3N4XA

Structure of csm1 full-length
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
163
structure length
149
Chain Sequence
SADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Monopolin Complex Crosslinks Kinetochore Components to Regulate Chromosome-Microtubule Attachments.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
molecule keywords Monopolin complex subunit CSM1
total genus 48
structure length 149
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3n4xA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3n4xA02
3BATA 3HRNA 3N4XA 3BASA 5BU5A 4GIFA 4O9BA 3N4SA 5BU8B 3P8CD 1WT6A 4ZKUA 4I1LA 3VP9A 3C9IA 3N7NA 2JEEA 4N3YB 3U59A 5KTBA 1X79B 4N78D 2FXMA 3U1AA 3VP8A 3U1CA 3N4RA 5BVZA 1IC2A 4ZKPA 1NKNA 3OJAB 2POHA
chains in the Genus database with same CATH superfamily
1SLQA 1JTHB 1VQOP 1Q81Q 4MN4C 5B66H 4CXQA 1LNQA 1VQPP 4W5KA 4NPDA 4ADEA 4Y99B 1Z3ZA 2DKJA 2RKLA 2YRRA 3II0A 1IAXA 4Q75A 4PV1D 1SQPD 2FFDB 2ZY4A 5AX8A 5IWQA 2OGEA 2MKVA 5D5SA 3AEBC 3H1KG 2FYUJ 3A7OA 4H63Q 3W1HA 5C39A 5H2FH 1WYVA 4WB4A 1LP1A 2OQQA 4C7NB 3AV7A 1NYHA 1SQQD 3L74E 2W8WA 3WUVA 1VQMP 4Y99C 1SQPE 2IBZD 2Z1ZA 4A6UA 5HXXA 2JGTA 1ZR4A 2W7JA 3H1HE 3BN1A 4B86A 2A45G 2AXCA 2YIUC 5CCHD 2W8VA 3VTPC 1DFOA 3HE5A 2AY8A 4RKUJ 3VP6A 4L76A 3MP7B 4KAMA 1BCCE 4K2MA 3M0DA 3AE8C 4PJ0H 2OGUA 1NU1E 2B89A 1NTZE 2WSEH 3DR4A 4O6ZA 3H1ID 1IUGA 3RQ1A 1BGYE 4L75A 2R5BA 2V1PA 3JC22 2QLRA 3CCJP 2VMSA 3CPWO 2M5AB 2OYHB 3Q5PA 3TDKA 2BKWA 3FKDA 3ZRRA 2VGUA 3HT4A 1S5LH 1L4AD 4UHMA 3WX9A 1P3WA 3E2ZB 5CBNA 5TISH 2FXPA 3TYYA 3CCLP 2YHKA 3JTXA 2IYPA 1S5LE 2GUSA 1S08A 1OVUA 5AW2B 2LR2A 2CTZA 3UAKA 2EZ2A 5AW8B 4DJGA 1S9KE 1ORDA 2WZ7A 5GTIE 5AW5B 2R5CB 1BE3J 3LY1A 3L73J 3I4JA 2CPSA 1SQPK 3RBLA 3CXHD 5GTHH 4ZSYA 1AMQA 1SQPG 3M06A 2JG2A 5KKZC 5F8VA 1GU4A 1KV4A 1VQNP 1NWQA 3BCAA 3PGYA 4CBSA 3H1HG 3H32B 3MAUA 3K40A 2YMYA 1HJ0A 1H8AA 1LT1A 1IX7A 1MUUA 1PGQA 3L36A 5KJ7A 2AEUA 2EYQA 1BJOA 1ASFA 3Q8NA 1YBKA 2Z4EA 1T3UA 5K5GB 4Y0DA 2O1KA 1FS0E 3E1RA 1SQQK 2IDBA 1RQVA 2KYVA 4K35A 1SQVE 1V2EA 3BASA 4ASVA 4OT8A 3H25A 2CINA 1ZN5A 1RF1A 2XBNA 3CL3D 4Y0HA 3D6ZA 3OW2O 1SZSA 2FYUD 1URQA 2W6BA 5KLIB 3Q5SA 4ASWA 3WY7A 1QL1A 2FBWC 5B66E 2WKAA 2K9JB 2YOBA 1L0NK 3LW5H 1PPJE 1S1CX 1AY5A 1CL1A 2FNUA 1WMKA 1VQ5P 1LWUA 1S09A 5CJ4A 4WP0A 2Z20A 1W3UA 2Q6QA 2E5TA 2AEMA 3FVSA 3BCCE 3FQAA 1YYCA 1RVYA 4WYCA 3HBXA 1NTKG 4AO9A 2VRSA 3CX5E 3E7KA 1J2JB 4H0LB 4M3LA 3HD7B 3RL0C 2O01H 3SWFA 1D7MA 5KLIC 1OHVA 1NO4A 4Y28J 4ITXA 2OYIA 2ZVOB 3ASAA 4I7ZC 4OH8B 2AEFA 4PV1B 2H7HA 1BQAA 1N73B 1S72P 4XAUA 3EI9A 2YO2A 1AHGA 2BWPA 1JO5A 1LWUB 1O4SA 3C8VA 1VEFA 3KGWA 1AA0A 1M1JC 3VOPA 5CHXA 3CCQP 3TCMA 4ADBA 1BE3G 3BC8A 4PJ0E 1EZVD 3H1KJ 2KI7B 2V7QJ 3ZDMA 1W5CE 2W90A 3ELPA 4RAEA 1NKZB 3V6IA 2OYIB 3RCHA 4JYCA 4PV1C 4W7ZA 3H7FA 4DZOA 1AMSA 2Z9UA 3JZLA 2JJHA 5DX5A 1M6SA 4F5GA 5JAYA 5L8RJ 4H13B 1TOIA 2NZ2A 1BSNA 3L70D 4UB8H 1LTIC 1NU1K 3AE9C 5KLVK 3TFUA 3H1KE 3HRNA 2W7FA 2W8JA 1FC4A 1NTMG 1VF5C 2WT7B 1H89A 3L44A 2M5AA 3B71A 1LT9A 2FY8A 2J59M 2M8RA 3BCCG 3BRTB 3MBBA 4M2MA 2KSJA 1ELUA 1GK4A 1YITP 1MDXA 2OYHA 5APXA 1ASCA 1T3JA 1E5FA 1RV3A 2FXMA 4WY4C 3B5NA 1V72A 1AAWA 1C7GA 3F9TA 3M0DC 4XFJA 4B9BA 1TOEA 2ORDA 4ATQA 3JW9A 3MUDA 1EZVE 1GDEA 2Q3IA 2WT7A 3FX0A 1L2PA 1QGNA 3FZ6A 2J58A 4Q76A 1AX4A 4M2KA 3ATHA 3HDOA 1SFCC 2VMYA 3E2YA 2CANA 3L72D 2YIUB 2WPSA 3LWSA 2W7KA 3F89A 1AKBA 4AZJA 4QGRA 1KB9H 2SPZA 3CWBG 4FFCA 4JQ0D 3FQ8A 1LW4A 4OVNF 2P58A 3L71G 1AJSA 4R4LA 2RN0A 5FT6A 3NX3A 4OGQC 3D71A 3IFMA 1L4AA 1ELQA 3VK2A 1L4AC 3CXHI 2ZYAA 4XE5B 1OW6A 2VMNA 3NU8A 1KN7A 1IVRA 1M32A 4GEBA 1X8YA 3D6KA 2BYLA 4C7RA 1X29A 3COGA 1LWUC 1ARTA 3DXVA 1CZQA 2XNDH 1IO4A 3I55P 3IAOA 3L75E 1MDZA 1BDDA 2M3EA 1AHEA 1WSTA 3IR9A 2QJPB 1CZEA 2AEJA 4PD4D 5AVQB 1LGHB 1VP4A 1B4XA 1LTJC 1MKMA 3AE6C 1TPLA 1M4NA 3W67A 3RL0D 2C0XA 2N1TB 1SQXD 1P84I 1CSBA 2W7HA 3WGBA 2NPSA 1D7SA 1IK9A 1JY2P 1ZOBA 2OYIC 4A6TA 2Z1YA 3DC1A 3PAAA 3A0HH 1WYUB 1M1JA 3G6EP 1SQVJ 4W8IA 2O3JA 2RH0A 1C4KA 1BCCJ 2A45H 2JR8A 2C81A 2W7DA 3L70J 1B8GA 1BJNA 5AVZB 4PD4I 2QE7H 1MDOA 3BWOA 4W80A 3GW6A 2QJPC 3KPEA 1OMIA 2D7ZA 2PB0A 2WSEJ 3E1IA 5DJ1A 5D95A 1U7MA 3MC6C 1J1DC 5AVVB 3CXHH 2ZYGA 2PP6A 3CBFA 4A6RA 4H51A 3MD0A 4ZDOA 5M4BA 1ZV8A 3EFFK 4IL6X 4RJTA 1YAAA 2FYZA 1RY3A 2ZYJA 4F5KA 1HGVA 2XDJA 1AV1A 5J8QA 4E1OA 1ASLA 2FQ6A 1YQ3C 3TGUD 4L73A 4YTPC 2VMZA 2FYUE 1EDIA 4OMAA 1T2KC 4EMYA 2C0WA 5B5EE 2IBZE 3CX5I 1JS6A 4ZWVA 1ECXA 1DGDA 4I1LA 4OGQD 3AEJC 5B5EH 4JF0A 3FD0A 5E4ZA 2VGVA 3WUTA 3NYUA 1NH4A 2M0BA 1H0TA 5M1BA 3CQ6A 1K05A 1PGJA 2HOXA 2YNYA 1HGZA 2YKOA 1N86A 1TARA 3WU2E 3EUCA 8AATA 3RK2B 3AEMA 4N6JA 3HUSC 5KAIH 1AMRA 1NOHA 1EZVI 3TNUB 2YCNA 4MSOA 2W7LA 1SQVK 2FKIA 1SQVD 1OW7A 4DGTA 1GEWA 4UHOA 1FZCC 3NNKA 1JCCA 3CAIA 1G1IA 1U7JA 1HH0A 3L70G 3FDDA 3E9KA 5AVYB 4F4EA 4I7ZB 1K9MQ 1HVVA 4KJMA 2G8YA 4RIZA 4LC1A 2Z9VA 3CCVP 2FM1A 3GETA 1JS3A 3TGUG 1FZFA 2QM7A 1LKCA 1NAYA 1B9IA 2OYOA 2ZUKA 5CCHC 1SQBJ 1J1EB 3L74D 2OARA 2HODB 2QJKB 3AOVA 3A3YB 4AQRD 2ZXEB 1RF1C 1UU1A 2OTKE 1G4XA 2BCCE 3VMXA 2CSTA 4ISYA 4EFFA 1MZ9A 4W91A 2QA3A 5I92A 3O8ZA 4WY4D 2IZ0A 3CC4P 3NTNA 1JY2N 4IYOA 3R4YA 4H44B 2KB7P 1LC7A 2WITA 2D2CB 4IXZA 4ATPA 4ZDPA 1FU1A 4A7PA 2JWAA 2IX7C 2ZT9D 4KHXA 1FBMA 1LTJA 1HTLC 2E76C 3PD6A 2OGAA 2P7JA 1KAFA 3RK3B 3CLQA 1PFFA 3V5BA 2HUUA 1N7LA 1LTBC 4UB6E 1EJIA 1ASMA 1R5LA 3QN6A 5HHYA 4D6TD 2AY6A 2V4HA 2W8TA 3AE2C 2XV5A 2KNCB 4WXGA 3AEDC 4NOGA 1GW4A 1NVOA 3NTJA 1D7RA 2E75D 1Q82Q 3BCCD 1W2EA 1IBJA 1PV3A 4IL6E 1AHXA 3TK1A 1HBWA 3PHLA 4IXSA 1JY2O 1RF0A 3H1KD 1WYTB 1KFMA 3JWAA 3B5NC 2B87B 4IL6H 4RITA 3TQXA 2XNXA 3VYIA 3RUYA 1CL2A 1S2EA 3VP9A 1BT4A 2P2UA 4BXLA 2KZJA 2O01J 1BSHA 2GA1A 4F5MA 4BHDA 3CXHE 2E43A 4WBAA 2FYFA 2FXOA 1W7LA 1EDKA 2AY9A 4R8DA 1DH3A 1M0PA 1AFOA 3AEGC 2VMVA 2PFXA 1LK9A 3P7KA 4WLJA 2AXTH 2ZY3A 2P67A 2BCCG 2TPLA 4ZAHA 4PD4H 2WSFH 2O1JA 5BU8B 3HUSB 3UIAA 2C44A 1IFPA 1CJ0A 3FWLA 3LVMA 1M8OB 4LLHA 1QL2A 1YIJP 3GHGB 3U59A 3IHJA 3RBXA 3PDBA 3AOWA 3EIBA 4ZSWA 1KZUB 5BJ4A 1D2FA 3WGCA 1SF2A 1LT9C 3HVYA 1J1DB 3AE7C 3UE8A 3W1JA 3OA7A 1N2DC 1OXZA 1GD2E 1IJDB 1I41A 3CCMP 1IFNA 2HPCB 4U2HA 1G7WA 3GLMA 3FXEA 4GOEA 2PRRA 2E7IA 1WKHA 1TATA 3L75J 3Q2YA 1QISA 2W7GA 5APQA 2ZJGA 1X22A 2JJEA 3FVXA 3CD6P 4N3YB 5AVRB 2DGKA 1OHWA 1FJKA 3PJ0A 1UIXA 1ASGA 3WMM0 3FZ7A 1SFFA 5GTHE 1YNUA 4DQ6A 2HYNA 1DGEA 2AY2A 1NHLA 4L74A 4IOIH 2FFDC 2PGDA 2PAJA 4JEZA 1FE6A 2O01N 3D70A 3LVJA 5G2PA 3EFGA 5AVUB 1U57A 3AATA 4P3MA 4C7NA 2ZY2A 2ZT9B 5G2QA 2Q7CA 1ARHA 4A00A 2OYHC 3RCHB 2YKXA 3E6GA 3AE3C 1DJ9A 2FN6A 3BWNA 3RBFA 4IFFA 1PP9D 1AKAA 1OFCX 1IFMA 1FDIA 4OWFA 1NGMB 4YXWH 2JP3A 1N7SB 1GBNA 2NPSB 2HPCA 3FTBA 3EI7A 5BJ3A 2JISA 2WSFJ 1G2CB 3L74J 3Q3DA 1GW3A 1KQLA 2VMRA 3T97A 1EXIA 1L0LG 5EUNA 1OW8A 3CWBE 2KS1A 3H1LE 2HG5D 4Z1MH 2YKYA 3U1AA 1CI6A 1ZW0A 4IYOB 1DJEA 3FWNA 4NPEA 4U3FE 3CX5D 5KLVG 2VIBA 3MZWB 4YXDC 2CH1A 3R9AA 2DGLA 2GSAA 2OTLP 3LIDA 4J5UA 3HE4B 4JEYA 1LP1B 1ASAA 2LKMA 1NTKD 1UKJA 5EIGB 4D6TE 2HODA 3QHXA 3NUBA 1KL2A 3SWKA 2JJFA 3L75G 3G7QA 1Q90D 1AHYA 3AENA 3KKIA 1KB9E 2DR1A 2D61A 1Z7DA 1HJBA 1VQ6P 2ZSMA 2P1JA 3O6QB 2YCTA 1H0TB 2E42A 4OYTA 1L0NJ 1NU1J 5EFSA 3ZZJA 4R5FA 2XH1A 4P7YA 1JOCA 3WUUA 4L0OA 1YJWP 1IAYA 1JY3N 5G09A 1JEKA 1SQBK 4AH3A 1N2TA 1GL2C 3MGNA 5AW7B 2BWOA 1IX8A 1GC4A 1HUCA 1O61A 2AATA 3NUIA 2FKWB 2CJDA 2DW3A 3VN0A 4MQQA 1KILC 4IFMA 2FNIA 2VMXA 1YTZI 2E74B 2VMTA 1H1CA 4RJYA 1J1EC 1LW5A 5DJUB 2BEZF 2QA4P 2BIAA 2KOGA 1RH5B 1PGOA 2QJKC 1GZLA 2WB6A 1BE3D 4RKDA 2QBTA 4LC3A 2W7MA 4WYAA 3K5BA 3EIAA 3VOMA 3H1LG 4A0RA 1KC8Q 3QGUA 1GL2B 1WRGA 3PJSK 4ZDLA 4LW4A 4RLGA 2IFMA 3H6PA 2WSCH 5APVA 2VMOA 4W1VA 3WU2H 1AVOA 3TFTA 1L4AB 2CH2A 2BI5A 3HE4A 1SS1A 1SQQG 2DOUA 2IBZG 1NTZK 1M0OA 1WYUA 1NTZG 1S06A 1ZP0C 4U3FJ 3B1CA 1AJRA 4N78D 3KE3A 3L70E 1FC2C 3PLNA 1SQXE 1M1KQ 1USDA 4I8AA 3BV0A 2D65A 2Y0DA 2K3RA 1QEXA 4GE7A 3O6QA 4W1WA 4YPCA 3M9BA 4H0LD 1AQTA 3OP7A 2GM4A 1LTAC 2Q1KA 4GDYA 2R5EA 4AO4A 1NTMJ 3A0BE 2AXTE 1E79H 4XA4A 2YCPA 3LV2A 3LVLB 1MFTA 2VI9A 2JKVA 4K2BA 1BS0A 2A45I 2XZRA 3N75A 5M49A 3QWOC 2WMMA 3AEEC 1S3JA 2AY4A 2VIAA 1LJ2A 2Y9YA 3MUDC 3KGXA 2AEVA 3MIWA 3GF7A 2P10A 1RVUA 3GZDA 1AHFA 4CXRA 5AVSB 2Y9ZA 3L73E 3V2RA 1BE3E 2Q3EA 3VP8A 2I1JA 1GL2A 3QI6A 1WYTA 3ELEA 3FVUA 4A0FA 1BDCA 3FGAD 2R44A 2KFPA 2YKQA 3CCEP 1FJPA 1BJOB 2YO3A 4AUWA 1BGYG 4CPGA 1NAFA 1VQLP 2IPPA 4HVKA 1XTGB 2NMPA 1S5LX 1GK6A 2O7CA 3VK4A 4HF8A 3DU4A 1R5SA 3FCRA 3HTKB 1FG3A 2HUFA 4FL0A 1BKGA 4H0LC 3H1LD 3RL0B 3QH9A 1DIPA 3A9YA 3DYDA 4XJMA 1Q7YQ 2Q5UA 2K9YA 3R2PA 3V4WA 3H1LJ 1JY3O 2CB1A 4JEXA 4XJPA 2G3AA 3QBOA 1GD9A 1NTMK 3BATA 3A5TA 1AAMA 4E3RA 4BRYB 2ZY5A 1ZXGA 5AW3B 2Q7WA 2VGSA 3RGUA 3ECDA 4ZM4A 4U1TA 5HDMA 1KQFB 1GCKA 2HP2A 1NJIQ 1PFIA 2QSRA 4EYYQ 2AY3A 4ZLVA 2HOZA 1DKAA 1L0NE 1CZCA 1PPJG 1KD1Q 2CJGA 4RESB 3PPLA 2K1AA 5KLVJ 1ZODA 1ARGA 1UIIA 3BVHA 1KILA 1AQ5A 4CVQA 3JCUH 1CQ7A 1GC2A 3M5UA 4Y0IA 2K37A 4E77A 5G4JA 1EZVG 2BASA 1NTKJ 1KQGB 1URQC 4PD4E 3L74G 3LG0A 4R5ZA 1VQ9P 2E74D 3G3ZA 5DJ9A 5E3KA 2QEXP 3FFRA 1M7YA 2GQNA 2QJYC 1GMJA 3B46A 4XEWA 3OJAB 1BCCG 1K04A 2QM8A 4B98A 2CY8A 1VQ8P 2E76D 1E5EA 1RE3A 3B1EA 3CWBJ 4D6TG 4QMAA 3H1JD 4HJGH 4HB1A 1AIBA 2O1BA 4TN4A 5KAFE 1CQ6A 4WLHA 4ZKPA 5M46A 3CC2P 3AE4C 2C7TA 4EDFA 3NFQA 3BS8A 2WSSH 3KQGA 2D2CD 2IBZI 2G7JA 4UOYA 4N0WA 3H32A 2E76B 3FSLA 3VMAA 2X8UA 3EQ2A 3VMYA 3MKJA 1FDMA 2BCCJ 4W1XA 1OXOA 3B8EB 1SVVA 4BA4A 1PGPA 4EB5A 1M56D 1RE4C 2WPVB 2YXRB 1CW5A 3W68A 1TOGA 1R8EA 1JTHA 1FDOA 2AY1A 4H13C 3BCCJ 1SQQJ 3G71P 4ZKUA 1ASEA 4LNJA 1BQDA 2VI8A 3L72G 4WXBA 1RF1B 1L0LE 2BEQD 1AIAA 3MEBA 3USSA 1DTYA 1FZCA 1B9HA 1SP4A 1FAVA 4TMRA 1SPAA 1ZC9A 4F5IA 2VLFA 3H1JG 1EXJA 3LW5J 2B9BA 4WYDA 2A06G 1P84D 2E74C 2M3BA 2X3LA 1DEEG 2E54A 1QJ5A 5F9SA 1ASDA 2CK3H 4AOAA 3HD7A 1A02F 2CPBA 2FYUK 3CQ5A 1XEYA 1YIZA 3H1IJ 4ZWMA 2DKBA 1MAPA 1DJUA 1AMAA 2R0TA 3GHGA 1B5OA 1IX6A 2BI1A 2A06E 3NYTA 3P1TA 3ACZA 1AICA 2LXCB 3HE5B 3RK3E 3KZIE 3ITKA 4EB7A 3ISLA 1KYOD 1ASBA 4F5HA 5AW6B 4EIJA 2I8DA 1KKJA 1ZRTD 4KXKA 4KYOA 3S1KA 5E79H 3KZIH 3C9IA 1I48A 2W7EA 3ZRQA 3GZDC 2KP8A 1W7NA 2RMZA 5CCGA 2R5DA 2E7UA 2QB2A 2BIEA 1XTCC 2FYUG 1NU1D 3I5TA 4BQ0A 3CWBD 3BCXA 4I6MC 3JSVC 4JF1A 2QG4A 3BCBA 1AY4A 2E5YA 4U3FG 1GEXA 4W7YA 2V7QH 3TGUJ 3L71D 4ZM3A 1YJNP 1KILD 4IX8A 3GF3A 1G1JA 1PP9G 4WY4A 1LTSC 3GR9A 1Y9BA 3PA9A 1WYVB 2GMSA 3IF4A 1Y4IA 5KLVE 1YHQP 3I16A 3NRAA 3A8UX 3P6KA 1OWAA 4WD2A 4RKCA 3TGUE 1KILB 2PB2A 2A1VA 1VL2A 5APUA 1YJ9P 3HMUA 1X79B 2R32A 2Z9WA 1S4XA 4BWNA 3KHUA 3ZRPA 2YMKA 1PMOA 3L71E 1AVYA 4GT1A 5APTA 5CCHA 2A06D 3FQ7A 3FZ8A 3NYSA 5KAFH 4LGDE 3HL2A 1DD4A 1GDTA 1LTJB 4HKZH 2BI9A 1A02J 4TT3H 3H9XA 1HWTC 1SQVG 4I2LC 3P8MC 2X5DA 3MTUE 3T97B 4A0HA 1U08A 1QLED 3L4FA 1QITA 4DCKA 3VK3A 5FT4A 4IFDK 3SSUA 2NRGA 2WPQA 3CCRP 3A9XA 4H44D 1M7LA 3WCNA 1TOJA 4WB0A 1BJ4A 1KB9D 1PP9J 3SFEC 1MFZA 1X0MA 2BIGA 5DB5A 4ZASA 4ADDA 4MY5A 1ARIA 3RK3D 2HP1A 2ITAA 1SZUA 3E2FA 2WWWA 1C9CA 3M91A 1OXPA 2CJHA 3B4SA 3B1DA 1O69A 5TJHA 3USFA 1OHYA 3SWYA 1D7VA 2R3CA 4K2IA 4GE9A 1JCDA 3NMDA 2B88A 3P8CE 5EFWB 3RK2C 1JUNA 2VGZA 2WK7A 2WPRA 3DODA 2FYNB 1MGVA 3GZCA 4XK1A 1VF5B 4UHNA 2Q9IA 3G9RA 3JWBA 3V2PA 1TOKA 2QSIA 1OX3A 2DGMA 3S4RA 2C9NY 3PDBB 4MKKA 5AVWB 4JF7A 2W8ZA 4A0GA 4PFNA 1D7UA 3V2NA 3RBZA 2O0RA 1LTTC 5KJ7D 2W27A 1ASNA 5G0AA 3HLMA 2ZXXA 1TU3F 1VPCA 2KNCA 2WQYC 3N4RA 1SQXJ 3ABVC 2JO1A 2KUBA 2KLVA 3L73G 2ZYDA 3MAFB 4WYGA 1QVFO 1NTZJ 2QIWA 5KLVD 1B5PA 3MADA 1VDFA 3L35A 1LC8A 4Q31A 1OATA 1JG8A 3Q5RA 2OTJP 4LW2A 3IN6A 4OGQB 1SQBG 1FZBA 3H1IG 2VMUA 1KYOE 1XI9A 1T2KD 1ARSA 4R2NA 3RK2D 2C9LY 3W1IA 2EO5A 3CMAP 1X2AA 3TATA 1GU5A 2POHA 1S0AA 4PIWA 1EQBA 2ZJSE 3NXSA 2E7JA 4J8LA 4MKJA 1JY3P 3CCSP 3AELA 2J5UA 3R4TA 1YIYA 2HZPA 1JF9A 3KXDA 3P32A 4PVFA 3PP5A 1X28A 1YJYA 3RI6A 4DOJA 2ZC0A 5FT5A 4RO0A 3V4QA 3WKSA 4GRXA 3L75D 1SFCD 2VYCA 5G4IA 2K9JA 1YQ4C 2HUIA 3F0HA 1MLYA 3L72J 2BI2A 2XKMA 5EAVA 3H1HD 3PRJA 1KORA 3L71J 3A0HE 3B5ND 3L73D 2HR3A 3VAXA 1Y8AA 3F6TA 1C7OA 1T8ZA 3CMEP 3H1JJ 3N7NA 1VQ7P 2IZ1A 1AKCA 1JMBA 3FRKA 3PTZA 5EQCA 1NTZD 4ZMDA 2VMWA 1VJOA 5APSA 1J04A 1L0NG 2H43A 2XU6A 2IFNA 3DR7A 1FZEA 2HOYA 4A72A 1H88A 1BGYD 4BRYA 3GJUA 1QIRA 4WVZA 1T6AA 4E3QA 1RF0C 3I5CA 2AY5A 3WLXA 4CBRA 4EI2A 3CCUP 2JEEA 2N1TA 1SQBE 1W23A 3JCUE 3PIUA 2HORA 1RHZB 1KFNA 1X9VA 3A0BH 1NKNA 2AY7A 1KMJA 1NTMD 3C1LA 3AE1C 3N4XA 2OQXA 1HF9A 3QM2A 1G4VA 1N8RQ 1KQSO 1WKGA 3ZZKA 4JEWA 2D66A 2W7IA 1M57D 1PL5A 1GTWA 3B8XA 1N8PA 2R3SA 4WB0B 1EQ7A 3LVKA 3U1CA 1O62A 1I29A 1J32A 3GHGC 2ZSLA 3PD6B 3K28A 2KK7A 2D63A 1RQUA 3A2AA 1P84E 3HD7D 3HD7C 2D7YA 1H0CA 3GSBA 1GC0A 2N9BA 1SQPJ 3WKRA 1M0NA 3OKSA 1LC5A 5KAIE 5KJ7C 4OTLA 1SQXK 1ZMEC 4K3AA 4DT0A 5KTBA 5CMZA 1VQKP 2ZAEB 3L72E 2QRXA 2WTYA 3NU7A 4GKGA 1USEA 2QB3A 1KILE 4M2JA 1L0LD 1T3IA 2E75B 1EG5A 2BI3A 1IJIA 3A2BA 3L37A 5CBOA 5AW1B 2QJYB 7AATA 2Z5IA 1JB0J 1QGKB 2JDIH 3II6A 4GDOA 2GMUA 1AJYA 1ZLLA 2OKJA 4DBCA 3GWPA 4EU1A 5APWA 3H1HJ 3WCOA 4MQPA 2GUVA 3M9HA 5E79E 4EOTA 1JNMA 3M0AA 3N5MA 1SFCB 1OVVA 4JEVA 1ZRTE 4LNLA 1EDJA 1BW0A 1V2FA 3AENB 1KB9I 1SZKA 1MLZA 1KYOI 2Y0CA 2ZT9C 5TISE 3DRDA 1TASA 3MC6A 1SQQE 5AVTB 3F5HA 3EZ1A 3VMZA 4AYCA 4ZNCA 3FFHA 3RL0g 1PP9E 2LXBA 2N1TC 1BGYJ 2QMAA 1IFDA 3EWKA 4XJOA 3RK3C 2PO3A 1KTMA 4HH2A 1PIXA 5GTIH 4WXFA 3AE5C 4GOFA 4H13D 4IY7A 3BRVB 2NPSC 4WYFA 5CCGC 2VGTA 1E5WA 1OIPA 1MV8A 2N9YB 3PDXA 1SQBD 4JBZA 1LS3A 1L0LJ 1QVGO 1IFJA 4UB6H 2WSCJ 1SQXG 2JJLA 1GL2D 2G6WA 1LTGC 2EH6A 4GODA 3AEMC 2HFED 3QPGA 4OC9A 1K73Q 1N73A 2OATA 5FT8A 2ZFCA 2VMPA 5CJ0A 3GMAA 1DD3A 5APYA 3BWNC 2F8JA 3AEPA 2UWJE 2BCCD 3G4SP 1PMMA 2C0RA 9AATA 1KMIZ 4GSAA 4PFFA 4MQRA 2WK8A 2W6AA 1VQ4P 4AZKA 3NDNA 3G8MA 2JWDA 3FDBA 1YOOA 1QJ3A 4RJ0A 3HTKA 1BJWA 4F5FA 2YRIA 1CI6B 5BU5A 4O9BA 3Q1MA 4U7JA 3N4SA 2YKVA 3E77A 1KYOH 1URQB 3GG2A 5DJTB 1YI2P 2FFDA 1PG8A 3WZFA 3CI9A 4IW7A 1UU0A 4WY4B 2ZP7A 3DXWA 5AVXB 5TF5A 1L0ND 1YJSA 5EUDA 2JJGA 2D64A 3OAKA 1PPJD 1C7NA 1KMKA 1N7SA 1SVFA 1Q2NA 4U3FD 5AW9B 2WVRA 3EI5A 4UB8E 1WT6A 2KSEA 4OCAA 1Q86Q 4BMKA 2H8PD 2H89C 3PH0A 2X5FA 5E5IA 1N31A 2Z5HA 4WYEA 2ZVNB 1LT9B 1P84H 4NPFX 2EZ1A 1PZQA 3E2ZA 4OBVA 3HUSA 1NTKE 2BYJA 2KS1B 4OBUA 2NPSD 2YKUA 1IC2A 5H2FE 1RE3C 5KKZB 1Z56A 2KXPB 2KIKA 1JM0A 1VF5D 2H88C 2EPJA 4UQVA 1YTZT 3D6YA 1OVRA 3M9QA 4JPZB 4HYTB 1FZAA 1BCCD 2RFVA 3AEOA 5EIGA 1QX8A 2N1TD 4WWIA 4D6TJ 3T32A 4F5LA 4N78E 2K88A 2VLHA 3AEAC 2D5YA 1GC3A 2MJZA 1G2CA 1DEBA 5C6UA 1NTME 4H44C 3AEJA 4R4MA 1M0QA 2L91A 4GIFA 3KYQA 1K8AQ 1RE4A 2VMQA 4BA5A 2BHXA 4C46A 2Z9XA 4IXOA 3TF5A 2QVAA 3G0TA 1AY8A 1M90Q 3EI8A 1W2BO 5AW4B 1JMMA 1I43A 3A9ZA 1S07A 2CFBA 3LIEA 3I56P 1FZGA 3SFDC 3DZZA 3AEFC 1KKPA 3L8AA 1GEYA 2R5CA 3N0LA 4RM1A 4LNMA 1SFCA 2Y0EA 1C0NA 2Z61A 3AECC 1KL1A 1X0TA 5K8BA 1NTKK 1MAQA 4WBTA 1W7MA 4GE4A 1EC5A 4Q6RA 2D2CC 3B5NB 1ZOYC 5AW0B 4K05A 5EUEA 2W8UA 1G7XA 1Y47A 2WK9A 3H1IE 3S9OA 3CX5H 2B87A 1FZCB 3CC7P 1CQ8A 3EZSA 1L0LK 1N73C 4KT0J 2KLUA 4XQ2A 3P8CD 2GB3A 1QZ9A 2I1KA 3K7YA 4ITGA 1DX7A 1FOSE 2EGYA 1YJZA 2OKKA 2HLOA 2W6JH 3KDPB 3V2QA 4JYBA 2YXQB 1FOSF 4ADCA 5CCGD 1M1JB 3MAFA 1IFIA 2BWNA 2W83C 2FYNC 3CQ4A 3GBXA 3BB8A 2V0YA 2KZIA 4F5JA 3UWCA 3H1JE 3MHVA 3ASBA 2IYOA 1IK7A 3HQTA 1V2DA 4TLFA 1NU1G 1URQD 1EDLA 2YKPA 2L5GB 1S9KD 3TSIA 1FG7A 1AJSB 2VGWA 5M4DA 1RV4A 3FXDA 2E75C 1IZNB 1CS1A 1UU2A 2R2NA 1ZR2A 3EI6A 5EAAA 3TNUA 1N7SD 1N7SC 1OZHA 4XJLA 5BVZA
chains in the Genus database with same CATH topology
1SLQA 1JTHB 4CXQA 4W5KA 4ADEA 4Y99B 1Z3ZA 2DKJA 3II0A 2YRRA 1IAXA 4Q75A 2FFDB 2ZY4A 5AX8A 5IWQA 2OGEA 5D5SA 3A7OA 4H63Q 3W1HA 1WYVA 4WB4A 4C7NB 3AV7A 2W8WA 2Z1ZA 4A6UA 4Y99C 5HXXA 2JGTA 1ZR4A 2W7JA 3BN1A 4B86A 2A45G 5CCHD 2W8VA 3VTPC 1DFOA 3HE5A 2AY8A 3VP6A 4KAMA 4K2MA 3M0DA 2WSEH 3DR4A 4O6ZA 1IUGA 3RQ1A 2R5BA 2V1PA 2QLRA 2VMSA 2OYHB 2BKWA 3FKDA 3ZRRA 2VGUA 3HT4A 1L4AD 4UHMA 3WX9A 1P3WA 3E2ZB 3TYYA 2YHKA 3JTXA 2GUSA 1S08A 5AW2B 2CTZA 3UAKA 2EZ2A 5AW8B 1S9KE 1ORDA 2WZ7A 5AW5B 2R5CB 3LY1A 3I4JA 2CPSA 1SQPK 3RBLA 4ZSYA 1AMQA 3M06A 2JG2A 5F8VA 1GU4A 1NWQA 3BCAA 3PGYA 4CBSA 3H32B 3MAUA 3K40A 2YMYA 1H8AA 1IX7A 1MUUA 3L36A 5KJ7A 2AEUA 2EYQA 1BJOA 1ASFA 3Q8NA 2Z4EA 1T3UA 4Y0DA 2O1KA 1SQQK 2KYVA 1V2EA 3BASA 4OT8A 2CINA 1ZN5A 1RF1A 2XBNA 3CL3D 4Y0HA 1SZSA 1URQA 2W6BA 3WY7A 1QL1A 2WKAA 2YOBA 1L0NK 3LW5H 1AY5A 1CL1A 2FNUA 1LWUA 1S09A 5CJ4A 4WP0A 2Z20A 1W3UA 3FVSA 3FQAA 1YYCA 1RVYA 4WYCA 3HBXA 4AO9A 2VRSA 1J2JB 3RL0C 4M3LA 3HD7B 2O01H 3SWFA 1OHVA 1NO4A 4ITXA 2OYIA 3ASAA 4OH8B 2H7HA 1BQAA 1N73B 4XAUA 3EI9A 2YO2A 1AHGA 2BWPA 1JO5A 1LWUB 1O4SA 1VEFA 3KGWA 1M1JC 3VOPA 5CHXA 3TCMA 4ADBA 3BC8A 3ELPA 4RAEA 1NKZB 2OYIB 3RCHA 4JYCA 4W7ZA 3H7FA 4DZOA 1AMSA 2Z9UA 3JZLA 2JJHA 5DX5A 1M6SA 4F5GA 5JAYA 1TOIA 1LTIC 1NU1K 5KLVK 3TFUA 3HRNA 2W7FA 2W8JA 1FC4A 2WT7B 1H89A 3L44A 1LT9A 2J59M 2M8RA 3BRTB 3MBBA 4M2MA 2KSJA 1ELUA 1GK4A 1MDXA 2OYHA 5APXA 1ASCA 1T3JA 1E5FA 1RV3A 2FXMA 4WY4C 3B5NA 1V72A 1AAWA 1C7GA 3F9TA 3M0DC 4B9BA 1TOEA 2ORDA 4ATQA 3JW9A 3MUDA 1GDEA 2Q3IA 2WT7A 1QGNA 3FZ6A 2J58A 4Q76A 1AX4A 4M2KA 3ATHA 3HDOA 1SFCC 2VMYA 3E2YA 2CANA 2WPSA 3LWSA 2W7KA 1AKBA 4AZJA 4QGRA 4FFCA 3FQ8A 1LW4A 1AJSA 5FT6A 3NX3A 3IFMA 1L4AA 1ELQA 3VK2A 1L4AC 4XE5B 2VMNA 3NU8A 1IVRA 1M32A 4GEBA 1X8YA 3D6KA 2BYLA 4C7RA 1X29A 3COGA 1LWUC 1ARTA 3DXVA 1CZQA 1IO4A 1MDZA 1AHEA 1WSTA 3IR9A 1CZEA 5AVQB 1LGHB 1VP4A 1B4XA 1LTJC 1TPLA 1M4NA 3RL0D 2C0XA 2N1TB 1CSBA 2W7HA 3WGBA 2NPSA 1D7SA 1IK9A 1JY2P 1ZOBA 2OYIC 4A6TA 2Z1YA 3DC1A 3PAAA 1WYUB 1M1JA 4W8IA 1C4KA 2A45H 2C81A 2W7DA 5AVZB 1B8GA 1BJNA 1MDOA 3BWOA 4W80A 3KPEA 2D7ZA 2PB0A 3E1IA 5DJ1A 5D95A 3MC6C 1J1DC 5AVVB 2PP6A 3CBFA 4A6RA 4H51A 3MD0A 4ZDOA 5M4BA 1ZV8A 1YAAA 4F5KA 2FYZA 1RY3A 2ZYJA 1HGVA 2XDJA 5J8QA 4E1OA 1ASLA 2FQ6A 2VMZA 4OMAA 1T2KC 4EMYA 2C0WA 1JS6A 4ZWVA 1ECXA 1DGDA 4I1LA 3AEJC 4JF0A 3FD0A 5E4ZA 2VGVA 3NYUA 1NH4A 3CQ6A 2HOXA 2YNYA 1HGZA 2YKOA 1N86A 1TARA 3EUCA 8AATA 3RK2B 3AEMA 4N6JA 3HUSC 1AMRA 1NOHA 3TNUB 2YCNA 4MSOA 2W7LA 1SQVK 2FKIA 4DGTA 1GEWA 4UHOA 1FZCC 3NNKA 1JCCA 3CAIA 1G1IA 1HH0A 3FDDA 3E9KA 5AVYB 4F4EA 1HVVA 4RIZA 4LC1A 2Z9VA 2FM1A 3GETA 1JS3A 1FZFA 2QM7A 1LKCA 1B9IA 2ZUKA 5CCHC 1J1EB 2OARA 2HODB 3AOVA 3A3YB 4AQRD 2ZXEB 1RF1C 1UU1A 1G4XA 3VMXA 2CSTA 4ISYA 4EFFA 1MZ9A 4W91A 2QA3A 5I92A 3O8ZA 4WY4D 3NTNA 1JY2N 4IYOA 2KB7P 1LC7A 2WITA 4IXZA 4ATPA 4ZDPA 1FU1A 2IX7C 4KHXA 1FBMA 1LTJA 1HTLC 3PD6A 2OGAA 2P7JA 3RK3B 3CLQA 1PFFA 3V5BA 2HUUA 1N7LA 1LTBC 1EJIA 1ASMA 3QN6A 5HHYA 2AY6A 2W8TA 2XV5A 4WXGA 4NOGA 1GW4A 3NTJA 1D7RA 1W2EA 1IBJA 1AHXA 3TK1A 1HBWA 4IXSA 1JY2O 1RF0A 1WYTB 1KFMA 3JWAA 3B5NC 4RITA 3TQXA 2XNXA 3VYIA 3RUYA 1CL2A 3VP9A 1BT4A 2P2UA 4F5MA 4BHDA 2E43A 4WBAA 2FYFA 1W7LA 2AY9A 4R8DA 1DH3A 1M0PA 1AFOA 2VMVA 1LK9A 3P7KA 4WLJA 2ZY3A 2P67A 2TPLA 4ZAHA 2WSFH 2O1JA 5BU8B 3HUSB 3UIAA 2C44A 1CJ0A 3LVMA 4LLHA 1QL2A 3GHGB 3U59A 3IHJA 3PDBA 3AOWA 3EIBA 4ZSWA 1KZUB 5BJ4A 1D2FA 3WGCA 1SF2A 1LT9C 3HVYA 1J1DB 3UE8A 3W1JA 3OA7A 1N2DC 1OXZA 1GD2E 1IJDB 1I41A 1IFNA 2HPCB 4U2HA 1G7WA 2E7IA 1WKHA 1TATA 1QISA 2W7GA 5APQA 2ZJGA 2JJEA 3FVXA 4N3YB 5AVRB 2DGKA 1OHWA 1FJKA 3PJ0A 1ASGA 3WMM0 3FZ7A 1SFFA 1YNUA 4DQ6A 2HYNA 1DGEA 2AY2A 1NHLA 2FFDC 2PAJA 4JEZA 3LVJA 5G2PA 3EFGA 5AVUB 3AATA 4P3MA 4C7NA 2ZY2A 5G2QA 2Q7CA 1ARHA 4A00A 2OYHC 3RCHB 2YKXA 3E6GA 1DJ9A 2FN6A 3BWNA 3RBFA 4IFFA 1AKAA 1IFMA 1N7SB 1GBNA 2NPSB 2HPCA 3FTBA 3EI7A 5BJ3A 2JISA 1G2CB 1GW3A 1KQLA 2VMRA 3T97A 5EUNA 2HG5D 2YKYA 3U1AA 1CI6A 4IYOB 1DJEA 2VIBA 2CH1A 3R9AA 2DGLA 2GSAA 3LIDA 4J5UA 3HE4B 4JEYA 1ASAA 2LKMA 1UKJA 5EIGB 2HODA 3QHXA 3NUBA 1KL2A 2JJFA 3G7QA 1AHYA 3AENA 3KKIA 2DR1A 2D61A 1Z7DA 1HJBA 2ZSMA 2P1JA 2YCTA 2E42A 4OYTA 5EFSA 3ZZJA 4R5FA 2XH1A 4P7YA 1JOCA 4L0OA 1IAYA 1JY3N 5G09A 1SQBK 4AH3A 1N2TA 1GL2C 3MGNA 5AW7B 2BWOA 1IX8A 1GC4A 1HUCA 1O61A 2AATA 3NUIA 2FKWB 2CJDA 3VN0A 4MQQA 1KILC 4IFMA 2FNIA 2VMXA 1YTZI 2VMTA 1H1CA 4RJYA 1J1EC 1LW5A 2BIAA 2KOGA 1GZLA 2WB6A 4RKDA 2QBTA 4LC3A 2W7MA 4WYAA 3EIAA 3VOMA 4A0RA 3QGUA 1GL2B 1WRGA 4ZDLA 4LW4A 4RLGA 2IFMA 3H6PA 2WSCH 5APVA 2VMOA 4W1VA 3TFTA 1L4AB 2CH2A 2BI5A 3HE4A 2DOUA 1NTZK 1M0OA 1WYUA 1S06A 3B1CA 1AJRA 4N78D 3KE3A 4I8AA 3BV0A 2D65A 4GE7A 4W1WA 3M9BA 3OP7A 2GM4A 1LTAC 4GDYA 2R5EA 4AO4A 4XA4A 2YCPA 3LV2A 3LVLB 2VI9A 4K2BA 1BS0A 2A45I 2XZRA 3N75A 5M49A 2AY4A 2VIAA 3KGXA 2AEVA 3MIWA 1RVUA 3GZDA 1AHFA 4CXRA 5AVSB 3V2RA 3VP8A 2I1JA 1GL2A 3QI6A 1WYTA 3ELEA 3FVUA 4A0FA 2KFPA 2YKQA 1FJPA 1BJOB 2YO3A 4AUWA 1NAFA 2IPPA 4HVKA 1XTGB 2NMPA 1GK6A 2O7CA 3VK4A 4HF8A 3DU4A 3FCRA 3HTKB 1FG3A 2HUFA 4FL0A 1BKGA 3RL0B 3A9YA 3DYDA 4XJMA 2Q5UA 3V4WA 3R2PA 2CB1A 1JY3O 4JEXA 4XJPA 3QBOA 1GD9A 1NTMK 3BATA 3A5TA 1AAMA 4E3RA 2ZY5A 5AW3B 2Q7WA 2VGSA 4ZM4A 3ECDA 4U1TA 5HDMA 1GCKA 2HP2A 1PFIA 2QSRA 2AY3A 4ZLVA 2HOZA 1DKAA 1CZCA 2CJGA 4RESB 3PPLA 1ZODA 1ARGA 3BVHA 1KILA 1AQ5A 4CVQA 1CQ7A 1GC2A 3M5UA 4Y0IA 4E77A 5G4JA 2BASA 1URQC 3LG0A 4R5ZA 3G3ZA 5DJ9A 5E3KA 3FFRA 1M7YA 2GQNA 3B46A 4XEWA 3OJAB 2QM8A 4B98A 2CY8A 1E5EA 1RE3A 3B1EA 1AIBA 2O1BA 4TN4A 1CQ6A 4WLHA 4ZKPA 5M46A 2C7TA 3NFQA 3BS8A 3KQGA 2G7JA 4UOYA 4N0WA 3H32A 3FSLA 2X8UA 3EQ2A 3VMYA 3MKJA 1FDMA 4W1XA 1OXOA 3B8EB 1SVVA 4BA4A 4EB5A 1RE4C 1CW5A 1TOGA 1JTHA 2AY1A 4ZKUA 1ASEA 4LNJA 1BQDA 2VI8A 4WXBA 1RF1B 1AIAA 3MEBA 1DTYA 1FZCA 1B9HA 1SP4A 1FAVA 4TMRA 1SPAA 1ZC9A 4F5IA 2VLFA 4WYDA 2M3BA 2X3LA 2E54A 1QJ5A 5F9SA 1ASDA 4AOAA 3HD7A 1A02F 2CPBA 2FYUK 3CQ5A 1XEYA 1YIZA 4ZWMA 2DKBA 1MAPA 1DJUA 1AMAA 2R0TA 3GHGA 1B5OA 1IX6A 2BI1A 3NYTA 3P1TA 3ACZA 1AICA 3HE5B 4EB7A 3ISLA 1ASBA 4F5HA 5AW6B 4EIJA 1KKJA 4KXKA 4KYOA 1I48A 3C9IA 2W7EA 3ZRQA 3GZDC 2KP8A 1W7NA 5CCGA 2R5DA 2E7UA 2QB2A 2BIEA 1XTCC 3I5TA 4BQ0A 3BCXA 4I6MC 4JF1A 3BCBA 1AY4A 1GEXA 4W7YA 4ZM3A 1KILD 4IX8A 1G1JA 4WY4A 1LTSC 3GR9A 3PA9A 1WYVB 2GMSA 1Y4IA 3I16A 3NRAA 3A8UX 3P6KA 1OWAA 4WD2A 4RKCA 1KILB 2PB2A 2A1VA 5APUA 3HMUA 1X79B 2R32A 2Z9WA 3ZRPA 1PMOA 4GT1A 5APTA 5CCHA 3FQ7A 3FZ8A 3NYSA 4LGDE 3HL2A 1GDTA 1LTJB 2BI9A 1A02J 3H9XA 1HWTC 4I2LC 3P8MC 2X5DA 3MTUE 4A0HA 1U08A 3L4FA 1QITA 3VK3A 5FT4A 4IFDK 2WPQA 3A9XA 1M7LA 3WCNA 1TOJA 4WB0A 1BJ4A 1X0MA 5DB5A 1MFZA 2BIGA 4ZASA 4ADDA 4MY5A 1ARIA 3RK3D 2HP1A 1SZUA 3E2FA 2WWWA 1C9CA 3M91A 1OXPA 2CJHA 3B1DA 1O69A 3USFA 1OHYA 3SWYA 1D7VA 2R3CA 4K2IA 4GE9A 1JCDA 3NMDA 3P8CE 3RK2C 1JUNA 2VGZA 2WK7A 2WPRA 3DODA 1MGVA 3GZCA 4XK1A 4UHNA 2Q9IA 3JWBA 3V2PA 1TOKA 2DGMA 3PDBB 2C9NY 4MKKA 5AVWB 4JF7A 4A0GA 4PFNA 1D7UA 3V2NA 2O0RA 1LTTC 5KJ7D 2W27A 1ASNA 5G0AA 3HLMA 1VPCA 3N4RA 2KLVA 3MAFB 4WYGA 1B5PA 3MADA 1VDFA 3L35A 1LC8A 4Q31A 1OATA 1JG8A 4LW2A 1FZBA 2VMUA 1XI9A 1T2KD 1ARSA 4R2NA 3RK2D 2C9LY 3W1IA 2EO5A 1X2AA 3TATA 1GU5A 1S0AA 2POHA 4PIWA 1EQBA 3NXSA 2E7JA 4J8LA 4MKJA 1JY3P 3AELA 3R4TA 1YIYA 2HZPA 1JF9A 3P32A 4PVFA 3PP5A 1X28A 1YJYA 3RI6A 4DOJA 2ZC0A 5FT5A 3V4QA 3WKSA 4GRXA 1SFCD 2VYCA 5G4IA 3F0HA 2HUIA 1MLYA 2BI2A 2XKMA 5EAVA 3B5ND 3VAXA 3F6TA 1C7OA 1T8ZA 3N7NA 1AKCA 3FRKA 5EQCA 2VMWA 1VJOA 5APSA 1J04A 2H43A 2XU6A 2IFNA 3DR7A 1FZEA 2HOYA 4A72A 1H88A 3GJUA 1QIRA 4E3QA 1RF0C 3I5CA 2AY5A 3WLXA 4CBRA 2JEEA 2N1TA 1W23A 3PIUA 2HORA 1KFNA 1X9VA 1NKNA 2AY7A 1KMJA 3N4XA 2OQXA 3QM2A 1G4VA 1WKGA 3ZZKA 4JEWA 2D66A 2W7IA 1GTWA 3B8XA 1N8PA 4WB0B 1EQ7A 3LVKA 3U1CA 1O62A 1I29A 1J32A 3GHGC 2ZSLA 3PD6B 3K28A 2D63A 3A2AA 3HD7C 3HD7D 2D7YA 1H0CA 3GSBA 1GC0A 2N9BA 3WKRA 1M0NA 3OKSA 1LC5A 5KJ7C 4OTLA 1SQXK 5KTBA 5CMZA 2WTYA 3NU7A 4GKGA 2QB3A 4M2JA 1T3IA 1EG5A 2BI3A 1IJIA 3A2BA 3L37A 5AW1B 7AATA 2Z5IA 3II6A 2GMUA 1ZLLA 2OKJA 4DBCA 3GWPA 4EU1A 5APWA 3WCOA 4MQPA 2GUVA 3M9HA 4EOTA 1JNMA 3M0AA 3N5MA 1SFCB 4JEVA 4LNLA 1BW0A 1V2FA 3AENB 1SZKA 1MLZA 3DRDA 1TASA 3MC6A 5AVTB 3EZ1A 3VMZA 4AYCA 3FFHA 2N1TC 2QMAA 1IFDA 4XJOA 3RK3C 2PO3A 4HH2A 4WXFA 4IY7A 3BRVB 2NPSC 4WYFA 5CCGC 2VGTA 1E5WA 1MV8A 3PDXA 1LS3A 1IFJA 2JJLA 1GL2D 2G6WA 1LTGC 2EH6A 3AEMC 2HFED 3QPGA 4OC9A 1N73A 2OATA 5FT8A 2ZFCA 2VMPA 5CJ0A 5APYA 3BWNC 2F8JA 3AEPA 1PMMA 2C0RA 9AATA 4PFFA 4GSAA 4MQRA 2WK8A 2W6AA 4AZKA 3NDNA 3G8MA 3FDBA 1YOOA 1QJ3A 4RJ0A 3HTKA 1BJWA 4F5FA 2YRIA 1CI6B 5BU5A 4O9BA 3N4SA 2YKVA 3E77A 1URQB 1PG8A 3WZFA 2FFDA 3CI9A 4IW7A 1UU0A 4WY4B 2ZP7A 3DXWA 5AVXB 5TF5A 1YJSA 5EUDA 2JJGA 2D64A 3OAKA 1C7NA 1KMKA 1N7SA 1SVFA 5AW9B 3EI5A 1WT6A 4OCAA 4BMKA 2H8PD 2X5FA 5E5IA 1N31A 2Z5HA 4WYEA 1LT9B 2EZ1A 3E2ZA 4OBVA 3HUSA 2BYJA 4OBUA 2NPSD 2YKUA 1IC2A 1RE3C 1Z56A 2EPJA 4UQVA 1YTZT 3M9QA 4HYTB 1FZAA 2RFVA 3AEOA 5EIGA 2N1TD 3T32A 4F5LA 4N78E 2VLHA 2D5YA 1GC3A 2MJZA 1G2CA 1DEBA 5C6UA 3AEJA 1M0QA 4GIFA 3KYQA 2VMQA 1RE4A 4BA5A 2BHXA 4C46A 2Z9XA 4IXOA 3G0TA 1AY8A 3EI8A 5AW4B 1JMMA 1I43A 3A9ZA 1S07A 2CFBA 3LIEA 1FZGA 3DZZA 1KKPA 3L8AA 1GEYA 2R5CA 3N0LA 4RM1A 4LNMA 1SFCA 1C0NA 2Z61A 1KL1A 5K8BA 4WBTA 1NTKK 1MAQA 1W7MA 4GE4A 4Q6RA 3B5NB 4K05A 5AW0B 5EUEA 2W8UA 1G7XA 2WK9A 1FZCB 1CQ8A 3EZSA 1L0LK 1N73C 4XQ2A 3P8CD 2GB3A 1QZ9A 2I1KA 3K7YA 4ITGA 1DX7A 1FOSE 2EGYA 1YJZA 2OKKA 2HLOA 3KDPB 3V2QA 4JYBA 1FOSF 4ADCA 5CCGD 1M1JB 3MAFA 1IFIA 2BWNA 3CQ4A 3GBXA 3BB8A 2V0YA 4F5JA 3UWCA 3ASBA 3HQTA 1V2DA 1URQD 2YKPA 2L5GB 3TSIA 1S9KD 1FG7A 1AJSB 2VGWA 5M4DA 1RV4A 1CS1A 1UU2A 2R2NA 1ZR2A 3EI6A 5EAAA 3TNUA 1N7SD 1N7SC 4XJLA 5BVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BAT A;  3HRN A;  3N4X A;  3BAS A;  5BU5 A;  4GIF A;  4O9B A;  3N4S A;  5BU8 B;  3P8C D;  1WT6 A;  4ZKU A;  4I1L A;  3VP9 A;  3C9I A;  3N7N A;  2JEE A;  4N3Y B;  3U59 A;  5KTB A;  1X79 B;  4N78 D;  2FXM A;  3U1A A;  3VP8 A;  3U1C A;  3N4R A;  5BVZ A;  1IC2 A;  4ZKP A;  1NKN A;  3OJA B;  2POH A; 
#chains in the Genus database with same CATH topology
 1SLQ A;  1JTH B;  1VQO P;  1Q81 Q;  4MN4 C;  5B66 H;  4CXQ A;  1LNQ A;  1VQP P;  4W5K A;  4NPD A;  4ADE A;  4Y99 B;  1Z3Z A;  2DKJ A;  2RKL A;  2YRR A;  3II0 A;  1IAX A;  4Q75 A;  4PV1 D;  1SQP D;  2FFD B;  2ZY4 A;  5AX8 A;  5IWQ A;  2OGE A;  2MKV A;  5D5S A;  3AEB C;  3H1K G;  2FYU J;  3A7O A;  4H63 Q;  3W1H A;  5C39 A;  5H2F H;  1WYV A;  4WB4 A;  1LP1 A;  2OQQ A;  4C7N B;  3AV7 A;  1NYH A;  1SQQ D;  3L74 E;  2W8W A;  3WUV A;  1VQM P;  4Y99 C;  1SQP E;  2IBZ D;  2Z1Z A;  4A6U A;  5HXX A;  2JGT A;  1ZR4 A;  2W7J A;  3H1H E;  3BN1 A;  4B86 A;  2A45 G;  2AXC A;  2YIU C;  5CCH D;  2W8V A;  3VTP C;  1DFO A;  3HE5 A;  2AY8 A;  4RKU J;  3VP6 A;  4L76 A;  3MP7 B;  4KAM A;  1BCC E;  4K2M A;  3M0D A;  3AE8 C;  4PJ0 H;  2OGU A;  1NU1 E;  2B89 A;  1NTZ E;  2WSE H;  3DR4 A;  4O6Z A;  3H1I D;  1IUG A;  3RQ1 A;  1BGY E;  4L75 A;  2R5B A;  2V1P A;  3JC2 2;  2QLR A;  3CCJ P;  2VMS A;  3CPW O;  2M5A B;  2OYH B;  3Q5P A;  3TDK A;  2BKW A;  3FKD A;  3ZRR A;  2VGU A;  3HT4 A;  1S5L H;  1L4A D;  4UHM A;  3WX9 A;  1P3W A;  3E2Z B;  5CBN A;  5TIS H;  2FXP A;  3TYY A;  3CCL P;  2YHK A;  3JTX A;  2IYP A;  1S5L E;  2GUS A;  1S08 A;  1OVU A;  5AW2 B;  2LR2 A;  2CTZ A;  3UAK A;  2EZ2 A;  5AW8 B;  4DJG A;  1S9K E;  1ORD A;  2WZ7 A;  5GTI E;  5AW5 B;  2R5C B;  1BE3 J;  3LY1 A;  3L73 J;  3I4J A;  2CPS A;  1SQP K;  3RBL A;  3CXH D;  5GTH H;  4ZSY A;  1AMQ A;  1SQP G;  3M06 A;  2JG2 A;  5KKZ C;  5F8V A;  1GU4 A;  1KV4 A;  1VQN P;  1NWQ A;  3BCA A;  3PGY A;  4CBS A;  3H1H G;  3H32 B;  3MAU A;  3K40 A;  2YMY A;  1HJ0 A;  1H8A A;  1LT1 A;  1IX7 A;  1MUU A;  1PGQ A;  3L36 A;  5KJ7 A;  2AEU A;  2EYQ A;  1BJO A;  1ASF A;  3Q8N A;  1YBK A;  2Z4E A;  1T3U A;  5K5G B;  4Y0D A;  2O1K A;  1FS0 E;  3E1R A;  1SQQ K;  2IDB A;  1RQV A;  2KYV A;  4K35 A;  1SQV E;  1V2E A;  3BAS A;  4ASV A;  4OT8 A;  3H25 A;  2CIN A;  1ZN5 A;  1RF1 A;  2XBN A;  3CL3 D;  4Y0H A;  3D6Z A;  3OW2 O;  1SZS A;  2FYU D;  1URQ A;  2W6B A;  5KLI B;  3Q5S A;  4ASW A;  3WY7 A;  1QL1 A;  2FBW C;  5B66 E;  2WKA A;  2K9J B;  2YOB A;  1L0N K;  3LW5 H;  1PPJ E;  1S1C X;  1AY5 A;  1CL1 A;  2FNU A;  1WMK A;  1VQ5 P;  1LWU A;  1S09 A;  5CJ4 A;  4WP0 A;  2Z20 A;  1W3U A;  2Q6Q A;  2E5T A;  2AEM A;  3FVS A;  3BCC E;  3FQA A;  1YYC A;  1RVY A;  4WYC A;  3HBX A;  1NTK G;  4AO9 A;  2VRS A;  3CX5 E;  3E7K A;  1J2J B;  4H0L B;  4M3L A;  3HD7 B;  3RL0 C;  2O01 H;  3SWF A;  1D7M A;  5KLI C;  1OHV A;  1NO4 A;  4Y28 J;  4ITX A;  2OYI A;  2ZVO B;  3ASA A;  4I7Z C;  4OH8 B;  2AEF A;  4PV1 B;  2H7H A;  1BQA A;  1N73 B;  1S72 P;  4XAU A;  3EI9 A;  2YO2 A;  1AHG A;  2BWP A;  1JO5 A;  1LWU B;  1O4S A;  3C8V A;  1VEF A;  3KGW A;  1AA0 A;  1M1J C;  3VOP A;  5CHX A;  3CCQ P;  3TCM A;  4ADB A;  1BE3 G;  3BC8 A;  4PJ0 E;  1EZV D;  3H1K J;  2KI7 B;  2V7Q J;  3ZDM A;  1W5C E;  2W90 A;  3ELP A;  4RAE A;  1NKZ B;  3V6I A;  2OYI B;  3RCH A;  4JYC A;  4PV1 C;  4W7Z A;  3H7F A;  4DZO A;  1AMS A;  2Z9U A;  3JZL A;  2JJH A;  5DX5 A;  1M6S A;  4F5G A;  5JAY A;  5L8R J;  4H13 B;  1TOI A;  2NZ2 A;  1BSN A;  3L70 D;  4UB8 H;  1LTI C;  1NU1 K;  3AE9 C;  5KLV K;  3TFU A;  3H1K E;  3HRN A;  2W7F A;  2W8J A;  1FC4 A;  1NTM G;  1VF5 C;  2WT7 B;  1H89 A;  3L44 A;  2M5A A;  3B71 A;  1LT9 A;  2FY8 A;  2J59 M;  2M8R A;  3BCC G;  3BRT B;  3MBB A;  4M2M A;  2KSJ A;  1ELU A;  1GK4 A;  1YIT P;  1MDX A;  2OYH A;  5APX A;  1ASC A;  1T3J A;  1E5F A;  1RV3 A;  2FXM A;  4WY4 C;  3B5N A;  1V72 A;  1AAW A;  1C7G A;  3F9T A;  3M0D C;  4XFJ A;  4B9B A;  1TOE A;  2ORD A;  4ATQ A;  3JW9 A;  3MUD A;  1EZV E;  1GDE A;  2Q3I A;  2WT7 A;  3FX0 A;  1L2P A;  1QGN A;  3FZ6 A;  2J58 A;  4Q76 A;  1AX4 A;  4M2K A;  3ATH A;  3HDO A;  1SFC C;  2VMY A;  3E2Y A;  2CAN A;  3L72 D;  2YIU B;  2WPS A;  3LWS A;  2W7K A;  3F89 A;  1AKB A;  4AZJ A;  4QGR A;  1KB9 H;  2SPZ A;  3CWB G;  4FFC A;  4JQ0 D;  3FQ8 A;  1LW4 A;  4OVN F;  2P58 A;  3L71 G;  1AJS A;  4R4L A;  2RN0 A;  5FT6 A;  3NX3 A;  4OGQ C;  3D71 A;  3IFM A;  1L4A A;  1ELQ A;  3VK2 A;  1L4A C;  3CXH I;  2ZYA A;  4XE5 B;  1OW6 A;  2VMN A;  3NU8 A;  1KN7 A;  1IVR A;  1M32 A;  4GEB A;  1X8Y A;  3D6K A;  2BYL A;  4C7R A;  1X29 A;  3COG A;  1LWU C;  1ART A;  3DXV A;  1CZQ A;  2XND H;  1IO4 A;  3I55 P;  3IAO A;  3L75 E;  1MDZ A;  1BDD A;  2M3E A;  1AHE A;  1WST A;  3IR9 A;  2QJP B;  1CZE A;  2AEJ A;  4PD4 D;  5AVQ B;  1LGH B;  1VP4 A;  1B4X A;  1LTJ C;  1MKM A;  3AE6 C;  1TPL A;  1M4N A;  3W67 A;  3RL0 D;  2C0X A;  2N1T B;  1SQX D;  1P84 I;  1CSB A;  2W7H A;  3WGB A;  2NPS A;  1D7S A;  1IK9 A;  1JY2 P;  1ZOB A;  2OYI C;  4A6T A;  2Z1Y A;  3DC1 A;  3PAA A;  3A0H H;  1WYU B;  1M1J A;  3G6E P;  1SQV J;  4W8I A;  2O3J A;  2RH0 A;  1C4K A;  1BCC J;  2A45 H;  2JR8 A;  2C81 A;  2W7D A;  3L70 J;  1B8G A;  1BJN A;  5AVZ B;  4PD4 I;  2QE7 H;  1MDO A;  3BWO A;  4W80 A;  3GW6 A;  2QJP C;  3KPE A;  1OMI A;  2D7Z A;  2PB0 A;  2WSE J;  3E1I A;  5DJ1 A;  5D95 A;  1U7M A;  3MC6 C;  1J1D C;  5AVV B;  3CXH H;  2ZYG A;  2PP6 A;  3CBF A;  4A6R A;  4H51 A;  3MD0 A;  4ZDO A;  5M4B A;  1ZV8 A;  3EFF K;  4IL6 X;  4RJT A;  1YAA A;  2FYZ A;  1RY3 A;  2ZYJ A;  4F5K A;  1HGV A;  2XDJ A;  1AV1 A;  5J8Q A;  4E1O A;  1ASL A;  2FQ6 A;  1YQ3 C;  3TGU D;  4L73 A;  4YTP C;  2VMZ A;  2FYU E;  1EDI A;  4OMA A;  1T2K C;  4EMY A;  2C0W A;  5B5E E;  2IBZ E;  3CX5 I;  1JS6 A;  4ZWV A;  1ECX A;  1DGD A;  4I1L A;  4OGQ D;  3AEJ C;  5B5E H;  4JF0 A;  3FD0 A;  5E4Z A;  2VGV A;  3WUT A;  3NYU A;  1NH4 A;  2M0B A;  1H0T A;  5M1B A;  3CQ6 A;  1K05 A;  1PGJ A;  2HOX A;  2YNY A;  1HGZ A;  2YKO A;  1N86 A;  1TAR A;  3WU2 E;  3EUC A;  8AAT A;  3RK2 B;  3AEM A;  4N6J A;  3HUS C;  5KAI H;  1AMR A;  1NOH A;  1EZV I;  3TNU B;  2YCN A;  4MSO A;  2W7L A;  1SQV K;  2FKI A;  1SQV D;  1OW7 A;  4DGT A;  1GEW A;  4UHO A;  1FZC C;  3NNK A;  1JCC A;  3CAI A;  1G1I A;  1U7J A;  1HH0 A;  3L70 G;  3FDD A;  3E9K A;  5AVY B;  4F4E A;  4I7Z B;  1K9M Q;  1HVV A;  4KJM A;  2G8Y A;  4RIZ A;  4LC1 A;  2Z9V A;  3CCV P;  2FM1 A;  3GET A;  1JS3 A;  3TGU G;  1FZF A;  2QM7 A;  1LKC A;  1NAY A;  1B9I A;  2OYO A;  2ZUK A;  5CCH C;  1SQB J;  1J1E B;  3L74 D;  2OAR A;  2HOD B;  2QJK B;  3AOV A;  3A3Y B;  4AQR D;  2ZXE B;  1RF1 C;  1UU1 A;  2OTK E;  1G4X A;  2BCC E;  3VMX A;  2CST A;  4ISY A;  4EFF A;  1MZ9 A;  4W91 A;  2QA3 A;  5I92 A;  3O8Z A;  4WY4 D;  2IZ0 A;  3CC4 P;  3NTN A;  1JY2 N;  4IYO A;  3R4Y A;  4H44 B;  2KB7 P;  1LC7 A;  2WIT A;  2D2C B;  4IXZ A;  4ATP A;  4ZDP A;  1FU1 A;  4A7P A;  2JWA A;  2IX7 C;  2ZT9 D;  4KHX A;  1FBM A;  1LTJ A;  1HTL C;  2E76 C;  3PD6 A;  2OGA A;  2P7J A;  1KAF A;  3RK3 B;  3CLQ A;  1PFF A;  3V5B A;  2HUU A;  1N7L A;  1LTB C;  4UB6 E;  1EJI A;  1ASM A;  1R5L A;  3QN6 A;  5HHY A;  4D6T D;  2AY6 A;  2V4H A;  2W8T A;  3AE2 C;  2XV5 A;  2KNC B;  4WXG A;  3AED C;  4NOG A;  1GW4 A;  1NVO A;  3NTJ A;  1D7R A;  2E75 D;  1Q82 Q;  3BCC D;  1W2E A;  1IBJ A;  1PV3 A;  4IL6 E;  1AHX A;  3TK1 A;  1HBW A;  3PHL A;  4IXS A;  1JY2 O;  1RF0 A;  3H1K D;  1WYT B;  1KFM A;  3JWA A;  3B5N C;  2B87 B;  4IL6 H;  4RIT A;  3TQX A;  2XNX A;  3VYI A;  3RUY A;  1CL2 A;  1S2E A;  3VP9 A;  1BT4 A;  2P2U A;  4BXL A;  2KZJ A;  2O01 J;  1BSH A;  2GA1 A;  4F5M A;  4BHD A;  3CXH E;  2E43 A;  4WBA A;  2FYF A;  2FXO A;  1W7L A;  1EDK A;  2AY9 A;  4R8D A;  1DH3 A;  1M0P A;  1AFO A;  3AEG C;  2VMV A;  2PFX A;  1LK9 A;  3P7K A;  4WLJ A;  2AXT H;  2ZY3 A;  2P67 A;  2BCC G;  2TPL A;  4ZAH A;  4PD4 H;  2WSF H;  2O1J A;  5BU8 B;  3HUS B;  3UIA A;  2C44 A;  1IFP A;  1CJ0 A;  3FWL A;  3LVM A;  1M8O B;  4LLH A;  1QL2 A;  1YIJ P;  3GHG B;  3U59 A;  3IHJ A;  3RBX A;  3PDB A;  3AOW A;  3EIB A;  4ZSW A;  1KZU B;  5BJ4 A;  1D2F A;  3WGC A;  1SF2 A;  1LT9 C;  3HVY A;  1J1D B;  3AE7 C;  3UE8 A;  3W1J A;  3OA7 A;  1N2D C;  1OXZ A;  1GD2 E;  1IJD B;  1I41 A;  3CCM P;  1IFN A;  2HPC B;  4U2H A;  1G7W A;  3GLM A;  3FXE A;  4GOE A;  2PRR A;  2E7I A;  1WKH A;  1TAT A;  3L75 J;  3Q2Y A;  1QIS A;  2W7G A;  5APQ A;  2ZJG A;  1X22 A;  2JJE A;  3FVX A;  3CD6 P;  4N3Y B;  5AVR B;  2DGK A;  1OHW A;  1FJK A;  3PJ0 A;  1UIX A;  1ASG A;  3WMM 0;  3FZ7 A;  1SFF A;  5GTH E;  1YNU A;  4DQ6 A;  2HYN A;  1DGE A;  2AY2 A;  1NHL A;  4L74 A;  4IOI H;  2FFD C;  2PGD A;  2PAJ A;  4JEZ A;  1FE6 A;  2O01 N;  3D70 A;  3LVJ A;  5G2P A;  3EFG A;  5AVU B;  1U57 A;  3AAT A;  4P3M A;  4C7N A;  2ZY2 A;  2ZT9 B;  5G2Q A;  2Q7C A;  1ARH A;  4A00 A;  2OYH C;  3RCH B;  2YKX A;  3E6G A;  3AE3 C;  1DJ9 A;  2FN6 A;  3BWN A;  3RBF A;  4IFF A;  1PP9 D;  1AKA A;  1OFC X;  1IFM A;  1FDI A;  4OWF A;  1NGM B;  4YXW H;  2JP3 A;  1N7S B;  1GBN A;  2NPS B;  2HPC A;  3FTB A;  3EI7 A;  5BJ3 A;  2JIS A;  2WSF J;  1G2C B;  3L74 J;  3Q3D A;  1GW3 A;  1KQL A;  2VMR A;  3T97 A;  1EXI A;  1L0L G;  5EUN A;  1OW8 A;  3CWB E;  2KS1 A;  3H1L E;  2HG5 D;  4Z1M H;  2YKY A;  3U1A A;  1CI6 A;  1ZW0 A;  4IYO B;  1DJE A;  3FWN A;  4NPE A;  4U3F E;  3CX5 D;  5KLV G;  2VIB A;  3MZW B;  4YXD C;  2CH1 A;  3R9A A;  2DGL A;  2GSA A;  2OTL P;  3LID A;  4J5U A;  3HE4 B;  4JEY A;  1LP1 B;  1ASA A;  2LKM A;  1NTK D;  1UKJ A;  5EIG B;  4D6T E;  2HOD A;  3QHX A;  3NUB A;  1KL2 A;  3SWK A;  2JJF A;  3L75 G;  3G7Q A;  1Q90 D;  1AHY A;  3AEN A;  3KKI A;  1KB9 E;  2DR1 A;  2D61 A;  1Z7D A;  1HJB A;  1VQ6 P;  2ZSM A;  2P1J A;  3O6Q B;  2YCT A;  1H0T B;  2E42 A;  4OYT A;  1L0N J;  1NU1 J;  5EFS A;  3ZZJ A;  4R5F A;  2XH1 A;  4P7Y A;  1JOC A;  3WUU A;  4L0O A;  1YJW P;  1IAY A;  1JY3 N;  5G09 A;  1JEK A;  1SQB K;  4AH3 A;  1N2T A;  1GL2 C;  3MGN A;  5AW7 B;  2BWO A;  1IX8 A;  1GC4 A;  1HUC A;  1O61 A;  2AAT A;  3NUI A;  2FKW B;  2CJD A;  2DW3 A;  3VN0 A;  4MQQ A;  1KIL C;  4IFM A;  2FNI A;  2VMX A;  1YTZ I;  2E74 B;  2VMT A;  1H1C A;  4RJY A;  1J1E C;  1LW5 A;  5DJU B;  2BEZ F;  2QA4 P;  2BIA A;  2KOG A;  1RH5 B;  1PGO A;  2QJK C;  1GZL A;  2WB6 A;  1BE3 D;  4RKD A;  2QBT A;  4LC3 A;  2W7M A;  4WYA A;  3K5B A;  3EIA A;  3VOM A;  3H1L G;  4A0R A;  1KC8 Q;  3QGU A;  1GL2 B;  1WRG A;  3PJS K;  4ZDL A;  4LW4 A;  4RLG A;  2IFM A;  3H6P A;  2WSC H;  5APV A;  2VMO A;  4W1V A;  3WU2 H;  1AVO A;  3TFT A;  1L4A B;  2CH2 A;  2BI5 A;  3HE4 A;  1SS1 A;  1SQQ G;  2DOU A;  2IBZ G;  1NTZ K;  1M0O A;  1WYU A;  1NTZ G;  1S06 A;  1ZP0 C;  4U3F J;  3B1C A;  1AJR A;  4N78 D;  3KE3 A;  3L70 E;  1FC2 C;  3PLN A;  1SQX E;  1M1K Q;  1USD A;  4I8A A;  3BV0 A;  2D65 A;  2Y0D A;  2K3R A;  1QEX A;  4GE7 A;  3O6Q A;  4W1W A;  4YPC A;  3M9B A;  4H0L D;  1AQT A;  3OP7 A;  2GM4 A;  1LTA C;  2Q1K A;  4GDY A;  2R5E A;  4AO4 A;  1NTM J;  3A0B E;  2AXT E;  1E79 H;  4XA4 A;  2YCP A;  3LV2 A;  3LVL B;  1MFT A;  2VI9 A;  2JKV A;  4K2B A;  1BS0 A;  2A45 I;  2XZR A;  3N75 A;  5M49 A;  3QWO C;  2WMM A;  3AEE C;  1S3J A;  2AY4 A;  2VIA A;  1LJ2 A;  2Y9Y A;  3MUD C;  3KGX A;  2AEV A;  3MIW A;  3GF7 A;  2P10 A;  1RVU A;  3GZD A;  1AHF A;  4CXR A;  5AVS B;  2Y9Z A;  3L73 E;  3V2R A;  1BE3 E;  2Q3E A;  3VP8 A;  2I1J A;  1GL2 A;  3QI6 A;  1WYT A;  3ELE A;  3FVU A;  4A0F A;  1BDC A;  3FGA D;  2R44 A;  2KFP A;  2YKQ A;  3CCE P;  1FJP A;  1BJO B;  2YO3 A;  4AUW A;  1BGY G;  4CPG A;  1NAF A;  1VQL P;  2IPP A;  4HVK A;  1XTG B;  2NMP A;  1S5L X;  1GK6 A;  2O7C A;  3VK4 A;  4HF8 A;  3DU4 A;  1R5S A;  3FCR A;  3HTK B;  1FG3 A;  2HUF A;  4FL0 A;  1BKG A;  4H0L C;  3H1L D;  3RL0 B;  3QH9 A;  1DIP A;  3A9Y A;  3DYD A;  4XJM A;  1Q7Y Q;  2Q5U A;  2K9Y A;  3R2P A;  3V4W A;  3H1L J;  1JY3 O;  2CB1 A;  4JEX A;  4XJP A;  2G3A A;  3QBO A;  1GD9 A;  1NTM K;  3BAT A;  3A5T A;  1AAM A;  4E3R A;  4BRY B;  2ZY5 A;  1ZXG A;  5AW3 B;  2Q7W A;  2VGS A;  3RGU A;  3ECD A;  4ZM4 A;  4U1T A;  5HDM A;  1KQF B;  1GCK A;  2HP2 A;  1NJI Q;  1PFI A;  2QSR A;  4EYY Q;  2AY3 A;  4ZLV A;  2HOZ A;  1DKA A;  1L0N E;  1CZC A;  1PPJ G;  1KD1 Q;  2CJG A;  4RES B;  3PPL A;  2K1A A;  5KLV J;  1ZOD A;  1ARG A;  1UII A;  3BVH A;  1KIL A;  1AQ5 A;  4CVQ A;  3JCU H;  1CQ7 A;  1GC2 A;  3M5U A;  4Y0I A;  2K37 A;  4E77 A;  5G4J A;  1EZV G;  2BAS A;  1NTK J;  1KQG B;  1URQ C;  4PD4 E;  3L74 G;  3LG0 A;  4R5Z A;  1VQ9 P;  2E74 D;  3G3Z A;  5DJ9 A;  5E3K A;  2QEX P;  3FFR A;  1M7Y A;  2GQN A;  2QJY C;  1GMJ A;  3B46 A;  4XEW A;  3OJA B;  1BCC G;  1K04 A;  2QM8 A;  4B98 A;  2CY8 A;  1VQ8 P;  2E76 D;  1E5E A;  1RE3 A;  3B1E A;  3CWB J;  4D6T G;  4QMA A;  3H1J D;  4HJG H;  4HB1 A;  1AIB A;  2O1B A;  4TN4 A;  5KAF E;  1CQ6 A;  4WLH A;  4ZKP A;  5M46 A;  3CC2 P;  3AE4 C;  2C7T A;  4EDF A;  3NFQ A;  3BS8 A;  2WSS H;  3KQG A;  2D2C D;  2IBZ I;  2G7J A;  4UOY A;  4N0W A;  3H32 A;  2E76 B;  3FSL A;  3VMA A;  2X8U A;  3EQ2 A;  3VMY A;  3MKJ A;  1FDM A;  2BCC J;  4W1X A;  1OXO A;  3B8E B;  1SVV A;  4BA4 A;  1PGP A;  4EB5 A;  1M56 D;  1RE4 C;  2WPV B;  2YXR B;  1CW5 A;  3W68 A;  1TOG A;  1R8E A;  1JTH A;  1FDO A;  2AY1 A;  4H13 C;  3BCC J;  1SQQ J;  3G71 P;  4ZKU A;  1ASE A;  4LNJ A;  1BQD A;  2VI8 A;  3L72 G;  4WXB A;  1RF1 B;  1L0L E;  2BEQ D;  1AIA A;  3MEB A;  3USS A;  1DTY A;  1FZC A;  1B9H A;  1SP4 A;  1FAV A;  4TMR A;  1SPA A;  1ZC9 A;  4F5I A;  2VLF A;  3H1J G;  1EXJ A;  3LW5 J;  2B9B A;  4WYD A;  2A06 G;  1P84 D;  2E74 C;  2M3B A;  2X3L A;  1DEE G;  2E54 A;  1QJ5 A;  5F9S A;  1ASD A;  2CK3 H;  4AOA A;  3HD7 A;  1A02 F;  2CPB A;  2FYU K;  3CQ5 A;  1XEY A;  1YIZ A;  3H1I J;  4ZWM A;  2DKB A;  1MAP A;  1DJU A;  1AMA A;  2R0T A;  3GHG A;  1B5O A;  1IX6 A;  2BI1 A;  2A06 E;  3NYT A;  3P1T A;  3ACZ A;  1AIC A;  2LXC B;  3HE5 B;  3RK3 E;  3KZI E;  3ITK A;  4EB7 A;  3ISL A;  1KYO D;  1ASB A;  4F5H A;  5AW6 B;  4EIJ A;  2I8D A;  1KKJ A;  1ZRT D;  4KXK A;  4KYO A;  3S1K A;  5E79 H;  3KZI H;  3C9I A;  1I48 A;  2W7E A;  3ZRQ A;  3GZD C;  2KP8 A;  1W7N A;  2RMZ A;  5CCG A;  2R5D A;  2E7U A;  2QB2 A;  2BIE A;  1XTC C;  2FYU G;  1NU1 D;  3I5T A;  4BQ0 A;  3CWB D;  3BCX A;  4I6M C;  3JSV C;  4JF1 A;  2QG4 A;  3BCB A;  1AY4 A;  2E5Y A;  4U3F G;  1GEX A;  4W7Y A;  2V7Q H;  3TGU J;  3L71 D;  4ZM3 A;  1YJN P;  1KIL D;  4IX8 A;  3GF3 A;  1G1J A;  1PP9 G;  4WY4 A;  1LTS C;  3GR9 A;  1Y9B A;  3PA9 A;  1WYV B;  2GMS A;  3IF4 A;  1Y4I A;  5KLV E;  1YHQ P;  3I16 A;  3NRA A;  3A8U X;  3P6K A;  1OWA A;  4WD2 A;  4RKC A;  3TGU E;  1KIL B;  2PB2 A;  2A1V A;  1VL2 A;  5APU A;  1YJ9 P;  3HMU A;  1X79 B;  2R32 A;  2Z9W A;  1S4X A;  4BWN A;  3KHU A;  3ZRP A;  2YMK A;  1PMO A;  3L71 E;  1AVY A;  4GT1 A;  5APT A;  5CCH A;  2A06 D;  3FQ7 A;  3FZ8 A;  3NYS A;  5KAF H;  4LGD E;  3HL2 A;  1DD4 A;  1GDT A;  1LTJ B;  4HKZ H;  2BI9 A;  1A02 J;  4TT3 H;  3H9X A;  1HWT C;  1SQV G;  4I2L C;  3P8M C;  2X5D A;  3MTU E;  3T97 B;  4A0H A;  1U08 A;  1QLE D;  3L4F A;  1QIT A;  4DCK A;  3VK3 A;  5FT4 A;  4IFD K;  3SSU A;  2NRG A;  2WPQ A;  3CCR P;  3A9X A;  4H44 D;  1M7L A;  3WCN A;  1TOJ A;  4WB0 A;  1BJ4 A;  1KB9 D;  1PP9 J;  3SFE C;  1MFZ A;  1X0M A;  2BIG A;  5DB5 A;  4ZAS A;  4ADD A;  4MY5 A;  1ARI A;  3RK3 D;  2HP1 A;  2ITA A;  1SZU A;  3E2F A;  2WWW A;  1C9C A;  3M91 A;  1OXP A;  2CJH A;  3B4S A;  3B1D A;  1O69 A;  5TJH A;  3USF A;  1OHY A;  3SWY A;  1D7V A;  2R3C A;  4K2I A;  4GE9 A;  1JCD A;  3NMD A;  2B88 A;  3P8C E;  5EFW B;  3RK2 C;  1JUN A;  2VGZ A;  2WK7 A;  2WPR A;  3DOD A;  2FYN B;  1MGV A;  3GZC A;  4XK1 A;  1VF5 B;  4UHN A;  2Q9I A;  3G9R A;  3JWB A;  3V2P A;  1TOK A;  2QSI A;  1OX3 A;  2DGM A;  3S4R A;  2C9N Y;  3PDB B;  4MKK A;  5AVW B;  4JF7 A;  2W8Z A;  4A0G A;  4PFN A;  1D7U A;  3V2N A;  3RBZ A;  2O0R A;  1LTT C;  5KJ7 D;  2W27 A;  1ASN A;  5G0A A;  3HLM A;  2ZXX A;  1TU3 F;  1VPC A;  2KNC A;  2WQY C;  3N4R A;  1SQX J;  3ABV C;  2JO1 A;  2KUB A;  2KLV A;  3L73 G;  2ZYD A;  3MAF B;  4WYG A;  1QVF O;  1NTZ J;  2QIW A;  5KLV D;  1B5P A;  3MAD A;  1VDF A;  3L35 A;  1LC8 A;  4Q31 A;  1OAT A;  1JG8 A;  3Q5R A;  2OTJ P;  4LW2 A;  3IN6 A;  4OGQ B;  1SQB G;  1FZB A;  3H1I G;  2VMU A;  1KYO E;  1XI9 A;  1T2K D;  1ARS A;  4R2N A;  3RK2 D;  2C9L Y;  3W1I A;  2EO5 A;  3CMA P;  1X2A A;  3TAT A;  1GU5 A;  2POH A;  1S0A A;  4PIW A;  1EQB A;  2ZJS E;  3NXS A;  2E7J A;  4J8L A;  4MKJ A;  1JY3 P;  3CCS P;  3AEL A;  2J5U A;  3R4T A;  1YIY A;  2HZP A;  1JF9 A;  3KXD A;  3P32 A;  4PVF A;  3PP5 A;  1X28 A;  1YJY A;  3RI6 A;  4DOJ A;  2ZC0 A;  5FT5 A;  4RO0 A;  3V4Q A;  3WKS A;  4GRX A;  3L75 D;  1SFC D;  2VYC A;  5G4I A;  2K9J A;  1YQ4 C;  2HUI A;  3F0H A;  1MLY A;  3L72 J;  2BI2 A;  2XKM A;  5EAV A;  3H1H D;  3PRJ A;  1KOR A;  3L71 J;  3A0H E;  3B5N D;  3L73 D;  2HR3 A;  3VAX A;  1Y8A A;  3F6T A;  1C7O A;  1T8Z A;  3CME P;  3H1J J;  3N7N A;  1VQ7 P;  2IZ1 A;  1AKC A;  1JMB A;  3FRK A;  3PTZ A;  5EQC A;  1NTZ D;  4ZMD A;  2VMW A;  1VJO A;  5APS A;  1J04 A;  1L0N G;  2H43 A;  2XU6 A;  2IFN A;  3DR7 A;  1FZE A;  2HOY A;  4A72 A;  1H88 A;  1BGY D;  4BRY A;  3GJU A;  1QIR A;  4WVZ A;  1T6A A;  4E3Q A;  1RF0 C;  3I5C A;  2AY5 A;  3WLX A;  4CBR A;  4EI2 A;  3CCU P;  2JEE A;  2N1T A;  1SQB E;  1W23 A;  3JCU E;  3PIU A;  2HOR A;  1RHZ B;  1KFN A;  1X9V A;  3A0B H;  1NKN A;  2AY7 A;  1KMJ A;  1NTM D;  3C1L A;  3AE1 C;  3N4X A;  2OQX A;  1HF9 A;  3QM2 A;  1G4V A;  1N8R Q;  1KQS O;  1WKG A;  3ZZK A;  4JEW A;  2D66 A;  2W7I A;  1M57 D;  1PL5 A;  1GTW A;  3B8X A;  1N8P A;  2R3S A;  4WB0 B;  1EQ7 A;  3LVK A;  3U1C A;  1O62 A;  1I29 A;  1J32 A;  3GHG C;  2ZSL A;  3PD6 B;  3K28 A;  2KK7 A;  2D63 A;  1RQU A;  3A2A A;  1P84 E;  3HD7 D;  3HD7 C;  2D7Y A;  1H0C A;  3GSB A;  1GC0 A;  2N9B A;  1SQP J;  3WKR A;  1M0N A;  3OKS A;  1LC5 A;  5KAI E;  5KJ7 C;  4OTL A;  1SQX K;  1ZME C;  4K3A A;  4DT0 A;  5KTB A;  5CMZ A;  1VQK P;  2ZAE B;  3L72 E;  2QRX A;  2WTY A;  3NU7 A;  4GKG A;  1USE A;  2QB3 A;  1KIL E;  4M2J A;  1L0L D;  1T3I A;  2E75 B;  1EG5 A;  2BI3 A;  1IJI A;  3A2B A;  3L37 A;  5CBO A;  5AW1 B;  2QJY B;  7AAT A;  2Z5I A;  1JB0 J;  1QGK B;  2JDI H;  3II6 A;  4GDO A;  2GMU A;  1AJY A;  1ZLL A;  2OKJ A;  4DBC A;  3GWP A;  4EU1 A;  5APW A;  3H1H J;  3WCO A;  4MQP A;  2GUV A;  3M9H A;  5E79 E;  4EOT A;  1JNM A;  3M0A A;  3N5M A;  1SFC B;  1OVV A;  4JEV A;  1ZRT E;  4LNL A;  1EDJ A;  1BW0 A;  1V2F A;  3AEN B;  1KB9 I;  1SZK A;  1MLZ A;  1KYO I;  2Y0C A;  2ZT9 C;  5TIS E;  3DRD A;  1TAS A;  3MC6 A;  1SQQ E;  5AVT B;  3F5H A;  3EZ1 A;  3VMZ A;  4AYC A;  4ZNC A;  3FFH A;  3RL0 g;  1PP9 E;  2LXB A;  2N1T C;  1BGY J;  2QMA A;  1IFD A;  3EWK A;  4XJO A;  3RK3 C;  2PO3 A;  1KTM A;  4HH2 A;  1PIX A;  5GTI H;  4WXF A;  3AE5 C;  4GOF A;  4H13 D;  4IY7 A;  3BRV B;  2NPS C;  4WYF A;  5CCG C;  2VGT A;  1E5W A;  1OIP A;  1MV8 A;  2N9Y B;  3PDX A;  1SQB D;  4JBZ A;  1LS3 A;  1L0L J;  1QVG O;  1IFJ A;  4UB6 H;  2WSC J;  1SQX G;  2JJL A;  1GL2 D;  2G6W A;  1LTG C;  2EH6 A;  4GOD A;  3AEM C;  2HFE D;  3QPG A;  4OC9 A;  1K73 Q;  1N73 A;  2OAT A;  5FT8 A;  2ZFC A;  2VMP A;  5CJ0 A;  3GMA A;  1DD3 A;  5APY A;  3BWN C;  2F8J A;  3AEP A;  2UWJ E;  2BCC D;  3G4S P;  1PMM A;  2C0R A;  9AAT A;  1KMI Z;  4GSA A;  4PFF A;  4MQR A;  2WK8 A;  2W6A A;  1VQ4 P;  4AZK A;  3NDN A;  3G8M A;  2JWD A;  3FDB A;  1YOO A;  1QJ3 A;  4RJ0 A;  3HTK A;  1BJW A;  4F5F A;  2YRI A;  1CI6 B;  5BU5 A;  4O9B A;  3Q1M A;  4U7J A;  3N4S A;  2YKV A;  3E77 A;  1KYO H;  1URQ B;  3GG2 A;  5DJT B;  1YI2 P;  2FFD A;  1PG8 A;  3WZF A;  3CI9 A;  4IW7 A;  1UU0 A;  4WY4 B;  2ZP7 A;  3DXW A;  5AVX B;  5TF5 A;  1L0N D;  1YJS A;  5EUD A;  2JJG A;  2D64 A;  3OAK A;  1PPJ D;  1C7N A;  1KMK A;  1N7S A;  1SVF A;  1Q2N A;  4U3F D;  5AW9 B;  2WVR A;  3EI5 A;  4UB8 E;  1WT6 A;  2KSE A;  4OCA A;  1Q86 Q;  4BMK A;  2H8P D;  2H89 C;  3PH0 A;  2X5F A;  5E5I A;  1N31 A;  2Z5H A;  4WYE A;  2ZVN B;  1LT9 B;  1P84 H;  4NPF X;  2EZ1 A;  1PZQ A;  3E2Z A;  4OBV A;  3HUS A;  1NTK E;  2BYJ A;  2KS1 B;  4OBU A;  2NPS D;  2YKU A;  1IC2 A;  5H2F E;  1RE3 C;  5KKZ B;  1Z56 A;  2KXP B;  2KIK A;  1JM0 A;  1VF5 D;  2H88 C;  2EPJ A;  4UQV A;  1YTZ T;  3D6Y A;  1OVR A;  3M9Q A;  4JPZ B;  4HYT B;  1FZA A;  1BCC D;  2RFV A;  3AEO A;  5EIG A;  1QX8 A;  2N1T D;  4WWI A;  4D6T J;  3T32 A;  4F5L A;  4N78 E;  2K88 A;  2VLH A;  3AEA C;  2D5Y A;  1GC3 A;  2MJZ A;  1G2C A;  1DEB A;  5C6U A;  1NTM E;  4H44 C;  3AEJ A;  4R4M A;  1M0Q A;  2L91 A;  4GIF A;  3KYQ A;  1K8A Q;  1RE4 A;  2VMQ A;  4BA5 A;  2BHX A;  4C46 A;  2Z9X A;  4IXO A;  3TF5 A;  2QVA A;  3G0T A;  1AY8 A;  1M90 Q;  3EI8 A;  1W2B O;  5AW4 B;  1JMM A;  1I43 A;  3A9Z A;  1S07 A;  2CFB A;  3LIE A;  3I56 P;  1FZG A;  3SFD C;  3DZZ A;  3AEF C;  1KKP A;  3L8A A;  1GEY A;  2R5C A;  3N0L A;  4RM1 A;  4LNM A;  1SFC A;  2Y0E A;  1C0N A;  2Z61 A;  3AEC C;  1KL1 A;  1X0T A;  5K8B A;  1NTK K;  1MAQ A;  4WBT A;  1W7M A;  4GE4 A;  1EC5 A;  4Q6R A;  2D2C C;  3B5N B;  1ZOY C;  5AW0 B;  4K05 A;  5EUE A;  2W8U A;  1G7X A;  1Y47 A;  2WK9 A;  3H1I E;  3S9O A;  3CX5 H;  2B87 A;  1FZC B;  3CC7 P;  1CQ8 A;  3EZS A;  1L0L K;  1N73 C;  4KT0 J;  2KLU A;  4XQ2 A;  3P8C D;  2GB3 A;  1QZ9 A;  2I1K A;  3K7Y A;  4ITG A;  1DX7 A;  1FOS E;  2EGY A;  1YJZ A;  2OKK A;  2HLO A;  2W6J H;  3KDP B;  3V2Q A;  4JYB A;  2YXQ B;  1FOS F;  4ADC A;  5CCG D;  1M1J B;  3MAF A;  1IFI A;  2BWN A;  2W83 C;  2FYN C;  3CQ4 A;  3GBX A;  3BB8 A;  2V0Y A;  2KZI A;  4F5J A;  3UWC A;  3H1J E;  3MHV A;  3ASB A;  2IYO A;  1IK7 A;  3HQT A;  1V2D A;  4TLF A;  1NU1 G;  1URQ D;  1EDL A;  2YKP A;  2L5G B;  1S9K D;  3TSI A;  1FG7 A;  1AJS B;  2VGW A;  5M4D A;  1RV4 A;  3FXD A;  2E75 C;  1IZN B;  1CS1 A;  1UU2 A;  2R2N A;  1ZR2 A;  3EI6 A;  5EAA A;  3TNU A;  1N7S D;  1N7S C;  1OZH A;  4XJL A;  5BVZ A; 
#chains in the Genus database with same CATH homology
 1SLQ A;  1JTH B;  4CXQ A;  4W5K A;  4ADE A;  4Y99 B;  1Z3Z A;  2DKJ A;  3II0 A;  2YRR A;  1IAX A;  4Q75 A;  2FFD B;  2ZY4 A;  5AX8 A;  5IWQ A;  2OGE A;  5D5S A;  3A7O A;  4H63 Q;  3W1H A;  1WYV A;  4WB4 A;  4C7N B;  3AV7 A;  2W8W A;  2Z1Z A;  4A6U A;  4Y99 C;  5HXX A;  2JGT A;  1ZR4 A;  2W7J A;  3BN1 A;  4B86 A;  2A45 G;  5CCH D;  2W8V A;  3VTP C;  1DFO A;  3HE5 A;  2AY8 A;  3VP6 A;  4KAM A;  4K2M A;  3M0D A;  2WSE H;  3DR4 A;  4O6Z A;  1IUG A;  3RQ1 A;  2R5B A;  2V1P A;  2QLR A;  2VMS A;  2OYH B;  2BKW A;  3FKD A;  3ZRR A;  2VGU A;  3HT4 A;  1L4A D;  4UHM A;  3WX9 A;  1P3W A;  3E2Z B;  3TYY A;  2YHK A;  3JTX A;  2GUS A;  1S08 A;  5AW2 B;  2CTZ A;  3UAK A;  2EZ2 A;  5AW8 B;  1S9K E;  1ORD A;  2WZ7 A;  5AW5 B;  2R5C B;  3LY1 A;  3I4J A;  2CPS A;  1SQP K;  3RBL A;  4ZSY A;  1AMQ A;  3M06 A;  2JG2 A;  5F8V A;  1GU4 A;  1NWQ A;  3BCA A;  3PGY A;  4CBS A;  3H32 B;  3MAU A;  3K40 A;  2YMY A;  1H8A A;  1IX7 A;  1MUU A;  3L36 A;  5KJ7 A;  2AEU A;  2EYQ A;  1BJO A;  1ASF A;  3Q8N A;  2Z4E A;  1T3U A;  4Y0D A;  2O1K A;  1SQQ K;  2KYV A;  1V2E A;  3BAS A;  4OT8 A;  2CIN A;  1ZN5 A;  1RF1 A;  2XBN A;  3CL3 D;  4Y0H A;  1SZS A;  1URQ A;  2W6B A;  3WY7 A;  1QL1 A;  2WKA A;  2YOB A;  1L0N K;  3LW5 H;  1AY5 A;  1CL1 A;  2FNU A;  1LWU A;  1S09 A;  5CJ4 A;  4WP0 A;  2Z20 A;  1W3U A;  3FVS A;  3FQA A;  1YYC A;  1RVY A;  4WYC A;  3HBX A;  4AO9 A;  2VRS A;  1J2J B;  3RL0 C;  4M3L A;  3HD7 B;  2O01 H;  3SWF A;  1OHV A;  1NO4 A;  4ITX A;  2OYI A;  3ASA A;  4OH8 B;  2H7H A;  1BQA A;  1N73 B;  4XAU A;  3EI9 A;  2YO2 A;  1AHG A;  2BWP A;  1JO5 A;  1LWU B;  1O4S A;  1VEF A;  3KGW A;  1M1J C;  3VOP A;  5CHX A;  3TCM A;  4ADB A;  3BC8 A;  3ELP A;  4RAE A;  1NKZ B;  2OYI B;  3RCH A;  4JYC A;  4W7Z A;  3H7F A;  4DZO A;  1AMS A;  2Z9U A;  3JZL A;  2JJH A;  5DX5 A;  1M6S A;  4F5G A;  5JAY A;  1TOI A;  1LTI C;  1NU1 K;  5KLV K;  3TFU A;  3HRN A;  2W7F A;  2W8J A;  1FC4 A;  2WT7 B;  1H89 A;  3L44 A;  1LT9 A;  2J59 M;  2M8R A;  3BRT B;  3MBB A;  4M2M A;  2KSJ A;  1ELU A;  1GK4 A;  1MDX A;  2OYH A;  5APX A;  1ASC A;  1T3J A;  1E5F A;  1RV3 A;  2FXM A;  4WY4 C;  3B5N A;  1V72 A;  1AAW A;  1C7G A;  3F9T A;  3M0D C;  4B9B A;  1TOE A;  2ORD A;  4ATQ A;  3JW9 A;  3MUD A;  1GDE A;  2Q3I A;  2WT7 A;  1QGN A;  3FZ6 A;  2J58 A;  4Q76 A;  1AX4 A;  4M2K A;  3ATH A;  3HDO A;  1SFC C;  2VMY A;  3E2Y A;  2CAN A;  2WPS A;  3LWS A;  2W7K A;  1AKB A;  4AZJ A;  4QGR A;  4FFC A;  3FQ8 A;  1LW4 A;  1AJS A;  5FT6 A;  3NX3 A;  3IFM A;  1L4A A;  1ELQ A;  3VK2 A;  1L4A C;  4XE5 B;  2VMN A;  3NU8 A;  1IVR A;  1M32 A;  4GEB A;  1X8Y A;  3D6K A;  2BYL A;  4C7R A;  1X29 A;  3COG A;  1LWU C;  1ART A;  3DXV A;  1CZQ A;  1IO4 A;  1MDZ A;  1AHE A;  1WST A;  3IR9 A;  1CZE A;  5AVQ B;  1LGH B;  1VP4 A;  1B4X A;  1LTJ C;  1TPL A;  1M4N A;  3RL0 D;  2C0X A;  2N1T B;  1CSB A;  2W7H A;  3WGB A;  2NPS A;  1D7S A;  1IK9 A;  1JY2 P;  1ZOB A;  2OYI C;  4A6T A;  2Z1Y A;  3DC1 A;  3PAA A;  1WYU B;  1M1J A;  4W8I A;  1C4K A;  2A45 H;  2C81 A;  2W7D A;  5AVZ B;  1B8G A;  1BJN A;  1MDO A;  3BWO A;  4W80 A;  3KPE A;  2D7Z A;  2PB0 A;  3E1I A;  5DJ1 A;  5D95 A;  3MC6 C;  1J1D C;  5AVV B;  2PP6 A;  3CBF A;  4A6R A;  4H51 A;  3MD0 A;  4ZDO A;  5M4B A;  1ZV8 A;  1YAA A;  4F5K A;  2FYZ A;  1RY3 A;  2ZYJ A;  1HGV A;  2XDJ A;  5J8Q A;  4E1O A;  1ASL A;  2FQ6 A;  2VMZ A;  4OMA A;  1T2K C;  4EMY A;  2C0W A;  1JS6 A;  4ZWV A;  1ECX A;  1DGD A;  4I1L A;  3AEJ C;  4JF0 A;  3FD0 A;  5E4Z A;  2VGV A;  3NYU A;  1NH4 A;  3CQ6 A;  2HOX A;  2YNY A;  1HGZ A;  2YKO A;  1N86 A;  1TAR A;  3EUC A;  8AAT A;  3RK2 B;  3AEM A;  4N6J A;  3HUS C;  1AMR A;  1NOH A;  3TNU B;  2YCN A;  4MSO A;  2W7L A;  1SQV K;  2FKI A;  4DGT A;  1GEW A;  4UHO A;  1FZC C;  3NNK A;  1JCC A;  3CAI A;  1G1I A;  1HH0 A;  3FDD A;  3E9K A;  5AVY B;  4F4E A;  1HVV A;  4RIZ A;  4LC1 A;  2Z9V A;  2FM1 A;  3GET A;  1JS3 A;  1FZF A;  2QM7 A;  1LKC A;  1B9I A;  2ZUK A;  5CCH C;  1J1E B;  2OAR A;  2HOD B;  3AOV A;  3A3Y B;  4AQR D;  2ZXE B;  1RF1 C;  1UU1 A;  1G4X A;  3VMX A;  2CST A;  4ISY A;  4EFF A;  1MZ9 A;  4W91 A;  2QA3 A;  5I92 A;  3O8Z A;  4WY4 D;  3NTN A;  1JY2 N;  4IYO A;  2KB7 P;  1LC7 A;  2WIT A;  4IXZ A;  4ATP A;  4ZDP A;  1FU1 A;  2IX7 C;  4KHX A;  1FBM A;  1LTJ A;  1HTL C;  3PD6 A;  2OGA A;  2P7J A;  3RK3 B;  3CLQ A;  1PFF A;  3V5B A;  2HUU A;  1N7L A;  1LTB C;  1EJI A;  1ASM A;  3QN6 A;  5HHY A;  2AY6 A;  2W8T A;  2XV5 A;  4WXG A;  4NOG A;  1GW4 A;  3NTJ A;  1D7R A;  1W2E A;  1IBJ A;  1AHX A;  3TK1 A;  1HBW A;  4IXS A;  1JY2 O;  1RF0 A;  1WYT B;  1KFM A;  3JWA A;  3B5N C;  4RIT A;  3TQX A;  2XNX A;  3VYI A;  3RUY A;  1CL2 A;  3VP9 A;  1BT4 A;  2P2U A;  4F5M A;  4BHD A;  2E43 A;  4WBA A;  2FYF A;  1W7L A;  2AY9 A;  4R8D A;  1DH3 A;  1M0P A;  1AFO A;  2VMV A;  1LK9 A;  3P7K A;  4WLJ A;  2ZY3 A;  2P67 A;  2TPL A;  4ZAH A;  2WSF H;  2O1J A;  5BU8 B;  3HUS B;  3UIA A;  2C44 A;  1CJ0 A;  3LVM A;  4LLH A;  1QL2 A;  3GHG B;  3U59 A;  3IHJ A;  3PDB A;  3AOW A;  3EIB A;  4ZSW A;  1KZU B;  5BJ4 A;  1D2F A;  3WGC A;  1SF2 A;  1LT9 C;  3HVY A;  1J1D B;  3UE8 A;  3W1J A;  3OA7 A;  1N2D C;  1OXZ A;  1GD2 E;  1IJD B;  1I41 A;  1IFN A;  2HPC B;  4U2H A;  1G7W A;  2E7I A;  1WKH A;  1TAT A;  1QIS A;  2W7G A;  5APQ A;  2ZJG A;  2JJE A;  3FVX A;  4N3Y B;  5AVR B;  2DGK A;  1OHW A;  1FJK A;  3PJ0 A;  1ASG A;  3WMM 0;  3FZ7 A;  1SFF A;  1YNU A;  4DQ6 A;  2HYN A;  1DGE A;  2AY2 A;  1NHL A;  2FFD C;  2PAJ A;  4JEZ A;  3LVJ A;  5G2P A;  3EFG A;  5AVU B;  3AAT A;  4P3M A;  4C7N A;  2ZY2 A;  5G2Q A;  2Q7C A;  1ARH A;  4A00 A;  2OYH C;  3RCH B;  2YKX A;  3E6G A;  1DJ9 A;  2FN6 A;  3BWN A;  3RBF A;  4IFF A;  1AKA A;  1IFM A;  1N7S B;  1GBN A;  2NPS B;  2HPC A;  3FTB A;  3EI7 A;  5BJ3 A;  2JIS A;  1G2C B;  1GW3 A;  1KQL A;  2VMR A;  3T97 A;  5EUN A;  2HG5 D;  2YKY A;  3U1A A;  1CI6 A;  4IYO B;  1DJE A;  2VIB A;  2CH1 A;  3R9A A;  2DGL A;  2GSA A;  3LID A;  4J5U A;  3HE4 B;  4JEY A;  1ASA A;  2LKM A;  1UKJ A;  5EIG B;  2HOD A;  3QHX A;  3NUB A;  1KL2 A;  2JJF A;  3G7Q A;  1AHY A;  3AEN A;  3KKI A;  2DR1 A;  2D61 A;  1Z7D A;  1HJB A;  2ZSM A;  2P1J A;  2YCT A;  2E42 A;  4OYT A;  5EFS A;  3ZZJ A;  4R5F A;  2XH1 A;  4P7Y A;  1JOC A;  4L0O A;  1IAY A;  1JY3 N;  5G09 A;  1SQB K;  4AH3 A;  1N2T A;  1GL2 C;  3MGN A;  5AW7 B;  2BWO A;  1IX8 A;  1GC4 A;  1HUC A;  1O61 A;  2AAT A;  3NUI A;  2FKW B;  2CJD A;  3VN0 A;  4MQQ A;  1KIL C;  4IFM A;  2FNI A;  2VMX A;  1YTZ I;  2VMT A;  1H1C A;  4RJY A;  1J1E C;  1LW5 A;  2BIA A;  2KOG A;  1GZL A;  2WB6 A;  4RKD A;  2QBT A;  4LC3 A;  2W7M A;  4WYA A;  3EIA A;  3VOM A;  4A0R A;  3QGU A;  1GL2 B;  1WRG A;  4ZDL A;  4LW4 A;  4RLG A;  2IFM A;  3H6P A;  2WSC H;  5APV A;  2VMO A;  4W1V A;  3TFT A;  1L4A B;  2CH2 A;  2BI5 A;  3HE4 A;  2DOU A;  1NTZ K;  1M0O A;  1WYU A;  1S06 A;  3B1C A;  1AJR A;  4N78 D;  3KE3 A;  4I8A A;  3BV0 A;  2D65 A;  4GE7 A;  4W1W A;  3M9B A;  3OP7 A;  2GM4 A;  1LTA C;  4GDY A;  2R5E A;  4AO4 A;  4XA4 A;  2YCP A;  3LV2 A;  3LVL B;  2VI9 A;  4K2B A;  1BS0 A;  2A45 I;  2XZR A;  3N75 A;  5M49 A;  2AY4 A;  2VIA A;  3KGX A;  2AEV A;  3MIW A;  1RVU A;  3GZD A;  1AHF A;  4CXR A;  5AVS B;  3V2R A;  3VP8 A;  2I1J A;  1GL2 A;  3QI6 A;  1WYT A;  3ELE A;  3FVU A;  4A0F A;  2KFP A;  2YKQ A;  1FJP A;  1BJO B;  2YO3 A;  4AUW A;  1NAF A;  2IPP A;  4HVK A;  1XTG B;  2NMP A;  1GK6 A;  2O7C A;  3VK4 A;  4HF8 A;  3DU4 A;  3FCR A;  3HTK B;  1FG3 A;  2HUF A;  4FL0 A;  1BKG A;  3RL0 B;  3A9Y A;  3DYD A;  4XJM A;  2Q5U A;  3V4W A;  3R2P A;  2CB1 A;  1JY3 O;  4JEX A;  4XJP A;  3QBO A;  1GD9 A;  1NTM K;  3BAT A;  3A5T A;  1AAM A;  4E3R A;  2ZY5 A;  5AW3 B;  2Q7W A;  2VGS A;  4ZM4 A;  3ECD A;  4U1T A;  5HDM A;  1GCK A;  2HP2 A;  1PFI A;  2QSR A;  2AY3 A;  4ZLV A;  2HOZ A;  1DKA A;  1CZC A;  2CJG A;  4RES B;  3PPL A;  1ZOD A;  1ARG A;  3BVH A;  1KIL A;  1AQ5 A;  4CVQ A;  1CQ7 A;  1GC2 A;  3M5U A;  4Y0I A;  4E77 A;  5G4J A;  2BAS A;  1URQ C;  3LG0 A;  4R5Z A;  3G3Z A;  5DJ9 A;  5E3K A;  3FFR A;  1M7Y A;  2GQN A;  3B46 A;  4XEW A;  3OJA B;  2QM8 A;  4B98 A;  2CY8 A;  1E5E A;  1RE3 A;  3B1E A;  1AIB A;  2O1B A;  4TN4 A;  1CQ6 A;  4WLH A;  4ZKP A;  5M46 A;  2C7T A;  3NFQ A;  3BS8 A;  3KQG A;  2G7J A;  4UOY A;  4N0W A;  3H32 A;  3FSL A;  2X8U A;  3EQ2 A;  3VMY A;  3MKJ A;  1FDM A;  4W1X A;  1OXO A;  3B8E B;  1SVV A;  4BA4 A;  4EB5 A;  1RE4 C;  1CW5 A;  1TOG A;  1JTH A;  2AY1 A;  4ZKU A;  1ASE A;  4LNJ A;  1BQD A;  2VI8 A;  4WXB A;  1RF1 B;  1AIA A;  3MEB A;  1DTY A;  1FZC A;  1B9H A;  1SP4 A;  1FAV A;  4TMR A;  1SPA A;  1ZC9 A;  4F5I A;  2VLF A;  4WYD A;  2M3B A;  2X3L A;  2E54 A;  1QJ5 A;  5F9S A;  1ASD A;  4AOA A;  3HD7 A;  1A02 F;  2CPB A;  2FYU K;  3CQ5 A;  1XEY A;  1YIZ A;  4ZWM A;  2DKB A;  1MAP A;  1DJU A;  1AMA A;  2R0T A;  3GHG A;  1B5O A;  1IX6 A;  2BI1 A;  3NYT A;  3P1T A;  3ACZ A;  1AIC A;  3HE5 B;  4EB7 A;  3ISL A;  1ASB A;  4F5H A;  5AW6 B;  4EIJ A;  1KKJ A;  4KXK A;  4KYO A;  1I48 A;  3C9I A;  2W7E A;  3ZRQ A;  3GZD C;  2KP8 A;  1W7N A;  5CCG A;  2R5D A;  2E7U A;  2QB2 A;  2BIE A;  1XTC C;  3I5T A;  4BQ0 A;  3BCX A;  4I6M C;  4JF1 A;  3BCB A;  1AY4 A;  1GEX A;  4W7Y A;  4ZM3 A;  1KIL D;  4IX8 A;  1G1J A;  4WY4 A;  1LTS C;  3GR9 A;  3PA9 A;  1WYV B;  2GMS A;  1Y4I A;  3I16 A;  3NRA A;  3A8U X;  3P6K A;  1OWA A;  4WD2 A;  4RKC A;  1KIL B;  2PB2 A;  2A1V A;  5APU A;  3HMU A;  1X79 B;  2R32 A;  2Z9W A;  3ZRP A;  1PMO A;  4GT1 A;  5APT A;  5CCH A;  3FQ7 A;  3FZ8 A;  3NYS A;  4LGD E;  3HL2 A;  1GDT A;  1LTJ B;  2BI9 A;  1A02 J;  3H9X A;  1HWT C;  4I2L C;  3P8M C;  2X5D A;  3MTU E;  4A0H A;  1U08 A;  3L4F A;  1QIT A;  3VK3 A;  5FT4 A;  4IFD K;  2WPQ A;  3A9X A;  1M7L A;  3WCN A;  1TOJ A;  4WB0 A;  1BJ4 A;  1X0M A;  5DB5 A;  1MFZ A;  2BIG A;  4ZAS A;  4ADD A;  4MY5 A;  1ARI A;  3RK3 D;  2HP1 A;  1SZU A;  3E2F A;  2WWW A;  1C9C A;  3M91 A;  1OXP A;  2CJH A;  3B1D A;  1O69 A;  3USF A;  1OHY A;  3SWY A;  1D7V A;  2R3C A;  4K2I A;  4GE9 A;  1JCD A;  3NMD A;  3P8C E;  3RK2 C;  1JUN A;  2VGZ A;  2WK7 A;  2WPR A;  3DOD A;  1MGV A;  3GZC A;  4XK1 A;  4UHN A;  2Q9I A;  3JWB A;  3V2P A;  1TOK A;  2DGM A;  3PDB B;  2C9N Y;  4MKK A;  5AVW B;  4JF7 A;  4A0G A;  4PFN A;  1D7U A;  3V2N A;  2O0R A;  1LTT C;  5KJ7 D;  2W27 A;  1ASN A;  5G0A A;  3HLM A;  1VPC A;  3N4R A;  2KLV A;  3MAF B;  4WYG A;  1B5P A;  3MAD A;  1VDF A;  3L35 A;  1LC8 A;  4Q31 A;  1OAT A;  1JG8 A;  4LW2 A;  1FZB A;  2VMU A;  1XI9 A;  1T2K D;  1ARS A;  4R2N A;  3RK2 D;  2C9L Y;  3W1I A;  2EO5 A;  1X2A A;  3TAT A;  1GU5 A;  1S0A A;  2POH A;  4PIW A;  1EQB A;  3NXS A;  2E7J A;  4J8L A;  4MKJ A;  1JY3 P;  3AEL A;  3R4T A;  1YIY A;  2HZP A;  1JF9 A;  3P32 A;  4PVF A;  3PP5 A;  1X28 A;  1YJY A;  3RI6 A;  4DOJ A;  2ZC0 A;  5FT5 A;  3V4Q A;  3WKS A;  4GRX A;  1SFC D;  2VYC A;  5G4I A;  3F0H A;  2HUI A;  1MLY A;  2BI2 A;  2XKM A;  5EAV A;  3B5N D;  3VAX A;  3F6T A;  1C7O A;  1T8Z A;  3N7N A;  1AKC A;  3FRK A;  5EQC A;  2VMW A;  1VJO A;  5APS A;  1J04 A;  2H43 A;  2XU6 A;  2IFN A;  3DR7 A;  1FZE A;  2HOY A;  4A72 A;  1H88 A;  3GJU A;  1QIR A;  4E3Q A;  1RF0 C;  3I5C A;  2AY5 A;  3WLX A;  4CBR A;  2JEE A;  2N1T A;  1W23 A;  3PIU A;  2HOR A;  1KFN A;  1X9V A;  1NKN A;  2AY7 A;  1KMJ A;  3N4X A;  2OQX A;  3QM2 A;  1G4V A;  1WKG A;  3ZZK A;  4JEW A;  2D66 A;  2W7I A;  1GTW A;  3B8X A;  1N8P A;  4WB0 B;  1EQ7 A;  3LVK A;  3U1C A;  1O62 A;  1I29 A;  1J32 A;  3GHG C;  2ZSL A;  3PD6 B;  3K28 A;  2D63 A;  3A2A A;  3HD7 C;  3HD7 D;  2D7Y A;  1H0C A;  3GSB A;  1GC0 A;  2N9B A;  3WKR A;  1M0N A;  3OKS A;  1LC5 A;  5KJ7 C;  4OTL A;  1SQX K;  5KTB A;  5CMZ A;  2WTY A;  3NU7 A;  4GKG A;  2QB3 A;  4M2J A;  1T3I A;  1EG5 A;  2BI3 A;  1IJI A;  3A2B A;  3L37 A;  5AW1 B;  7AAT A;  2Z5I A;  3II6 A;  2GMU A;  1ZLL A;  2OKJ A;  4DBC A;  3GWP A;  4EU1 A;  5APW A;  3WCO A;  4MQP A;  2GUV A;  3M9H A;  4EOT A;  1JNM A;  3M0A A;  3N5M A;  1SFC B;  4JEV A;  4LNL A;  1BW0 A;  1V2F A;  3AEN B;  1SZK A;  1MLZ A;  3DRD A;  1TAS A;  3MC6 A;  5AVT B;  3EZ1 A;  3VMZ A;  4AYC A;  3FFH A;  2N1T C;  2QMA A;  1IFD A;  4XJO A;  3RK3 C;  2PO3 A;  4HH2 A;  4WXF A;  4IY7 A;  3BRV B;  2NPS C;  4WYF A;  5CCG C;  2VGT A;  1E5W A;  1MV8 A;  3PDX A;  1LS3 A;  1IFJ A;  2JJL A;  1GL2 D;  2G6W A;  1LTG C;  2EH6 A;  3AEM C;  2HFE D;  3QPG A;  4OC9 A;  1N73 A;  2OAT A;  5FT8 A;  2ZFC A;  2VMP A;  5CJ0 A;  5APY A;  3BWN C;  2F8J A;  3AEP A;  1PMM A;  2C0R A;  9AAT A;  4PFF A;  4GSA A;  4MQR A;  2WK8 A;  2W6A A;  4AZK A;  3NDN A;  3G8M A;  3FDB A;  1YOO A;  1QJ3 A;  4RJ0 A;  3HTK A;  1BJW A;  4F5F A;  2YRI A;  1CI6 B;  5BU5 A;  4O9B A;  3N4S A;  2YKV A;  3E77 A;  1URQ B;  1PG8 A;  3WZF A;  2FFD A;  3CI9 A;  4IW7 A;  1UU0 A;  4WY4 B;  2ZP7 A;  3DXW A;  5AVX B;  5TF5 A;  1YJS A;  5EUD A;  2JJG A;  2D64 A;  3OAK A;  1C7N A;  1KMK A;  1N7S A;  1SVF A;  5AW9 B;  3EI5 A;  1WT6 A;  4OCA A;  4BMK A;  2H8P D;  2X5F A;  5E5I A;  1N31 A;  2Z5H A;  4WYE A;  1LT9 B;  2EZ1 A;  3E2Z A;  4OBV A;  3HUS A;  2BYJ A;  4OBU A;  2NPS D;  2YKU A;  1IC2 A;  1RE3 C;  1Z56 A;  2EPJ A;  4UQV A;  1YTZ T;  3M9Q A;  4HYT B;  1FZA A;  2RFV A;  3AEO A;  5EIG A;  2N1T D;  3T32 A;  4F5L A;  4N78 E;  2VLH A;  2D5Y A;  1GC3 A;  2MJZ A;  1G2C A;  1DEB A;  5C6U A;  3AEJ A;  1M0Q A;  4GIF A;  3KYQ A;  2VMQ A;  1RE4 A;  4BA5 A;  2BHX A;  4C46 A;  2Z9X A;  4IXO A;  3G0T A;  1AY8 A;  3EI8 A;  5AW4 B;  1JMM A;  1I43 A;  3A9Z A;  1S07 A;  2CFB A;  3LIE A;  1FZG A;  3DZZ A;  1KKP A;  3L8A A;  1GEY A;  2R5C A;  3N0L A;  4RM1 A;  4LNM A;  1SFC A;  1C0N A;  2Z61 A;  1KL1 A;  5K8B A;  4WBT A;  1NTK K;  1MAQ A;  1W7M A;  4GE4 A;  4Q6R A;  3B5N B;  4K05 A;  5AW0 B;  5EUE A;  2W8U A;  1G7X A;  2WK9 A;  1FZC B;  1CQ8 A;  3EZS A;  1L0L K;  1N73 C;  4XQ2 A;  3P8C D;  2GB3 A;  1QZ9 A;  2I1K A;  3K7Y A;  4ITG A;  1DX7 A;  1FOS E;  2EGY A;  1YJZ A;  2OKK A;  2HLO A;  3KDP B;  3V2Q A;  4JYB A;  1FOS F;  4ADC A;  5CCG D;  1M1J B;  3MAF A;  1IFI A;  2BWN A;  3CQ4 A;  3GBX A;  3BB8 A;  2V0Y A;  4F5J A;  3UWC A;  3ASB A;  3HQT A;  1V2D A;  1URQ D;  2YKP A;  2L5G B;  3TSI A;  1S9K D;  1FG7 A;  1AJS B;  2VGW A;  5M4D A;  1RV4 A;  1CS1 A;  1UU2 A;  2R2N A;  1ZR2 A;  3EI6 A;  5EAA A;  3TNU A;  1N7S D;  1N7S C;  4XJL A;  5BVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...