7A 1YGYA 2MKYA 1D9DA 4DV1F 2KKHA 4KJIA 4A47A 1H73A 4QOTA 1KN6A 1H6KX 2PD1A 2HHTA 2EK6A 3BGRB 4O44B 5HATA 4DL0C 2XWYA 3J81j 3MEEA 3QAEA 3X3UA 3VAKA 4D3HA 4C3MA 2IM1A 1CJTB 2F9JA 1S76D 1RAEB 4DV0J 4M63A 1HR0J 1VQ8S 2UUBJ 3D0HE 2CQDA 3MPVA 4GKKF 1FERA 1JLAA 3MR5A 3OPKA 2J6SA 2E1AA 3GFYA 3LW5C 1TP7A 5KFSA 2CIMA 1NEEA 2VQFF 1HHTP 2HIYA 2QLXA 3Q8YA 2RE1A 4UF4A 5EGYA 3VZIA 2G1HA 3W9JA 3IM8A 3HMJG 4DV1J 2HHQA 3M2RB 3D0IE 2KT2A 1Z1ZA 4ECSA 1BMQB 2D41A 3T9NA 4DG1A 5C25B 2CYYA 5DJBA 4PXDA 1N5YB 1CVJA 2OH2A 1WORA 3DOLA 3G87A 5B0DA 5HLFA 1R43A 3M8PB 1PO6A 2DEIA 2V9WA 4HYKA 3K7RA 4FVCA 2QMXA 5F0WA 4NLVA 5LXRA 3BQ1A 5D4PA 2L48A 3PM9A 4OZLA 2XHCA 2VASA 5FDLB 4KH1B 2RH3A 3NS6A 1F2HA 3PIPQ 3AXKA 3HHLB 2XS7A 4RW8B 1OPZA 3D5MA 3QGPA 2BR0A 3Q8UA 1QVFR 2BKOA 3HSDA 1U2RA 5KG0A 5CYMA 1L5UA 3W2WB 1RU1A 5L8RC 4QWBA 5GAGI 3MM6A 4TLRA 3F73A 4J9SA 2C2EA 3UN2A 1NKBA 4PWDA 4ZHRA 2D1CA 2GAHC 5BR8F 4Q2LA 2H3EB 2DNLA 5EX0A 3PW7A 1F5CA 2XC9A 2QT7A 3DM2B 1W26A 3EVWA 5FDLA 2GVZB 3MMJA 1L3SA 5D15A 1RWNB 3TNVA 1JLBA 1KONA 5A8WA 2UUAJ 1S1XA 2M2BA 1VCTA 2H5EA 1KQSR 2XLJA 4O3SA 3CCJS 4DUYF 2JL9A 5B0EA 2D7SA 2PMZD 5B08A 1PG5B 1RTJA 2Y8WA 4U7CA 3Q8VA 4NPOA 1Y9OA 3M32A 1RTHB 4B3TF 2DR6A 4CLWA 3QGGA 2KZZA 1ZPWX 2AT1B 4PRFA 1RT6B 3K5OA 4MJKA 3QSIA 1VRUA 5DQGA 4NMXA 1LFPA 3ISND 2CZVC 3JXOA 1BD6A 2A18A 3K57A 5L1LA 4AQYF 3RAXA 4DN0A 2UXBF 3CCQS 4XPCA 1WNEA 2W2OP 4K5RA 3QNWB 2DIUA 4I68A 3BS9A 3R5JB 3TAMB 3IWNC 3CJKB 3M6XA 3T41A 1F9FA 1FKPB 2PMWA 5KFOA 2XMJA 3RRKA 1JJ4A 1RUSA 4LREA 3PHEA 1Y3JA 2CRLA 3G86A 3R9LA 3J7YU 3POTA 4JP8A 4WP8A 1KS2A 1QM9A 3H90A 3MTJA 1EZZB 4P6QA 1UVLA 2MKCA 4PABA 1FK9A 1S9GB 4QIEA 1TL1B 5IM0A 2C3UA 3M30B 3CSKA 2A3JA 3W65A 2B4UA 1QD1A 1NDLA 5E3CA 2EFPA 4DQSA 3CNQP 2GS8A 4USTA 4B3RF 2UU9J 4M1KA 1QUPA 3FSXA 4WE1A 3IR6B 3KG0A 2W2MP 2RF2B 2DNYA 3C16A 2YWEA 4RBTA 4QYRA 1K44A 2RRBA 3KUHA 2C3YA 2J7UA 4FS1A 3W5ZA 2QMWA 1PAUB 4HHUA 1W2BR 1S0MA 3C2PA 3I6PA 3IG1B 4C8OA 3L3CA 4USUA 2V4RA 4ZPCA 2GMJA 3LH2S 5KFAA 2WRMA 2YX7A 4W4MA 4GO7X 5IV3A 4DPUA 3TUIC 2C2OB 2CJ9A 4DDFA 4W92B 4J9MA 2CWXA 2RAQA 2XCAA 1J5EJ 1DTQA 2L9NA 4MT1A 4RBVA 4M8LA 5J1NA 1RWPB 2H65B 3TP2A 4DPTA 5LSRA 2CWKA 2GVDB 2XMKA 1VMBA 1S1TB 4LFBF 4RW6B 1CULB 2HQDA 1R6VA 2RIJA 4USVA 2PI5A 1OQ3A 4CO5A 5IC6B 3CD5A 3J7A1 5CZXA 5J2PB 3GFXA 3JSRA 1TKDA 1KQGB 3OJSA 1NB7A 3KK1A 1NJXA 3CC2S 2BE2A 4F4WA 4ZVOB 2AJ2A 1R7IA 1GXTA 4I64A 1HBNB 4TU7A 2WZ1A 1SL1A 1RKIA 3HVWA 2C2RA 1KNZA 1S1UA 3UCGA 1NDPA 4JI7J 3CDUA 2ZH6A 3TI0A 3HK2A 5ITHA 4ZP8A 2XSFA 5U47A 3H5YA 5FIIA 1U8WA 3IXQA 3CJ3A 2J0QD 4RW9B 4ED2A 1GXUA 3VGUA 1U1RA 4KPYA 2DD8S 2HWIA 3EGVA 2DBBA 4DV5J 3ZZZA 5HSPA 2ZH3A 5A8KA 4LMZA 4GVLA 4M5KA 2XULA 4CNYA 2P6SA 3T3FA 2QEXS 1X4AA 1JNZB 3C14B 3DYAA 3HVTA 1RT5A 2H5JB 3M30A 3RBZA 4LF9J 4DL6A 1LEOA 1S9GA 5HQLA 2OFHX 1C0UB 5LSOA 1VQ6S 1BWVA 3GONA 2GGPB 1TKXB 4FF2A 4C8YA 1SIWB 3TZWA 4UQGA 1NJIT 4TVAB 1Y5LB 3MFHA 1AFJA 4K59A 1LW0A 1M0SA 3DCAA 2CPZA 1SQEA 2XGQA 3G8TA 3OJUA 3FVYA 1HARA 2AP6A 3DRXA 3EICA 3GJTB 1XBWA 1RSCA 1HWUA 3AOAA 3DRPB 4PKDB 3DM2A 5A6PA 2IRUA 1VFJA 4UUWA 4QR2A 3EE3A 1IWAA 3JYTB 3UCUP 3P45B 1D8YA 2IC3A 2WSFC
chains in the Genus database with same CATH topology
3NP5A 2VKZG 4HT7A 1RWUA 5GADI 1NJWA 2M3DA 4DF8A 4RW7B 1BQXA 2KJVA 4Y65A 5CQGA 2N82B 5E3RA 2G9OA 5CYQB 1SV5B 2R7QA 4G1QA 4QWCA 5E2QA 3HJFA 4GC7A 3N79A 3GSDA 4ZPDA 3F56A 1M5SA 4RZRA 2E66A 2BJEA 4F50A 1BC6A 2HIQA 2OP5A 5DG7A 2L3MA 2LQBA 2GV1A 2JFDA 3DLHA 3CE8A 2B9WA 3T5HA 3TO8A 2AYGA 1HYSA 2AGOA 1Q81T 2VKRA 3MM6B 3JAMY 5I4MA 1PGZA 2XNRA 1UETA 4I2PA 5E3QA 4ZDNA 3CCWA 1SV5A 2Q6BA 2EKYA 3AHPA 2E5HA 5J1PA 1RT7B 2B43A 2LMIA 1FJEB 4G3IA 1Q1KA 3OTEA 2B9YA 2E7XA 2RDJA 1U4BA 4L72B 2DNKA 2JC1A 2OKQA 1LWEA 4R25A 2W9BB 3TARA 4N41A 3G9CA 3QJJA 3E51A 1KOOA 3HF5A 2JVRA 3QAUA 2CZ4A 4L6V3 4OX7A 3JTNA 3GG0A 4URGA 4DS4A 3PJWA 4KHRA 1NKCA 2OPPB 3PO4A 4C9DA 4OZ1A 3IS9A 3Q23A 2VA3A 1VBXA 5C24A 2DNQA 4WK3A 3MMCB 1CSJA 5DDOC 1JLGB 2UUTA 1F0XA 1JLFA 2V8VA 3GR0A 1FDDA 1RK8A 1HI0P 3Q2SC 1R3NA 4QBUA 4RNNA 2I5JB 4O0IA 2FVPA 5GAHI 2OFGX 1Y00A 1U09A 2XZWA 1IUJA 5F8GA 2IM3A 4DFPA 4KTQA 5HL7Q 3LAMA 4RUHA 4DL4A 1S7HA 2R7WA 1HWIA 4NLYA 1RISA 2WHOA 2CQ2A 3VAGA 4MTPA 2VG6B 3PVXA 1K1SA 1FO1A 3H5SA 4UY8T 4PUOB 3DLGB 3HHKA 2DVIA 3K0JA 4I6AA 3GFHA 4EBDA 3K5LA 2YKAA 2WSEC 1OSDA 4YDXA 4PPZA 5B0BA 2KI2A 1NK0A 1HBNA 1HNVA 2POKA 3OL7A 3UPFA 2FTRA 4ICLB 2FC8A 4OZJA 3K2YA 3SV4A 2OO4A 2DGVA 2JLEA 5B0AA 2XO7A 2ZBCA 2DNMA 4DLGA 2O66A 1HMVA 1E6YA 3PFEA 4Q8EA 1S1XB 2HLTA 3U1MA 2XHWA 1KFDA 1S6UA 2JH3A 4FP9A 3EXCX 4QWEA 3KHLA 1UP1A 4NXMF 1PSDA 2EW9A 4CNZA 1Q16B 3EPGA 2IYGA 2MHNA 5KT7A 3M2UB 4DLEA 1R8CA 5A0YA 4A8KA 2YKMA 3MFIA 2CJKA 1CLFA 2FJEB 1K73T 2W9BA 1FVQA 4K4VA 2CFXA 1H2VZ 1LFWA 3ZZRA 3M9MB 2F8HA 3O6QA 3ZFVA 2YH0A 2LU1A 4RKUC 1U1OA 5DO2A 3LP0A 5K5MA 5B0GA 5AE1A 1FESA 1A6LA 2LXFA 4AFFA 2CDQA 3BQ2A 1XK8A 5D4NA 1FDNA 5KG7A 1SXLA 1HFEL 4TYAA 4ES3A 2KT5A 2M8HA 3CJ2A 2KM8B 3DRRA 3R1HA 2CQGA 2C3PA 4MIAA 4IG3B 5E33A 2UVUA 2KYZA 5A6WA 1O8BA 4RLEA 1KRPA 3CD6S 1U1QA 2X3GA 1YRXA 2Z2LA 3SYZA 3FZBA 4M5DA 3VAJA 2ZH5A 3KLHB 3RAMA 2HGNA 2V9KA 2J0WA 4KFBA 3J80Y 4DV3F 1VRTA 2CQHA 1J5OA 5KFRA 1S6QA 3SCLE 2E5GA 2ZVSA 1X9MA 3VR1A 4J9PA 3D1QA 3GILA 4A8OA 2E1MC 1SJ3P 3Q8SB 1TFYA 4RX6A 3EX7B 1M5HA 4EZ9A 4Q7AA 2B6AA 4ELTA 2GHPA 3EGWB 2FVSA 2N3OA 2RQKA 3I4HX 5KT3A 4C11A 3H4DA 2NREA 1S0OA 5J1EA 3IA0A 5I3PA 3V2UC 2FVRA 3AQPA 4NLWA 4F4XA 3OW2R 4EYHB 1HA1A 1V6HA 4IH7A 5BYSA 3BSAA 3BSNA 4PQUB 3PW4A 4TU8A 4WXWA 4O4GB 2KFZA 3C3LA 1HD0A 2HHVA 2BANA 2COLA 4URSA 4C8NA 4TKTA 1H7WA 4ZVEA 3TOQA 3ZZTA 4ZA1A 1JB0C 2VBZA 5HMWA 4ILLA 1VC0A 4I2PB 1KVJA 3US5A 4OJ3A 4H4OA 2ZDPA 3OTBA 4Z2XA 3DHWC 1H7XA 4CT8A 4DR2F 4M95A 1P1LA 2AGPA 3HXMA 2CG4A 2GA7A 3GYXB 3HM9A 4IOBA 3LP2A 5E3PA 1WI6A 5E0OA 3W7BA 5C25A 3UNGC 3CVKA 5EHHA 2MZRA 3R5AA 3CUNA 4WKRA 2KT3A 2VH7A 2YKNB 3WDOA 4R8UB 2HWTA 2OD4A 4FXWA 3JTOA 5M2UA 1UJ5A 2AX0A 4Q44A 4HTIA 2IAJA 2XY5A 3IN5A 5C24B 2HHWA 3CC7S 4PG5A 2GJIA 2DHAA 4J9KA 1EP4B 2FC9A 4DV7F 1TL3B 2X1GA 3OBIA 3UFCX 2ZKUA 4AL6A 1S6QB 2W4PA 1DURA 1YJ9S 1J5OB 1RA7A 2RS8A 1NHVA 3OVBA 4OHYA 4A8MP 1GX6A 2IBKA 1TKTB 1XERA 1UEVA 3L95X 2PFFB 1HNIB 1S6OA 3SFGA 1TAQA 2MXYA 4B3OB 3H40A 2LDIA 1WG4A 2JVOA 4P7TA 4LSLB 4E98A 4ECZA 3KJVB 1HNXF 4B3SF 1K0VA 3KOAA 2J9EA 3RB3A 1IKWB 4TY9A 5GAHU 4OI1A 4GC6A 1VK8A 1JJ2R 4K4YA 2KXHA 4X64F 3M8QB 4FZVA 2XGPA 4O3PA 3DOKB 1N5QA 1R8PA 2A1BA 3U1LA 4ZLPA 3NBPA 5KAKA 3N6NA 4RWXA 2QSWA 5F0UA 2GO8A 2J8AA 4L3NA 2MHEA 4QWDA 2AQ4A 1VQ9S 4U7UK 3NCRA 2RT3A 2VBYA 3M8RA 1VJWA 1W2IA 3ENVA 1APSA 3QWUA 1YHQS 1VQ7S 4QQBA 1FRHA 3KMQA 2ASLA 2BDPA 2B56A 2ZE2A 1SL2A 1KLMB 4K2XA 3GIJA 3CCVS 3G4SS 4DX8H 3GWCA 2HFZA 1L3TA 3H20A 1ZTWA 4LVNP 4JBCA 5K8MA 1FD8A 2MZQA 2HNYB 3VAHA 3MEDB 3HKZD 1M5VC 3KLVA 4EO8A 2HQIA 2CQ1A 3PEHA 2HFNA 2RNEA 4RNFA 2DPIA 4EUVA 3DLEA 1M1KT 1NHUA 1VQPS 1FD2A 3QYYA 2HS0A 1TAUA 2WOMB 1MMNA 2WCXA 3MM5A 3O8WA 4RW8A 1DHMA 2PC6A 4QIVA 2IA0A 4V19X 2MQPA 2I0XA 3OUYB 3EZUA 3KK2A 2MGZB 4FYDA 4DQRA 1HW8A 3PKMA 1GH8A 2KHCA 2E1CA 1TVRB 4N8OA 2JLGA 2VD3A 2B9XA 2DHGA 2J76E 3O5TB 5JUMA 3TQ1A 4WFXA 1P1TA 4CO2A 4DOZA 3IO1A 1CG2A 5KG2A 1UA0A 3N28A 2NUHA 2MQMA 3RRHA 1ZH5A 1HI8A 3FGVA 4Y34A 1ELOA 4LSLA 2K1RB 2R2SA 2ZH7A 1VIXA 2APOA 4HH0A 1FDAA 3LALA 4LUBA 4NXNF 3LPYA 1FEEA 3CGIA 3KK2B 4K4SA 2EC0A 2MKIA 3M6UA 2AYBA 3SI8A 3K8WA 1JXLA 3OHBA 5CD4H 4X4RA 3S6EA 1R89A 2MYFA 5KG5A 4IG0B 2VG5A 1KTVA 3JSYA 2C3MA 4AL7A 3ZZOA 2OPQB 4OZ5A 3THPA 4FBTA 2G1DA 2R2RA 4XPEA 2NUUG 1QSSA 4DQPA 1JWWA 1LW0B 2RMLA 1HBMB 5HLFB 1D8ZA 4JOUA 1RT4A 2F40A 2GGPA 3U02A 4DJBA 1KFSA 5HP1B 2AJ0A 4OHXA 5AXLA 4ZCLA 3FCHA 5FLXY 1JNRB 3PX4A 4RU9A 3DLJA 5D4LA 3QGHA 2HNDA 4TQRA 5CCMA 1YTYA 1G3OA 1P27B 1YRTA 2HHUA 3M6WA 4TQSA 1WF2A 5IS2A 4DV5F 3LWLA 2F3JA 2VC0A 3T5JA 3KLFA 4B9LA 3KLEB 2OD6A 1U7LA 3LP2B 3MZIA 2EFNA 3I9V9 2N3LA 4B08A 4IO9Q 5J2QB 5DGAA 2HVIA 3IWXA 1NH8A 3OLBA 3QIPA 1NK7A 2AX1A 4XAKA 1VBZA 5A8RB 2BV3A 4WKYA 2RQMA 2I9SA 2BA9A 2BQUA 2JEJA 2ASJA 2NSBA 1U1MA 2DRAA 3NG8A 2W7OA 4YB7A 3BSOA 2BVZA 5EWFA 2IJFA 4RW4B 5I3UA 2FLLA 2VPWB 2MSTA 2ZUGA 1SBRA 4MIBA 4CI0B 2MY7A 2NXUA 1DJ0A 1G6BA 2AJFE 5FD1A 1TKZB 4H4KA 3V6KA 4K50A 3ENQA 3UWTA 2AW0A 3H2UB 1TK5A 1ZZNA 3K5MA 1XMQF 3QJPA 1AW0A 3RU0A 2ILZA 4HDGA 5EUHA 1IBKF 4OI6A 1U49A 3SCKE 2W24A 4ETXA 3MR2A 1QY7A 4F3MA 3EGNA 1KR4A 4QIGA 3M9OB 4ES2A 4ETZA 1GTEA 3PXGa 3SCIE 3BO2A 1FDBA 2M0GB 5KFDA 2V94A 3RTVA 1X9WA 3PX6A 1DQ8A 4TNOA 3AB2B 3HZGA 1FRXA 3N5FA 2BE2B 5AXKA 1K9MT 4H4MA 4EGLA 2LQJA 2KRRA 2K7KA 5CXTA 3FDSA 4ZCIA 1FXLA 1N5VA 3QPIA 4O4RA 2RS2A 2A10A 2F9DA 2HNDB 1TL1A 4I2QB 4OJ1A 3U7JA 1WG5A 2OAUA 3CDBA 4XK8C 3A8EA 3OTOF 4R5PA 1JLFB 4DV2F 1B64A 2K3IA 2HAIA 3CB4A 1IM4A 1YBAA 1TKXA 2OSRA 2FHOB 3M6VA 3MWBA 5KOWA 5KT6A 1N5YA 3FQKA 4ZCKA 3TYTA 2RILA 3HFKA 5DDQC 2UUCF 2GQCA 1JKHA 4Y2CA 2FHMA 3DMJB 3HPOA 2ADCA 3CDAA 3JTPA 4ILRA 1FRIA 2B7BB 3IG1A 4OHZA 3V81A 4ELVA 4FF3A 2AJ4A 4N8NA 3QWPA 2ALZA 4B9NA 3UI3A 3Q8QB 2C2DA 4DL7A 3I0RB 2IA6A 4UY85 3HVRA 2XBPA 3ULHA 3CWJA 3H2LA 4XDCA 3CCLS 2KG0A 1QLNA 5EDWA 3OL6A 4Y6IA 5KFTA 4LIRA 1UL3A 2BACA 1X5PA 3GIIA 1T05A 2BUNA 1TKZA 1WTFA 3KKFA 2XMTA 4CO3A 2CJAA 2YWGA 5KFWA 3C6TB 3MEKA 5L39A 2R8GA 3EGZA 3D28A 4NA1A 5J2PA 5G4DA 4Y2IA 1MROB 3PR4A 1XMOF 1ZBTA 4ZHRB 3UDCA 5D4OA 4NX9A 2CPIA 1XR6A 5F8NA 2BZ2A 3GE9A 3I5CA 2DHXA 3KFWX 2RU3A 2R7RA 1SKSA 1RYRA 4IOAQ 1YVFA 2DCUB 2DNRA 1IJFB 2OPRB 2J9DA 4C8ZA 2ZOMA 2DGTA 1JJHA 1FRMA 2PMHA 3T1HF 1CC7A 4J9OA 1RTHA 1Q86T 2XLKA 2R7SA 3K59A 3DLKA 2J7KA 4ZOSA 5B0FA 5KFFA 1WTBA 1X8DA 5THWA 5FJ4A 3X1LB 3MGJA 3QO9B 4F4KA 4OIXA 4GKJF 2X51A 4YOEA 2MPUA 1HNZF 3S7RA 2EFOA 4R5PB 1GQEA 3MUTP 1DARA 4HI1A 4X4VA 2O67A 1ZAWA 4EZ6A 3LWMA 3HLUA 4LFCF 1W25A 2R7VA 2HS4A 4B9SA 2KB2A 3NGDA 3MMCA 2VOPA 1FNOA 4KC5A 5L38A 2QSFA 3PKYA 4ED7A 2PDAA 1C1CB 4F67A 3IS9B 1KTQA 4LVOP 3MXHP 3DDNA 5HP1A 5MAOA 2FJWA 5E3AA 3Q2TC 4M5DB 1EETB 2IHR1 2D9OA 4HH1A 4JV2A 5D3GA 1TL4A 2VG6A 3THVA 2GO9A 4ZPVR 1H3DA 1B7FA 2IAJB 3IRXB 3E8OA 4ZS6A 2JOQA 4QR1A 1EP4A 2P5VA 4DMZA 3KLFB 3L7PA 4OX9F 5AE3A 5EX3A 2I38A 4Y2KA 4IKAA 1I1GA 4ED8A 2PEHA 5M2RA 2MZSA 2FY1A 2GMLA 3CCRS 4C2MA 3NWGA 1VBYA 1O5JA 1SUQB 1S1TA 2YKPA 2YNFA 2VPYB 3IBWA 4CIOA 4IRCA 4P7VA 1N56A 3V6DB 4DSKA 3KG1A 3CULA 2DGSA 3V6HA 4ZCMA 3G8SA 1RQ0A 1MMDA 2BANB 4MIWA 5LT5A 4DR4F 4I6YA 4YB6A 1YI2S 1K0TA 3HKWA 4NLQA 2J6TA 4B9MA 1AFIA 2KO1A 2LCWA 1F60B 4JI6F 4WFBQ 2B5JA 3DI6A 3BO3A 3I87A 3B4MA 4JV1A 2YKNA 3V5RA 4YR0A 1TL5A 3HHDA 4DR1F 2L9DA 1AROP 2EVZA 3KNGA 4FF1A 1MU2A 3CJ5A 1FT8A 3RYLA 2KJWA 2MZTA 3SFUA 5HROA 3TX8A 2CQBA 3BM7A 1S49A 3N4WA 2FHJA 4RBUA 4K4WA 2W25A 4C4WA 2YWHA 3L09A 3Q8PB 4DL5A 1RT5B 2WBMA 2R7UA 2BM0A 2JEFA 4NCAA 3U27A 3C6TA 1NJYA 4WFAQ 2CJBA 4HEA9 4X65F 2P9GA 4PUOA 3H5XA 5KFEA 1HBOA 4LQ3A 1KHVA 1WACA 3DU5A 4CT9A 1HBUA 2NPFA 1R0AB 1FRKA 3THTA 4RNMA 4ZKAA 1UEUA 2OPSB 5DGBA 3V81B 4LFAF 3HHLC 4BWMA 1JLCA 4IFVB 3CCES 1CQMA 4F2RA 4U9RA 3MHYA 3KJVA 2YX4A 1PC4A 3BB5A 5LXYA 5DM7Q 4QIWD 3BGUA 3GV7B 7FDRA 4B9TA 1G1XA 2UXDF 2ZD1B 1LQ9A 2JFKA 1NK4A 3FEXB 3VAMA 3UW1A 1J5EF 1Y0HA 2HYIB 4LF8F 1SUQA 2YNFB 1T05B 3OSPA 1ULRA 3FSYA 1C1BA 3H8YA 4ECQA 2CKWA 2NQPA 1HR0F 4WFNQ 1N5SA 3V4IA 3MECB 2FLOA 4ZVFA 5MLCV 1TV6A 2JWNA 1IR0A 4FXVA 1HWJA 4NYZA 1KC8T 3K5PA 1XNRF 1L3KA 2Q1LA 3T1AA 2YKOA 5DDPC 3H25A 5ADZA 1ZAVA 3BN7A 3I0SB 4U67Q 1SL0A 3M1VA 3E01B 1X4CA 3VALA 3UCZP 4KV8B 2PIIA 3TANA 2HNYA 3VQSA 1YJWS 3R1LA 4O23A 3KLGA 5KFCA 1NNDA 2R4FA 1HWKA 2RUGA 3ITHB 1T8EA 2RQCA 2OLWA 1B0VA 1WELA 3MEDA 5L9NA 5J2MA 1JLEB 2GJ2A 5JVHQ 3MD1A 2N4DA 4IQMA 3MURP 4H4OB 1HQEA 3AA9A 4A8FA 3M2VB 4Q45A 1U25A 4YQWA 2WB4A 3MEGA 4RW7A 5HMYA 1REVB 4OV1A 2YKQA 4Q8FA 1U6BA 1XTZA 3GG1A 1WHVA 2HS3A 1S1WB 3D0GE 4FN5A 3VF0B 4YR2A 3BDPA 1WEYA 4F02A 2CPXA 4TYBA 2R8JA 2E1RA 3CO9A 3HHEA 1X4FA 2DR5A 2JJ4D 4C8KA 1BQMA 2E9RX 2ZH9A 4ZVHA 1VI7A 6FD1A 5IQ6A 2XS7A 3MM7B 2FIUA 4IFYB 3M32B 3BREA 3VAIA 4NYPA 1RTJB 3MEGB 4X4NA 2B6AB 5KFGA 3NLCA 2Q3PA 5M2PA 5AXNA 3SCJE 3IR5B 2J0SD 2L9WA 4WIIA 4FPRA 4QPTA 2VG7A 2ZD1A 4B17A 3CMES<