3N4XA

Structure of csm1 full-length
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
163
structure length
149
Chain Sequence
SADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Monopolin Complex Crosslinks Kinetochore Components to Regulate Chromosome-Microtubule Attachments.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
molecule keywords Monopolin complex subunit CSM1
total genus 48
structure length 149
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3n4xA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3n4xA02
1IC2A 3VP9A 3N7NA 3C9IA 3U1AA 1X79B 2JEEA 3OJAB 5BU8B 4ZKPA 5BU5A 4O9BA 1NKNA 1WT6A 3BASA 5KTBA 3N4XA 3U1CA 3HRNA 2FXMA 3BATA 3N4RA 3U59A 3P8CD 4N3YB 4GIFA 4ZKUA 5BVZA 4I1LA 4N78D 3N4SA 3VP8A 2POHA
chains in the Genus database with same CATH superfamily
2N1TD 3TATA 2ZYAA 3NUIA 1GL2A 3I4JA 4ADCA 1IK7A 2XZRA 2Q6QA 2QEXP 1PIXA 2P2UA 1SZUA 3PD6A 2FNIA 1L0LG 5E79E 3TYYA 1B5OA 1RV4A 1NTZJ 1NTME 3RCHB 3WY7A 3H32A 1NTMJ 1AMAA 1LWUA 1URQA 1TATA 4EB5A 4H44C 1M1KQ 1A02J 1ZODA 5E5IA 1JMBA 3PTZA 3Q8NA 3KPEA 3V2QA 4DBCA 1VQKP 4U3FJ 2R32A 2D7YA 1NTKE 4RJ0A 2KNCB 2X5FA 1QIRA 2Q3EA 4C7RA 2Z9VA 1UIXA 2FFDB 3MUDC 1X8YA 3N75A 2C7TA 1AMSA 4W80A 4OBUA 2WSEJ 2VMVA 3HD7C 1X22A 5CMZA 1FG7A 4Q31A 5E79H 2FKIA 5G2PA 3W1HA 2HG5D 1KORA 1JY3N 1DIPA 1LGHB 4OMAA 4BXLA 4R5FA 1NTMD 5B5EE 1OZHA 3U1CA 4UOYA 2AEJA 1G4VA 4XJLA 2FM1A 2XNDH 2PGDA 3H1JD 5CHXA 4GOEA 1KILB 4OYTA 3E1IA 2QJPB 2HODA 2W8JA 3CCSP 3EZSA 3OA7A 2JGTA 4H44B 2WSCH 3H7FA 1R5LA 1CSBA 3FXDA 1VQLP 1NU1J 4R8DA 3BWNA 5CCGC 2RN0A 2WKAA 1LS3A 3FFHA 2E7UA 3RL0g 2ZY4A 5HXXA 1E79H 2FYUD 3VK2A 1LWUB 1J1EB 1WYVA 3PH0A 1H0TB 1KQLA 3GSBA 2Z4EA 1NYHA 3RK3E 4CBSA 1N8PA 3CXHE 2Q3IA 1ZRTD 4ADDA 3ELPA 5L8RJ 5KAIE 4PD4I 5AX8A 4WYGA 1NTKG 2BI9A 2SPZA 2ZXEB 1OFCX 2N1TB 1SQPJ 4DCKA 3AEDC 2OKKA 3LW5H 5AVUB 1WMKA 2FYUE 1WYVB 2ZC0A 1LT9C 1E5FA 1H88A 3AELA 1O62A 2H8PD 2CINA 1KILC 2YMKA 1MLYA 3LVJA 2WK8A 1OIPA 3F5HA 1FJPA 3A9YA 3JZLA 3JCUE 3LVLB 5D5SA 3PAAA 2R0TA 3PPLA 2QBTA 4J5UA 1BKGA 1RH5B 2FXMA 1RF1A 3GR9A 5G0AA 1AVOA 1P3WA 2DGMA 4XJMA 5HDMA 3IN6A 1L2PA 2VMXA 1ZRTE 4Y28J 3WKSA 1ASCA 3OKSA 4E1OA 2BIAA 1AJYA 4LNMA 4PV1D 1RVYA 1FE6A 1KB9I 3PRJA 5DJ9A 5C39A 1BT4A 4A6RA 1GDTA 2WVRA 4RJTA 4ZNCA 1DFOA 1JMMA 3AEAC 2QLRA 3P8CD 2C9LY 4MY5A 2FYUK 4ZKUA 2QM7A 3NU8A 3D71A 1SZKA 1JUNA 1FDOA 2JJEA 2IYPA 3RBXA 3TNUA 3H1JG 4ZLVA 3NRAA 1X79B 3SWFA 3TDKA 3AENB 1GC3A 3FXEA 4CBRA 1W2BO 2FFDC 5BU8B 1ARHA 4KAMA 1FZEA 1RVUA 2Z61A 3DR4A 1OW6A 1XEYA 1GEWA 1L0LJ 4KXKA 4RO0A 3AEOA 4DQ6A 3H32B 2IBZG 1KB9E 4HF8A 3I56P 3LIDA 1URQB 1V2FA 1RE4A 5FT5A 1OXOA 2GB3A 4IFMA 2W27A 2XH1A 5EUNA 1KILD 2XU6A 2YKXA 1TASA 3PIUA 3R9AA 1LT9B 2E76D 5EIGA 2B88A 2LR2A 2JJGA 4K35A 1SFFA 1KTMA 1PP9E 2IX7C 5APUA 4JEVA 2B9BA 4GSAA 4F5IA 2YCPA 4LC3A 1PMOA 1PGPA 4RLGA 3RUYA 3CCVP 2K9YA 2JWDA 3KKIA 3TK1A 3L70D 2MKVA 1NTZG 3PLNA 1IX7A 1KYOD 1RHZB 3HE5B 1SF2A 4OCAA 1N86A 3CMAP 1ZOBA 1SQVE 4Q75A 5G09A 2P7JA 3WMM0 1IVRA 1T3UA 4CVQA 3ABVC 1JY2N 1E5EA 1KILA 1T2KC 4XAUA 3HRNA 2E76C 1EQ7A 2X3LA 4IXOA 1YJYA 2NZ2A 1M32A 1M8OB 3B5NB 3ISLA 1CZEA 4ZWMA 3H1LJ 3VMZA 4NOGA 2YKUA 1GU5A 3WKRA 1IUGA 1Y8AA 2JR8A 4YPCA 3CAIA 2Q7CA 2E43A 1QJ3A 3HD7A 1AMQA 1ASLA 5KTBA 1JTHB 3A0BE 1AICA 4A0HA 1SVFA 4W8IA 4R4LA 3L73D 1ARSA 2EPJA 2D2CB 1ORDA 4AO4A 3WUUA 1N31A 2V4HA 2A1VA 4UHOA 1T2KD 3R4TA 1FC2C 1KV4A 2BCCJ 1EZVG 1FDIA 3CWBG 4R5ZA 4B98A 2VMZA 1DH3A 2OKJA 1X0TA 5DJ1A 5KKZB 3DXWA 1FOSF 2IFNA 1ARTA 3L72J 3D6YA 3AE8C 4J8LA 5APWA 1JCCA 2C0WA 2PAJA 2OYHC 3VK3A 4GKGA 2CTZA 3AE2C 1AQ5A 4UB6E 3P7KA 5FT4A 3DYDA 3V4QA 1JY3P 2W7GA 1BCCE 2H43A 3M0DC 1JO5A 1HBWA 2WPQA 1AMRA 4EYYQ 3FFRA 2BI1A 2P1JA 1L0NG 4C46A 1OW7A 1YITP 3H1KJ 1DX7A 2DR1A 1NTZK 4P3MA 2VIAA 1W7MA 1N2DC 1EXJA 3AE7C 2CJHA 5BJ4A 3E2FA 4MQRA 2BIGA 2OYIA 1CI6A 3WGCA 1S5LE 2NPSC 3WZFA 2M8RA 1ARGA 1E5WA 3AEMC 1Q82Q 1OWAA 1SQQJ 2PFXA 2EZ2A 2ZAEB 3E2ZB 4I7ZB 3MGNA 1P84D 2AY8A 3Q2YA 2OARA 3JCUH 2FYUJ 1LTJC 2M5AA 1DGDA 3IAOA 3G8MA 3BATA 1IJIA 2VRSA 4AZKA 1SVVA 3ZRQA 1ZP0C 2UWJE 2W7EA 2E7IA 4PFNA 1J2JB 2VGVA 2WSFH 2FXPA 1R8EA 1N73A 1SQXE 3S4RA 3MAUA 4CXRA 1GC2A 1S06A 4IL6X 1P84I 1BGYD 2ZXXA 2JP3A 4O9BA 1U57A 2KS1A 3BCAA 1M1JA 3NMDA 1GCKA 1OHYA 2QIWA 4ISYA 3CCUP 4WXFA 3NTNA 3RL0B 1OW8A 3EIBA 1GW4A 3COGA 3E77A 1LTTC 4EDFA 1AKBA 4GIFA 1NKZB 3CCLP 2D64A 3I16A 3M06A 1K73Q 3NU7A 4RKUJ 1D7VA 1AHGA 2W8WA 3AATA 4R2NA 2WT7B 2WTYA 1L0LD 1X28A 2D63A 3LVKA 3T97A 1FZBA 5EUDA 2IPPA 3QGUA 2OYIB 3HE5A 3N4RA 1DJEA 4A0GA 4MQQA 1VF5C 1LP1A 3FWNA 4BMKA 4WYDA 4ZAHA 2FBWC 1N2TA 1RQUA 2V7QJ 1HGVA 4XEWA 5AVVB 2VIBA 1BCCJ 4HB1A 1GZLA 5EQCA 2B87B 4U7JA 2BYJA 5CCHA 3HL2A 1ARIA 5AW6B 3PHLA 2OYOA 4MKKA 3H1IE 5M4DA 2EH6A 3Q5PA 4N78D 4PVFA 1ZMEC 3EZ1A 3V2PA 2C0RA 1VEFA 2JWAA 5APXA 3BB8A 2KS1B 5AVTB 1WYTA 4U3FE 1M1JB 2N1TC 1PP9D 1YQ3C 3JWBA 4AZJA 1WYUB 1S1CX 2B87A 2VGTA 3Q5SA 1M0OA 1FZFA 1LW5A 3BWOA 1QX8A 1FZCA 2Q9IA 1EZVE 1UU2A 4A6TA 3M9HA 1M0PA 4PV1C 3H1ID 1W5CE 1VQ4P 1KYOE 1HF9A 3L44A 5BJ3A 1BCCD 2WITA 5GTHE 3L75D 5CBNA 1M0NA 3CPWO 3MHVA 4XQ2A 3RL0D 1AJSA 3MBBA 3TSIA 1YYCA 3BASA 1SFCC 2FY8A 4JBZA 2J58A 1OMIA 3W1JA 1WRGA 1ZW0A 2BASA 4OBVA 1KN7A 3ZRPA 1BCCG 4F5FA 4ASWA 1PV3A 2CK3H 4XA4A 2ZYJA 2M0BA 5AW1B 5AW9B 2VMSA 2E75C 3U1AA 1ASMA 2W6JH 5IWQA 1ZOYC 3A0BH 3LV2A 4WY4A 1GL2C 4NPFX 4ZDOA 4LNJA 1EZVD 2VMRA 2BCCE 1OXPA 4UQVA 2YRRA 1SQQK 1L0NJ 3L73G 4B86A 2XBNA 2WQYC 5K8BA 3L72E 1NTMK 1N7LA 2R5DA 1B4XA 4BQ0A 1WYTB 2B89A 4OH8B 2IZ1A 5M1BA 1QL1A 1SQPD 1WYUA 2D61A 2YO2A 3EWKA 3ZZJA 1N7SD 5AVQB 4RIZA 3EIAA 1Z3ZA 5D95A 2HUUA 3CI9A 1LTAC 4H0LD 1PGJA 2JJFA 3N0LA 2ZT9D 3MUDA 2Y9ZA 1FJKA 3VP9A 3HQTA 3C8VA 3L72D 1AJSB 4JYBA 1S3JA 4EFFA 3HMUA 3CX5D 1Q2NA 1OX3A 1QLED 4WY4C 2BI2A 1SP4A 2ZSLA 3HUSC 4H13B 3QN6A 2V7QH 1SQQE 3TGUG 4IXSA 3FVUA 2HOZA 1T3JA 4I2LC 1MV8A 3AEJA 4OGQD 1HJ0A 3A0HH 5KAFH 2VGZA 2BWOA 1UIIA 1CQ6A 2X8UA 1T3IA 4L74A 1RF1C 3WU2H 2IZ0A 1XTGB 3NNKA 2E76B 1JNMA 2W90A 1DJUA 2ZT9C 1MFTA 4FL0A 1WKHA 2K1AA 4JEZA 4M2KA 4ZWVA 3NX3A 3II6A 4B9BA 4UB8E 1Y47A 3CQ5A 4IYOA 1SQQD 1VQ7P 1IAXA 2GMUA 1W23A 4WY4D 3K28A 5AW2B 2CANA 2H7HA 4DZOA 1LT1A 2E7JA 3VMXA 4F4EA 3KHUA 1KKJA 2E74B 3FX0A 3AEFC 1KQGB 1VPCA 4U3FD 2M3BA 3FSLA 3FCRA 4D6TG 2HP2A 4WYCA 1NHLA 3CD6P 2OGUA 3GWPA 1LT9A 2DGKA 4BA4A 1GL2D 2A45I 2E75B 4OWFA 4F5JA 4LC1A 5APQA 2QVAA 1X2AA 3GLMA 1PG8A 4RJYA 2C44A 2D5YA 3BS8A 4ITXA 1VL2A 3KZIE 1C9CA 2OTKE 4PV1B 2JKVA 1Q7YQ 5FT8A 2YIUB 5HHYA 3EI9A 4QGRA 3H1HJ 1QITA 5KJ7C 3GBXA 2AXTE 1FZCC 2KSJA 4LLHA 2HZPA 4TMRA 1LTIC 1MAQA 1IFJA 1NH4A 5E3KA 1PP9G 1MKMA 2ZSMA 1IZNB 2I8DA 4WYFA 1ZR4A 1X0MA 1EDKA 1BJ4A 2E75D 3P6KA 3FDDA 1GDEA 4L73A 1M4NA 2CPBA 1KC8Q 3FVXA 3ELEA 1MUUA 2WWWA 4AH3A 2LXBA 5M46A 3EI6A 2AEUA 1FU1A 3PD6B 3S1KA 1BDDA 2Z9UA 1YAAA 3MAFB 3GF3A 3RK2B 2DOUA 1VQPP 3SWKA 1JB0J 2GQNA 4UHNA 3W1IA 2CFBA 3B1CA 1NTKJ 3MC6A 1GD2E 2FN6A 3EUCA 1PZQA 2W7MA 1K9MQ 4ATPA 3AEGC 1N8RQ 2M3EA 3G71P 3FQAA 4ASVA 1SQBG 5KLVE 4ZM4A 2KI7B 1EQBA 1W2EA 2H89C 1PFFA 3CC2P 2FYUG 1CZQA 1NU1E 1MDZA 3SFDC 2FFDA 1EZVI 4D6TE 1D7RA 3MKJA 3UIAA 1QGKB 2P10A 1H1CA 3GW6A 1AY8A 2HUFA 2XDJA 1XI9A 2C81A 3E6GA 5CCHD 3RGUA 1FZAA 1PP9J 2ZFCA 1S08A 3F9TA 2A45H 5B5EH 1CI6B 2XV5A 1NAFA 1S9KE 2KIKA 3GF7A 3RBFA 2YIUC 1PGOA 3CWBE 4BRYB 4GODA 5H2FH 4HH2A 3UE8A 4WXGA 2HOXA 4D6TD 5APSA 1USDA 3I5TA 2VMQA 3GZDC 1Q86Q 2WPVB 4DJGA 4OVNF 1N73C 1OXZA 2R3CA 1AAWA 3V6IA 3OP7A 1LTGC 1H89A 3BCCJ 4OTLA 2VMOA 7AATA 1TOGA 4ITGA 3H1JE 3T32A 3U59A 1SQVK 3L36A 1SFCB 2Q5UA 1YJWP 4H51A 2CH1A 4NPEA 3G6EP 4GEBA 1Z56A 4N0WA 3JSVC 3F0HA 3E9KA 3USFA 1GU4A 2OTJP 2IBZD 2C9NY 1FOSE 2PB0A 5EAVA 1JY2O 3CCMP 1CJ0A 4N6JA 2Q7WA 1KMJA 5AW5B 3CWBD 4WBTA 2QJYB 1IFIA 1AIBA 3V2RA 1M6SA 3KZIH 2NRGA 1TOEA 4WB4A 4PD4H 1ZN5A 3L74D 3L37A 3MP7B 1JY3O 4WYAA 4C7NB 1BDCA 2EO5A 3CMEP 3QBOA 1NAYA 5AVSB 2GMSA 2BWPA 2AY2A 1RF0A 3UWCA 1OVRA 1KQSO 4EI2A 4A0FA 2KFPA 4OGQB 4BRYA 3DC1A 2R3SA 3CX5E 4KHXA 2QE7H 1Q81Q 4DOJA 3WCNA 3PP5A 1B9IA 3HLMA 2VYCA 4K2MA 4JQ0D 1RF1B 1SS1A 1N7SA 1LW4A 2Y0EA 2FYZA 2AXTH 4F5HA 1OVVA 3NYSA 1QL2A 4IX8A 1T6AA 2MJZA 1C7OA 3WUVA 1B8GA 3H1HG 1ASAA 4EU1A 1BJOA 1AKCA 1IO4A 3ASBA 1FS0E 3FQ8A 3I55P 4U1TA 4M2MA 2N9YB 3OAKA 3AEEC 4H0LB 2HPCA 1YIZA 2KZJA 2D2CD 4WWIA 4A72A 1NTMG 1DGEA 4BA5A 2ITAA 1IX8A 1N7SB 1SQPG 1NTKD 2JEEA 3USSA 3OJAB 3A9XA 3HE4A 2NPSA 4RKDA 1YBKA 2GUVA 1NKNA 1FZGA 3DZZA 2O1JA 2W6AA 5DX5A 1LJ2A 5CCGD 3NYTA 4UHMA 5AVYB 2KK7A 4ZM3A 1LTJA 3B5ND 3L73J 3FZ6A 1AIAA 4C7NA 3B1EA 1SQBE 4ADEA 3F6TA 4WP0A 2BIEA 4LW2A 4W1WA 3P8MC 2HFED 4Y0IA 1L4AC 3ZDMA 3HDOA 5AVXB 2YKYA 4H13D 4JF7A 2KLVA 2IFMA 3K7YA 4L76A 2O0RA 2D65A 2K9JB 3AE1C 3NFQA 3L74G 1A02F 2NMPA 4U3FG 1VQ9P 1W3UA 1NO4A 3GJUA 4W7YA 3AECC 4UB6H 1YTZT 1HWTC 1KFNA 2O01H 4DT0A 2R5CB 3E2ZA 2XKMA 2BHXA 2YNYA 1G1JA 2CY8A 2E74C 1SQBJ 1VQ6P 1RF0C 1SLQA 3IF4A 2K9JA 4PJ0H 2R2NA 4JEWA 2YXQB 1SQBD 1U08A 5KAFE 1DD3A 3KDPB 3LIEA 2BI3A 1L4AB 2W8VA 3G9RA 2FYNB 1J1EC 2QA3A 1PPJG 2X5DA 2ZYDA 3AE9C 1S09A 3NUBA 1QZ9A 3QWOC 5AW3B 3CCJP 1KYOI 2O3JA 2RKLA 3BCCG 1LNQA 4U2HA 1KKPA 1SQVG 1BQAA 5AW8B 2YKVA 5FT6A 1FDMA 2AY7A 1SQXG 3HD7B 4EIJA 3V5BA 4WY4B 1P84E 1YJSA 4W1VA 3RBLA 1DEEG 1BSHA 2GSAA 4XJOA 1AQTA 1VF5B 3WU2E 2YOBA 4Y99C 3QH9A 3VMYA 2W7IA 1UU0A 4XJPA 1NOHA 1KZUB 1QGNA 3BC8A 1JG8A 2YKQA 4AUWA 3L71G 4Q76A 1OATA 2QB2A 2YRIA 3LG0A 4ZMDA 1S07A 2OTLP 2KXPB 3HBXA 2OQXA 3ACZA 8AATA 3GHGB 2DKJA 1MDXA 1CL1A 3CWBJ 1JEKA 3II0A 5G4IA 3H1LG 2AY5A 3CXHD 1SQBK 3R4YA 1SQPK 2Q1KA 1L0LE 3K40A 1KMKA 1D7UA 5KLIC 1YOOA 4JEXA 4QMAA 3BVHA 2KSEA 2VI9A 3AE3C 2FQ6A 1ASDA 1I48A 1KYOH 3N5MA 1ZLLA 2O01N 1LC8A 1C4KA 3O8ZA 4EB7A 1YNUA 2QRXA 2RH0A 5AVRB 1YJZA 3BV0A 1TU3F 3HTKB 2ZVOB 2YXRB 1N7SC 2PP6A 3S9OA 3FDBA 3G0TA 1PL5A 3H1IG 1K8AQ 3RCHA 1EXIA 4OT8A 3P1TA 2C0XA 2RMZA 2QJPC 1JS6A 5EAAA 1LTJB 1VQNP 3EFGA 2R44A 2W83C 1L0NK 1SQXD 2POHA 2VMTA 1HH0A 1V2EA 9AATA 3AV7A 5CBOA 1AHEA 1AHFA 1MAPA 1O4SA 1M57D 3AE5C 3L70G 2A06G 2ZY5A 4TLFA 1NTZD 3H1KG 1GEXA 2IYOA 4WXBA 5GTHH 1PPJD 1HTLC 2A45G 4W1XA 3DU4A 1KB9D 3W68A 1ELUA 4YTPC 1M7YA 1ASFA 3C1LA 1URQD 1DJ9A 3VYIA 1CS1A 4ZSWA 3TFUA 4AYCA 5APVA 3KE3A 4TN4A 3JW9A 1NTZE 1AY4A 1ASEA 3L73E 2EYQA 3O6QA 3WLXA 3TGUD 1D7MA 2CJGA 1RE4C 3H1LD 2D7ZA 3GG2A 1PPJE 1AKAA 4WB0A 3TNUB 1KILE 2OYIC 1VF5D 2BI5A 4JEYA 3VMAA 2DGLA 2FYFA 1JCDA 1NU1K 3RK3D 3GZDA 1GTWA 5E4ZA 1QEXA 1R5SA 2CPSA 4HKZH 1LC5A 4BHDA 4IW7A 1GK4A 4ZKPA 2CJDA 5CJ4A 3RK3B 2WSEH 5DJUB 1UKJA 1X29A 3HVYA 4F5GA 3L8AA 3CL3D 4AO9A 1HVVA 1YQ4C 2CH2A 1EDLA 3BCBA 4KT0J 1TOJA 3RK2D 4DGTA 4W91A 4FFCA 1HJBA 4H63Q 5EIGB 3N7NA 1ZXGA 1ASNA 1LTSC 4F5MA 3DR7A 3NTJA 4ZASA 5JAYA 1CZCA 5CJ0A 4R4MA 5KJ7D 3VP6A 3B1DA 3L75G 3AE4C 3TGUE 3GZCA 1G2CA 4W7ZA 1KAFA 3CC7P 1ASBA 1AHXA 3L35A 1QVGO 1IFDA 3AOVA 1G4XA 1JOCA 2L5GB 4IYOB 3JC22 4UB8H 2ZT9B 2RFVA 2QJKB 3CCRP 4WLJA 2O1KA 2V1PA 1BGYE 4IFDK 4P7YA 3ATHA 1ZC9A 5TISH 2L91A 1SQQG 3GETA 5B66H 3DXVA 1JY2P 3BWNC 1AAMA 2FXOA 1KQFB 4F5KA 4I1LA 4RESB 2W6BA 1LP1B 2AY4A 2D66A 1BJNA 1S72P 5I92A 1I43A 4K3AA 3HT4A 1RY3A 2K3RA 4F5LA 1O61A 1YI2P 3R2PA 1O69A 3IR9A 3M5UA 3ZZKA 5APTA 1URQC 3VTPC 2W8UA 2YMYA 4OC9A 3L4FA 3V2NA 1TOIA 2A06D 3LVMA 1MZ9A 2OYHB 2VMWA 2Z1YA 3PA9A 4HJGH 5J8QA 1K04A 1NVOA 5K5GB 3VOMA 2K37A 5B66E 2AEVA 1FBMA 4RM1A 1G7WA 4E3QA 1WT6A 2ZP7A 3HUSB 4H13C 2HPCB 1PMMA 3B71A 4ATQA 1P84H 4I8AA 2KOGA 3TFTA 2OGEA 3AENA 3MAFA 3MIWA 3CC4P 3AEMA 1MFZA 1V72A 2G8YA 3L70E 2FNUA 2A06E 4JYCA 5M4BA 2P58A 2HLOA 4WBAA 1SZSA 3G4SP 3WX9A 1AVYA 2DW3A 1VJOA 3A7OA 5AVZB 1AX4A 2O1BA 2QJKC 2VLHA 1BGYG 5APYA 2N1TA 2H88C 5M49A 3D70A 2BWNA 2VGSA 3D6ZA 3CCEP 2W7HA 1IFPA 5EFWB 3BRVB 2V0YA 4Y0DA 3FQ7A 3QM2A 3LWSA 3EI7A 2BEZF 3FD0A 2AY1A 1OHWA 4PIWA 4GE9A 2IBZI 4JF1A 2WPRA 3B46A 1J1DB 1SQVJ 4YXWH 3L70J 4MN4C 4Y0HA 3MZWB 3HD7D 3K5BA 2CSTA 3FGAD 1VQMP 5BVZA 1RE3A 1MGVA 1N73B 1C7GA 1BE3G 3SWYA 3H1JJ 1ECXA 1GC0A 3V4WA 1S5LX 1VQ5P 5KLVD 1EDJA 2Z5IA 1NU1G 1CQ8A 3A9ZA 3TGUJ 1FAVA 3PJ0A 2K88A 4M3LA 1I41A 1OVUA 2WB6A 1IJDB 2JG2A 2I1JA 4A0RA 4RITA 2HUIA 3M91A 4ADBA 2NPSB 1YIYA 1PGQA 3WUTA 3QPGA 2GA1A 3Q1MA 2KNCA 3P32A 4Z1MH 3QHXA 2Z5HA 4N78E 5AVWB 4A00A 3PJSK 4HYTB 1Y4IA 2O7CA 5F8VA 1SQVD 1S9KD 2J59M 3F89A 1LC7A 1GK6A 1G2CB 5KKZC 3A2BA 2CB1A 4AQRD 2AY3A 2QB3A 1YTZI 4MSOA 4N3YB 2NPSD 2YKPA 2WZ7A 5GTIE 4WLHA 3H1LE 2FKWB 3VP8A 3RQ1A 3UAKA 1T8ZA 1KL2A 1J32A 1BS0A 1C0NA 2YHKA 2KUBA 1BW0A 4PJ0E 4EOTA 5TISE 2E42A 1L4AA 3H25A 3AE6C 1BSNA 2QM8A 4D6TJ 1RQVA 3CXHH 3H1IJ 1QVFO 3WCOA 1SPAA 1J04A 2W7DA 3KYQA 1K05A 1M7LA 4H44D 3M9QA 2QJYC 2W8TA 4E77A 3N4SA 1QISA 1D7SA 2R5BA 4WD2A 2YO3A 4YXDC 2HORA 1L4AD 2BCCG 3RBZA 5BU5A 5KLVK 3DRDA 2D2CC 1H0CA 3H6PA 3AEPA 3Q5RA 3BN1A 3O6QB 3FVSA 4GRXA 4JPZB 4KJMA 1BQDA 3KGWA 1UU1A 1GC4A 3L72G 2ZY3A 2Z9WA 2G3AA 3BCCD 5EFSA 3FTBA 4JF0A 2KP8A 2VGWA 5GTIH 1CQ7A 3A8UX 2WK9A 2HOYA 2E54A 2YCTA 5C6UA 5H2FE 4RKCA 3G3ZA 1YHQP 2JJLA 4CPGA 3AEJC 3BRTB 2AATA 5CCGA 5DJTB 1EC5A 1S4XA 3JTXA 3IHJA 1NTKK 1S5LH 1IAYA 1SFCA 4O6ZA 3HTKA 2DKBA 5G2QA 2VMPA 1KMIZ 2OGAA 4GE4A 4L75A 5AW0B 2WSFJ 3D6KA 3CLQA 2VMUA 3PDBA 4H0LC 1J1DC 1AJRA 1DEBA 3E7KA 3W67A 1H8AA 5KJ7A 4WVZA 2G6WA 1KD1Q 2BEQD 4GE7A 3G7QA 1LTBC 4XE5B 3PGYA 1U7JA 2W7KA 3T97B 3OW2O 1HUCA 4EMYA 3NDNA 2EZ1A 2HP1A 1LKCA 1S0AA 2IBZE 1GW3A 3NXSA 3RK3C 2VI8A 4KYOA 2JO1A 4IOIH 4XK1A 4CXQA 2IDBA 2VLFA 1WKGA 3GHGC 4A6UA 1AY5A 4NPDA 1NGMB 1IK9A 2J5UA 3L74J 1BE3E 1YJNP 4Y99B 5TF5A 4E3RA 2WK7A 1NWQA 1KFMA 1IC2A 3RK2C 3KXDA 3FZ8A 1Z7DA 2ZVNB 4ZSYA 3L75E 1PFIA 1YIJP 3L75J 3IFMA 4LW4A 1AV1A 1I29A 4I6MC 2AEMA 4IXZA 1RE3C 1BJOB 1TPLA 2W7JA 2FYNC 1LK9A 1HGZA 3H1HD 1MLZA 2PO3A 3SSUA 4OGQC 1JF9A 5KLVJ 1ASGA 3MADA 3KGXA 4Q6RA 3BCXA 4K05A 3MD0A 2WSSH 3CQ4A 3B8EB 4RAEA 3JWAA 1GL2B 3L71D 1ZV8A 2JJHA 4MQPA 2WMMA 2ZYGA 1RV3A 1FZCB 4LGDE 1AA0A 1W7LA 2KYVA 1BE3J 3ZRRA 1FG3A 3AOWA 4WB0B 1ELQA 3A2AA 5KLIB 3TQXA 1BE3D 3HE4B 2KZIA 1EJIA 1L0LK 2JISA 1SQXJ 1Y9BA 5CCHC 2GM4A 3H1HE 4IL6E 3M9BA 5AW4B 2LXCB 3M0DA 2WPSA 3VOPA 1FC4A 1LWUC 1JTHA 2QG4A 1DKAA 4ZDLA 3C9IA 1U7MA 2XNXA 1WSTA 2QMAA 4GOFA 1C7NA 2E5YA 1TOKA 2KLUA 2LKMA 3WGBA 3MTUE 3N4XA 2Y9YA 3FKDA 1SQPE 4L0OA 2F8JA 2JDIH 2AXCA 2Y0DA 2HYNA 2ZJSE 1VP4A 2R5CA 3RI6A 4GDOA 3L71J 3E2YA 1GBNA 1BJWA 3QI6A 3VN0A 2W7LA 2AY9A 2WSCJ 3B5NA 3LY1A 1M90Q 2P67A 1VQOP 1GD9A 1EG5A 4M2JA 5KAIH 2HODB 2BYLA 2AEFA 2ZUKA 4I7ZC 4BWNA 3NYUA 2I1KA 1NU1D 4PD4D 4LNLA 1M1JC 3SFEC 1CL2A 1XTCC 3CX5I 3MC6C 5EUEA 4A7PA 1CW5A 1S2EA 1ZR2A 4XFJA 4IY7A 2M5AB 1YJ9P 3L74E 4K2IA 3H1KD 4IFFA 1W7NA 1G7XA 4TT3H 1B5PA 3ECDA 2OATA 2Y0CA 3AEBC 4ZDPA 1USEA 4MKJA 2Z9XA 1BGYJ 2VMNA 3TCMA 1B9HA 3ITKA 2G7JA 3CQ6A 1VDFA 1DD4A 2HR3A 1M0QA 3Q3DA 1G1IA 2BCCD 3A0HE 3PDXA 2O01J 4PD4E 2ORDA 1IFMA 3EQ2A 1KB9H 1OHVA 1JS3A 1AHYA 1AFOA 3CXHI 2VMYA 1Q90D 3PDBB 1QJ5A 1V2DA 1GMJA 3VK4A 1H0TA 2BKWA 2ZJGA 3ASAA 3FWLA 2GUSA 4GT1A 2E5TA 2N9BA 1X9VA 2OYHA 2Z1ZA 1L0ND 3EI5A 2R5EA 5F9SA 1SQXK 1TARA 2PRRA 3P8CE 2YCNA 4K2BA 4AOAA 3KQGA 3BCCE 5G4JA 3H9XA 2WT7A 2W8ZA 3GMAA 1DTYA 4WYEA 3RL0C 2OQQA 3H1KE 2W7FA 1JM0A 1SFCD 1M56D 2QSRA 1D2FA 3EFFK 2Z20A 5DB5A 3CBFA 3E1RA 3MEBA 3I5CA 3A5TA 3M0AA 1IX6A 3B4SA 2PB2A 2TPLA 1EDIA 2KB7P 3TF5A 3HUSA 2EGYA 4GDYA 3GHGA 3EI8A 4PFFA 4IL6H 3B8XA 5TJHA 2VGUA 5AW7B 3CX5H 3A3YB 4HVKA 2QSIA 3L71E 1KL1A 1L0NE 2ZY2A 3B5NC 3DODA 1VQ8P 1NJIQ 3FZ7A 2YKOA 4W5KA 2QA4P 3LW5J 2E74D 1MDOA 3VAXA 3CCQP 3FRKA 1GEYA 1IBJA 2AY6A 1IFNA 5KLVG
chains in the Genus database with same CATH topology
2N1TD 3TATA 3NUIA 1GL2A 3I4JA 4ADCA 2XZRA 2P2UA 1SZUA 3PD6A 2FNIA 1B5OA 3TYYA 1RV4A 3RCHB 3WY7A 3H32A 1AMAA 1LWUA 1URQA 1TATA 4EB5A 1A02J 1ZODA 5E5IA 3Q8NA 3KPEA 3V2QA 4DBCA 2R32A 2D7YA 4RJ0A 2X5FA 1QIRA 4C7RA 2Z9VA 2FFDB 1X8YA 3N75A 2C7TA 1AMSA 4W80A 4OBUA 2VMVA 3HD7C 5CMZA 1FG7A 4Q31A 2FKIA 5G2PA 3W1HA 2HG5D 1JY3N 1LGHB 4OMAA 4R5FA 3U1CA 4UOYA 1G4VA 4XJLA 2FM1A 5CHXA 1KILB 4OYTA 3E1IA 2HODA 2W8JA 3EZSA 3OA7A 2JGTA 2WSCH 3H7FA 1CSBA 4R8DA 3BWNA 5CCGC 2WKAA 1LS3A 3FFHA 2E7UA 2ZY4A 5HXXA 3VK2A 1LWUB 1J1EB 1WYVA 1KQLA 3GSBA 2Z4EA 4CBSA 1N8PA 2Q3IA 4ADDA 3ELPA 5AX8A 4WYGA 2BI9A 2ZXEB 2N1TB 2OKKA 3LW5H 5AVUB 1WYVB 2ZC0A 1LT9C 1E5FA 1H88A 3AELA 1O62A 2H8PD 2CINA 1KILC 1MLYA 3LVJA 2WK8A 5D5SA 1FJPA 3A9YA 3JZLA 3LVLB 3PAAA 2R0TA 3PPLA 2QBTA 4J5UA 1BKGA 2FXMA 1RF1A 3GR9A 5G0AA 1P3WA 2DGMA 4XJMA 5HDMA 2VMXA 3WKSA 1ASCA 3OKSA 4E1OA 2BIAA 4LNMA 1RVYA 5DJ9A 1BT4A 4A6RA 1GDTA 1DFOA 1JMMA 2QLRA 3P8CD 2C9LY 4MY5A 2FYUK 4ZKUA 2QM7A 3NU8A 1SZKA 1JUNA 2JJEA 3TNUA 4ZLVA 3NRAA 1X79B 3SWFA 3AENB 1GC3A 4CBRA 2FFDC 5BU8B 1ARHA 4KAMA 1FZEA 1RVUA 2Z61A 3DR4A 1XEYA 1GEWA 4KXKA 3AEOA 4DQ6A 3H32B 4HF8A 3LIDA 1URQB 1V2FA 1RE4A 5FT5A 1OXOA 2GB3A 4IFMA 2W27A 2XH1A 5EUNA 1KILD 2XU6A 2YKXA 1TASA 3PIUA 3R9AA 1LT9B 5EIGA 2JJGA 1SFFA 2IX7C 5APUA 4JEVA 4GSAA 4F5IA 2YCPA 4LC3A 1PMOA 4RLGA 3RUYA 3KKIA 3TK1A 1IX7A 3HE5B 1SF2A 4OCAA 1N86A 1ZOBA 4Q75A 5G09A 2P7JA 3WMM0 1IVRA 1T3UA 4CVQA 1JY2N 1E5EA 1KILA 1T2KC 4XAUA 3HRNA 1EQ7A 2X3LA 4IXOA 1YJYA 1M32A 3B5NB 3ISLA 1CZEA 4ZWMA 3VMZA 4NOGA 2YKUA 1GU5A 3WKRA 1IUGA 3CAIA 2Q7CA 2E43A 1QJ3A 3HD7A 1AMQA 1ASLA 5KTBA 1JTHB 1AICA 4A0HA 1SVFA 4W8IA 1ARSA 2EPJA 1ORDA 4AO4A 1N31A 2A1VA 4UHOA 1T2KD 3R4TA 4R5ZA 4B98A 2VMZA 1DH3A 2OKJA 5DJ1A 3DXWA 1FOSF 2IFNA 1ARTA 4J8LA 5APWA 1JCCA 2C0WA 2PAJA 2OYHC 3VK3A 4GKGA 2CTZA 1AQ5A 3P7KA 5FT4A 3DYDA 3V4QA 1JY3P 2W7GA 2H43A 3M0DC 1JO5A 1HBWA 2WPQA 1AMRA 3FFRA 2BI1A 2P1JA 4C46A 1DX7A 2DR1A 1NTZK 4P3MA 2VIAA 1W7MA 1N2DC 2CJHA 5BJ4A 3E2FA 4MQRA 2BIGA 2OYIA 1CI6A 3WGCA 2NPSC 3WZFA 2M8RA 3AEMC 1E5WA 1ARGA 1OWAA 2EZ2A 3E2ZB 3MGNA 2AY8A 2OARA 1LTJC 1DGDA 3G8MA 3BATA 1IJIA 2VRSA 4AZKA 1SVVA 3ZRQA 2W7EA 2E7IA 4PFNA 1J2JB 2VGVA 2WSFH 1N73A 3MAUA 4CXRA 1GC2A 1S06A 4O9BA 3BCAA 1M1JA 3NMDA 1GCKA 1OHYA 4ISYA 4WXFA 3NTNA 3RL0B 3EIBA 1GW4A 3COGA 3E77A 1LTTC 1AKBA 4GIFA 1NKZB 2D64A 3I16A 3M06A 3NU7A 1D7VA 1AHGA 2W8WA 3AATA 4R2NA 2WT7B 2WTYA 1X28A 3LVKA 2D63A 3T97A 1FZBA 5EUDA 2IPPA 3QGUA 2OYIB 3HE5A 3N4RA 1DJEA 4A0GA 4MQQA 4BMKA 4WYDA 4ZAHA 1N2TA 1HGVA 4XEWA 5AVVB 2VIBA 5EQCA 1GZLA 2BYJA 5CCHA 3HL2A 1ARIA 5AW6B 4MKKA 5M4DA 2EH6A 4N78D 4PVFA 3EZ1A 3V2PA 2C0RA 1VEFA 5APXA 3BB8A 5AVTB 1WYTA 1M1JB 2N1TC 3JWBA 4AZJA 1WYUB 2VGTA 1M0OA 1FZFA 1LW5A 3BWOA 1FZCA 2Q9IA 1UU2A 4A6TA 3M9HA 1M0PA 3L44A 5BJ3A 2WITA 1M0NA 4XQ2A 3RL0D 1AJSA 3MBBA 3TSIA 1YYCA 3BASA 1SFCC 2J58A 3W1JA 1WRGA 2BASA 4OBVA 4F5FA 3ZRPA 2ZYJA 4XA4A 5AW1B 5AW9B 2VMSA 3U1AA 1ASMA 5IWQA 3LV2A 4WY4A 1GL2C 4ZDOA 4LNJA 2VMRA 1OXPA 4UQVA 2YRRA 1SQQK 4B86A 2XBNA 5K8BA 1NTMK 1N7LA 2R5DA 1B4XA 4BQ0A 1WYTB 4OH8B 1QL1A 1WYUA 2D61A 2YO2A 3ZZJA 1N7SD 5AVQB 4RIZA 3EIAA 1Z3ZA 5D95A 2HUUA 3CI9A 1LTAC 2JJFA 3N0LA 3MUDA 1FJKA 3VP9A 3HQTA 1AJSB 4JYBA 4EFFA 3HMUA 4WY4C 2BI2A 1SP4A 2ZSLA 3HUSC 3QN6A 4IXSA 3FVUA 2HOZA 1T3JA 4I2LC 1MV8A 3AEJA 2VGZA 2BWOA 1CQ6A 2X8UA 1T3IA 1RF1C 1XTGB 3NNKA 1JNMA 1DJUA 4FL0A 1WKHA 4JEZA 4M2KA 4ZWVA 3NX3A 3II6A 4B9BA 3CQ5A 4IYOA 1IAXA 2GMUA 1W23A 4WY4D 3K28A 5AW2B 2CANA 2H7HA 4DZOA 2E7JA 3VMXA 4F4EA 1KKJA 1VPCA 2M3BA 3FSLA 3FCRA 2HP2A 4WYCA 1NHLA 3GWPA 1LT9A 2DGKA 4BA4A 1GL2D 2A45I 4F5JA 4LC1A 5APQA 1X2AA 1PG8A 4RJYA 2C44A 2D5YA 3BS8A 4ITXA 1C9CA 5FT8A 5HHYA 3EI9A 4QGRA 1QITA 5KJ7C 3GBXA 1FZCC 2KSJA 4LLHA 2HZPA 4TMRA 1LTIC 1MAQA 1IFJA 1NH4A 5E3KA 2ZSMA 4WYFA 1ZR4A 1X0MA 1BJ4A 3P6KA 3FDDA 1GDEA 1M4NA 2CPBA 3FVXA 3ELEA 1MUUA 2WWWA 4AH3A 5M46A 3EI6A 2AEUA 1FU1A 3PD6B 2Z9UA 1YAAA 3MAFB 3RK2B 2DOUA 2GQNA 4UHNA 3W1IA 2CFBA 3B1CA 3MC6A 1GD2E 2FN6A 3EUCA 2W7MA 4ATPA 3FQAA 4ZM4A 1EQBA 1W2EA 1PFFA 1CZQA 1MDZA 2FFDA 1D7RA 3MKJA 3UIAA 1H1CA 1AY8A 2HUFA 2XDJA 1XI9A 2C81A 3E6GA 5CCHD 1FZAA 2ZFCA 1S08A 3F9TA 2A45H 1CI6B 2XV5A 1NAFA 1S9KE 3RBFA 3UE8A 4HH2A 4WXGA 2HOXA 5APSA 3I5TA 2VMQA 3GZDC 1N73C 1OXZA 2R3CA 1AAWA 3OP7A 1LTGC 1H89A 4OTLA 2VMOA 7AATA 1TOGA 4ITGA 3T32A 3U59A 1SQVK 3L36A 1SFCB 2Q5UA 4H51A 2CH1A 4GEBA 1Z56A 4N0WA 3F0HA 3E9KA 3USFA 1GU4A 2C9NY 1FOSE 2PB0A 5EAVA 1JY2O 1CJ0A 4N6JA 2Q7WA 1KMJA 5AW5B 4WBTA 1IFIA 1AIBA 3V2RA 1M6SA 1TOEA 4WB4A 1ZN5A 3L37A 1JY3O 4WYAA 4C7NB 2EO5A 3QBOA 5AVSB 2GMSA 2BWPA 2AY2A 1RF0A 3UWCA 4A0FA 2KFPA 3DC1A 4KHXA 4DOJA 3WCNA 3PP5A 1B9IA 3HLMA 2VYCA 4K2MA 1RF1B 1N7SA 1LW4A 2FYZA 4F5HA 3NYSA 1QL2A 4IX8A 2MJZA 1C7OA 1B8GA 1ASAA 4EU1A 1BJOA 1AKCA 1IO4A 3ASBA 3FQ8A 4U1TA 4M2MA 3OAKA 1YIZA 2HPCA 4A72A 1DGEA 4BA5A 1IX8A 1N7SB 2JEEA 3OJAB 3A9XA 3HE4A 2NPSA 4RKDA 2GUVA 1NKNA 1FZGA 3DZZA 2O1JA 2W6AA 5DX5A 5CCGD 3NYTA 4UHMA 5AVYB 4ZM3A 1LTJA 3B5ND 3FZ6A 1AIAA 4C7NA 3B1EA 4ADEA 3F6TA 4WP0A 2BIEA 4LW2A 4W1WA 3P8MC 2HFED 4Y0IA 1L4AC 3HDOA 5AVXB 2YKYA 4JF7A 2KLVA 2IFMA 3K7YA 2O0RA 2D65A 3NFQA 1A02F 2NMPA 1W3UA 1NO4A 3GJUA 4W7YA 1YTZT 1HWTC 1KFNA 2O01H 2R5CB 3E2ZA 2XKMA 2BHXA 2YNYA 1G1JA 2CY8A 1RF0C 1SLQA 4JEWA 2R2NA 1U08A 3LIEA 3KDPB 2BI3A 1L4AB 2W8VA 1J1EC 2QA3A 2X5DA 1S09A 3NUBA 1QZ9A 5AW3B 4U2HA 1KKPA 1BQAA 5AW8B 2YKVA 5FT6A 1FDMA 2AY7A 3HD7B 4EIJA 3V5BA 4WY4B 1YJSA 4W1VA 3RBLA 2GSAA 4XJOA 2YOBA 4Y99C 3VMYA 2W7IA 1UU0A 4XJPA 1NOHA 1KZUB 1QGNA 3BC8A 1JG8A 2YKQA 4AUWA 4Q76A 1OATA 2QB2A 2YRIA 3LG0A 1S07A 3HBXA 2OQXA 3ACZA 8AATA 3GHGB 2DKJA 1MDXA 1CL1A 3II0A 5G4IA 2AY5A 1SQBK 1SQPK 3K40A 1KMKA 1D7UA 1YOOA 4JEXA 3BVHA 2VI9A 2FQ6A 1ASDA 1I48A 3N5MA 1ZLLA 1LC8A 1C4KA 3O8ZA 4EB7A 1YNUA 5AVRB 1YJZA 3BV0A 3HTKB 1N7SC 2PP6A 3FDBA 3G0TA 3RCHA 4OT8A 3P1TA 2C0XA 1JS6A 5EAAA 1LTJB 3EFGA 1L0NK 2POHA 2VMTA 1HH0A 1V2EA 9AATA 3AV7A 1AHEA 1AHFA 1MAPA 1O4SA 2ZY5A 1GEXA 4WXBA 1HTLC 2A45G 4W1XA 3DU4A 1ELUA 1M7YA 1ASFA 1URQD 1DJ9A 3VYIA 1CS1A 4ZSWA 3TFUA 4AYCA 5APVA 3KE3A 4TN4A 3JW9A 1AY4A 1ASEA 2EYQA 3WLXA 2CJGA 1RE4C 2D7ZA 1AKAA 4WB0A 3TNUB 2OYIC 2BI5A 4JEYA 2DGLA 2FYFA 1JCDA 1NU1K 3RK3D 3GZDA 1GTWA 5E4ZA 2CPSA 1LC5A 4BHDA 4IW7A 1GK4A 4ZKPA 2CJDA 5CJ4A 3RK3B 2WSEH 1X29A 1UKJA 3HVYA 4F5GA 3L8AA 3CL3D 4AO9A 1HVVA 2CH2A 3BCBA 1TOJA 3RK2D 4DGTA 4W91A 4FFCA 1HJBA 4H63Q 5EIGB 3N7NA 1ASNA 1LTSC 4F5MA 3DR7A 3NTJA 4ZASA 5JAYA 1CZCA 5CJ0A 5KJ7D 3VP6A 3B1DA 3GZCA 1G2CA 4W7ZA 1ASBA 1AHXA 3L35A 1IFDA 3AOVA 1G4XA 1JOCA 2L5GB 4IYOB 2RFVA 4WLJA 2O1KA 2V1PA 4P7YA 4IFDK 3ATHA 1ZC9A 3GETA 3DXVA 1JY2P 3BWNC 1AAMA 4F5KA 4I1LA 4RESB 2W6BA 2AY4A 2D66A 1BJNA 5I92A 1I43A 3HT4A 1RY3A 4F5LA 1O61A 3R2PA 1O69A 3IR9A 3M5UA 3ZZKA 5APTA 1URQC 3VTPC 2W8UA 2YMYA 4OC9A 3L4FA 3V2NA 1TOIA 3LVMA 1MZ9A 2OYHB 2VMWA 2Z1YA 3PA9A 5J8QA 3VOMA 2AEVA 1FBMA 4RM1A 1G7WA 4E3QA 1WT6A 2ZP7A 3HUSB 2HPCB 1PMMA 4ATQA 4I8AA 2KOGA 3TFTA 2OGEA 3AENA 3MAFA 3MIWA 3AEMA 1MFZA 1V72A 2FNUA 4JYCA 5M4BA 2HLOA 4WBAA 1SZSA 3WX9A 1VJOA 3A7OA 5AVZB 1AX4A 2O1BA 2VLHA 5APYA 2N1TA 5M49A 2BWNA 2VGSA 2W7HA 3BRVB 2V0YA 4Y0DA 3FQ7A 3QM2A 3LWSA 3EI7A 3FD0A 2AY1A 1OHWA 4PIWA 4GE9A 4JF1A 2WPRA 3B46A 1J1DB 4Y0HA 3HD7D 2CSTA 5BVZA 1RE3A 1MGVA 1N73B 1C7GA 3SWYA 1ECXA 1GC0A 3V4WA 2Z5IA 1CQ8A 3A9ZA 1FAVA 3PJ0A 4M3LA 1I41A 2WB6A 1IJDB 2JG2A 2I1JA 4A0RA 4RITA 2HUIA 3M91A 4ADBA 2NPSB 1YIYA 3QPGA 3P32A 3QHXA 2Z5HA 4N78E 5AVWB 4A00A 4HYTB 1Y4IA 2O7CA 5F8VA 1S9KD 2J59M 1LC7A 1GK6A 1G2CB 3A2BA 2CB1A 4AQRD 2AY3A 2QB3A 1YTZI 4MSOA 4N3YB 2NPSD 2YKPA 2WZ7A 4WLHA 2FKWB 3VP8A 3RQ1A 3UAKA 1T8ZA 1KL2A 1J32A 1BS0A 1C0NA 2YHKA 1BW0A 4EOTA 2E42A 1L4AA 2QM8A 3WCOA 1SPAA 1J04A 2W7DA 3KYQA 1M7LA 3M9QA 2W8TA 4E77A 3N4SA 1QISA 1D7SA 2R5BA 4WD2A 2YO3A 2HORA 1L4AD 5BU5A 5KLVK 3DRDA 1H0CA 3H6PA 3AEPA 3BN1A 3FVSA 4GRXA 3KGWA 1BQDA 1UU1A 1GC4A 2ZY3A 2Z9WA 5EFSA 3FTBA 4JF0A 2KP8A 2VGWA 1CQ7A 3A8UX 2WK9A 2HOYA 2E54A 2YCTA 5C6UA 4RKCA 3G3ZA 2JJLA 3AEJC 3BRTB 2AATA 5CCGA 3JTXA 3IHJA 1NTKK 1IAYA 1SFCA 4O6ZA 3HTKA 2DKBA 5G2QA 2VMPA 4GE4A 2OGAA 5AW0B 3D6KA 3CLQA 2VMUA 3PDBA 1J1DC 1AJRA 1DEBA 1H8AA 5KJ7A 2G6WA 4GE7A 3G7QA 1LTBC 4XE5B 3PGYA 2W7KA 1HUCA 4EMYA 3NDNA 2EZ1A 2HP1A 1LKCA 1S0AA 1GW3A 3NXSA 3RK3C 2VI8A 4KYOA 4XK1A 4CXQA 2VLFA 1WKGA 3GHGC 4A6UA 1AY5A 1IK9A 4Y99B 5TF5A 4E3RA 2WK7A 1NWQA 1KFMA 1IC2A 3RK2C 3FZ8A 1Z7DA 4ZSYA 1PFIA 3IFMA 4LW4A 1I29A 4I6MC 4IXZA 1RE3C 1BJOB 1TPLA 2W7JA 1LK9A 1HGZA 1MLZA 2PO3A 1JF9A 1ASGA 3MADA 3KGXA 4Q6RA 3BCXA 4K05A 3MD0A 3CQ4A 3B8EB 4RAEA 3JWAA 1GL2B 1ZV8A 2JJHA 4MQPA 1RV3A 1FZCB 4LGDE 1W7LA 2KYVA 3ZRRA 1FG3A 3AOWA 4WB0B 1ELQA 3A2AA 3TQXA 3HE4B 1EJIA 1L0LK 2JISA 5CCHC 2GM4A 3M9BA 5AW4B 3M0DA 2WPSA 3VOPA 1FC4A 1LWUC 1JTHA 4ZDLA 1DKAA 3C9IA 2XNXA 1WSTA 2QMAA 1C7NA 1TOKA 2LKMA 3WGBA 3MTUE 3N4XA 3FKDA 4L0OA 2F8JA 2HYNA 1VP4A 2R5CA 3RI6A 3E2YA 1GBNA 1BJWA 3QI6A 3VN0A 2W7LA 2AY9A 3B5NA 3LY1A 2P67A 1GD9A 4M2JA 1EG5A 2HODB 2BYLA 2ZUKA 3NYUA 2I1KA 4LNLA 1M1JC 1CL2A 1XTCC 3MC6C 5EUEA 1CW5A 1ZR2A 4IY7A 4K2IA 4IFFA 1W7NA 1G7XA 1B5PA 3ECDA 2OATA 4ZDPA 4MKJA 2Z9XA 2VMNA 3TCMA 1B9HA 2G7JA 3CQ6A 1VDFA 1M0QA 1G1IA 3PDXA 2ORDA 1IFMA 3EQ2A 1OHVA 1JS3A 1AHYA 1AFOA 2VMYA 3PDBB 1QJ5A 1V2DA 3VK4A 2BKWA 2ZJGA 3ASAA 2GUSA 4GT1A 2N9BA 1X9VA 2OYHA 2Z1ZA 3EI5A 2R5EA 5F9SA 1SQXK 1TARA 3P8CE 2YCNA 4K2BA 4AOAA 3KQGA 5G4JA 3H9XA 2WT7A 1DTYA 4WYEA 3RL0C 2W7FA 1SFCD 2QSRA 1D2FA 2Z20A 5DB5A 3CBFA 3MEBA 3I5CA 3A5TA 3M0AA 1IX6A 2PB2A 2TPLA 2KB7P 3HUSA 2EGYA 4GDYA 3GHGA 3EI8A 4PFFA 3B8XA 2VGUA 5AW7B 3A3YB 4HVKA 1KL1A 2ZY2A 3B5NC 3DODA 3FZ7A 2YKOA 4W5KA 1MDOA 3VAXA 3FRKA 1GEYA 1IBJA 2AY6A 1IFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IC2 A;  3VP9 A;  3N7N A;  3C9I A;  3U1A A;  1X79 B;  2JEE A;  3OJA B;  5BU8 B;  4ZKP A;  5BU5 A;  4O9B A;  1NKN A;  1WT6 A;  3BAS A;  5KTB A;  3N4X A;  3U1C A;  3HRN A;  2FXM A;  3BAT A;  3N4R A;  3U59 A;  3P8C D;  4N3Y B;  4GIF A;  4ZKU A;  5BVZ A;  4I1L A;  4N78 D;  3N4S A;  3VP8 A;  2POH A; 
#chains in the Genus database with same CATH topology
 2N1T D;  3TAT A;  2ZYA A;  3NUI A;  1GL2 A;  3I4J A;  4ADC A;  1IK7 A;  2XZR A;  2Q6Q A;  2QEX P;  1PIX A;  2P2U A;  1SZU A;  3PD6 A;  2FNI A;  1L0L G;  5E79 E;  3TYY A;  1B5O A;  1RV4 A;  1NTZ J;  1NTM E;  3RCH B;  3WY7 A;  3H32 A;  1NTM J;  1AMA A;  1LWU A;  1URQ A;  1TAT A;  4EB5 A;  4H44 C;  1M1K Q;  1A02 J;  1ZOD A;  5E5I A;  1JMB A;  3PTZ A;  3Q8N A;  3KPE A;  3V2Q A;  4DBC A;  1VQK P;  4U3F J;  2R32 A;  2D7Y A;  1NTK E;  4RJ0 A;  2KNC B;  2X5F A;  1QIR A;  2Q3E A;  4C7R A;  2Z9V A;  1UIX A;  2FFD B;  3MUD C;  1X8Y A;  3N75 A;  2C7T A;  1AMS A;  4W80 A;  4OBU A;  2WSE J;  2VMV A;  3HD7 C;  1X22 A;  5CMZ A;  1FG7 A;  4Q31 A;  5E79 H;  2FKI A;  5G2P A;  3W1H A;  2HG5 D;  1KOR A;  1JY3 N;  1DIP A;  1LGH B;  4OMA A;  4BXL A;  4R5F A;  1NTM D;  5B5E E;  1OZH A;  3U1C A;  4UOY A;  2AEJ A;  1G4V A;  4XJL A;  2FM1 A;  2XND H;  2PGD A;  3H1J D;  5CHX A;  4GOE A;  1KIL B;  4OYT A;  3E1I A;  2QJP B;  2HOD A;  2W8J A;  3CCS P;  3EZS A;  3OA7 A;  2JGT A;  4H44 B;  2WSC H;  3H7F A;  1R5L A;  1CSB A;  3FXD A;  1VQL P;  1NU1 J;  4R8D A;  3BWN A;  5CCG C;  2RN0 A;  2WKA A;  1LS3 A;  3FFH A;  2E7U A;  3RL0 g;  2ZY4 A;  5HXX A;  1E79 H;  2FYU D;  3VK2 A;  1LWU B;  1J1E B;  1WYV A;  3PH0 A;  1H0T B;  1KQL A;  3GSB A;  2Z4E A;  1NYH A;  3RK3 E;  4CBS A;  1N8P A;  3CXH E;  2Q3I A;  1ZRT D;  4ADD A;  3ELP A;  5L8R J;  5KAI E;  4PD4 I;  5AX8 A;  4WYG A;  1NTK G;  2BI9 A;  2SPZ A;  2ZXE B;  1OFC X;  2N1T B;  1SQP J;  4DCK A;  3AED C;  2OKK A;  3LW5 H;  5AVU B;  1WMK A;  2FYU E;  1WYV B;  2ZC0 A;  1LT9 C;  1E5F A;  1H88 A;  3AEL A;  1O62 A;  2H8P D;  2CIN A;  1KIL C;  2YMK A;  1MLY A;  3LVJ A;  2WK8 A;  1OIP A;  3F5H A;  1FJP A;  3A9Y A;  3JZL A;  3JCU E;  3LVL B;  5D5S A;  3PAA A;  2R0T A;  3PPL A;  2QBT A;  4J5U A;  1BKG A;  1RH5 B;  2FXM A;  1RF1 A;  3GR9 A;  5G0A A;  1AVO A;  1P3W A;  2DGM A;  4XJM A;  5HDM A;  3IN6 A;  1L2P A;  2VMX A;  1ZRT E;  4Y28 J;  3WKS A;  1ASC A;  3OKS A;  4E1O A;  2BIA A;  1AJY A;  4LNM A;  4PV1 D;  1RVY A;  1FE6 A;  1KB9 I;  3PRJ A;  5DJ9 A;  5C39 A;  1BT4 A;  4A6R A;  1GDT A;  2WVR A;  4RJT A;  4ZNC A;  1DFO A;  1JMM A;  3AEA C;  2QLR A;  3P8C D;  2C9L Y;  4MY5 A;  2FYU K;  4ZKU A;  2QM7 A;  3NU8 A;  3D71 A;  1SZK A;  1JUN A;  1FDO A;  2JJE A;  2IYP A;  3RBX A;  3TNU A;  3H1J G;  4ZLV A;  3NRA A;  1X79 B;  3SWF A;  3TDK A;  3AEN B;  1GC3 A;  3FXE A;  4CBR A;  1W2B O;  2FFD C;  5BU8 B;  1ARH A;  4KAM A;  1FZE A;  1RVU A;  2Z61 A;  3DR4 A;  1OW6 A;  1XEY A;  1GEW A;  1L0L J;  4KXK A;  4RO0 A;  3AEO A;  4DQ6 A;  3H32 B;  2IBZ G;  1KB9 E;  4HF8 A;  3I56 P;  3LID A;  1URQ B;  1V2F A;  1RE4 A;  5FT5 A;  1OXO A;  2GB3 A;  4IFM A;  2W27 A;  2XH1 A;  5EUN A;  1KIL D;  2XU6 A;  2YKX A;  1TAS A;  3PIU A;  3R9A A;  1LT9 B;  2E76 D;  5EIG A;  2B88 A;  2LR2 A;  2JJG A;  4K35 A;  1SFF A;  1KTM A;  1PP9 E;  2IX7 C;  5APU A;  4JEV A;  2B9B A;  4GSA A;  4F5I A;  2YCP A;  4LC3 A;  1PMO A;  1PGP A;  4RLG A;  3RUY A;  3CCV P;  2K9Y A;  2JWD A;  3KKI A;  3TK1 A;  3L70 D;  2MKV A;  1NTZ G;  3PLN A;  1IX7 A;  1KYO D;  1RHZ B;  3HE5 B;  1SF2 A;  4OCA A;  1N86 A;  3CMA P;  1ZOB A;  1SQV E;  4Q75 A;  5G09 A;  2P7J A;  3WMM 0;  1IVR A;  1T3U A;  4CVQ A;  3ABV C;  1JY2 N;  1E5E A;  1KIL A;  1T2K C;  4XAU A;  3HRN A;  2E76 C;  1EQ7 A;  2X3L A;  4IXO A;  1YJY A;  2NZ2 A;  1M32 A;  1M8O B;  3B5N B;  3ISL A;  1CZE A;  4ZWM A;  3H1L J;  3VMZ A;  4NOG A;  2YKU A;  1GU5 A;  3WKR A;  1IUG A;  1Y8A A;  2JR8 A;  4YPC A;  3CAI A;  2Q7C A;  2E43 A;  1QJ3 A;  3HD7 A;  1AMQ A;  1ASL A;  5KTB A;  1JTH B;  3A0B E;  1AIC A;  4A0H A;  1SVF A;  4W8I A;  4R4L A;  3L73 D;  1ARS A;  2EPJ A;  2D2C B;  1ORD A;  4AO4 A;  3WUU A;  1N31 A;  2V4H A;  2A1V A;  4UHO A;  1T2K D;  3R4T A;  1FC2 C;  1KV4 A;  2BCC J;  1EZV G;  1FDI A;  3CWB G;  4R5Z A;  4B98 A;  2VMZ A;  1DH3 A;  2OKJ A;  1X0T A;  5DJ1 A;  5KKZ B;  3DXW A;  1FOS F;  2IFN A;  1ART A;  3L72 J;  3D6Y A;  3AE8 C;  4J8L A;  5APW A;  1JCC A;  2C0W A;  2PAJ A;  2OYH C;  3VK3 A;  4GKG A;  2CTZ A;  3AE2 C;  1AQ5 A;  4UB6 E;  3P7K A;  5FT4 A;  3DYD A;  3V4Q A;  1JY3 P;  2W7G A;  1BCC E;  2H43 A;  3M0D C;  1JO5 A;  1HBW A;  2WPQ A;  1AMR A;  4EYY Q;  3FFR A;  2BI1 A;  2P1J A;  1L0N G;  4C46 A;  1OW7 A;  1YIT P;  3H1K J;  1DX7 A;  2DR1 A;  1NTZ K;  4P3M A;  2VIA A;  1W7M A;  1N2D C;  1EXJ A;  3AE7 C;  2CJH A;  5BJ4 A;  3E2F A;  4MQR A;  2BIG A;  2OYI A;  1CI6 A;  3WGC A;  1S5L E;  2NPS C;  3WZF A;  2M8R A;  1ARG A;  1E5W A;  3AEM C;  1Q82 Q;  1OWA A;  1SQQ J;  2PFX A;  2EZ2 A;  2ZAE B;  3E2Z B;  4I7Z B;  3MGN A;  1P84 D;  2AY8 A;  3Q2Y A;  2OAR A;  3JCU H;  2FYU J;  1LTJ C;  2M5A A;  1DGD A;  3IAO A;  3G8M A;  3BAT A;  1IJI A;  2VRS A;  4AZK A;  1SVV A;  3ZRQ A;  1ZP0 C;  2UWJ E;  2W7E A;  2E7I A;  4PFN A;  1J2J B;  2VGV A;  2WSF H;  2FXP A;  1R8E A;  1N73 A;  1SQX E;  3S4R A;  3MAU A;  4CXR A;  1GC2 A;  1S06 A;  4IL6 X;  1P84 I;  1BGY D;  2ZXX A;  2JP3 A;  4O9B A;  1U57 A;  2KS1 A;  3BCA A;  1M1J A;  3NMD A;  1GCK A;  1OHY A;  2QIW A;  4ISY A;  3CCU P;  4WXF A;  3NTN A;  3RL0 B;  1OW8 A;  3EIB A;  1GW4 A;  3COG A;  3E77 A;  1LTT C;  4EDF A;  1AKB A;  4GIF A;  1NKZ B;  3CCL P;  2D64 A;  3I16 A;  3M06 A;  1K73 Q;  3NU7 A;  4RKU J;  1D7V A;  1AHG A;  2W8W A;  3AAT A;  4R2N A;  2WT7 B;  2WTY A;  1L0L D;  1X28 A;  2D63 A;  3LVK A;  3T97 A;  1FZB A;  5EUD A;  2IPP A;  3QGU A;  2OYI B;  3HE5 A;  3N4R A;  1DJE A;  4A0G A;  4MQQ A;  1VF5 C;  1LP1 A;  3FWN A;  4BMK A;  4WYD A;  4ZAH A;  2FBW C;  1N2T A;  1RQU A;  2V7Q J;  1HGV A;  4XEW A;  5AVV B;  2VIB A;  1BCC J;  4HB1 A;  1GZL A;  5EQC A;  2B87 B;  4U7J A;  2BYJ A;  5CCH A;  3HL2 A;  1ARI A;  5AW6 B;  3PHL A;  2OYO A;  4MKK A;  3H1I E;  5M4D A;  2EH6 A;  3Q5P A;  4N78 D;  4PVF A;  1ZME C;  3EZ1 A;  3V2P A;  2C0R A;  1VEF A;  2JWA A;  5APX A;  3BB8 A;  2KS1 B;  5AVT B;  1WYT A;  4U3F E;  1M1J B;  2N1T C;  1PP9 D;  1YQ3 C;  3JWB A;  4AZJ A;  1WYU B;  1S1C X;  2B87 A;  2VGT A;  3Q5S A;  1M0O A;  1FZF A;  1LW5 A;  3BWO A;  1QX8 A;  1FZC A;  2Q9I A;  1EZV E;  1UU2 A;  4A6T A;  3M9H A;  1M0P A;  4PV1 C;  3H1I D;  1W5C E;  1VQ4 P;  1KYO E;  1HF9 A;  3L44 A;  5BJ3 A;  1BCC D;  2WIT A;  5GTH E;  3L75 D;  5CBN A;  1M0N A;  3CPW O;  3MHV A;  4XQ2 A;  3RL0 D;  1AJS A;  3MBB A;  3TSI A;  1YYC A;  3BAS A;  1SFC C;  2FY8 A;  4JBZ A;  2J58 A;  1OMI A;  3W1J A;  1WRG A;  1ZW0 A;  2BAS A;  4OBV A;  1KN7 A;  3ZRP A;  1BCC G;  4F5F A;  4ASW A;  1PV3 A;  2CK3 H;  4XA4 A;  2ZYJ A;  2M0B A;  5AW1 B;  5AW9 B;  2VMS A;  2E75 C;  3U1A A;  1ASM A;  2W6J H;  5IWQ A;  1ZOY C;  3A0B H;  3LV2 A;  4WY4 A;  1GL2 C;  4NPF X;  4ZDO A;  4LNJ A;  1EZV D;  2VMR A;  2BCC E;  1OXP A;  4UQV A;  2YRR A;  1SQQ K;  1L0N J;  3L73 G;  4B86 A;  2XBN A;  2WQY C;  5K8B A;  3L72 E;  1NTM K;  1N7L A;  2R5D A;  1B4X A;  4BQ0 A;  1WYT B;  2B89 A;  4OH8 B;  2IZ1 A;  5M1B A;  1QL1 A;  1SQP D;  1WYU A;  2D61 A;  2YO2 A;  3EWK A;  3ZZJ A;  1N7S D;  5AVQ B;  4RIZ A;  3EIA A;  1Z3Z A;  5D95 A;  2HUU A;  3CI9 A;  1LTA C;  4H0L D;  1PGJ A;  2JJF A;  3N0L A;  2ZT9 D;  3MUD A;  2Y9Z A;  1FJK A;  3VP9 A;  3HQT A;  3C8V A;  3L72 D;  1AJS B;  4JYB A;  1S3J A;  4EFF A;  3HMU A;  3CX5 D;  1Q2N A;  1OX3 A;  1QLE D;  4WY4 C;  2BI2 A;  1SP4 A;  2ZSL A;  3HUS C;  4H13 B;  3QN6 A;  2V7Q H;  1SQQ E;  3TGU G;  4IXS A;  3FVU A;  2HOZ A;  1T3J A;  4I2L C;  1MV8 A;  3AEJ A;  4OGQ D;  1HJ0 A;  3A0H H;  5KAF H;  2VGZ A;  2BWO A;  1UII A;  1CQ6 A;  2X8U A;  1T3I A;  4L74 A;  1RF1 C;  3WU2 H;  2IZ0 A;  1XTG B;  3NNK A;  2E76 B;  1JNM A;  2W90 A;  1DJU A;  2ZT9 C;  1MFT A;  4FL0 A;  1WKH A;  2K1A A;  4JEZ A;  4M2K A;  4ZWV A;  3NX3 A;  3II6 A;  4B9B A;  4UB8 E;  1Y47 A;  3CQ5 A;  4IYO A;  1SQQ D;  1VQ7 P;  1IAX A;  2GMU A;  1W23 A;  4WY4 D;  3K28 A;  5AW2 B;  2CAN A;  2H7H A;  4DZO A;  1LT1 A;  2E7J A;  3VMX A;  4F4E A;  3KHU A;  1KKJ A;  2E74 B;  3FX0 A;  3AEF C;  1KQG B;  1VPC A;  4U3F D;  2M3B A;  3FSL A;  3FCR A;  4D6T G;  2HP2 A;  4WYC A;  1NHL A;  3CD6 P;  2OGU A;  3GWP A;  1LT9 A;  2DGK A;  4BA4 A;  1GL2 D;  2A45 I;  2E75 B;  4OWF A;  4F5J A;  4LC1 A;  5APQ A;  2QVA A;  1X2A A;  3GLM A;  1PG8 A;  4RJY A;  2C44 A;  2D5Y A;  3BS8 A;  4ITX A;  1VL2 A;  3KZI E;  1C9C A;  2OTK E;  4PV1 B;  2JKV A;  1Q7Y Q;  5FT8 A;  2YIU B;  5HHY A;  3EI9 A;  4QGR A;  3H1H J;  1QIT A;  5KJ7 C;  3GBX A;  2AXT E;  1FZC C;  2KSJ A;  4LLH A;  2HZP A;  4TMR A;  1LTI C;  1MAQ A;  1IFJ A;  1NH4 A;  5E3K A;  1PP9 G;  1MKM A;  2ZSM A;  1IZN B;  2I8D A;  4WYF A;  1ZR4 A;  1X0M A;  1EDK A;  1BJ4 A;  2E75 D;  3P6K A;  3FDD A;  1GDE A;  4L73 A;  1M4N A;  2CPB A;  1KC8 Q;  3FVX A;  3ELE A;  1MUU A;  2WWW A;  4AH3 A;  2LXB A;  5M46 A;  3EI6 A;  2AEU A;  1FU1 A;  3PD6 B;  3S1K A;  1BDD A;  2Z9U A;  1YAA A;  3MAF B;  3GF3 A;  3RK2 B;  2DOU A;  1VQP P;  3SWK A;  1JB0 J;  2GQN A;  4UHN A;  3W1I A;  2CFB A;  3B1C A;  1NTK J;  3MC6 A;  1GD2 E;  2FN6 A;  3EUC A;  1PZQ A;  2W7M A;  1K9M Q;  4ATP A;  3AEG C;  1N8R Q;  2M3E A;  3G71 P;  3FQA A;  4ASV A;  1SQB G;  5KLV E;  4ZM4 A;  2KI7 B;  1EQB A;  1W2E A;  2H89 C;  1PFF A;  3CC2 P;  2FYU G;  1CZQ A;  1NU1 E;  1MDZ A;  3SFD C;  2FFD A;  1EZV I;  4D6T E;  1D7R A;  3MKJ A;  3UIA A;  1QGK B;  2P10 A;  1H1C A;  3GW6 A;  1AY8 A;  2HUF A;  2XDJ A;  1XI9 A;  2C81 A;  3E6G A;  5CCH D;  3RGU A;  1FZA A;  1PP9 J;  2ZFC A;  1S08 A;  3F9T A;  2A45 H;  5B5E H;  1CI6 B;  2XV5 A;  1NAF A;  1S9K E;  2KIK A;  3GF7 A;  3RBF A;  2YIU C;  1PGO A;  3CWB E;  4BRY B;  4GOD A;  5H2F H;  4HH2 A;  3UE8 A;  4WXG A;  2HOX A;  4D6T D;  5APS A;  1USD A;  3I5T A;  2VMQ A;  3GZD C;  1Q86 Q;  2WPV B;  4DJG A;  4OVN F;  1N73 C;  1OXZ A;  2R3C A;  1AAW A;  3V6I A;  3OP7 A;  1LTG C;  1H89 A;  3BCC J;  4OTL A;  2VMO A;  7AAT A;  1TOG A;  4ITG A;  3H1J E;  3T32 A;  3U59 A;  1SQV K;  3L36 A;  1SFC B;  2Q5U A;  1YJW P;  4H51 A;  2CH1 A;  4NPE A;  3G6E P;  4GEB A;  1Z56 A;  4N0W A;  3JSV C;  3F0H A;  3E9K A;  3USF A;  1GU4 A;  2OTJ P;  2IBZ D;  2C9N Y;  1FOS E;  2PB0 A;  5EAV A;  1JY2 O;  3CCM P;  1CJ0 A;  4N6J A;  2Q7W A;  1KMJ A;  5AW5 B;  3CWB D;  4WBT A;  2QJY B;  1IFI A;  1AIB A;  3V2R A;  1M6S A;  3KZI H;  2NRG A;  1TOE A;  4WB4 A;  4PD4 H;  1ZN5 A;  3L74 D;  3L37 A;  3MP7 B;  1JY3 O;  4WYA A;  4C7N B;  1BDC A;  2EO5 A;  3CME P;  3QBO A;  1NAY A;  5AVS B;  2GMS A;  2BWP A;  2AY2 A;  1RF0 A;  3UWC A;  1OVR A;  1KQS O;  4EI2 A;  4A0F A;  2KFP A;  4OGQ B;  4BRY A;  3DC1 A;  2R3S A;  3CX5 E;  4KHX A;  2QE7 H;  1Q81 Q;  4DOJ A;  3WCN A;  3PP5 A;  1B9I A;  3HLM A;  2VYC A;  4K2M A;  4JQ0 D;  1RF1 B;  1SS1 A;  1N7S A;  1LW4 A;  2Y0E A;  2FYZ A;  2AXT H;  4F5H A;  1OVV A;  3NYS A;  1QL2 A;  4IX8 A;  1T6A A;  2MJZ A;  1C7O A;  3WUV A;  1B8G A;  3H1H G;  1ASA A;  4EU1 A;  1BJO A;  1AKC A;  1IO4 A;  3ASB A;  1FS0 E;  3FQ8 A;  3I55 P;  4U1T A;  4M2M A;  2N9Y B;  3OAK A;  3AEE C;  4H0L B;  2HPC A;  1YIZ A;  2KZJ A;  2D2C D;  4WWI A;  4A72 A;  1NTM G;  1DGE A;  4BA5 A;  2ITA A;  1IX8 A;  1N7S B;  1SQP G;  1NTK D;  2JEE A;  3USS A;  3OJA B;  3A9X A;  3HE4 A;  2NPS A;  4RKD A;  1YBK A;  2GUV A;  1NKN A;  1FZG A;  3DZZ A;  2O1J A;  2W6A A;  5DX5 A;  1LJ2 A;  5CCG D;  3NYT A;  4UHM A;  5AVY B;  2KK7 A;  4ZM3 A;  1LTJ A;  3B5N D;  3L73 J;  3FZ6 A;  1AIA A;  4C7N A;  3B1E A;  1SQB E;  4ADE A;  3F6T A;  4WP0 A;  2BIE A;  4LW2 A;  4W1W A;  3P8M C;  2HFE D;  4Y0I A;  1L4A C;  3ZDM A;  3HDO A;  5AVX B;  2YKY A;  4H13 D;  4JF7 A;  2KLV A;  2IFM A;  3K7Y A;  4L76 A;  2O0R A;  2D65 A;  2K9J B;  3AE1 C;  3NFQ A;  3L74 G;  1A02 F;  2NMP A;  4U3F G;  1VQ9 P;  1W3U A;  1NO4 A;  3GJU A;  4W7Y A;  3AEC C;  4UB6 H;  1YTZ T;  1HWT C;  1KFN A;  2O01 H;  4DT0 A;  2R5C B;  3E2Z A;  2XKM A;  2BHX A;  2YNY A;  1G1J A;  2CY8 A;  2E74 C;  1SQB J;  1VQ6 P;  1RF0 C;  1SLQ A;  3IF4 A;  2K9J A;  4PJ0 H;  2R2N A;  4JEW A;  2YXQ B;  1SQB D;  1U08 A;  5KAF E;  1DD3 A;  3KDP B;  3LIE A;  2BI3 A;  1L4A B;  2W8V A;  3G9R A;  2FYN B;  1J1E C;  2QA3 A;  1PPJ G;  2X5D A;  2ZYD A;  3AE9 C;  1S09 A;  3NUB A;  1QZ9 A;  3QWO C;  5AW3 B;  3CCJ P;  1KYO I;  2O3J A;  2RKL A;  3BCC G;  1LNQ A;  4U2H A;  1KKP A;  1SQV G;  1BQA A;  5AW8 B;  2YKV A;  5FT6 A;  1FDM A;  2AY7 A;  1SQX G;  3HD7 B;  4EIJ A;  3V5B A;  4WY4 B;  1P84 E;  1YJS A;  4W1V A;  3RBL A;  1DEE G;  1BSH A;  2GSA A;  4XJO A;  1AQT A;  1VF5 B;  3WU2 E;  2YOB A;  4Y99 C;  3QH9 A;  3VMY A;  2W7I A;  1UU0 A;  4XJP A;  1NOH A;  1KZU B;  1QGN A;  3BC8 A;  1JG8 A;  2YKQ A;  4AUW A;  3L71 G;  4Q76 A;  1OAT A;  2QB2 A;  2YRI A;  3LG0 A;  4ZMD A;  1S07 A;  2OTL P;  2KXP B;  3HBX A;  2OQX A;  3ACZ A;  8AAT A;  3GHG B;  2DKJ A;  1MDX A;  1CL1 A;  3CWB J;  1JEK A;  3II0 A;  5G4I A;  3H1L G;  2AY5 A;  3CXH D;  1SQB K;  3R4Y A;  1SQP K;  2Q1K A;  1L0L E;  3K40 A;  1KMK A;  1D7U A;  5KLI C;  1YOO A;  4JEX A;  4QMA A;  3BVH A;  2KSE A;  2VI9 A;  3AE3 C;  2FQ6 A;  1ASD A;  1I48 A;  1KYO H;  3N5M A;  1ZLL A;  2O01 N;  1LC8 A;  1C4K A;  3O8Z A;  4EB7 A;  1YNU A;  2QRX A;  2RH0 A;  5AVR B;  1YJZ A;  3BV0 A;  1TU3 F;  3HTK B;  2ZVO B;  2YXR B;  1N7S C;  2PP6 A;  3S9O A;  3FDB A;  3G0T A;  1PL5 A;  3H1I G;  1K8A Q;  3RCH A;  1EXI A;  4OT8 A;  3P1T A;  2C0X A;  2RMZ A;  2QJP C;  1JS6 A;  5EAA A;  1LTJ B;  1VQN P;  3EFG A;  2R44 A;  2W83 C;  1L0N K;  1SQX D;  2POH A;  2VMT A;  1HH0 A;  1V2E A;  9AAT A;  3AV7 A;  5CBO A;  1AHE A;  1AHF A;  1MAP A;  1O4S A;  1M57 D;  3AE5 C;  3L70 G;  2A06 G;  2ZY5 A;  4TLF A;  1NTZ D;  3H1K G;  1GEX A;  2IYO A;  4WXB A;  5GTH H;  1PPJ D;  1HTL C;  2A45 G;  4W1X A;  3DU4 A;  1KB9 D;  3W68 A;  1ELU A;  4YTP C;  1M7Y A;  1ASF A;  3C1L A;  1URQ D;  1DJ9 A;  3VYI A;  1CS1 A;  4ZSW A;  3TFU A;  4AYC A;  5APV A;  3KE3 A;  4TN4 A;  3JW9 A;  1NTZ E;  1AY4 A;  1ASE A;  3L73 E;  2EYQ A;  3O6Q A;  3WLX A;  3TGU D;  1D7M A;  2CJG A;  1RE4 C;  3H1L D;  2D7Z A;  3GG2 A;  1PPJ E;  1AKA A;  4WB0 A;  3TNU B;  1KIL E;  2OYI C;  1VF5 D;  2BI5 A;  4JEY A;  3VMA A;  2DGL A;  2FYF A;  1JCD A;  1NU1 K;  3RK3 D;  3GZD A;  1GTW A;  5E4Z A;  1QEX A;  1R5S A;  2CPS A;  4HKZ H;  1LC5 A;  4BHD A;  4IW7 A;  1GK4 A;  4ZKP A;  2CJD A;  5CJ4 A;  3RK3 B;  2WSE H;  5DJU B;  1UKJ A;  1X29 A;  3HVY A;  4F5G A;  3L8A A;  3CL3 D;  4AO9 A;  1HVV A;  1YQ4 C;  2CH2 A;  1EDL A;  3BCB A;  4KT0 J;  1TOJ A;  3RK2 D;  4DGT A;  4W91 A;  4FFC A;  1HJB A;  4H63 Q;  5EIG B;  3N7N A;  1ZXG A;  1ASN A;  1LTS C;  4F5M A;  3DR7 A;  3NTJ A;  4ZAS A;  5JAY A;  1CZC A;  5CJ0 A;  4R4M A;  5KJ7 D;  3VP6 A;  3B1D A;  3L75 G;  3AE4 C;  3TGU E;  3GZC A;  1G2C A;  4W7Z A;  1KAF A;  3CC7 P;  1ASB A;  1AHX A;  3L35 A;  1QVG O;  1IFD A;  3AOV A;  1G4X A;  1JOC A;  2L5G B;  4IYO B;  3JC2 2;  4UB8 H;  2ZT9 B;  2RFV A;  2QJK B;  3CCR P;  4WLJ A;  2O1K A;  2V1P A;  1BGY E;  4IFD K;  4P7Y A;  3ATH A;  1ZC9 A;  5TIS H;  2L91 A;  1SQQ G;  3GET A;  5B66 H;  3DXV A;  1JY2 P;  3BWN C;  1AAM A;  2FXO A;  1KQF B;  4F5K A;  4I1L A;  4RES B;  2W6B A;  1LP1 B;  2AY4 A;  2D66 A;  1BJN A;  1S72 P;  5I92 A;  1I43 A;  4K3A A;  3HT4 A;  1RY3 A;  2K3R A;  4F5L A;  1O61 A;  1YI2 P;  3R2P A;  1O69 A;  3IR9 A;  3M5U A;  3ZZK A;  5APT A;  1URQ C;  3VTP C;  2W8U A;  2YMY A;  4OC9 A;  3L4F A;  3V2N A;  1TOI A;  2A06 D;  3LVM A;  1MZ9 A;  2OYH B;  2VMW A;  2Z1Y A;  3PA9 A;  4HJG H;  5J8Q A;  1K04 A;  1NVO A;  5K5G B;  3VOM A;  2K37 A;  5B66 E;  2AEV A;  1FBM A;  4RM1 A;  1G7W A;  4E3Q A;  1WT6 A;  2ZP7 A;  3HUS B;  4H13 C;  2HPC B;  1PMM A;  3B71 A;  4ATQ A;  1P84 H;  4I8A A;  2KOG A;  3TFT A;  2OGE A;  3AEN A;  3MAF A;  3MIW A;  3CC4 P;  3AEM A;  1MFZ A;  1V72 A;  2G8Y A;  3L70 E;  2FNU A;  2A06 E;  4JYC A;  5M4B A;  2P58 A;  2HLO A;  4WBA A;  1SZS A;  3G4S P;  3WX9 A;  1AVY A;  2DW3 A;  1VJO A;  3A7O A;  5AVZ B;  1AX4 A;  2O1B A;  2QJK C;  2VLH A;  1BGY G;  5APY A;  2N1T A;  2H88 C;  5M49 A;  3D70 A;  2BWN A;  2VGS A;  3D6Z A;  3CCE P;  2W7H A;  1IFP A;  5EFW B;  3BRV B;  2V0Y A;  4Y0D A;  3FQ7 A;  3QM2 A;  3LWS A;  3EI7 A;  2BEZ F;  3FD0 A;  2AY1 A;  1OHW A;  4PIW A;  4GE9 A;  2IBZ I;  4JF1 A;  2WPR A;  3B46 A;  1J1D B;  1SQV J;  4YXW H;  3L70 J;  4MN4 C;  4Y0H A;  3MZW B;  3HD7 D;  3K5B A;  2CST A;  3FGA D;  1VQM P;  5BVZ A;  1RE3 A;  1MGV A;  1N73 B;  1C7G A;  1BE3 G;  3SWY A;  3H1J J;  1ECX A;  1GC0 A;  3V4W A;  1S5L X;  1VQ5 P;  5KLV D;  1EDJ A;  2Z5I A;  1NU1 G;  1CQ8 A;  3A9Z A;  3TGU J;  1FAV A;  3PJ0 A;  2K88 A;  4M3L A;  1I41 A;  1OVU A;  2WB6 A;  1IJD B;  2JG2 A;  2I1J A;  4A0R A;  4RIT A;  2HUI A;  3M91 A;  4ADB A;  2NPS B;  1YIY A;  1PGQ A;  3WUT A;  3QPG A;  2GA1 A;  3Q1M A;  2KNC A;  3P32 A;  4Z1M H;  3QHX A;  2Z5H A;  4N78 E;  5AVW B;  4A00 A;  3PJS K;  4HYT B;  1Y4I A;  2O7C A;  5F8V A;  1SQV D;  1S9K D;  2J59 M;  3F89 A;  1LC7 A;  1GK6 A;  1G2C B;  5KKZ C;  3A2B A;  2CB1 A;  4AQR D;  2AY3 A;  2QB3 A;  1YTZ I;  4MSO A;  4N3Y B;  2NPS D;  2YKP A;  2WZ7 A;  5GTI E;  4WLH A;  3H1L E;  2FKW B;  3VP8 A;  3RQ1 A;  3UAK A;  1T8Z A;  1KL2 A;  1J32 A;  1BS0 A;  1C0N A;  2YHK A;  2KUB A;  1BW0 A;  4PJ0 E;  4EOT A;  5TIS E;  2E42 A;  1L4A A;  3H25 A;  3AE6 C;  1BSN A;  2QM8 A;  4D6T J;  1RQV A;  3CXH H;  3H1I J;  1QVF O;  3WCO A;  1SPA A;  1J04 A;  2W7D A;  3KYQ A;  1K05 A;  1M7L A;  4H44 D;  3M9Q A;  2QJY C;  2W8T A;  4E77 A;  3N4S A;  1QIS A;  1D7S A;  2R5B A;  4WD2 A;  2YO3 A;  4YXD C;  2HOR A;  1L4A D;  2BCC G;  3RBZ A;  5BU5 A;  5KLV K;  3DRD A;  2D2C C;  1H0C A;  3H6P A;  3AEP A;  3Q5R A;  3BN1 A;  3O6Q B;  3FVS A;  4GRX A;  4JPZ B;  4KJM A;  1BQD A;  3KGW A;  1UU1 A;  1GC4 A;  3L72 G;  2ZY3 A;  2Z9W A;  2G3A A;  3BCC D;  5EFS A;  3FTB A;  4JF0 A;  2KP8 A;  2VGW A;  5GTI H;  1CQ7 A;  3A8U X;  2WK9 A;  2HOY A;  2E54 A;  2YCT A;  5C6U A;  5H2F E;  4RKC A;  3G3Z A;  1YHQ P;  2JJL A;  4CPG A;  3AEJ C;  3BRT B;  2AAT A;  5CCG A;  5DJT B;  1EC5 A;  1S4X A;  3JTX A;  3IHJ A;  1NTK K;  1S5L H;  1IAY A;  1SFC A;  4O6Z A;  3HTK A;  2DKB A;  5G2Q A;  2VMP A;  1KMI Z;  2OGA A;  4GE4 A;  4L75 A;  5AW0 B;  2WSF J;  3D6K A;  3CLQ A;  2VMU A;  3PDB A;  4H0L C;  1J1D C;  1AJR A;  1DEB A;  3E7K A;  3W67 A;  1H8A A;  5KJ7 A;  4WVZ A;  2G6W A;  1KD1 Q;  2BEQ D;  4GE7 A;  3G7Q A;  1LTB C;  4XE5 B;  3PGY A;  1U7J A;  2W7K A;  3T97 B;  3OW2 O;  1HUC A;  4EMY A;  3NDN A;  2EZ1 A;  2HP1 A;  1LKC A;  1S0A A;  2IBZ E;  1GW3 A;  3NXS A;  3RK3 C;  2VI8 A;  4KYO A;  2JO1 A;  4IOI H;  4XK1 A;  4CXQ A;  2IDB A;  2VLF A;  1WKG A;  3GHG C;  4A6U A;  1AY5 A;  4NPD A;  1NGM B;  1IK9 A;  2J5U A;  3L74 J;  1BE3 E;  1YJN P;  4Y99 B;  5TF5 A;  4E3R A;  2WK7 A;  1NWQ A;  1KFM A;  1IC2 A;  3RK2 C;  3KXD A;  3FZ8 A;  1Z7D A;  2ZVN B;  4ZSY A;  3L75 E;  1PFI A;  1YIJ P;  3L75 J;  3IFM A;  4LW4 A;  1AV1 A;  1I29 A;  4I6M C;  2AEM A;  4IXZ A;  1RE3 C;  1BJO B;  1TPL A;  2W7J A;  2FYN C;  1LK9 A;  1HGZ A;  3H1H D;  1MLZ A;  2PO3 A;  3SSU A;  4OGQ C;  1JF9 A;  5KLV J;  1ASG A;  3MAD A;  3KGX A;  4Q6R A;  3BCX A;  4K05 A;  3MD0 A;  2WSS H;  3CQ4 A;  3B8E B;  4RAE A;  3JWA A;  1GL2 B;  3L71 D;  1ZV8 A;  2JJH A;  4MQP A;  2WMM A;  2ZYG A;  1RV3 A;  1FZC B;  4LGD E;  1AA0 A;  1W7L A;  2KYV A;  1BE3 J;  3ZRR A;  1FG3 A;  3AOW A;  4WB0 B;  1ELQ A;  3A2A A;  5KLI B;  3TQX A;  1BE3 D;  3HE4 B;  2KZI A;  1EJI A;  1L0L K;  2JIS A;  1SQX J;  1Y9B A;  5CCH C;  2GM4 A;  3H1H E;  4IL6 E;  3M9B A;  5AW4 B;  2LXC B;  3M0D A;  2WPS A;  3VOP A;  1FC4 A;  1LWU C;  1JTH A;  2QG4 A;  1DKA A;  4ZDL A;  3C9I A;  1U7M A;  2XNX A;  1WST A;  2QMA A;  4GOF A;  1C7N A;  2E5Y A;  1TOK A;  2KLU A;  2LKM A;  3WGB A;  3MTU E;  3N4X A;  2Y9Y A;  3FKD A;  1SQP E;  4L0O A;  2F8J A;  2JDI H;  2AXC A;  2Y0D A;  2HYN A;  2ZJS E;  1VP4 A;  2R5C A;  3RI6 A;  4GDO A;  3L71 J;  3E2Y A;  1GBN A;  1BJW A;  3QI6 A;  3VN0 A;  2W7L A;  2AY9 A;  2WSC J;  3B5N A;  3LY1 A;  1M90 Q;  2P67 A;  1VQO P;  1GD9 A;  1EG5 A;  4M2J A;  5KAI H;  2HOD B;  2BYL A;  2AEF A;  2ZUK A;  4I7Z C;  4BWN A;  3NYU A;  2I1K A;  1NU1 D;  4PD4 D;  4LNL A;  1M1J C;  3SFE C;  1CL2 A;  1XTC C;  3CX5 I;  3MC6 C;  5EUE A;  4A7P A;  1CW5 A;  1S2E A;  1ZR2 A;  4XFJ A;  4IY7 A;  2M5A B;  1YJ9 P;  3L74 E;  4K2I A;  3H1K D;  4IFF A;  1W7N A;  1G7X A;  4TT3 H;  1B5P A;  3ECD A;  2OAT A;  2Y0C A;  3AEB C;  4ZDP A;  1USE A;  4MKJ A;  2Z9X A;  1BGY J;  2VMN A;  3TCM A;  1B9H A;  3ITK A;  2G7J A;  3CQ6 A;  1VDF A;  1DD4 A;  2HR3 A;  1M0Q A;  3Q3D A;  1G1I A;  2BCC D;  3A0H E;  3PDX A;  2O01 J;  4PD4 E;  2ORD A;  1IFM A;  3EQ2 A;  1KB9 H;  1OHV A;  1JS3 A;  1AHY A;  1AFO A;  3CXH I;  2VMY A;  1Q90 D;  3PDB B;  1QJ5 A;  1V2D A;  1GMJ A;  3VK4 A;  1H0T A;  2BKW A;  2ZJG A;  3ASA A;  3FWL A;  2GUS A;  4GT1 A;  2E5T A;  2N9B A;  1X9V A;  2OYH A;  2Z1Z A;  1L0N D;  3EI5 A;  2R5E A;  5F9S A;  1SQX K;  1TAR A;  2PRR A;  3P8C E;  2YCN A;  4K2B A;  4AOA A;  3KQG A;  3BCC E;  5G4J A;  3H9X A;  2WT7 A;  2W8Z A;  3GMA A;  1DTY A;  4WYE A;  3RL0 C;  2OQQ A;  3H1K E;  2W7F A;  1JM0 A;  1SFC D;  1M56 D;  2QSR A;  1D2F A;  3EFF K;  2Z20 A;  5DB5 A;  3CBF A;  3E1R A;  3MEB A;  3I5C A;  3A5T A;  3M0A A;  1IX6 A;  3B4S A;  2PB2 A;  2TPL A;  1EDI A;  2KB7 P;  3TF5 A;  3HUS A;  2EGY A;  4GDY A;  3GHG A;  3EI8 A;  4PFF A;  4IL6 H;  3B8X A;  5TJH A;  2VGU A;  5AW7 B;  3CX5 H;  3A3Y B;  4HVK A;  2QSI A;  3L71 E;  1KL1 A;  1L0N E;  2ZY2 A;  3B5N C;  3DOD A;  1VQ8 P;  1NJI Q;  3FZ7 A;  2YKO A;  4W5K A;  2QA4 P;  3LW5 J;  2E74 D;  1MDO A;  3VAX A;  3CCQ P;  3FRK A;  1GEY A;  1IBJ A;  2AY6 A;  1IFN A;  5KLV G; 
#chains in the Genus database with same CATH homology
 2N1T D;  3TAT A;  3NUI A;  1GL2 A;  3I4J A;  4ADC A;  2XZR A;  2P2U A;  1SZU A;  3PD6 A;  2FNI A;  1B5O A;  3TYY A;  1RV4 A;  3RCH B;  3WY7 A;  3H32 A;  1AMA A;  1LWU A;  1URQ A;  1TAT A;  4EB5 A;  1A02 J;  1ZOD A;  5E5I A;  3Q8N A;  3KPE A;  3V2Q A;  4DBC A;  2R32 A;  2D7Y A;  4RJ0 A;  2X5F A;  1QIR A;  4C7R A;  2Z9V A;  2FFD B;  1X8Y A;  3N75 A;  2C7T A;  1AMS A;  4W80 A;  4OBU A;  2VMV A;  3HD7 C;  5CMZ A;  1FG7 A;  4Q31 A;  2FKI A;  5G2P A;  3W1H A;  2HG5 D;  1JY3 N;  1LGH B;  4OMA A;  4R5F A;  3U1C A;  4UOY A;  1G4V A;  4XJL A;  2FM1 A;  5CHX A;  1KIL B;  4OYT A;  3E1I A;  2HOD A;  2W8J A;  3EZS A;  3OA7 A;  2JGT A;  2WSC H;  3H7F A;  1CSB A;  4R8D A;  3BWN A;  5CCG C;  2WKA A;  1LS3 A;  3FFH A;  2E7U A;  2ZY4 A;  5HXX A;  3VK2 A;  1LWU B;  1J1E B;  1WYV A;  1KQL A;  3GSB A;  2Z4E A;  4CBS A;  1N8P A;  2Q3I A;  4ADD A;  3ELP A;  5AX8 A;  4WYG A;  2BI9 A;  2ZXE B;  2N1T B;  2OKK A;  3LW5 H;  5AVU B;  1WYV B;  2ZC0 A;  1LT9 C;  1E5F A;  1H88 A;  3AEL A;  1O62 A;  2H8P D;  2CIN A;  1KIL C;  1MLY A;  3LVJ A;  2WK8 A;  5D5S A;  1FJP A;  3A9Y A;  3JZL A;  3LVL B;  3PAA A;  2R0T A;  3PPL A;  2QBT A;  4J5U A;  1BKG A;  2FXM A;  1RF1 A;  3GR9 A;  5G0A A;  1P3W A;  2DGM A;  4XJM A;  5HDM A;  2VMX A;  3WKS A;  1ASC A;  3OKS A;  4E1O A;  2BIA A;  4LNM A;  1RVY A;  5DJ9 A;  1BT4 A;  4A6R A;  1GDT A;  1DFO A;  1JMM A;  2QLR A;  3P8C D;  2C9L Y;  4MY5 A;  2FYU K;  4ZKU A;  2QM7 A;  3NU8 A;  1SZK A;  1JUN A;  2JJE A;  3TNU A;  4ZLV A;  3NRA A;  1X79 B;  3SWF A;  3AEN B;  1GC3 A;  4CBR A;  2FFD C;  5BU8 B;  1ARH A;  4KAM A;  1FZE A;  1RVU A;  2Z61 A;  3DR4 A;  1XEY A;  1GEW A;  4KXK A;  3AEO A;  4DQ6 A;  3H32 B;  4HF8 A;  3LID A;  1URQ B;  1V2F A;  1RE4 A;  5FT5 A;  1OXO A;  2GB3 A;  4IFM A;  2W27 A;  2XH1 A;  5EUN A;  1KIL D;  2XU6 A;  2YKX A;  1TAS A;  3PIU A;  3R9A A;  1LT9 B;  5EIG A;  2JJG A;  1SFF A;  2IX7 C;  5APU A;  4JEV A;  4GSA A;  4F5I A;  2YCP A;  4LC3 A;  1PMO A;  4RLG A;  3RUY A;  3KKI A;  3TK1 A;  1IX7 A;  3HE5 B;  1SF2 A;  4OCA A;  1N86 A;  1ZOB A;  4Q75 A;  5G09 A;  2P7J A;  3WMM 0;  1IVR A;  1T3U A;  4CVQ A;  1JY2 N;  1E5E A;  1KIL A;  1T2K C;  4XAU A;  3HRN A;  1EQ7 A;  2X3L A;  4IXO A;  1YJY A;  1M32 A;  3B5N B;  3ISL A;  1CZE A;  4ZWM A;  3VMZ A;  4NOG A;  2YKU A;  1GU5 A;  3WKR A;  1IUG A;  3CAI A;  2Q7C A;  2E43 A;  1QJ3 A;  3HD7 A;  1AMQ A;  1ASL A;  5KTB A;  1JTH B;  1AIC A;  4A0H A;  1SVF A;  4W8I A;  1ARS A;  2EPJ A;  1ORD A;  4AO4 A;  1N31 A;  2A1V A;  4UHO A;  1T2K D;  3R4T A;  4R5Z A;  4B98 A;  2VMZ A;  1DH3 A;  2OKJ A;  5DJ1 A;  3DXW A;  1FOS F;  2IFN A;  1ART A;  4J8L A;  5APW A;  1JCC A;  2C0W A;  2PAJ A;  2OYH C;  3VK3 A;  4GKG A;  2CTZ A;  1AQ5 A;  3P7K A;  5FT4 A;  3DYD A;  3V4Q A;  1JY3 P;  2W7G A;  2H43 A;  3M0D C;  1JO5 A;  1HBW A;  2WPQ A;  1AMR A;  3FFR A;  2BI1 A;  2P1J A;  4C46 A;  1DX7 A;  2DR1 A;  1NTZ K;  4P3M A;  2VIA A;  1W7M A;  1N2D C;  2CJH A;  5BJ4 A;  3E2F A;  4MQR A;  2BIG A;  2OYI A;  1CI6 A;  3WGC A;  2NPS C;  3WZF A;  2M8R A;  3AEM C;  1E5W A;  1ARG A;  1OWA A;  2EZ2 A;  3E2Z B;  3MGN A;  2AY8 A;  2OAR A;  1LTJ C;  1DGD A;  3G8M A;  3BAT A;  1IJI A;  2VRS A;  4AZK A;  1SVV A;  3ZRQ A;  2W7E A;  2E7I A;  4PFN A;  1J2J B;  2VGV A;  2WSF H;  1N73 A;  3MAU A;  4CXR A;  1GC2 A;  1S06 A;  4O9B A;  3BCA A;  1M1J A;  3NMD A;  1GCK A;  1OHY A;  4ISY A;  4WXF A;  3NTN A;  3RL0 B;  3EIB A;  1GW4 A;  3COG A;  3E77 A;  1LTT C;  1AKB A;  4GIF A;  1NKZ B;  2D64 A;  3I16 A;  3M06 A;  3NU7 A;  1D7V A;  1AHG A;  2W8W A;  3AAT A;  4R2N A;  2WT7 B;  2WTY A;  1X28 A;  3LVK A;  2D63 A;  3T97 A;  1FZB A;  5EUD A;  2IPP A;  3QGU A;  2OYI B;  3HE5 A;  3N4R A;  1DJE A;  4A0G A;  4MQQ A;  4BMK A;  4WYD A;  4ZAH A;  1N2T A;  1HGV A;  4XEW A;  5AVV B;  2VIB A;  5EQC A;  1GZL A;  2BYJ A;  5CCH A;  3HL2 A;  1ARI A;  5AW6 B;  4MKK A;  5M4D A;  2EH6 A;  4N78 D;  4PVF A;  3EZ1 A;  3V2P A;  2C0R A;  1VEF A;  5APX A;  3BB8 A;  5AVT B;  1WYT A;  1M1J B;  2N1T C;  3JWB A;  4AZJ A;  1WYU B;  2VGT A;  1M0O A;  1FZF A;  1LW5 A;  3BWO A;  1FZC A;  2Q9I A;  1UU2 A;  4A6T A;  3M9H A;  1M0P A;  3L44 A;  5BJ3 A;  2WIT A;  1M0N A;  4XQ2 A;  3RL0 D;  1AJS A;  3MBB A;  3TSI A;  1YYC A;  3BAS A;  1SFC C;  2J58 A;  3W1J A;  1WRG A;  2BAS A;  4OBV A;  4F5F A;  3ZRP A;  2ZYJ A;  4XA4 A;  5AW1 B;  5AW9 B;  2VMS A;  3U1A A;  1ASM A;  5IWQ A;  3LV2 A;  4WY4 A;  1GL2 C;  4ZDO A;  4LNJ A;  2VMR A;  1OXP A;  4UQV A;  2YRR A;  1SQQ K;  4B86 A;  2XBN A;  5K8B A;  1NTM K;  1N7L A;  2R5D A;  1B4X A;  4BQ0 A;  1WYT B;  4OH8 B;  1QL1 A;  1WYU A;  2D61 A;  2YO2 A;  3ZZJ A;  1N7S D;  5AVQ B;  4RIZ A;  3EIA A;  1Z3Z A;  5D95 A;  2HUU A;  3CI9 A;  1LTA C;  2JJF A;  3N0L A;  3MUD A;  1FJK A;  3VP9 A;  3HQT A;  1AJS B;  4JYB A;  4EFF A;  3HMU A;  4WY4 C;  2BI2 A;  1SP4 A;  2ZSL A;  3HUS C;  3QN6 A;  4IXS A;  3FVU A;  2HOZ A;  1T3J A;  4I2L C;  1MV8 A;  3AEJ A;  2VGZ A;  2BWO A;  1CQ6 A;  2X8U A;  1T3I A;  1RF1 C;  1XTG B;  3NNK A;  1JNM A;  1DJU A;  4FL0 A;  1WKH A;  4JEZ A;  4M2K A;  4ZWV A;  3NX3 A;  3II6 A;  4B9B A;  3CQ5 A;  4IYO A;  1IAX A;  2GMU A;  1W23 A;  4WY4 D;  3K28 A;  5AW2 B;  2CAN A;  2H7H A;  4DZO A;  2E7J A;  3VMX A;  4F4E A;  1KKJ A;  1VPC A;  2M3B A;  3FSL A;  3FCR A;  2HP2 A;  4WYC A;  1NHL A;  3GWP A;  1LT9 A;  2DGK A;  4BA4 A;  1GL2 D;  2A45 I;  4F5J A;  4LC1 A;  5APQ A;  1X2A A;  1PG8 A;  4RJY A;  2C44 A;  2D5Y A;  3BS8 A;  4ITX A;  1C9C A;  5FT8 A;  5HHY A;  3EI9 A;  4QGR A;  1QIT A;  5KJ7 C;  3GBX A;  1FZC C;  2KSJ A;  4LLH A;  2HZP A;  4TMR A;  1LTI C;  1MAQ A;  1IFJ A;  1NH4 A;  5E3K A;  2ZSM A;  4WYF A;  1ZR4 A;  1X0M A;  1BJ4 A;  3P6K A;  3FDD A;  1GDE A;  1M4N A;  2CPB A;  3FVX A;  3ELE A;  1MUU A;  2WWW A;  4AH3 A;  5M46 A;  3EI6 A;  2AEU A;  1FU1 A;  3PD6 B;  2Z9U A;  1YAA A;  3MAF B;  3RK2 B;  2DOU A;  2GQN A;  4UHN A;  3W1I A;  2CFB A;  3B1C A;  3MC6 A;  1GD2 E;  2FN6 A;  3EUC A;  2W7M A;  4ATP A;  3FQA A;  4ZM4 A;  1EQB A;  1W2E A;  1PFF A;  1CZQ A;  1MDZ A;  2FFD A;  1D7R A;  3MKJ A;  3UIA A;  1H1C A;  1AY8 A;  2HUF A;  2XDJ A;  1XI9 A;  2C81 A;  3E6G A;  5CCH D;  1FZA A;  2ZFC A;  1S08 A;  3F9T A;  2A45 H;  1CI6 B;  2XV5 A;  1NAF A;  1S9K E;  3RBF A;  3UE8 A;  4HH2 A;  4WXG A;  2HOX A;  5APS A;  3I5T A;  2VMQ A;  3GZD C;  1N73 C;  1OXZ A;  2R3C A;  1AAW A;  3OP7 A;  1LTG C;  1H89 A;  4OTL A;  2VMO A;  7AAT A;  1TOG A;  4ITG A;  3T32 A;  3U59 A;  1SQV K;  3L36 A;  1SFC B;  2Q5U A;  4H51 A;  2CH1 A;  4GEB A;  1Z56 A;  4N0W A;  3F0H A;  3E9K A;  3USF A;  1GU4 A;  2C9N Y;  1FOS E;  2PB0 A;  5EAV A;  1JY2 O;  1CJ0 A;  4N6J A;  2Q7W A;  1KMJ A;  5AW5 B;  4WBT A;  1IFI A;  1AIB A;  3V2R A;  1M6S A;  1TOE A;  4WB4 A;  1ZN5 A;  3L37 A;  1JY3 O;  4WYA A;  4C7N B;  2EO5 A;  3QBO A;  5AVS B;  2GMS A;  2BWP A;  2AY2 A;  1RF0 A;  3UWC A;  4A0F A;  2KFP A;  3DC1 A;  4KHX A;  4DOJ A;  3WCN A;  3PP5 A;  1B9I A;  3HLM A;  2VYC A;  4K2M A;  1RF1 B;  1N7S A;  1LW4 A;  2FYZ A;  4F5H A;  3NYS A;  1QL2 A;  4IX8 A;  2MJZ A;  1C7O A;  1B8G A;  1ASA A;  4EU1 A;  1BJO A;  1AKC A;  1IO4 A;  3ASB A;  3FQ8 A;  4U1T A;  4M2M A;  3OAK A;  1YIZ A;  2HPC A;  4A72 A;  1DGE A;  4BA5 A;  1IX8 A;  1N7S B;  2JEE A;  3OJA B;  3A9X A;  3HE4 A;  2NPS A;  4RKD A;  2GUV A;  1NKN A;  1FZG A;  3DZZ A;  2O1J A;  2W6A A;  5DX5 A;  5CCG D;  3NYT A;  4UHM A;  5AVY B;  4ZM3 A;  1LTJ A;  3B5N D;  3FZ6 A;  1AIA A;  4C7N A;  3B1E A;  4ADE A;  3F6T A;  4WP0 A;  2BIE A;  4LW2 A;  4W1W A;  3P8M C;  2HFE D;  4Y0I A;  1L4A C;  3HDO A;  5AVX B;  2YKY A;  4JF7 A;  2KLV A;  2IFM A;  3K7Y A;  2O0R A;  2D65 A;  3NFQ A;  1A02 F;  2NMP A;  1W3U A;  1NO4 A;  3GJU A;  4W7Y A;  1YTZ T;  1HWT C;  1KFN A;  2O01 H;  2R5C B;  3E2Z A;  2XKM A;  2BHX A;  2YNY A;  1G1J A;  2CY8 A;  1RF0 C;  1SLQ A;  4JEW A;  2R2N A;  1U08 A;  3LIE A;  3KDP B;  2BI3 A;  1L4A B;  2W8V A;  1J1E C;  2QA3 A;  2X5D A;  1S09 A;  3NUB A;  1QZ9 A;  5AW3 B;  4U2H A;  1KKP A;  1BQA A;  5AW8 B;  2YKV A;  5FT6 A;  1FDM A;  2AY7 A;  3HD7 B;  4EIJ A;  3V5B A;  4WY4 B;  1YJS A;  4W1V A;  3RBL A;  2GSA A;  4XJO A;  2YOB A;  4Y99 C;  3VMY A;  2W7I A;  1UU0 A;  4XJP A;  1NOH A;  1KZU B;  1QGN A;  3BC8 A;  1JG8 A;  2YKQ A;  4AUW A;  4Q76 A;  1OAT A;  2QB2 A;  2YRI A;  3LG0 A;  1S07 A;  3HBX A;  2OQX A;  3ACZ A;  8AAT A;  3GHG B;  2DKJ A;  1MDX A;  1CL1 A;  3II0 A;  5G4I A;  2AY5 A;  1SQB K;  1SQP K;  3K40 A;  1KMK A;  1D7U A;  1YOO A;  4JEX A;  3BVH A;  2VI9 A;  2FQ6 A;  1ASD A;  1I48 A;  3N5M A;  1ZLL A;  1LC8 A;  1C4K A;  3O8Z A;  4EB7 A;  1YNU A;  5AVR B;  1YJZ A;  3BV0 A;  3HTK B;  1N7S C;  2PP6 A;  3FDB A;  3G0T A;  3RCH A;  4OT8 A;  3P1T A;  2C0X A;  1JS6 A;  5EAA A;  1LTJ B;  3EFG A;  1L0N K;  2POH A;  2VMT A;  1HH0 A;  1V2E A;  9AAT A;  3AV7 A;  1AHE A;  1AHF A;  1MAP A;  1O4S A;  2ZY5 A;  1GEX A;  4WXB A;  1HTL C;  2A45 G;  4W1X A;  3DU4 A;  1ELU A;  1M7Y A;  1ASF A;  1URQ D;  1DJ9 A;  3VYI A;  1CS1 A;  4ZSW A;  3TFU A;  4AYC A;  5APV A;  3KE3 A;  4TN4 A;  3JW9 A;  1AY4 A;  1ASE A;  2EYQ A;  3WLX A;  2CJG A;  1RE4 C;  2D7Z A;  1AKA A;  4WB0 A;  3TNU B;  2OYI C;  2BI5 A;  4JEY A;  2DGL A;  2FYF A;  1JCD A;  1NU1 K;  3RK3 D;  3GZD A;  1GTW A;  5E4Z A;  2CPS A;  1LC5 A;  4BHD A;  4IW7 A;  1GK4 A;  4ZKP A;  2CJD A;  5CJ4 A;  3RK3 B;  2WSE H;  1X29 A;  1UKJ A;  3HVY A;  4F5G A;  3L8A A;  3CL3 D;  4AO9 A;  1HVV A;  2CH2 A;  3BCB A;  1TOJ A;  3RK2 D;  4DGT A;  4W91 A;  4FFC A;  1HJB A;  4H63 Q;  5EIG B;  3N7N A;  1ASN A;  1LTS C;  4F5M A;  3DR7 A;  3NTJ A;  4ZAS A;  5JAY A;  1CZC A;  5CJ0 A;  5KJ7 D;  3VP6 A;  3B1D A;  3GZC A;  1G2C A;  4W7Z A;  1ASB A;  1AHX A;  3L35 A;  1IFD A;  3AOV A;  1G4X A;  1JOC A;  2L5G B;  4IYO B;  2RFV A;  4WLJ A;  2O1K A;  2V1P A;  4P7Y A;  4IFD K;  3ATH A;  1ZC9 A;  3GET A;  3DXV A;  1JY2 P;  3BWN C;  1AAM A;  4F5K A;  4I1L A;  4RES B;  2W6B A;  2AY4 A;  2D66 A;  1BJN A;  5I92 A;  1I43 A;  3HT4 A;  1RY3 A;  4F5L A;  1O61 A;  3R2P A;  1O69 A;  3IR9 A;  3M5U A;  3ZZK A;  5APT A;  1URQ C;  3VTP C;  2W8U A;  2YMY A;  4OC9 A;  3L4F A;  3V2N A;  1TOI A;  3LVM A;  1MZ9 A;  2OYH B;  2VMW A;  2Z1Y A;  3PA9 A;  5J8Q A;  3VOM A;  2AEV A;  1FBM A;  4RM1 A;  1G7W A;  4E3Q A;  1WT6 A;  2ZP7 A;  3HUS B;  2HPC B;  1PMM A;  4ATQ A;  4I8A A;  2KOG A;  3TFT A;  2OGE A;  3AEN A;  3MAF A;  3MIW A;  3AEM A;  1MFZ A;  1V72 A;  2FNU A;  4JYC A;  5M4B A;  2HLO A;  4WBA A;  1SZS A;  3WX9 A;  1VJO A;  3A7O A;  5AVZ B;  1AX4 A;  2O1B A;  2VLH A;  5APY A;  2N1T A;  5M49 A;  2BWN A;  2VGS A;  2W7H A;  3BRV B;  2V0Y A;  4Y0D A;  3FQ7 A;  3QM2 A;  3LWS A;  3EI7 A;  3FD0 A;  2AY1 A;  1OHW A;  4PIW A;  4GE9 A;  4JF1 A;  2WPR A;  3B46 A;  1J1D B;  4Y0H A;  3HD7 D;  2CST A;  5BVZ A;  1RE3 A;  1MGV A;  1N73 B;  1C7G A;  3SWY A;  1ECX A;  1GC0 A;  3V4W A;  2Z5I A;  1CQ8 A;  3A9Z A;  1FAV A;  3PJ0 A;  4M3L A;  1I41 A;  2WB6 A;  1IJD B;  2JG2 A;  2I1J A;  4A0R A;  4RIT A;  2HUI A;  3M91 A;  4ADB A;  2NPS B;  1YIY A;  3QPG A;  3P32 A;  3QHX A;  2Z5H A;  4N78 E;  5AVW B;  4A00 A;  4HYT B;  1Y4I A;  2O7C A;  5F8V A;  1S9K D;  2J59 M;  1LC7 A;  1GK6 A;  1G2C B;  3A2B A;  2CB1 A;  4AQR D;  2AY3 A;  2QB3 A;  1YTZ I;  4MSO A;  4N3Y B;  2NPS D;  2YKP A;  2WZ7 A;  4WLH A;  2FKW B;  3VP8 A;  3RQ1 A;  3UAK A;  1T8Z A;  1KL2 A;  1J32 A;  1BS0 A;  1C0N A;  2YHK A;  1BW0 A;  4EOT A;  2E42 A;  1L4A A;  2QM8 A;  3WCO A;  1SPA A;  1J04 A;  2W7D A;  3KYQ A;  1M7L A;  3M9Q A;  2W8T A;  4E77 A;  3N4S A;  1QIS A;  1D7S A;  2R5B A;  4WD2 A;  2YO3 A;  2HOR A;  1L4A D;  5BU5 A;  5KLV K;  3DRD A;  1H0C A;  3H6P A;  3AEP A;  3BN1 A;  3FVS A;  4GRX A;  3KGW A;  1BQD A;  1UU1 A;  1GC4 A;  2ZY3 A;  2Z9W A;  5EFS A;  3FTB A;  4JF0 A;  2KP8 A;  2VGW A;  1CQ7 A;  3A8U X;  2WK9 A;  2HOY A;  2E54 A;  2YCT A;  5C6U A;  4RKC A;  3G3Z A;  2JJL A;  3AEJ C;  3BRT B;  2AAT A;  5CCG A;  3JTX A;  3IHJ A;  1NTK K;  1IAY A;  1SFC A;  4O6Z A;  3HTK A;  2DKB A;  5G2Q A;  2VMP A;  4GE4 A;  2OGA A;  5AW0 B;  3D6K A;  3CLQ A;  2VMU A;  3PDB A;  1J1D C;  1AJR A;  1DEB A;  1H8A A;  5KJ7 A;  2G6W A;  4GE7 A;  3G7Q A;  1LTB C;  4XE5 B;  3PGY A;  2W7K A;  1HUC A;  4EMY A;  3NDN A;  2EZ1 A;  2HP1 A;  1LKC A;  1S0A A;  1GW3 A;  3NXS A;  3RK3 C;  2VI8 A;  4KYO A;  4XK1 A;  4CXQ A;  2VLF A;  1WKG A;  3GHG C;  4A6U A;  1AY5 A;  1IK9 A;  4Y99 B;  5TF5 A;  4E3R A;  2WK7 A;  1NWQ A;  1KFM A;  1IC2 A;  3RK2 C;  3FZ8 A;  1Z7D A;  4ZSY A;  1PFI A;  3IFM A;  4LW4 A;  1I29 A;  4I6M C;  4IXZ A;  1RE3 C;  1BJO B;  1TPL A;  2W7J A;  1LK9 A;  1HGZ A;  1MLZ A;  2PO3 A;  1JF9 A;  1ASG A;  3MAD A;  3KGX A;  4Q6R A;  3BCX A;  4K05 A;  3MD0 A;  3CQ4 A;  3B8E B;  4RAE A;  3JWA A;  1GL2 B;  1ZV8 A;  2JJH A;  4MQP A;  1RV3 A;  1FZC B;  4LGD E;  1W7L A;  2KYV A;  3ZRR A;  1FG3 A;  3AOW A;  4WB0 B;  1ELQ A;  3A2A A;  3TQX A;  3HE4 B;  1EJI A;  1L0L K;  2JIS A;  5CCH C;  2GM4 A;  3M9B A;  5AW4 B;  3M0D A;  2WPS A;  3VOP A;  1FC4 A;  1LWU C;  1JTH A;  4ZDL A;  1DKA A;  3C9I A;  2XNX A;  1WST A;  2QMA A;  1C7N A;  1TOK A;  2LKM A;  3WGB A;  3MTU E;  3N4X A;  3FKD A;  4L0O A;  2F8J A;  2HYN A;  1VP4 A;  2R5C A;  3RI6 A;  3E2Y A;  1GBN A;  1BJW A;  3QI6 A;  3VN0 A;  2W7L A;  2AY9 A;  3B5N A;  3LY1 A;  2P67 A;  1GD9 A;  4M2J A;  1EG5 A;  2HOD B;  2BYL A;  2ZUK A;  3NYU A;  2I1K A;  4LNL A;  1M1J C;  1CL2 A;  1XTC C;  3MC6 C;  5EUE A;  1CW5 A;  1ZR2 A;  4IY7 A;  4K2I A;  4IFF A;  1W7N A;  1G7X A;  1B5P A;  3ECD A;  2OAT A;  4ZDP A;  4MKJ A;  2Z9X A;  2VMN A;  3TCM A;  1B9H A;  2G7J A;  3CQ6 A;  1VDF A;  1M0Q A;  1G1I A;  3PDX A;  2ORD A;  1IFM A;  3EQ2 A;  1OHV A;  1JS3 A;  1AHY A;  1AFO A;  2VMY A;  3PDB B;  1QJ5 A;  1V2D A;  3VK4 A;  2BKW A;  2ZJG A;  3ASA A;  2GUS A;  4GT1 A;  2N9B A;  1X9V A;  2OYH A;  2Z1Z A;  3EI5 A;  2R5E A;  5F9S A;  1SQX K;  1TAR A;  3P8C E;  2YCN A;  4K2B A;  4AOA A;  3KQG A;  5G4J A;  3H9X A;  2WT7 A;  1DTY A;  4WYE A;  3RL0 C;  2W7F A;  1SFC D;  2QSR A;  1D2F A;  2Z20 A;  5DB5 A;  3CBF A;  3MEB A;  3I5C A;  3A5T A;  3M0A A;  1IX6 A;  2PB2 A;  2TPL A;  2KB7 P;  3HUS A;  2EGY A;  4GDY A;  3GHG A;  3EI8 A;  4PFF A;  3B8X A;  2VGU A;  5AW7 B;  3A3Y B;  4HVK A;  1KL1 A;  2ZY2 A;  3B5N C;  3DOD A;  3FZ7 A;  2YKO A;  4W5K A;  1MDO A;  3VAX A;  3FRK A;  1GEY A;  1IBJ A;  2AY6 A;  1IFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...