3N4XA

Structure of csm1 full-length
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
163
structure length
149
Chain Sequence
b'SADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monopolin complex subunit CSM1
molecule tags Replication
source organism Saccharomyces cerevisiae
publication title The Monopolin Complex Crosslinks Kinetochore Components to Regulate Chromosome-Microtubule Attachments.
pubmed doi rcsb
total genus 48
structure length 149
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3n4xA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3n4xA02
3U1AA 3BASA 3N7NA 1IC2A 4I1LA 3N4SA 3VP8A 1X79B 3C9IA 3N4RA 2JEEA 3OJAB 4ZKPA 3VP9A 3U1CA 5BVZA 2FXMA 5BU5A 4N78D 3BATA 2POHA 1NKNA 3P8CD 4GIFA 3U59A 3HRNA 5KTBA 4N3YB 5BU8B 3N4XA 1WT6A 4ZKUA 4O9BA
chains in the Genus database with same CATH superfamily
2GUVA 1LC7A 2KFPA 3FVSA 1AVOA 1QVGO 5K8BA 1EXJA 2CB1A 2VMOA 1BQAA 3EWKA 3GSBA 2BKWA 1LNQA 2X8UA 5CCHC 1LTJA 1KILE 3BV0A 1P84I 5KTBA 5BU8B 1EDKA 3H1LJ 4WBAA 2IFMA 3A0HH 4C46A 4DGTA 1YQ3C 1BDCA 4UB6E 4ZNCA 2OYOA 2WPSA 2WSFJ 4U3FE 2D5YA 1LWUA 1MLZA 1QX8A 1JO5A 2VMQA 4WD2A 1WKGA 2HUUA 1AJRA 3L35A 4AZJA 1DD4A 4DOJA 2G3AA 1AX4A 1MV8A 3H1KD 3NTNA 2PRRA 1A02J 3HD7A 3CD6P 4Q75A 3AE1C 2XU6A 3B8EB 4WWIA 2ITAA 4CBRA 5E3KA 2AEJA 1EZVE 3TGUD 1QZ9A 2GMSA 3AEMA 3M5UA 4H44C 1BJNA 4U3FD 2HOZA 3KGWA 4H63Q 3QWOC 2E75D 4RO0A 1FZCC 1IAXA 2J5UA 4OCAA 2OQXA 1QITA 3I4JA 3TNUB 3BS8A 1BJWA 4ISYA 4JF7A 1SZSA 4K3AA 1ZN5A 4LW2A 1B9IA 1I41A 1RY3A 2PGDA 4I1LA 5CCGD 2R2NA 1KTMA 3FKDA 2IZ1A 2ZSMA 2BWOA 3VK3A 4WYAA 4WYGA 1PGOA 1W3UA 1FOSE 3FDBA 4K2MA 1BQDA 4PD4I 3RK3E 4JF0A 2POHA 3NMDA 3SWKA 1DJEA 2J58A 1AJSA 1HUCA 2Y0CA 2W8UA 5HDMA 1GC4A 3GG2A 3IAOA 4H51A 1DEEG 3CCVP 4HVKA 2WSEH 3L71J 4EI2A 1PP9G 2R44A 5G2PA 2VIAA 3B5ND 3CCUP 4R5FA 1CZCA 1M32A 2HFED 5KJ7A 1RHZB 3ELEA 4RESB 2N9YB 2Y0DA 2D7ZA 2KLUA 1LTTC 2HLOA 3RGUA 1J1EB 3CWBJ 1ZODA 1L0LK 2W8VA 4ADCA 1SPAA 3P8CE 1BSNA 1ASEA 1WRGA 2P7JA 2Z5IA 5AVZB 4HH2A 3L70D 4AQRD 3H1JD 4IL6E 4PJ0H 2OKJA 1ZR2A 1ELUA 4MSOA 1IK9A 4IXOA 2P2UA 3LIEA 1DJUA 1SVVA 4ADDA 2WZ7A 2MKVA 3RK3C 3TK1A 4MKJA 1UU2A 3NNKA 2OGEA 2AY7A 4GKGA 1KV4A 2VGSA 1G1IA 3L73J 1ZR4A 3M0DC 4IFDK 1Q2NA 2Z61A 3S4RA 4W7YA 1FDMA 1DKAA 3BWNA 3BWOA 1P84E 2E43A 1CI6B 2VMNA 3ISLA 2QLRA 2KB7P 4XEWA 2GA1A 5FT4A 1LT9C 2LR2A 2I1JA 1H0CA 1JM0A 1CZEA 4F5MA 1X0MA 2A45G 3R9AA 2CJGA 1D7RA 1KB9E 2PB2A 3EQ2A 4OBVA 2WB6A 2F8JA 3GZCA 1PP9J 5FT6A 2B87B 3G9RA 1L4AA 1B4XA 2DKBA 5B66E 3MADA 2X3LA 1ELQA 1GC2A 2JISA 4P3MA 1EC5A 4K2BA 4UQVA 2B87A 2YMYA 1PMMA 5CBOA 1BW0A 4OT8A 4ADBA 2ZXEB 2H43A 3B1EA 1J32A 2Q3IA 3Q3DA 1SFFA 2VMSA 3I16A 3RBLA 2VMYA 1BE3E 3VMZA 3LWSA 1NTZD 4EB7A 3COGA 2FXMA 1IFDA 1R5LA 2O01N 3CCEP 3H1LE 3EZ1A 2YKPA 2KSJA 3JZLA 2FYUD 1QISA 3A0HE 1NTMJ 3L74D 3KXDA 2OGAA 3H1IG 2R5BA 1ASGA 4UB6H 3RBZA 2Q7WA 3HMUA 2E76B 2QMAA 3WLXA 4LC1A 2BWPA 4WYDA 2CPBA 1K04A 1Q82Q 1NTKJ 3RK2C 4IXSA 4FFCA 2AY3A 4RITA 3A2AA 4NOGA 1AMSA 2YRRA 2FKWB 2GQNA 1AIBA 1BJ4A 1EZVI 3TF5A 2M5AA 2HP2A 4Y0DA 3BCCD 1LC8A 3L44A 4E1OA 1TU3F 1BS0A 1C7OA 3USSA 2OYHA 2JJFA 2VLHA 3MKJA 1SQBD 1XTGB 1KL2A 2QRXA 4EOTA 4ZASA 5TJHA 1KILC 3BB8A 2MJZA 1L0NE 3WY7A 3L75J 5APSA 2E7JA 3EI6A 1L0LJ 1G7XA 4HJGH 1LT1A 1YIJP 1FG3A 4ZDLA 2XNDH 2K88A 1OHVA 3E9KA 2QJPC 2QA3A 1W7MA 2YMKA 1NAFA 1N7LA 3ITKA 3KZIE 4DJGA 2YKOA 3W67A 2BIGA 1GMJA 5KLVG 4UB8H 3M9QA 1DX7A 1JEKA 2EGYA 3JTXA 4B98A 2AEUA 5HXXA 2YXRB 5EIGA 1LP1A 1JY3N 3CCLP 4ADEA 3AENA 4YPCA 2IBZE 3RK3B 1E5FA 2BYLA 1NU1G 1BGYJ 1AAMA 1DH3A 4MN4C 2HYNA 3C8VA 4ZMDA 1YQ4C 4QGRA 3ATHA 5KLVE 2CJDA 2YIUB 1S5LX 1YTZT 1NTKK 3M0AA 3LVJA 3WU2H 1DEBA 2NPSB 1S08A 1ZMEC 2KNCA 5JAYA 1AQ5A 3L4FA 1S1CX 2D2CB 1NU1J 2K9JB 1YYCA 4IW7A 3CPWO 4GDOA 1VQ6P 4ZM3A 1IFJA 4R4LA 1U7JA 1G1JA 4JYCA 1EZVD 3RL0B 3D6ZA 5D95A 1BCCE 1LJ2A 1OMIA 2R0TA 5KLVJ 1J1DB 3TFUA 3G7QA 3E2YA 1RF1A 4PV1B 2CH1A 2C0WA 3T32A 1VQ9P 4RJTA 2QSIA 4GT1A 5AW1B 3L72E 4LW4A 3VP6A 1GDEA 1KN7A 4GEBA 4CXRA 2JJHA 3A9XA 2WK9A 1OATA 2E5YA 1PG8A 3ZRQA 3F89A 5AW5B 1Q81Q 1ASFA 5I92A 1JY3O 2A45I 1EDLA 3TCMA 3HTKB 5M49A 2W7JA 2IDBA 3VMYA 2K9JA 1BJOB 5F8VA 5APQA 3RCHA 5E79E 4ZSYA 2XNXA 3RQ1A 4A6TA 4BWNA 1X8YA 5KAFE 1SQXD 3K40A 4M2MA 3FZ8A 2ZVOB 2N1TC 3L71E 3LW5J 4KAMA 1GC0A 1Y8AA 1EZVG 3EZSA 3PIUA 2ZJSE 1KB9H 1TOEA 1S2EA 1QL1A 1FE6A 1FU1A 1UIIA 4BHDA 3GHGB 4HB1A 3JCUH 1S9KE 2FYZA 3VN0A 1RE4A 3EUCA 3CQ5A 1SQPG 2E5TA 3PA9A 2ZYGA 3PGYA 1YJ9P 1EDJA 2LKMA 2CPSA 3II0A 1NJIQ 2G6WA 1SQVJ 1U08A 3E1RA 3H1IJ 1FBMA 2O3JA 4L0OA 4LLHA 3JSVC 2Z5HA 1NTME 1VF5D 1O61A 3I55P 2AEMA 1G7WA 5AVVB 4RKUJ 4A6RA 4WYEA 4F5JA 1C7NA 3WUVA 2BHXA 4XQ2A 4WP0A 2VYCA 1OFCX 1MGVA 1MUUA 1NO4A 2C9NY 1S07A 5AVTB 3L70E 1HF9A 3HE4A 3QM2A 1SFCD 3E1IA 3OKSA 3USFA 3W1JA 1GEXA 2WSFH 1RVUA 4WBTA 3HRNA 3AE9C 3DYDA 2JKVA 3M9BA 1YJSA 4MKKA 2FNUA 5AW4B 3PJSK 2JEEA 2HUFA 3OJAB 1TOGA 3EIBA 3VP9A 1U57A 3NU8A 4NPFX 3OA7A 1NTZK 3CX5E 3KHUA 1RV3A 1SQVK 5TISE 1CI6A 1CS1A 4H13C 3B1DA 1X0TA 1HVVA 3GF3A 1NYHA 1P3WA 2WSCH 3AEFC 3G4SP 2WQYC 4JEZA 4EFFA 3B5NA 3V2RA 4R5ZA 1OXZA 5APYA 1SS1A 1NTZJ 1L0LE 2KOGA 3T97A 1EDIA 3DR7A 4OMAA 1X28A 5TF5A 1GK4A 1M90Q 3WGCA 4ZDOA 2O1KA 1SQVG 2YKQA 3NTJA 2J59M 3WMM0 5AW0B 3PDBA 3CL3D 1NKZB 1BE3D 1S5LH 1YTZI 3WZFA 4KJMA 1AKBA 2C0XA 3WCNA 3FCRA 1GEWA 3TGUE 4C7NA 3CXHI 1N73A 1EQBA 3Q5RA 3PD6B 3M91A 3G3ZA 4U1TA 4DBCA 4W5KA 1ORDA 4R8DA 4W80A 2W8WA 4EU1A 3N4SA 2KLVA 5KLVK 3VMXA 2VRSA 5M1BA 4MY5A 2A06D 4PD4E 3MEBA 5AVQB 4N0WA 4WLHA 3ZZKA 2JJLA 2SPZA 1OXPA 4WXGA 3I56P 2VMWA 2KYVA 3TFTA 5AVRB 2EO5A 2FXPA 1WT6A 1VQLP 1S72P 1N86A 1HGVA 4U2HA 1KD1Q 5AW8B 1NGMB 2EZ2A 1BE3G 4JBZA 1RQUA 1SQPK 2QB2A 1BT4A 4DCKA 2O7CA 3CXHE 3GZDA 4WY4C 3FD0A 1M7LA 1KL1A 1AV1A 1RF0C 1Z7DA 2VI8A 5APTA 4CPGA 4N78D 2RFVA 2X5DA 1T3UA 2Q5UA 1L0ND 3D70A 2RH0A 3DC1A 3L37A 2BEQD 3TYYA 1ASNA 2V4HA 1D7SA 3FQAA 1IO4A 2PO3A 4IFFA 1KB9D 1K73Q 3FQ7A 3HUSA 4OGQD 3GBXA 4A7PA 2JJEA 1PPJG 1AHYA 1OIPA 3RL0D 5GTHH 1URQC 3W68A 4F5HA 3HD7B 4I2LC 4GE9A 1CZQA 2OYIB 1YNUA 3W1HA 4I7ZB 1VQNP 3JWBA 3AEEC 1JCCA 1HBWA 2AEVA 4UHOA 3BWNC 1JCDA 2CSTA 1ZXGA 1AJSB 2Z20A 3HVYA 2FYNC 1PPJE 1LTAC 3FDDA 1KYOD 3MUDC 3H1ID 4N6JA 1ZRTE 1LTIC 5KAIE 3MIWA 1ASCA 3EI8A 5IWQA 1EQ7A 1GL2A 3C1LA 2GSAA 2OYIC 2FYUK 2NMPA 5DJ9A 1PP9E 2FFDC 1FC2C 1C0NA 1OHYA 1QIRA 2ZJGA 1ZV8A 1OW6A 2E42A 4EDFA 3TQXA 3L70J 5HHYA 1PPJD 3KDPB 1ARGA 3AATA 5DJTB 3TNUA 1L0NJ 4EYYQ 3BCCG 4IYOB 4Y99C 4ITGA 2BI9A 1ASDA 4HYTB 3R4YA 5H2FH 1Q90D 3H25A 1JG8A 1SQXJ 4RM1A 4JYBA 2RN0A 1K9MQ 4B9BA 2XKMA 3DRDA 4ZLVA 3L74J 2BCCG 2R3CA 3DU4A 4L75A 3ACZA 4IXZA 2P10A 1FJPA 3NFQA 5EFSA 1I29A 1AMQA 3BCCE 2DR1A 2H7HA 2Y9ZA 4IL6X 4TMRA 1WYUB 4W91A 1CJ0A 3AEPA 2VMRA 1PGQA 3CX5I 1DGEA 2QB3A 4Q6RA 2BCCJ 2OTLP 1PFIA 2OYIA 2AATA 4ATPA 1S4XA 2R5CB 2VI9A 2QBTA 3H1LD 3P32A 3FXDA 2FYNB 1YJNP 1KAFA 1KMJA 3VK2A 3VP8A 1SQQD 1NTZG 3EI9A 3VOPA 2D63A 3FSLA 2JWAA 1UKJA 4Y99B 4AOAA 1W2EA 3GLMA 1TASA 2W7LA 2JGTA 3RK2D 2PB0A 2WVRA 2PP6A 3PTZA 3VMAA 3ZDMA 4WYFA 5B5EE 2W27A 1O62A 2WT7B 1SQQK 2X5FA 3ASAA 4Q31A 1Q86Q 4A0RA 3U1AA 1ARHA 2HR3A 3QGUA 3V6IA 4JEYA 1IFIA 3ZRRA 3FWLA 3CC2P 3K5BA 4RJ0A 3L75E 2V1PA 4W1WA 2DGLA 2W7KA 2Z9XA 2GMUA 4GDYA 3GR9A 1QGNA 2E74C 4A72A 2W7FA 1M1JB 4D6TD 1VF5C 5CCHD 2EPJA 3HE5A 2JG2A 1AHFA 2FN6A 1L4AB 1RE4C 1RV4A 1QVFO 1SQQG 3JC22 1EG5A 1HGZA 3ECDA 3CLQA 1T3JA 4H44B 1KKJA 1CQ8A 1D7VA 1QEXA 2R5DA 2O0RA 2ZY4A 1GL2D 2A45H 3MZWB 1AMRA 4GOFA 4WY4D 3OP7A 2FYFA 1FZCA 1BGYG 1AHXA 3SWYA 3D71A 1RF1C 2V0YA 3H1HG 4CVQA 4Z1MH 1B8GA 3DR4A 3CXHH 4DZOA 1T6AA 1RE3A 2BASA 3N4RA 1UU0A 3HE4B 4JF1A 1KILB 1LT9A 1ZOBA 2Q3EA 4FL0A 1SQPD 2QJKC 3IR9A 1RQVA 1MFTA 1IK7A 3CWBG 4KHXA 3SFDC 4J5UA 2D61A 3LVLB 4F5FA 5GTIH 3AEOA 3JWAA 2YHKA 4AO4A 1S9KD 3GMAA 5EUDA 3P6KA 3RI6A 1NH4A 4W1XA 2JJGA 3CC7P 3FXEA 3RBFA 2NPSD 2QM7A 5FT5A 5KJ7D 1GL2B 2FFDA 2W8JA 5DX5A 1EJIA 3GF7A 3AEJC 4HKZH 2NPSC 1OZHA 3H1HD 3AOVA 3AELA 1K05A 2V7QH 4WLJA 4ZSWA 2E76C 1OW7A 1DFOA 3N0LA 4F4EA 1SP4A 4TN4A 3PHLA 1IX8A 3NYUA 4PV1D 3CBFA 4ATQA 3Q1MA 3BCXA 3D6YA 3AEBC 4U3FJ 3S9OA 2BYJA 1KQSO 2OTJP 1LC5A 3NDNA 1V72A 4B86A 3TGUJ 5EUEA 1N73C 1MZ9A 3CWBD 4E3QA 3AE5C 2ZAEB 4C7RA 3AE7C 2FXOA 3HBXA 3AE6C 2E7UA 1G4VA 1KFMA 1PL5A 1H1CA 5AVYB 1C7GA 1DGDA 2QJYC 5KAFH 1USDA 1JNMA 3TGUG 5CJ0A 1GBNA 1PMOA 2KS1B 1YITP 2Z9UA 3WKRA 3H1JE 1GCKA 1KILA 3V4WA 3CX5D 4U3FG 1SFCC 1OX3A 2HUIA 4DT0A 2ZFCA 3AEJA 3U59A 3FVXA 2W7MA 1QL2A 1LWUB 1YJWP 3P7KA 2RKLA 3II6A 4BRYA 1NHLA 1SQBJ 1SQVD 1U7MA 2C9LY 2HG5D 3FFRA 1W7LA 3A9ZA 3HTKA 3CMAP 3QHXA 1OVRA 5KKZB 3A0BH 1VPCA 3AECC 2DW3A 1TARA 3AEGC 3CAIA 3CCMP 1SFCA 1VQ5P 1AVYA 1LW4A 2P1JA 5E4ZA 5G4JA 3VAXA 1VQPP 2VMXA 1RF0A 2BIEA 3PPLA 1V2EA 2L91A 3ZZJA 1NTMK 2AXTE 1IJDB 1M1JC 8AATA 1OVUA 1FDOA 1AY5A 3MD0A 3ZRPA 1AMAA 4H0LB 3ABVC 3CQ4A 4GODA 4TLFA 3LY1A 2Y9YA 4JEVA 3A3YB 2ZY5A 1GC3A 2BI5A 1CSBA 3P8CD 2VIBA 1N2DC 4IOIH 1RF1B 3MBBA 1H8AA 2XZRA 1G4XA 1N2TA 1VQOP 2TPLA 2KZJA 4PD4D 4XFJA 4EB5A 3HD7C 2XH1A 2M0BA 2WPRA 3LV2A 1KQFB 3CCSP 3QI6A 3H1KG 3L70G 1RH5B 2HP1A 5G2QA 4BXLA 2AY1A 2JR8A 1IFNA 1LGHB 4I7ZC 4YTPC 1BSHA 1N7SA 1M1KQ 3BASA 2DGKA 2VGTA 1IVRA 2ZY2A 1IFMA 1AKCA 3EI7A 1JTHB 1OW8A 4XJOA 4EMYA 1AQTA 2FQ6A 3H1KE 3LVKA 3VYIA 3TDKA 1YOOA 1Q7YQ 3A5TA 4WXBA 1WKHA 5DJUB 1TOJA 3GHGC 1IBJA 1LKCA 2Q9IA 1DTYA 2EYQA 2Q7CA 3RK3D 1D7UA 1S5LE 2Y0EA 4JPZB 3CCRP 4PIWA 2O1JA 2W90A 3A8UX 5C6UA 2PAJA 4WB0B 1GU5A 2O1BA 4IL6H 3G8MA 1UIXA 3CCQP 2BEZF 2AY8A 1GW4A 1KC8Q 4AZKA 2NPSA 3Q8NA 2BIAA 1H0TA 2BCCE 4PJ0E 1N8PA 1YJYA 2CANA 2QIWA 1LTGC 2QSRA 3K28A 4Q76A 1KYOE 1I48A 4UOYA 1FZAA 2A06G 1ARSA 1LS3A 4PVFA 1YJZA 3L74E 2YCPA 2B89A 2HPCA 3S1KA 1TOKA 2KXPB 1CW5A 2AXCA 2A06E 3B5NC 1YIYA 5CCGA 1KZUB 4O9BA 2W7GA 1NTZE 4OC9A 3F0HA 1KFNA 3L74G 4J8LA 3HUSC 1SZUA 3GWPA 1IJIA 1USEA 3C9IA 3E6GA 1N7SC 5EUNA 1IZNB 1D2FA 4A0FA 1M0QA 3UE8A 3RUYA 5APXA 1XEYA 5F9SA 3HQTA 5BJ4A 1IFPA 4I8AA 4JEXA 4RAEA 3PH0A 1CQ7A 1KB9I 1GL2C 3FVUA 1JY3P 2VMPA 1SQBE 2B88A 3I5CA 1S3JA 5C39A 1BCCD 3L75G 1BKGA 3L72J 3MUDA 3AE8C 4N78E 1J1EC 2AY5A 2VMVA 5G09A 4HF8A 1HWTC 1PGJA 1IAYA 1VQMP 2W8TA 1OHWA 4WY4B 3O8ZA 1VP4A 5AVUB 1NTKE 4XJMA 1CQ6A 4K2IA 2EZ1A 3H1HJ 1WYTA 1LK9A 1SQBG 2HOYA 1M0NA 3PAAA 3IN6A 2CJHA 3SWFA 1PGPA 3A7OA 4PFFA 1PV3A 1RVYA 2VMZA 3BCAA 3WGBA 2VGZA 2Z4EA 3MAFB 1BCCJ 4IX8A 4OWFA 3V4QA 3G0TA 4H44D 2K9YA 1NTKG 2CINA 4F5IA 2OARA 3QPGA 3GW6A 1TOIA 1ZLLA 1I43A 1H89A 1B5OA 4BA5A 1GK6A 1ZP0C 1KMKA 2ZYAA 3MHVA 9AATA 2AXTH 4OTLA 1T3IA 4D6TG 2I1KA 1HH0A 4WY4A 1QJ3A 3EIAA 1XTCC 3RBXA 2D2CC 1JY2N 2WITA 2FYUE 1LP1B 5H2FE 2CFBA 2IYOA 3V2PA 3B8XA 3R4TA 2YIUC 1AKAA 3CI9A 2GB3A 4OGQB 4ZKPA 2GM4A 4Y0IA 1IX7A 2VMTA 3NUBA 3QN6A 4P7YA 1X9VA 3CWBE 1YHQP 1YI2P 2YXQB 1LTJC 4PD4H 2R5CA 4U7JA 2EH6A 1QGKB 3WCOA 1HJBA 1FS0E 3M0DA 4MQQA 3P8MC 4BMKA 3KZIH 2IBZG 4M2KA 5KLIC 1BJOA 2WTYA 1FZBA 3LG0A 1IX6A 1WYVA 3WUTA 1GD2E 4OVNF 1LW5A 5AVSB 1KQGB 2BI1A 4XA4A 3L73E 1JF9A 1VQ7P 4L73A 4MQPA 1GTWA 1GEYA 4M2JA 2IX7C 3PP5A 4AH3A 4H13B 2O01H 2OQQA 2ZVNB 1Y47A 2W6BA 1TATA 1YIZA 1W23A 3W1IA 2H89C 1OWAA 2IZ0A 2ZYDA 1IUGA 2LXCB 1SQXE 2AY6A 1ZOYC 1MAQA 3MAFA 2JP3A 4RKDA 1OVVA 2QA4P 3WU2E 2FNIA 4W1VA 4WB0A 5DB5A 5EIGB 3WX9A 3L73G 4PV1C 1W5CE 3NX3A 3AENB 4RJYA 3BN1A 2ZT9B 5B5EH 2OATA 3EFFK 4R2NA 1N73B 4C7NB 5AVXB 1S0AA 2P67A 3PD6A 1H0TB 1AIAA 1SQXK 1J2JB 3O6QA 4AO9A 2WMMA 2VGUA 3LIDA 1E79H 2KK7A 1SQXG 1O69A 3IHJA 2WK8A 4IYOA 1Z3ZA 1JB0J 1JOCA 3SFEC 2M5AB 1M56D 3O6QB 4OGQC 2G7JA 3A9YA 4KT0J 3CQ6A 1JMBA 2KI7B 1NOHA 2VGVA 2G8YA 1NU1D 3P1TA 1T2KC 4F5GA 1G2CA 1FC4A 1KYOH 4BRYB 3AE3C 3KGXA 3RL0C 2A1VA 3Q5SA 2WK7A 3LW5H 1CL1A 2E54A 2D64A 3UIAA 2YRIA 3H9XA 1JMMA 1O4SA 3HD7D 1T2KD 3F6TA 1SFCB 2W83C 4Y28J 3HLMA 3QBOA 4XJPA 2E75C 4RKCA 2FM1A 4BQ0A 4ZAHA 1WYUA 1AHEA 4GRXA 2WSEJ 3HE5B 3JCUE 1V2DA 3D6KA 3DXVA 2JDIH 2HORA 3M9HA 2AY2A 1AJYA 1AHGA 4ASWA 4RIZA 2XBNA 1D7MA 1G2CB 1PFFA 1M8OB 4ASVA 3T97B 3HL2A 4H0LC 1YBKA 2GUSA 1JTHA 2Z1ZA 1WYTB 1Z56A 1LTBC 2NRGA 4D6TJ 1FG7A 3VK4A 3FGAD 1PZQA 2W6JH 1BGYE 2BWNA 1L0LD 5G0AA 5APWA 4UHMA 1KORA 2YKVA 3N5MA 2Q1KA 2W6AA 2H8PD 5AW6B 1X79B 2D65A 3BCBA 3CXHD 2K37A 3KQGA 3ELPA 2WT7A 2YKYA 4JQ0D 2CK3H 1M4NA 4LNLA 1QJ5A 1TPLA 4PFNA 4XJLA 2WPVB 5CMZA 2QE7H 4NPEA 3UWCA 2C0RA 3H7FA 1M7YA 3L8AA 1ECXA 1HTLC 3K7YA 3E2FA 3N7NA 1N7SD 1QLED 1E5WA 1J04A 2BI3A 3KPEA 1ASAA 2H88C 1VQ4P 4BA4A 1JY2P 3B4SA 1KILD 2FFDB 3FZ6A 1NKNA 3MAUA 2YKUA 3CX5H 2FYUJ 1L0NK 1L0LG 1AY8A 4GIFA 2HPCB 2AY9A 2N1TB 3AOWA 4A00A 2BI2A 3H1KJ 1X29A 3N75A 1R5SA 1PIXA 3AEDC 1LTSC 2ZT9C 3BRTB 2L5GB 4OYTA 3Q5PA 5DJ1A 1W2BO 4GE4A 1C4KA 1NU1K 1C9CA 5M46A 4LGDE 3B46A 5APVA 4UHNA 1DIPA 3FZ7A 3R2PA 5AW3B 1GDTA 5APUA 3NU7A 2R32A 5KJ7C 1GU4A 2N1TA 5FT8A 3PRJA 2PFXA 3IF4A 1SLQA 3SSUA 3QH9A 1SQVE 4IFMA 3JW9A 4ZDPA 3H1JG 2OYHC 1XI9A 3B5NB 1L4AD 2KIKA 1RE3C 2OGUA 4LC3A 2WPQA 2M3BA 5CHXA 1WMKA 3WUUA 3OW2O 4NPDA 3BC8A 2QJKB 2ZUKA 5KKZC 5AVWB 3G6EP 1S09A 5CBNA 2W8ZA 2UWJE 3PDXA 4WYCA 1P84H 5J8QA 2K1AA 3VTPC 3H1JJ 2P58A 3TSIA 3CC4P 1FZEA 2WWWA 2CY8A 4ITXA 3NXSA 1OXOA 1KMIZ 2FKIA 3TATA 5CCHA 1VJOA 3FFHA 2RMZA 3MGNA 5B66H 1L4AC 2QJYB 2FBWC 3B1CA 1SQPJ 2E76D 1PP9D 2N9BA 3FQ8A 1SF2A 2ORDA 3PDBB 3WKSA 4F5LA 2AEFA 2QM8A 5BU5A 4ZWVA 2D66A 2C44A 1DD3A 4D6TE 3Q2YA 3V2QA 4WXFA 3NUIA 2FYUG 3N4XA 3A2BA 3AEMC 4E3RA 1KKPA 2BCCD 1S06A 4RLGA 2XDJA 3H32A 3OAKA 4YXDC 5KAIH 3BVHA 1P84D 3AE4C 2QVAA 1L0NG 3A0BE 2C81A 1AA0A 3PLNA 3RL0g 3HT4A 3L36A 2YOBA 1N31A 2OTKE 1A02F 1YAAA 1H88A 1AY4A 2Z9VA 4A0HA 1ASBA 1UU1A 2XV5A 5BVZA 4K05A 4CBSA 3FX0A 3F5HA 4OBUA 1ZRTD 4H13D 1ARTA 1N8RQ 3RCHB 2YCNA 5AW2B 2R5EA 3H32B 4IY7A 2WSCJ 3DZZA 4E77A 1X22A 1Y9BA 1W7NA 1VF5B 5EAVA 1KYOI 3KYQA 2IBZD 4AUWA 3M06A 3FWNA 2ZT9D 4AYCA 2HODB 3U1CA 1FZFA 1VQ8P 2C7TA 2OYHB 2KUBA 2KNCB 5G4IA 3CMEP 1B9HA 2D7YA 2WKAA 2W7IA 5KLVD 2NZ2A 7AATA 3GETA 1JS3A 3KE3A 4GE7A 3FRKA 2AY4A 4YXWH 3MC6C 1ZC9A 1BCCG 3L75D 4UB8E 5EFWB 1NWQA 1AICA 3LVMA 2KSEA 2WSSH 1L2PA 1VEFA 3E77A 2QJPB 4XAUA 3NYTA 4WB4A 5K5GB 1M57D 3L72G 4O6ZA 3E2ZB 3GHGA 2YCTA 2JWDA 2E7IA 3VOMA 2DGMA 4QMAA 5CJ4A 1BE3J 1BDDA 4XE5B 2ZXXA 1BGYD 2LXBA 3MP7B 4ZKUA 5EQCA 2HZPA 1GW3A 2YNYA 1ASLA 2M8RA 2N1TD 1NTKD 3UAKA 2FY8A 1JUNA 4W8IA 4A6UA 2O01J 4H0LD 2W7EA 3F9TA 1NAYA 2ZY3A 5TISH 2KP8A 3AEAC 1M6SA 3L71G 1DJ9A 2E75B 2ZC0A 5BJ3A 1FZGA 1VQKP 1MLYA 1HJ0A 1E5EA 2YO2A 3H1LG 3FTBA 1V2FA 4L74A 3H6PA 4ZM4A 4KXKA 4KYOA 3NYSA 4WVZA 3E2ZA 1B5PA 3H1HE 4I6MC 5KLIB 1SQPE 3L72D 1AAWA 1JY2O 3H1IE 3GJUA 1WYVB 1WSTA 3MC6A 3I5TA 3KKIA 2ZYJA 2JO1A 2KZIA 2HODA 3G71P 1NTMG 1ASMA 4CXQA 3BATA 3B71A 2YKXA 1URQB 4XK1A 3RK2B 2E74D 1M0PA 5D5SA 4F5KA 2DOUA 5L8RJ 5E79H 1FDIA 1LT9B 1SQQE 3BRVB 2YO3A 1KQLA 4ZWMA 1GZLA 1N7SB 4GSAA 2DKJA 1SQBK 1Y4IA 1GD9A 1ARIA 1IC2A 3BCCJ 1MAPA 4JEWA 5EAAA 3V2NA 2R3SA 3HUSB 5CCGC 1M1JA 4LNJA 5AW9B 2QEXP 3L71D 3CCJP 3DODA 1LTJB 1VL2A 2IFNA 4GOEA 1MDZA 5AW7B 3EFGA 5M4DA 2I8DA 2Z9WA 2VLFA 1SQQJ 1MKMA 1LWUC 2HOXA 2VGWA 5GTIE 2K3RA 2B9BA 4EIJA 3GZDC 1JS6A 1MDXA 4A0GA 1FOSF 1M0OA 3DXWA 3L73D 2Z1YA 4W7ZA 1ZW0A 1NTMD 3MTUE 1CL2A 2CH2A 3NRAA 4LNMA 2ZSLA 4L76A 2OKKA 5M4BA 1URQD 4DQ6A 2E74B 3HDOA 2VMUA 1T8ZA 4MQRA 1AFOA 4OH8B 1VDFA 2QG4A 4K35A 4N3YB 1MFZA 4Y0HA 1MDOA 3PJ0A 2IBZI 3AV7A 4M3LA 1FAVA 1NU1E 3V5BA 1SVFA 2IPPA 1EXIA 1FJKA 1X2AA 2M3EA 1NVOA 2V7QJ 3E7KA 2Q6QA 1SZKA 2ZP7A 1K8AQ 3AE2C 5E5IA 2W7HA 4R4MA 1URQA 2KS1A 2D2CD 4TT3H 3EI5A 1FZCB 3ASBA 1J1DC 2CTZA 1R8EA 2W7DA 5AX8A 2IYPA 3IFMA 5GTHE
chains in the Genus database with same CATH topology
2GUVA 1LC7A 2KFPA 3FVSA 5K8BA 2CB1A 2VMOA 1BQAA 3GSBA 2BKWA 2X8UA 5CCHC 1LTJA 3BV0A 5KTBA 5BU8B 4WBAA 2IFMA 4C46A 4DGTA 2WPSA 2D5YA 1LWUA 1MLZA 1JO5A 2VMQA 4WD2A 1WKGA 2HUUA 1AJRA 3L35A 4AZJA 4DOJA 1AX4A 1MV8A 3NTNA 1A02J 4Q75A 3HD7A 3B8EB 2XU6A 4CBRA 5E3KA 1QZ9A 2GMSA 3AEMA 3M5UA 1BJNA 2HOZA 3KGWA 4H63Q 1FZCC 1IAXA 4OCAA 2OQXA 1QITA 3I4JA 3TNUB 3BS8A 1BJWA 4ISYA 4JF7A 1SZSA 1ZN5A 4LW2A 1B9IA 1I41A 1RY3A 4I1LA 5CCGD 2R2NA 3FKDA 2ZSMA 2BWOA 3VK3A 4WYAA 4WYGA 1W3UA 1FOSE 3FDBA 4K2MA 1BQDA 4JF0A 2POHA 3NMDA 1DJEA 2J58A 1AJSA 1HUCA 2W8UA 5HDMA 1GC4A 4H51A 4HVKA 2WSEH 5G2PA 2VIAA 3B5ND 4R5FA 1CZCA 1M32A 2HFED 5KJ7A 3ELEA 4RESB 2D7ZA 1ZODA 1LTTC 2HLOA 1J1EB 1L0LK 2W8VA 4ADCA 1SPAA 3P8CE 1WRGA 2P7JA 2Z5IA 5AVZB 1ASEA 4HH2A 4AQRD 2OKJA 4MSOA 1ZR2A 1ELUA 1IK9A 4IXOA 2P2UA 3LIEA 1DJUA 1SVVA 4ADDA 2WZ7A 3RK3C 3TK1A 4MKJA 1UU2A 3NNKA 2OGEA 2AY7A 4GKGA 2VGSA 1G1IA 1ZR4A 3M0DC 4IFDK 2Z61A 4W7YA 1FDMA 1DKAA 3BWNA 3BWOA 2E43A 1CI6B 2VMNA 3ISLA 2QLRA 2KB7P 4XEWA 5FT4A 1LT9C 2I1JA 1H0CA 1CZEA 4F5MA 1X0MA 2A45G 3R9AA 2CJGA 1D7RA 2PB2A 3EQ2A 4OBVA 2WB6A 2F8JA 3GZCA 5FT6A 1L4AA 1B4XA 2DKBA 3MADA 2X3LA 1ELQA 1GC2A 2JISA 4P3MA 4K2BA 4UQVA 1PMMA 2YMYA 1BW0A 4OT8A 4ADBA 2ZXEB 2H43A 3B1EA 1J32A 2Q3IA 1SFFA 2VMSA 3I16A 3RBLA 2VMYA 3VMZA 3LWSA 4EB7A 3COGA 2FXMA 1IFDA 3EZ1A 2YKPA 2KSJA 3JZLA 1QISA 2OGAA 2R5BA 1ASGA 2Q7WA 3HMUA 2QMAA 3WLXA 4LC1A 2BWPA 4WYDA 2CPBA 3RK2C 4IXSA 4FFCA 2AY3A 4RITA 3A2AA 4NOGA 1AMSA 2YRRA 2FKWB 2GQNA 1AIBA 1BJ4A 2HP2A 4Y0DA 1LC8A 3L44A 4E1OA 1BS0A 1C7OA 2OYHA 2JJFA 2VLHA 3MKJA 1XTGB 1KL2A 4EOTA 4ZASA 1KILC 3BB8A 2MJZA 3WY7A 5APSA 2E7JA 3EI6A 1G7XA 1FG3A 4ZDLA 1OHVA 3E9KA 2QA3A 1W7MA 1NAFA 1N7LA 2YKOA 2BIGA 3M9QA 1DX7A 2EGYA 3JTXA 4B98A 2AEUA 5HXXA 5EIGA 1JY3N 4ADEA 3AENA 3RK3B 1E5FA 2BYLA 1AAMA 1DH3A 2HYNA 4QGRA 3ATHA 2CJDA 1YTZT 1NTKK 3M0AA 3LVJA 1DEBA 2NPSB 1S08A 5JAYA 1AQ5A 3L4FA 1YYCA 4IW7A 4ZM3A 1IFJA 1G1JA 4JYCA 3RL0B 5D95A 2R0TA 3TFUA 1J1DB 3G7QA 3E2YA 1RF1A 2CH1A 2C0WA 3T32A 4GT1A 5AW1B 3VP6A 4LW4A 1GDEA 4GEBA 4CXRA 2JJHA 3A9XA 2WK9A 1OATA 1PG8A 3ZRQA 5AW5B 1ASFA 5I92A 1JY3O 2A45I 3TCMA 3HTKB 5M49A 2W7JA 3VMYA 5F8VA 1BJOB 5APQA 3RCHA 4ZSYA 2XNXA 3RQ1A 4A6TA 1X8YA 3K40A 4M2MA 3FZ8A 2N1TC 4KAMA 1GC0A 3EZSA 3PIUA 1TOEA 1QL1A 1FU1A 4BHDA 3GHGB 1S9KE 2FYZA 3VN0A 1RE4A 3EUCA 3CQ5A 3PA9A 3PGYA 2LKMA 2CPSA 3II0A 2G6WA 1U08A 1FBMA 4L0OA 2Z5HA 4LLHA 1O61A 1G7WA 5AVVB 4A6RA 4WYEA 4F5JA 1C7NA 4WP0A 2BHXA 4XQ2A 2VYCA 1MGVA 1MUUA 1NO4A 2C9NY 1S07A 5AVTB 3HE4A 3QM2A 1SFCD 3E1IA 3OKSA 3USFA 3W1JA 1GEXA 2WSFH 1RVUA 4WBTA 3HRNA 3DYDA 3M9BA 1YJSA 4MKKA 2FNUA 5AW4B 2JEEA 2HUFA 3OJAB 1TOGA 3EIBA 3VP9A 3NU8A 3OA7A 1NTZK 1RV3A 1SQVK 1CI6A 1CS1A 3B1DA 1HVVA 1P3WA 2WSCH 4JEZA 4EFFA 3B5NA 3V2RA 4R5ZA 1OXZA 5APYA 2KOGA 3T97A 3DR7A 4OMAA 1X28A 5TF5A 1GK4A 3WGCA 4ZDOA 2O1KA 2YKQA 3NTJA 2J59M 3WMM0 5AW0B 3PDBA 3CL3D 1NKZB 1YTZI 3WZFA 1AKBA 2C0XA 3WCNA 3FCRA 1GEWA 4C7NA 1N73A 1EQBA 3PD6B 3M91A 3G3ZA 4U1TA 4DBCA 4W5KA 1ORDA 4R8DA 4W80A 2W8WA 4EU1A 3N4SA 2KLVA 5KLVK 3VMXA 2VRSA 4MY5A 3MEBA 5AVQB 4N0WA 4WLHA 3ZZKA 2JJLA 1OXPA 4WXGA 2VMWA 2KYVA 3TFTA 5AVRB 2EO5A 1WT6A 1N86A 1HGVA 4U2HA 5AW8B 2EZ2A 1SQPK 2QB2A 1BT4A 2O7CA 3GZDA 4WY4C 3FD0A 1M7LA 1KL1A 1RF0C 1Z7DA 2VI8A 5APTA 4N78D 2RFVA 2X5DA 1T3UA 2Q5UA 3DC1A 3L37A 3TYYA 1ASNA 1D7SA 3FQAA 1IO4A 2PO3A 4IFFA 3FQ7A 3HUSA 3GBXA 2JJEA 1AHYA 3RL0D 1URQC 4F5HA 3HD7B 4I2LC 4GE9A 1CZQA 2OYIB 1YNUA 3W1HA 3JWBA 1JCCA 1HBWA 2AEVA 4UHOA 3BWNC 1JCDA 2CSTA 1AJSB 2Z20A 3HVYA 1LTAC 3FDDA 4N6JA 1LTIC 1ASCA 3MIWA 3EI8A 5IWQA 1EQ7A 1GL2A 2GSAA 2OYIC 2FYUK 2NMPA 5DJ9A 2FFDC 1C0NA 1OHYA 1QIRA 2ZJGA 1ZV8A 2E42A 3TQXA 5HHYA 3KDPB 1ARGA 3AATA 3TNUA 4IYOB 4Y99C 4ITGA 2BI9A 1ASDA 4HYTB 1JG8A 4RM1A 4JYBA 4B9BA 2XKMA 3DRDA 4ZLVA 2R3CA 3DU4A 4IXZA 3ACZA 1FJPA 3NFQA 5EFSA 1I29A 1AMQA 2DR1A 2H7HA 4TMRA 1WYUB 4W91A 1CJ0A 3AEPA 2VMRA 1DGEA 2QB3A 4Q6RA 1PFIA 2OYIA 2AATA 4ATPA 2R5CB 2VI9A 2QBTA 3P32A 1KMJA 3VK2A 3VP8A 3EI9A 3VOPA 2D63A 3FSLA 1UKJA 4Y99B 4AOAA 1W2EA 1TASA 2W7LA 2JGTA 3RK2D 2PB0A 2PP6A 4WYFA 2W27A 1O62A 2WT7B 1SQQK 2X5FA 3ASAA 4Q31A 4A0RA 4JEYA 3QGUA 3U1AA 1ARHA 3ZRRA 1IFIA 4RJ0A 2V1PA 4W1WA 2DGLA 2W7KA 2Z9XA 2GMUA 4GDYA 3GR9A 1QGNA 4A72A 2W7FA 1M1JB 5CCHD 2EPJA 3HE5A 2JG2A 1AHFA 2FN6A 1L4AB 1RE4C 1RV4A 1EG5A 1HGZA 3ECDA 3CLQA 1T3JA 1KKJA 1CQ8A 1D7VA 2R5DA 2O0RA 2ZY4A 1GL2D 2A45H 4WY4D 1AMRA 3OP7A 2FYFA 1FZCA 1AHXA 3SWYA 1RF1C 2V0YA 4CVQA 1B8GA 3DR4A 4DZOA 2BASA 1RE3A 3N4RA 1UU0A 3HE4B 4JF1A 1KILB 1LT9A 1ZOBA 4FL0A 3IR9A 4KHXA 4J5UA 2D61A 3LVLB 4F5FA 3AEOA 3JWAA 2YHKA 4AO4A 1S9KD 5EUDA 3P6KA 3RI6A 1NH4A 4W1XA 2JJGA 3RBFA 2NPSD 2QM7A 5FT5A 5KJ7D 1GL2B 2FFDA 2W8JA 5DX5A 1EJIA 3AEJC 2NPSC 3AOVA 3AELA 4WLJA 4ZSWA 1DFOA 3N0LA 4F4EA 1SP4A 4TN4A 1IX8A 3NYUA 3CBFA 4ATQA 3BCXA 2BYJA 1LC5A 3NDNA 1V72A 4B86A 5EUEA 1N73C 1MZ9A 4E3QA 4C7RA 3HBXA 2E7UA 1G4VA 1KFMA 1H1CA 5AVYB 1C7GA 1DGDA 1JNMA 5CJ0A 1GBNA 1PMOA 3WKRA 2Z9UA 1GCKA 1KILA 3V4WA 1SFCC 2HUIA 2ZFCA 3AEJA 3U59A 3FVXA 2W7MA 1QL2A 1LWUB 3P7KA 3II6A 1NHLA 2C9LY 2HG5D 3FFRA 1W7LA 3A9ZA 3HTKA 3QHXA 1VPCA 1TARA 3CAIA 1SFCA 1LW4A 2P1JA 5E4ZA 5G4JA 3VAXA 2VMXA 1RF0A 2BIEA 3PPLA 1V2EA 3ZZJA 1NTMK 1IJDB 1M1JC 8AATA 1AY5A 3MD0A 3ZRPA 1AMAA 3CQ4A 3LY1A 4JEVA 3A3YB 2ZY5A 1GC3A 2BI5A 1CSBA 3P8CD 2VIBA 1N2DC 1RF1B 3MBBA 1H8AA 2XZRA 1G4XA 1N2TA 2TPLA 4EB5A 3HD7C 2XH1A 2WPRA 3LV2A 3QI6A 2HP1A 5G2QA 2AY1A 1IFNA 1LGHB 1N7SA 3BASA 2DGKA 2VGTA 1IVRA 2ZY2A 1IFMA 1AKCA 3EI7A 1JTHB 4XJOA 4EMYA 2FQ6A 3LVKA 3VYIA 1YOOA 3A5TA 4WXBA 1WKHA 1TOJA 3GHGC 1IBJA 1LKCA 2Q9IA 1DTYA 2EYQA 2Q7CA 3RK3D 1D7UA 4PIWA 2O1JA 3A8UX 5C6UA 2PAJA 4WB0B 1GU5A 2O1BA 3G8MA 2AY8A 1GW4A 4AZKA 2NPSA 3Q8NA 2BIAA 1N8PA 1YJYA 2CANA 1LTGC 2QSRA 3K28A 4Q76A 1I48A 4UOYA 1FZAA 1ARSA 1LS3A 4PVFA 1YJZA 2YCPA 2HPCA 1TOKA 1CW5A 3B5NC 1YIYA 5CCGA 1KZUB 4O9BA 2W7GA 4OC9A 3F0HA 1KFNA 4J8LA 3HUSC 1SZUA 3GWPA 3C9IA 1IJIA 3E6GA 1N7SC 5EUNA 1D2FA 4A0FA 1M0QA 3UE8A 3RUYA 5APXA 1XEYA 5F9SA 3HQTA 5BJ4A 4I8AA 4JEXA 4RAEA 1CQ7A 3FVUA 1GL2C 1JY3P 2VMPA 3I5CA 1BKGA 3MUDA 4N78E 1J1EC 2AY5A 2VMVA 5G09A 4HF8A 1HWTC 1IAYA 2W8TA 1OHWA 4WY4B 3O8ZA 1VP4A 5AVUB 4XJMA 1CQ6A 4K2IA 2EZ1A 1WYTA 1LK9A 2HOYA 1M0NA 3PAAA 2CJHA 3SWFA 3A7OA 4PFFA 1RVYA 2VMZA 3BCAA 3WGBA 2VGZA 2Z4EA 3MAFB 4IX8A 3V4QA 3G0TA 2CINA 4F5IA 2OARA 3QPGA 1TOIA 1ZLLA 1I43A 1H89A 1B5OA 4BA5A 1GK6A 1KMKA 9AATA 4OTLA 1T3IA 3EIAA 2I1KA 1HH0A 4WY4A 1QJ3A 1XTCC 1JY2N 2WITA 2CFBA 3V2PA 3B8XA 3R4TA 1AKAA 3CI9A 2GB3A 4ZKPA 2GM4A 4Y0IA 1IX7A 2VMTA 3NUBA 3QN6A 4P7YA 1X9VA 1LTJC 2R5CA 2EH6A 3WCOA 1HJBA 3M0DA 4MQQA 3P8MC 4BMKA 4M2KA 1BJOA 2WTYA 1FZBA 3LG0A 1IX6A 1WYVA 1GD2E 1LW5A 5AVSB 2BI1A 4XA4A 1JF9A 4MQPA 1GTWA 1GEYA 4M2JA 2IX7C 3PP5A 4AH3A 2O01H 2W6BA 1TATA 1YIZA 1W23A 3W1IA 1OWAA 1IUGA 2AY6A 1MAQA 3MAFA 4RKDA 2FNIA 4W1VA 4WB0A 5DB5A 3WX9A 5EIGB 3NX3A 3AENB 4RJYA 3BN1A 2OATA 4R2NA 4C7NB 1N73B 5AVXB 1S0AA 2P67A 3PD6A 1SQXK 1J2JB 1AIAA 4AO9A 2VGUA 3LIDA 1O69A 3IHJA 2WK8A 4IYOA 1Z3ZA 1JOCA 2G7JA 3A9YA 3CQ6A 1NOHA 2VGVA 3P1TA 1T2KC 4F5GA 1G2CA 1FC4A 3KGXA 3RL0C 2A1VA 2WK7A 3LW5H 1CL1A 2E54A 2D64A 3UIAA 2YRIA 3H9XA 1JMMA 1O4SA 3HD7D 1T2KD 3F6TA 1SFCB 3HLMA 3QBOA 4XJPA 4RKCA 2FM1A 4BQ0A 4ZAHA 1WYUA 1AHEA 4GRXA 3HE5B 1V2DA 3D6KA 3DXVA 2HORA 3M9HA 2AY2A 1AHGA 4RIZA 2XBNA 1PFFA 1G2CB 3HL2A 2GUSA 1JTHA 2Z1ZA 1WYTB 1Z56A 1LTBC 1FG7A 3VK4A 2BWNA 5G0AA 5APWA 4UHMA 2YKVA 3N5MA 2W6AA 2H8PD 5AW6B 1X79B 2D65A 3BCBA 3KQGA 3ELPA 2WT7A 2YKYA 1M4NA 4LNLA 1QJ5A 1TPLA 4PFNA 4XJLA 5CMZA 3UWCA 2C0RA 3H7FA 1M7YA 3L8AA 1ECXA 1HTLC 3K7YA 3E2FA 3N7NA 1N7SD 1E5WA 1J04A 2BI3A 3KPEA 1ASAA 4BA4A 1JY2P 1KILD 2FFDB 3FZ6A 1NKNA 3MAUA 2YKUA 1L0NK 2HPCB 1AY8A 4GIFA 3AOWA 2AY9A 2N1TB 4A00A 2BI2A 1X29A 3N75A 1LTSC 3BRTB 2L5GB 4OYTA 5DJ1A 4GE4A 1C4KA 1NU1K 1C9CA 5M46A 4LGDE 3B46A 5APVA 4UHNA 3FZ7A 3R2PA 5AW3B 1GDTA 5APUA 3NU7A 2R32A 5KJ7C 1GU4A 2N1TA 5FT8A 1SLQA 4IFMA 3JW9A 4ZDPA 2OYHC 1XI9A 3B5NB 1L4AD 1RE3C 4LC3A 2WPQA 2M3BA 5CHXA 3BC8A 2ZUKA 5AVWB 1S09A 3PDXA 4WYCA 5J8QA 3VTPC 3TSIA 1FZEA 2WWWA 2CY8A 4ITXA 3NXSA 1OXOA 2FKIA 3TATA 5CCHA 1VJOA 3FFHA 3MGNA 1L4AC 3B1CA 2N9BA 3FQ8A 1SF2A 2ORDA 3PDBB 3WKSA 4F5LA 2QM8A 5BU5A 4ZWVA 2D66A 2C44A 3V2QA 4WXFA 3NUIA 3N4XA 3A2BA 3AEMC 4E3RA 1KKPA 1S06A 4RLGA 2XDJA 3H32A 3OAKA 3BVHA 2C81A 3HT4A 3L36A 2YOBA 1N31A 1A02F 1YAAA 1H88A 1AY4A 2Z9VA 4A0HA 1ASBA 1UU1A 2XV5A 5BVZA 4K05A 4CBSA 4OBUA 1ARTA 3RCHB 2YCNA 5AW2B 2R5EA 3H32B 4IY7A 3DZZA 4E77A 1W7NA 5EAVA 3KYQA 4AUWA 3M06A 4AYCA 3U1CA 2HODB 2C7TA 1FZFA 2OYHB 5G4IA 1B9HA 2D7YA 2WKAA 2W7IA 7AATA 3GETA 1JS3A 3KE3A 4GE7A 3FRKA 2AY4A 3MC6C 1ZC9A 1NWQA 1AICA 3LVMA 1VEFA 3E77A 4XAUA 3NYTA 4WB4A 4O6ZA 3E2ZB 3GHGA 2YCTA 2E7IA 3VOMA 2DGMA 5CJ4A 4XE5B 4ZKUA 5EQCA 2HZPA 1GW3A 2YNYA 2M8RA 1ASLA 2N1TD 3UAKA 1JUNA 4W8IA 4A6UA 2W7EA 3F9TA 2ZY3A 2KP8A 1M6SA 1DJ9A 2ZC0A 5BJ3A 1FZGA 1MLYA 1E5EA 2YO2A 3FTBA 1V2FA 3H6PA 4ZM4A 4KXKA 4KYOA 3NYSA 3E2ZA 1B5PA 4I6MC 1AAWA 1JY2O 3GJUA 1WYVB 1WSTA 3MC6A 3I5TA 3KKIA 2ZYJA 2HODA 4CXQA 1ASMA 3BATA 4XK1A 2YKXA 1URQB 3RK2B 1M0PA 5D5SA 4F5KA 2DOUA 1LT9B 3BRVB 2YO3A 1KQLA 4ZWMA 1GZLA 1N7SB 4GSAA 2DKJA 1SQBK 1Y4IA 1GD9A 1ARIA 1IC2A 1MAPA 5EAAA 4JEWA 3V2NA 3HUSB 5CCGC 1M1JA 4LNJA 5AW9B 3DODA 1LTJB 2IFNA 1MDZA 5AW7B 3EFGA 5M4DA 2Z9WA 2VLFA 1LWUC 2HOXA 2VGWA 4EIJA 3GZDC 1JS6A 1MDXA 4A0GA 1FOSF 1M0OA 3DXWA 2Z1YA 4W7ZA 2CH2A 3MTUE 1CL2A 3NRAA 4LNMA 2ZSLA 2OKKA 5M4BA 1URQD 4DQ6A 3HDOA 2VMUA 1T8ZA 4MQRA 1AFOA 4OH8B 1VDFA 4N3YB 1MFZA 4Y0HA 1MDOA 3PJ0A 3AV7A 4M3LA 1FAVA 3V5BA 1SVFA 2IPPA 1FJKA 1X2AA 1SZKA 2ZP7A 5E5IA 2W7HA 1URQA 3EI5A 1FZCB 3ASBA 1J1DC 2CTZA 2W7DA 5AX8A 3IFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1A A;  3BAS A;  3N7N A;  1IC2 A;  4I1L A;  3N4S A;  3VP8 A;  1X79 B;  3C9I A;  3N4R A;  2JEE A;  3OJA B;  4ZKP A;  3VP9 A;  3U1C A;  5BVZ A;  2FXM A;  5BU5 A;  4N78 D;  3BAT A;  2POH A;  1NKN A;  3P8C D;  4GIF A;  3U59 A;  3HRN A;  5KTB A;  4N3Y B;  5BU8 B;  3N4X A;  1WT6 A;  4ZKU A;  4O9B A; 
#chains in the Genus database with same CATH topology
 2GUV A;  1LC7 A;  2KFP A;  3FVS A;  1AVO A;  1QVG O;  5K8B A;  1EXJ A;  2CB1 A;  2VMO A;  1BQA A;  3EWK A;  3GSB A;  2BKW A;  1LNQ A;  2X8U A;  5CCH C;  1LTJ A;  1KIL E;  3BV0 A;  1P84 I;  5KTB A;  5BU8 B;  1EDK A;  3H1L J;  4WBA A;  2IFM A;  3A0H H;  4C46 A;  4DGT A;  1YQ3 C;  1BDC A;  4UB6 E;  4ZNC A;  2OYO A;  2WPS A;  2WSF J;  4U3F E;  2D5Y A;  1LWU A;  1MLZ A;  1QX8 A;  1JO5 A;  2VMQ A;  4WD2 A;  1WKG A;  2HUU A;  1AJR A;  3L35 A;  4AZJ A;  1DD4 A;  4DOJ A;  2G3A A;  1AX4 A;  1MV8 A;  3H1K D;  3NTN A;  2PRR A;  1A02 J;  3HD7 A;  3CD6 P;  4Q75 A;  3AE1 C;  2XU6 A;  3B8E B;  4WWI A;  2ITA A;  4CBR A;  5E3K A;  2AEJ A;  1EZV E;  3TGU D;  1QZ9 A;  2GMS A;  3AEM A;  3M5U A;  4H44 C;  1BJN A;  4U3F D;  2HOZ A;  3KGW A;  4H63 Q;  3QWO C;  2E75 D;  4RO0 A;  1FZC C;  1IAX A;  2J5U A;  4OCA A;  2OQX A;  1QIT A;  3I4J A;  3TNU B;  3BS8 A;  1BJW A;  4ISY A;  4JF7 A;  1SZS A;  4K3A A;  1ZN5 A;  4LW2 A;  1B9I A;  1I41 A;  1RY3 A;  2PGD A;  4I1L A;  5CCG D;  2R2N A;  1KTM A;  3FKD A;  2IZ1 A;  2ZSM A;  2BWO A;  3VK3 A;  4WYA A;  4WYG A;  1PGO A;  1W3U A;  1FOS E;  3FDB A;  4K2M A;  1BQD A;  4PD4 I;  3RK3 E;  4JF0 A;  2POH A;  3NMD A;  3SWK A;  1DJE A;  2J58 A;  1AJS A;  1HUC A;  2Y0C A;  2W8U A;  5HDM A;  1GC4 A;  3GG2 A;  3IAO A;  4H51 A;  1DEE G;  3CCV P;  4HVK A;  2WSE H;  3L71 J;  4EI2 A;  1PP9 G;  2R44 A;  5G2P A;  2VIA A;  3B5N D;  3CCU P;  4R5F A;  1CZC A;  1M32 A;  2HFE D;  5KJ7 A;  1RHZ B;  3ELE A;  4RES B;  2N9Y B;  2Y0D A;  2D7Z A;  2KLU A;  1LTT C;  2HLO A;  3RGU A;  1J1E B;  3CWB J;  1ZOD A;  1L0L K;  2W8V A;  4ADC A;  1SPA A;  3P8C E;  1BSN A;  1ASE A;  1WRG A;  2P7J A;  2Z5I A;  5AVZ B;  4HH2 A;  3L70 D;  4AQR D;  3H1J D;  4IL6 E;  4PJ0 H;  2OKJ A;  1ZR2 A;  1ELU A;  4MSO A;  1IK9 A;  4IXO A;  2P2U A;  3LIE A;  1DJU A;  1SVV A;  4ADD A;  2WZ7 A;  2MKV A;  3RK3 C;  3TK1 A;  4MKJ A;  1UU2 A;  3NNK A;  2OGE A;  2AY7 A;  4GKG A;  1KV4 A;  2VGS A;  1G1I A;  3L73 J;  1ZR4 A;  3M0D C;  4IFD K;  1Q2N A;  2Z61 A;  3S4R A;  4W7Y A;  1FDM A;  1DKA A;  3BWN A;  3BWO A;  1P84 E;  2E43 A;  1CI6 B;  2VMN A;  3ISL A;  2QLR A;  2KB7 P;  4XEW A;  2GA1 A;  5FT4 A;  1LT9 C;  2LR2 A;  2I1J A;  1H0C A;  1JM0 A;  1CZE A;  4F5M A;  1X0M A;  2A45 G;  3R9A A;  2CJG A;  1D7R A;  1KB9 E;  2PB2 A;  3EQ2 A;  4OBV A;  2WB6 A;  2F8J A;  3GZC A;  1PP9 J;  5FT6 A;  2B87 B;  3G9R A;  1L4A A;  1B4X A;  2DKB A;  5B66 E;  3MAD A;  2X3L A;  1ELQ A;  1GC2 A;  2JIS A;  4P3M A;  1EC5 A;  4K2B A;  4UQV A;  2B87 A;  2YMY A;  1PMM A;  5CBO A;  1BW0 A;  4OT8 A;  4ADB A;  2ZXE B;  2H43 A;  3B1E A;  1J32 A;  2Q3I A;  3Q3D A;  1SFF A;  2VMS A;  3I16 A;  3RBL A;  2VMY A;  1BE3 E;  3VMZ A;  3LWS A;  1NTZ D;  4EB7 A;  3COG A;  2FXM A;  1IFD A;  1R5L A;  2O01 N;  3CCE P;  3H1L E;  3EZ1 A;  2YKP A;  2KSJ A;  3JZL A;  2FYU D;  1QIS A;  3A0H E;  1NTM J;  3L74 D;  3KXD A;  2OGA A;  3H1I G;  2R5B A;  1ASG A;  4UB6 H;  3RBZ A;  2Q7W A;  3HMU A;  2E76 B;  2QMA A;  3WLX A;  4LC1 A;  2BWP A;  4WYD A;  2CPB A;  1K04 A;  1Q82 Q;  1NTK J;  3RK2 C;  4IXS A;  4FFC A;  2AY3 A;  4RIT A;  3A2A A;  4NOG A;  1AMS A;  2YRR A;  2FKW B;  2GQN A;  1AIB A;  1BJ4 A;  1EZV I;  3TF5 A;  2M5A A;  2HP2 A;  4Y0D A;  3BCC D;  1LC8 A;  3L44 A;  4E1O A;  1TU3 F;  1BS0 A;  1C7O A;  3USS A;  2OYH A;  2JJF A;  2VLH A;  3MKJ A;  1SQB D;  1XTG B;  1KL2 A;  2QRX A;  4EOT A;  4ZAS A;  5TJH A;  1KIL C;  3BB8 A;  2MJZ A;  1L0N E;  3WY7 A;  3L75 J;  5APS A;  2E7J A;  3EI6 A;  1L0L J;  1G7X A;  4HJG H;  1LT1 A;  1YIJ P;  1FG3 A;  4ZDL A;  2XND H;  2K88 A;  1OHV A;  3E9K A;  2QJP C;  2QA3 A;  1W7M A;  2YMK A;  1NAF A;  1N7L A;  3ITK A;  3KZI E;  4DJG A;  2YKO A;  3W67 A;  2BIG A;  1GMJ A;  5KLV G;  4UB8 H;  3M9Q A;  1DX7 A;  1JEK A;  2EGY A;  3JTX A;  4B98 A;  2AEU A;  5HXX A;  2YXR B;  5EIG A;  1LP1 A;  1JY3 N;  3CCL P;  4ADE A;  3AEN A;  4YPC A;  2IBZ E;  3RK3 B;  1E5F A;  2BYL A;  1NU1 G;  1BGY J;  1AAM A;  1DH3 A;  4MN4 C;  2HYN A;  3C8V A;  4ZMD A;  1YQ4 C;  4QGR A;  3ATH A;  5KLV E;  2CJD A;  2YIU B;  1S5L X;  1YTZ T;  1NTK K;  3M0A A;  3LVJ A;  3WU2 H;  1DEB A;  2NPS B;  1S08 A;  1ZME C;  2KNC A;  5JAY A;  1AQ5 A;  3L4F A;  1S1C X;  2D2C B;  1NU1 J;  2K9J B;  1YYC A;  4IW7 A;  3CPW O;  4GDO A;  1VQ6 P;  4ZM3 A;  1IFJ A;  4R4L A;  1U7J A;  1G1J A;  4JYC A;  1EZV D;  3RL0 B;  3D6Z A;  5D95 A;  1BCC E;  1LJ2 A;  1OMI A;  2R0T A;  5KLV J;  1J1D B;  3TFU A;  3G7Q A;  3E2Y A;  1RF1 A;  4PV1 B;  2CH1 A;  2C0W A;  3T32 A;  1VQ9 P;  4RJT A;  2QSI A;  4GT1 A;  5AW1 B;  3L72 E;  4LW4 A;  3VP6 A;  1GDE A;  1KN7 A;  4GEB A;  4CXR A;  2JJH A;  3A9X A;  2WK9 A;  1OAT A;  2E5Y A;  1PG8 A;  3ZRQ A;  3F89 A;  5AW5 B;  1Q81 Q;  1ASF A;  5I92 A;  1JY3 O;  2A45 I;  1EDL A;  3TCM A;  3HTK B;  5M49 A;  2W7J A;  2IDB A;  3VMY A;  2K9J A;  1BJO B;  5F8V A;  5APQ A;  3RCH A;  5E79 E;  4ZSY A;  2XNX A;  3RQ1 A;  4A6T A;  4BWN A;  1X8Y A;  5KAF E;  1SQX D;  3K40 A;  4M2M A;  3FZ8 A;  2ZVO B;  2N1T C;  3L71 E;  3LW5 J;  4KAM A;  1GC0 A;  1Y8A A;  1EZV G;  3EZS A;  3PIU A;  2ZJS E;  1KB9 H;  1TOE A;  1S2E A;  1QL1 A;  1FE6 A;  1FU1 A;  1UII A;  4BHD A;  3GHG B;  4HB1 A;  3JCU H;  1S9K E;  2FYZ A;  3VN0 A;  1RE4 A;  3EUC A;  3CQ5 A;  1SQP G;  2E5T A;  3PA9 A;  2ZYG A;  3PGY A;  1YJ9 P;  1EDJ A;  2LKM A;  2CPS A;  3II0 A;  1NJI Q;  2G6W A;  1SQV J;  1U08 A;  3E1R A;  3H1I J;  1FBM A;  2O3J A;  4L0O A;  4LLH A;  3JSV C;  2Z5H A;  1NTM E;  1VF5 D;  1O61 A;  3I55 P;  2AEM A;  1G7W A;  5AVV B;  4RKU J;  4A6R A;  4WYE A;  4F5J A;  1C7N A;  3WUV A;  2BHX A;  4XQ2 A;  4WP0 A;  2VYC A;  1OFC X;  1MGV A;  1MUU A;  1NO4 A;  2C9N Y;  1S07 A;  5AVT B;  3L70 E;  1HF9 A;  3HE4 A;  3QM2 A;  1SFC D;  3E1I A;  3OKS A;  3USF A;  3W1J A;  1GEX A;  2WSF H;  1RVU A;  4WBT A;  3HRN A;  3AE9 C;  3DYD A;  2JKV A;  3M9B A;  1YJS A;  4MKK A;  2FNU A;  5AW4 B;  3PJS K;  2JEE A;  2HUF A;  3OJA B;  1TOG A;  3EIB A;  3VP9 A;  1U57 A;  3NU8 A;  4NPF X;  3OA7 A;  1NTZ K;  3CX5 E;  3KHU A;  1RV3 A;  1SQV K;  5TIS E;  1CI6 A;  1CS1 A;  4H13 C;  3B1D A;  1X0T A;  1HVV A;  3GF3 A;  1NYH A;  1P3W A;  2WSC H;  3AEF C;  3G4S P;  2WQY C;  4JEZ A;  4EFF A;  3B5N A;  3V2R A;  4R5Z A;  1OXZ A;  5APY A;  1SS1 A;  1NTZ J;  1L0L E;  2KOG A;  3T97 A;  1EDI A;  3DR7 A;  4OMA A;  1X28 A;  5TF5 A;  1GK4 A;  1M90 Q;  3WGC A;  4ZDO A;  2O1K A;  1SQV G;  2YKQ A;  3NTJ A;  2J59 M;  3WMM 0;  5AW0 B;  3PDB A;  3CL3 D;  1NKZ B;  1BE3 D;  1S5L H;  1YTZ I;  3WZF A;  4KJM A;  1AKB A;  2C0X A;  3WCN A;  3FCR A;  1GEW A;  3TGU E;  4C7N A;  3CXH I;  1N73 A;  1EQB A;  3Q5R A;  3PD6 B;  3M91 A;  3G3Z A;  4U1T A;  4DBC A;  4W5K A;  1ORD A;  4R8D A;  4W80 A;  2W8W A;  4EU1 A;  3N4S A;  2KLV A;  5KLV K;  3VMX A;  2VRS A;  5M1B A;  4MY5 A;  2A06 D;  4PD4 E;  3MEB A;  5AVQ B;  4N0W A;  4WLH A;  3ZZK A;  2JJL A;  2SPZ A;  1OXP A;  4WXG A;  3I56 P;  2VMW A;  2KYV A;  3TFT A;  5AVR B;  2EO5 A;  2FXP A;  1WT6 A;  1VQL P;  1S72 P;  1N86 A;  1HGV A;  4U2H A;  1KD1 Q;  5AW8 B;  1NGM B;  2EZ2 A;  1BE3 G;  4JBZ A;  1RQU A;  1SQP K;  2QB2 A;  1BT4 A;  4DCK A;  2O7C A;  3CXH E;  3GZD A;  4WY4 C;  3FD0 A;  1M7L A;  1KL1 A;  1AV1 A;  1RF0 C;  1Z7D A;  2VI8 A;  5APT A;  4CPG A;  4N78 D;  2RFV A;  2X5D A;  1T3U A;  2Q5U A;  1L0N D;  3D70 A;  2RH0 A;  3DC1 A;  3L37 A;  2BEQ D;  3TYY A;  1ASN A;  2V4H A;  1D7S A;  3FQA A;  1IO4 A;  2PO3 A;  4IFF A;  1KB9 D;  1K73 Q;  3FQ7 A;  3HUS A;  4OGQ D;  3GBX A;  4A7P A;  2JJE A;  1PPJ G;  1AHY A;  1OIP A;  3RL0 D;  5GTH H;  1URQ C;  3W68 A;  4F5H A;  3HD7 B;  4I2L C;  4GE9 A;  1CZQ A;  2OYI B;  1YNU A;  3W1H A;  4I7Z B;  1VQN P;  3JWB A;  3AEE C;  1JCC A;  1HBW A;  2AEV A;  4UHO A;  3BWN C;  1JCD A;  2CST A;  1ZXG A;  1AJS B;  2Z20 A;  3HVY A;  2FYN C;  1PPJ E;  1LTA C;  3FDD A;  1KYO D;  3MUD C;  3H1I D;  4N6J A;  1ZRT E;  1LTI C;  5KAI E;  3MIW A;  1ASC A;  3EI8 A;  5IWQ A;  1EQ7 A;  1GL2 A;  3C1L A;  2GSA A;  2OYI C;  2FYU K;  2NMP A;  5DJ9 A;  1PP9 E;  2FFD C;  1FC2 C;  1C0N A;  1OHY A;  1QIR A;  2ZJG A;  1ZV8 A;  1OW6 A;  2E42 A;  4EDF A;  3TQX A;  3L70 J;  5HHY A;  1PPJ D;  3KDP B;  1ARG A;  3AAT A;  5DJT B;  3TNU A;  1L0N J;  4EYY Q;  3BCC G;  4IYO B;  4Y99 C;  4ITG A;  2BI9 A;  1ASD A;  4HYT B;  3R4Y A;  5H2F H;  1Q90 D;  3H25 A;  1JG8 A;  1SQX J;  4RM1 A;  4JYB A;  2RN0 A;  1K9M Q;  4B9B A;  2XKM A;  3DRD A;  4ZLV A;  3L74 J;  2BCC G;  2R3C A;  3DU4 A;  4L75 A;  3ACZ A;  4IXZ A;  2P10 A;  1FJP A;  3NFQ A;  5EFS A;  1I29 A;  1AMQ A;  3BCC E;  2DR1 A;  2H7H A;  2Y9Z A;  4IL6 X;  4TMR A;  1WYU B;  4W91 A;  1CJ0 A;  3AEP A;  2VMR A;  1PGQ A;  3CX5 I;  1DGE A;  2QB3 A;  4Q6R A;  2BCC J;  2OTL P;  1PFI A;  2OYI A;  2AAT A;  4ATP A;  1S4X A;  2R5C B;  2VI9 A;  2QBT A;  3H1L D;  3P32 A;  3FXD A;  2FYN B;  1YJN P;  1KAF A;  1KMJ A;  3VK2 A;  3VP8 A;  1SQQ D;  1NTZ G;  3EI9 A;  3VOP A;  2D63 A;  3FSL A;  2JWA A;  1UKJ A;  4Y99 B;  4AOA A;  1W2E A;  3GLM A;  1TAS A;  2W7L A;  2JGT A;  3RK2 D;  2PB0 A;  2WVR A;  2PP6 A;  3PTZ A;  3VMA A;  3ZDM A;  4WYF A;  5B5E E;  2W27 A;  1O62 A;  2WT7 B;  1SQQ K;  2X5F A;  3ASA A;  4Q31 A;  1Q86 Q;  4A0R A;  3U1A A;  1ARH A;  2HR3 A;  3QGU A;  3V6I A;  4JEY A;  1IFI A;  3ZRR A;  3FWL A;  3CC2 P;  3K5B A;  4RJ0 A;  3L75 E;  2V1P A;  4W1W A;  2DGL A;  2W7K A;  2Z9X A;  2GMU A;  4GDY A;  3GR9 A;  1QGN A;  2E74 C;  4A72 A;  2W7F A;  1M1J B;  4D6T D;  1VF5 C;  5CCH D;  2EPJ A;  3HE5 A;  2JG2 A;  1AHF A;  2FN6 A;  1L4A B;  1RE4 C;  1RV4 A;  1QVF O;  1SQQ G;  3JC2 2;  1EG5 A;  1HGZ A;  3ECD A;  3CLQ A;  1T3J A;  4H44 B;  1KKJ A;  1CQ8 A;  1D7V A;  1QEX A;  2R5D A;  2O0R A;  2ZY4 A;  1GL2 D;  2A45 H;  3MZW B;  1AMR A;  4GOF A;  4WY4 D;  3OP7 A;  2FYF A;  1FZC A;  1BGY G;  1AHX A;  3SWY A;  3D71 A;  1RF1 C;  2V0Y A;  3H1H G;  4CVQ A;  4Z1M H;  1B8G A;  3DR4 A;  3CXH H;  4DZO A;  1T6A A;  1RE3 A;  2BAS A;  3N4R A;  1UU0 A;  3HE4 B;  4JF1 A;  1KIL B;  1LT9 A;  1ZOB A;  2Q3E A;  4FL0 A;  1SQP D;  2QJK C;  3IR9 A;  1RQV A;  1MFT A;  1IK7 A;  3CWB G;  4KHX A;  3SFD C;  4J5U A;  2D61 A;  3LVL B;  4F5F A;  5GTI H;  3AEO A;  3JWA A;  2YHK A;  4AO4 A;  1S9K D;  3GMA A;  5EUD A;  3P6K A;  3RI6 A;  1NH4 A;  4W1X A;  2JJG A;  3CC7 P;  3FXE A;  3RBF A;  2NPS D;  2QM7 A;  5FT5 A;  5KJ7 D;  1GL2 B;  2FFD A;  2W8J A;  5DX5 A;  1EJI A;  3GF7 A;  3AEJ C;  4HKZ H;  2NPS C;  1OZH A;  3H1H D;  3AOV A;  3AEL A;  1K05 A;  2V7Q H;  4WLJ A;  4ZSW A;  2E76 C;  1OW7 A;  1DFO A;  3N0L A;  4F4E A;  1SP4 A;  4TN4 A;  3PHL A;  1IX8 A;  3NYU A;  4PV1 D;  3CBF A;  4ATQ A;  3Q1M A;  3BCX A;  3D6Y A;  3AEB C;  4U3F J;  3S9O A;  2BYJ A;  1KQS O;  2OTJ P;  1LC5 A;  3NDN A;  1V72 A;  4B86 A;  3TGU J;  5EUE A;  1N73 C;  1MZ9 A;  3CWB D;  4E3Q A;  3AE5 C;  2ZAE B;  4C7R A;  3AE7 C;  2FXO A;  3HBX A;  3AE6 C;  2E7U A;  1G4V A;  1KFM A;  1PL5 A;  1H1C A;  5AVY B;  1C7G A;  1DGD A;  2QJY C;  5KAF H;  1USD A;  1JNM A;  3TGU G;  5CJ0 A;  1GBN A;  1PMO A;  2KS1 B;  1YIT P;  2Z9U A;  3WKR A;  3H1J E;  1GCK A;  1KIL A;  3V4W A;  3CX5 D;  4U3F G;  1SFC C;  1OX3 A;  2HUI A;  4DT0 A;  2ZFC A;  3AEJ A;  3U59 A;  3FVX A;  2W7M A;  1QL2 A;  1LWU B;  1YJW P;  3P7K A;  2RKL A;  3II6 A;  4BRY A;  1NHL A;  1SQB J;  1SQV D;  1U7M A;  2C9L Y;  2HG5 D;  3FFR A;  1W7L A;  3A9Z A;  3HTK A;  3CMA P;  3QHX A;  1OVR A;  5KKZ B;  3A0B H;  1VPC A;  3AEC C;  2DW3 A;  1TAR A;  3AEG C;  3CAI A;  3CCM P;  1SFC A;  1VQ5 P;  1AVY A;  1LW4 A;  2P1J A;  5E4Z A;  5G4J A;  3VAX A;  1VQP P;  2VMX A;  1RF0 A;  2BIE A;  3PPL A;  1V2E A;  2L91 A;  3ZZJ A;  1NTM K;  2AXT E;  1IJD B;  1M1J C;  8AAT A;  1OVU A;  1FDO A;  1AY5 A;  3MD0 A;  3ZRP A;  1AMA A;  4H0L B;  3ABV C;  3CQ4 A;  4GOD A;  4TLF A;  3LY1 A;  2Y9Y A;  4JEV A;  3A3Y B;  2ZY5 A;  1GC3 A;  2BI5 A;  1CSB A;  3P8C D;  2VIB A;  1N2D C;  4IOI H;  1RF1 B;  3MBB A;  1H8A A;  2XZR A;  1G4X A;  1N2T A;  1VQO P;  2TPL A;  2KZJ A;  4PD4 D;  4XFJ A;  4EB5 A;  3HD7 C;  2XH1 A;  2M0B A;  2WPR A;  3LV2 A;  1KQF B;  3CCS P;  3QI6 A;  3H1K G;  3L70 G;  1RH5 B;  2HP1 A;  5G2Q A;  4BXL A;  2AY1 A;  2JR8 A;  1IFN A;  1LGH B;  4I7Z C;  4YTP C;  1BSH A;  1N7S A;  1M1K Q;  3BAS A;  2DGK A;  2VGT A;  1IVR A;  2ZY2 A;  1IFM A;  1AKC A;  3EI7 A;  1JTH B;  1OW8 A;  4XJO A;  4EMY A;  1AQT A;  2FQ6 A;  3H1K E;  3LVK A;  3VYI A;  3TDK A;  1YOO A;  1Q7Y Q;  3A5T A;  4WXB A;  1WKH A;  5DJU B;  1TOJ A;  3GHG C;  1IBJ A;  1LKC A;  2Q9I A;  1DTY A;  2EYQ A;  2Q7C A;  3RK3 D;  1D7U A;  1S5L E;  2Y0E A;  4JPZ B;  3CCR P;  4PIW A;  2O1J A;  2W90 A;  3A8U X;  5C6U A;  2PAJ A;  4WB0 B;  1GU5 A;  2O1B A;  4IL6 H;  3G8M A;  1UIX A;  3CCQ P;  2BEZ F;  2AY8 A;  1GW4 A;  1KC8 Q;  4AZK A;  2NPS A;  3Q8N A;  2BIA A;  1H0T A;  2BCC E;  4PJ0 E;  1N8P A;  1YJY A;  2CAN A;  2QIW A;  1LTG C;  2QSR A;  3K28 A;  4Q76 A;  1KYO E;  1I48 A;  4UOY A;  1FZA A;  2A06 G;  1ARS A;  1LS3 A;  4PVF A;  1YJZ A;  3L74 E;  2YCP A;  2B89 A;  2HPC A;  3S1K A;  1TOK A;  2KXP B;  1CW5 A;  2AXC A;  2A06 E;  3B5N C;  1YIY A;  5CCG A;  1KZU B;  4O9B A;  2W7G A;  1NTZ E;  4OC9 A;  3F0H A;  1KFN A;  3L74 G;  4J8L A;  3HUS C;  1SZU A;  3GWP A;  1IJI A;  1USE A;  3C9I A;  3E6G A;  1N7S C;  5EUN A;  1IZN B;  1D2F A;  4A0F A;  1M0Q A;  3UE8 A;  3RUY A;  5APX A;  1XEY A;  5F9S A;  3HQT A;  5BJ4 A;  1IFP A;  4I8A A;  4JEX A;  4RAE A;  3PH0 A;  1CQ7 A;  1KB9 I;  1GL2 C;  3FVU A;  1JY3 P;  2VMP A;  1SQB E;  2B88 A;  3I5C A;  1S3J A;  5C39 A;  1BCC D;  3L75 G;  1BKG A;  3L72 J;  3MUD A;  3AE8 C;  4N78 E;  1J1E C;  2AY5 A;  2VMV A;  5G09 A;  4HF8 A;  1HWT C;  1PGJ A;  1IAY A;  1VQM P;  2W8T A;  1OHW A;  4WY4 B;  3O8Z A;  1VP4 A;  5AVU B;  1NTK E;  4XJM A;  1CQ6 A;  4K2I A;  2EZ1 A;  3H1H J;  1WYT A;  1LK9 A;  1SQB G;  2HOY A;  1M0N A;  3PAA A;  3IN6 A;  2CJH A;  3SWF A;  1PGP A;  3A7O A;  4PFF A;  1PV3 A;  1RVY A;  2VMZ A;  3BCA A;  3WGB A;  2VGZ A;  2Z4E A;  3MAF B;  1BCC J;  4IX8 A;  4OWF A;  3V4Q A;  3G0T A;  4H44 D;  2K9Y A;  1NTK G;  2CIN A;  4F5I A;  2OAR A;  3QPG A;  3GW6 A;  1TOI A;  1ZLL A;  1I43 A;  1H89 A;  1B5O A;  4BA5 A;  1GK6 A;  1ZP0 C;  1KMK A;  2ZYA A;  3MHV A;  9AAT A;  2AXT H;  4OTL A;  1T3I A;  4D6T G;  2I1K A;  1HH0 A;  4WY4 A;  1QJ3 A;  3EIA A;  1XTC C;  3RBX A;  2D2C C;  1JY2 N;  2WIT A;  2FYU E;  1LP1 B;  5H2F E;  2CFB A;  2IYO A;  3V2P A;  3B8X A;  3R4T A;  2YIU C;  1AKA A;  3CI9 A;  2GB3 A;  4OGQ B;  4ZKP A;  2GM4 A;  4Y0I A;  1IX7 A;  2VMT A;  3NUB A;  3QN6 A;  4P7Y A;  1X9V A;  3CWB E;  1YHQ P;  1YI2 P;  2YXQ B;  1LTJ C;  4PD4 H;  2R5C A;  4U7J A;  2EH6 A;  1QGK B;  3WCO A;  1HJB A;  1FS0 E;  3M0D A;  4MQQ A;  3P8M C;  4BMK A;  3KZI H;  2IBZ G;  4M2K A;  5KLI C;  1BJO A;  2WTY A;  1FZB A;  3LG0 A;  1IX6 A;  1WYV A;  3WUT A;  1GD2 E;  4OVN F;  1LW5 A;  5AVS B;  1KQG B;  2BI1 A;  4XA4 A;  3L73 E;  1JF9 A;  1VQ7 P;  4L73 A;  4MQP A;  1GTW A;  1GEY A;  4M2J A;  2IX7 C;  3PP5 A;  4AH3 A;  4H13 B;  2O01 H;  2OQQ A;  2ZVN B;  1Y47 A;  2W6B A;  1TAT A;  1YIZ A;  1W23 A;  3W1I A;  2H89 C;  1OWA A;  2IZ0 A;  2ZYD A;  1IUG A;  2LXC B;  1SQX E;  2AY6 A;  1ZOY C;  1MAQ A;  3MAF A;  2JP3 A;  4RKD A;  1OVV A;  2QA4 P;  3WU2 E;  2FNI A;  4W1V A;  4WB0 A;  5DB5 A;  5EIG B;  3WX9 A;  3L73 G;  4PV1 C;  1W5C E;  3NX3 A;  3AEN B;  4RJY A;  3BN1 A;  2ZT9 B;  5B5E H;  2OAT A;  3EFF K;  4R2N A;  1N73 B;  4C7N B;  5AVX B;  1S0A A;  2P67 A;  3PD6 A;  1H0T B;  1AIA A;  1SQX K;  1J2J B;  3O6Q A;  4AO9 A;  2WMM A;  2VGU A;  3LID A;  1E79 H;  2KK7 A;  1SQX G;  1O69 A;  3IHJ A;  2WK8 A;  4IYO A;  1Z3Z A;  1JB0 J;  1JOC A;  3SFE C;  2M5A B;  1M56 D;  3O6Q B;  4OGQ C;  2G7J A;  3A9Y A;  4KT0 J;  3CQ6 A;  1JMB A;  2KI7 B;  1NOH A;  2VGV A;  2G8Y A;  1NU1 D;  3P1T A;  1T2K C;  4F5G A;  1G2C A;  1FC4 A;  1KYO H;  4BRY B;  3AE3 C;  3KGX A;  3RL0 C;  2A1V A;  3Q5S A;  2WK7 A;  3LW5 H;  1CL1 A;  2E54 A;  2D64 A;  3UIA A;  2YRI A;  3H9X A;  1JMM A;  1O4S A;  3HD7 D;  1T2K D;  3F6T A;  1SFC B;  2W83 C;  4Y28 J;  3HLM A;  3QBO A;  4XJP A;  2E75 C;  4RKC A;  2FM1 A;  4BQ0 A;  4ZAH A;  1WYU A;  1AHE A;  4GRX A;  2WSE J;  3HE5 B;  3JCU E;  1V2D A;  3D6K A;  3DXV A;  2JDI H;  2HOR A;  3M9H A;  2AY2 A;  1AJY A;  1AHG A;  4ASW A;  4RIZ A;  2XBN A;  1D7M A;  1G2C B;  1PFF A;  1M8O B;  4ASV A;  3T97 B;  3HL2 A;  4H0L C;  1YBK A;  2GUS A;  1JTH A;  2Z1Z A;  1WYT B;  1Z56 A;  1LTB C;  2NRG A;  4D6T J;  1FG7 A;  3VK4 A;  3FGA D;  1PZQ A;  2W6J H;  1BGY E;  2BWN A;  1L0L D;  5G0A A;  5APW A;  4UHM A;  1KOR A;  2YKV A;  3N5M A;  2Q1K A;  2W6A A;  2H8P D;  5AW6 B;  1X79 B;  2D65 A;  3BCB A;  3CXH D;  2K37 A;  3KQG A;  3ELP A;  2WT7 A;  2YKY A;  4JQ0 D;  2CK3 H;  1M4N A;  4LNL A;  1QJ5 A;  1TPL A;  4PFN A;  4XJL A;  2WPV B;  5CMZ A;  2QE7 H;  4NPE A;  3UWC A;  2C0R A;  3H7F A;  1M7Y A;  3L8A A;  1ECX A;  1HTL C;  3K7Y A;  3E2F A;  3N7N A;  1N7S D;  1QLE D;  1E5W A;  1J04 A;  2BI3 A;  3KPE A;  1ASA A;  2H88 C;  1VQ4 P;  4BA4 A;  1JY2 P;  3B4S A;  1KIL D;  2FFD B;  3FZ6 A;  1NKN A;  3MAU A;  2YKU A;  3CX5 H;  2FYU J;  1L0N K;  1L0L G;  1AY8 A;  4GIF A;  2HPC B;  2AY9 A;  2N1T B;  3AOW A;  4A00 A;  2BI2 A;  3H1K J;  1X29 A;  3N75 A;  1R5S A;  1PIX A;  3AED C;  1LTS C;  2ZT9 C;  3BRT B;  2L5G B;  4OYT A;  3Q5P A;  5DJ1 A;  1W2B O;  4GE4 A;  1C4K A;  1NU1 K;  1C9C A;  5M46 A;  4LGD E;  3B46 A;  5APV A;  4UHN A;  1DIP A;  3FZ7 A;  3R2P A;  5AW3 B;  1GDT A;  5APU A;  3NU7 A;  2R32 A;  5KJ7 C;  1GU4 A;  2N1T A;  5FT8 A;  3PRJ A;  2PFX A;  3IF4 A;  1SLQ A;  3SSU A;  3QH9 A;  1SQV E;  4IFM A;  3JW9 A;  4ZDP A;  3H1J G;  2OYH C;  1XI9 A;  3B5N B;  1L4A D;  2KIK A;  1RE3 C;  2OGU A;  4LC3 A;  2WPQ A;  2M3B A;  5CHX A;  1WMK A;  3WUU A;  3OW2 O;  4NPD A;  3BC8 A;  2QJK B;  2ZUK A;  5KKZ C;  5AVW B;  3G6E P;  1S09 A;  5CBN A;  2W8Z A;  2UWJ E;  3PDX A;  4WYC A;  1P84 H;  5J8Q A;  2K1A A;  3VTP C;  3H1J J;  2P58 A;  3TSI A;  3CC4 P;  1FZE A;  2WWW A;  2CY8 A;  4ITX A;  3NXS A;  1OXO A;  1KMI Z;  2FKI A;  3TAT A;  5CCH A;  1VJO A;  3FFH A;  2RMZ A;  3MGN A;  5B66 H;  1L4A C;  2QJY B;  2FBW C;  3B1C A;  1SQP J;  2E76 D;  1PP9 D;  2N9B A;  3FQ8 A;  1SF2 A;  2ORD A;  3PDB B;  3WKS A;  4F5L A;  2AEF A;  2QM8 A;  5BU5 A;  4ZWV A;  2D66 A;  2C44 A;  1DD3 A;  4D6T E;  3Q2Y A;  3V2Q A;  4WXF A;  3NUI A;  2FYU G;  3N4X A;  3A2B A;  3AEM C;  4E3R A;  1KKP A;  2BCC D;  1S06 A;  4RLG A;  2XDJ A;  3H32 A;  3OAK A;  4YXD C;  5KAI H;  3BVH A;  1P84 D;  3AE4 C;  2QVA A;  1L0N G;  3A0B E;  2C81 A;  1AA0 A;  3PLN A;  3RL0 g;  3HT4 A;  3L36 A;  2YOB A;  1N31 A;  2OTK E;  1A02 F;  1YAA A;  1H88 A;  1AY4 A;  2Z9V A;  4A0H A;  1ASB A;  1UU1 A;  2XV5 A;  5BVZ A;  4K05 A;  4CBS A;  3FX0 A;  3F5H A;  4OBU A;  1ZRT D;  4H13 D;  1ART A;  1N8R Q;  3RCH B;  2YCN A;  5AW2 B;  2R5E A;  3H32 B;  4IY7 A;  2WSC J;  3DZZ A;  4E77 A;  1X22 A;  1Y9B A;  1W7N A;  1VF5 B;  5EAV A;  1KYO I;  3KYQ A;  2IBZ D;  4AUW A;  3M06 A;  3FWN A;  2ZT9 D;  4AYC A;  2HOD B;  3U1C A;  1FZF A;  1VQ8 P;  2C7T A;  2OYH B;  2KUB A;  2KNC B;  5G4I A;  3CME P;  1B9H A;  2D7Y A;  2WKA A;  2W7I A;  5KLV D;  2NZ2 A;  7AAT A;  3GET A;  1JS3 A;  3KE3 A;  4GE7 A;  3FRK A;  2AY4 A;  4YXW H;  3MC6 C;  1ZC9 A;  1BCC G;  3L75 D;  4UB8 E;  5EFW B;  1NWQ A;  1AIC A;  3LVM A;  2KSE A;  2WSS H;  1L2P A;  1VEF A;  3E77 A;  2QJP B;  4XAU A;  3NYT A;  4WB4 A;  5K5G B;  1M57 D;  3L72 G;  4O6Z A;  3E2Z B;  3GHG A;  2YCT A;  2JWD A;  2E7I A;  3VOM A;  2DGM A;  4QMA A;  5CJ4 A;  1BE3 J;  1BDD A;  4XE5 B;  2ZXX A;  1BGY D;  2LXB A;  3MP7 B;  4ZKU A;  5EQC A;  2HZP A;  1GW3 A;  2YNY A;  1ASL A;  2M8R A;  2N1T D;  1NTK D;  3UAK A;  2FY8 A;  1JUN A;  4W8I A;  4A6U A;  2O01 J;  4H0L D;  2W7E A;  3F9T A;  1NAY A;  2ZY3 A;  5TIS H;  2KP8 A;  3AEA C;  1M6S A;  3L71 G;  1DJ9 A;  2E75 B;  2ZC0 A;  5BJ3 A;  1FZG A;  1VQK P;  1MLY A;  1HJ0 A;  1E5E A;  2YO2 A;  3H1L G;  3FTB A;  1V2F A;  4L74 A;  3H6P A;  4ZM4 A;  4KXK A;  4KYO A;  3NYS A;  4WVZ A;  3E2Z A;  1B5P A;  3H1H E;  4I6M C;  5KLI B;  1SQP E;  3L72 D;  1AAW A;  1JY2 O;  3H1I E;  3GJU A;  1WYV B;  1WST A;  3MC6 A;  3I5T A;  3KKI A;  2ZYJ A;  2JO1 A;  2KZI A;  2HOD A;  3G71 P;  1NTM G;  1ASM A;  4CXQ A;  3BAT A;  3B71 A;  2YKX A;  1URQ B;  4XK1 A;  3RK2 B;  2E74 D;  1M0P A;  5D5S A;  4F5K A;  2DOU A;  5L8R J;  5E79 H;  1FDI A;  1LT9 B;  1SQQ E;  3BRV B;  2YO3 A;  1KQL A;  4ZWM A;  1GZL A;  1N7S B;  4GSA A;  2DKJ A;  1SQB K;  1Y4I A;  1GD9 A;  1ARI A;  1IC2 A;  3BCC J;  1MAP A;  4JEW A;  5EAA A;  3V2N A;  2R3S A;  3HUS B;  5CCG C;  1M1J A;  4LNJ A;  5AW9 B;  2QEX P;  3L71 D;  3CCJ P;  3DOD A;  1LTJ B;  1VL2 A;  2IFN A;  4GOE A;  1MDZ A;  5AW7 B;  3EFG A;  5M4D A;  2I8D A;  2Z9W A;  2VLF A;  1SQQ J;  1MKM A;  1LWU C;  2HOX A;  2VGW A;  5GTI E;  2K3R A;  2B9B A;  4EIJ A;  3GZD C;  1JS6 A;  1MDX A;  4A0G A;  1FOS F;  1M0O A;  3DXW A;  3L73 D;  2Z1Y A;  4W7Z A;  1ZW0 A;  1NTM D;  3MTU E;  1CL2 A;  2CH2 A;  3NRA A;  4LNM A;  2ZSL A;  4L76 A;  2OKK A;  5M4B A;  1URQ D;  4DQ6 A;  2E74 B;  3HDO A;  2VMU A;  1T8Z A;  4MQR A;  1AFO A;  4OH8 B;  1VDF A;  2QG4 A;  4K35 A;  4N3Y B;  1MFZ A;  4Y0H A;  1MDO A;  3PJ0 A;  2IBZ I;  3AV7 A;  4M3L A;  1FAV A;  1NU1 E;  3V5B A;  1SVF A;  2IPP A;  1EXI A;  1FJK A;  1X2A A;  2M3E A;  1NVO A;  2V7Q J;  3E7K A;  2Q6Q A;  1SZK A;  2ZP7 A;  1K8A Q;  3AE2 C;  5E5I A;  2W7H A;  4R4M A;  1URQ A;  2KS1 A;  2D2C D;  4TT3 H;  3EI5 A;  1FZC B;  3ASB A;  1J1D C;  2CTZ A;  1R8E A;  2W7D A;  5AX8 A;  2IYP A;  3IFM A;  5GTH E; 
#chains in the Genus database with same CATH homology
 2GUV A;  1LC7 A;  2KFP A;  3FVS A;  5K8B A;  2CB1 A;  2VMO A;  1BQA A;  3GSB A;  2BKW A;  2X8U A;  5CCH C;  1LTJ A;  3BV0 A;  5KTB A;  5BU8 B;  4WBA A;  2IFM A;  4C46 A;  4DGT A;  2WPS A;  2D5Y A;  1LWU A;  1MLZ A;  1JO5 A;  2VMQ A;  4WD2 A;  1WKG A;  2HUU A;  1AJR A;  3L35 A;  4AZJ A;  4DOJ A;  1AX4 A;  1MV8 A;  3NTN A;  1A02 J;  4Q75 A;  3HD7 A;  3B8E B;  2XU6 A;  4CBR A;  5E3K A;  1QZ9 A;  2GMS A;  3AEM A;  3M5U A;  1BJN A;  2HOZ A;  3KGW A;  4H63 Q;  1FZC C;  1IAX A;  4OCA A;  2OQX A;  1QIT A;  3I4J A;  3TNU B;  3BS8 A;  1BJW A;  4ISY A;  4JF7 A;  1SZS A;  1ZN5 A;  4LW2 A;  1B9I A;  1I41 A;  1RY3 A;  4I1L A;  5CCG D;  2R2N A;  3FKD A;  2ZSM A;  2BWO A;  3VK3 A;  4WYA A;  4WYG A;  1W3U A;  1FOS E;  3FDB A;  4K2M A;  1BQD A;  4JF0 A;  2POH A;  3NMD A;  1DJE A;  2J58 A;  1AJS A;  1HUC A;  2W8U A;  5HDM A;  1GC4 A;  4H51 A;  4HVK A;  2WSE H;  5G2P A;  2VIA A;  3B5N D;  4R5F A;  1CZC A;  1M32 A;  2HFE D;  5KJ7 A;  3ELE A;  4RES B;  2D7Z A;  1ZOD A;  1LTT C;  2HLO A;  1J1E B;  1L0L K;  2W8V A;  4ADC A;  1SPA A;  3P8C E;  1WRG A;  2P7J A;  2Z5I A;  5AVZ B;  1ASE A;  4HH2 A;  4AQR D;  2OKJ A;  4MSO A;  1ZR2 A;  1ELU A;  1IK9 A;  4IXO A;  2P2U A;  3LIE A;  1DJU A;  1SVV A;  4ADD A;  2WZ7 A;  3RK3 C;  3TK1 A;  4MKJ A;  1UU2 A;  3NNK A;  2OGE A;  2AY7 A;  4GKG A;  2VGS A;  1G1I A;  1ZR4 A;  3M0D C;  4IFD K;  2Z61 A;  4W7Y A;  1FDM A;  1DKA A;  3BWN A;  3BWO A;  2E43 A;  1CI6 B;  2VMN A;  3ISL A;  2QLR A;  2KB7 P;  4XEW A;  5FT4 A;  1LT9 C;  2I1J A;  1H0C A;  1CZE A;  4F5M A;  1X0M A;  2A45 G;  3R9A A;  2CJG A;  1D7R A;  2PB2 A;  3EQ2 A;  4OBV A;  2WB6 A;  2F8J A;  3GZC A;  5FT6 A;  1L4A A;  1B4X A;  2DKB A;  3MAD A;  2X3L A;  1ELQ A;  1GC2 A;  2JIS A;  4P3M A;  4K2B A;  4UQV A;  1PMM A;  2YMY A;  1BW0 A;  4OT8 A;  4ADB A;  2ZXE B;  2H43 A;  3B1E A;  1J32 A;  2Q3I A;  1SFF A;  2VMS A;  3I16 A;  3RBL A;  2VMY A;  3VMZ A;  3LWS A;  4EB7 A;  3COG A;  2FXM A;  1IFD A;  3EZ1 A;  2YKP A;  2KSJ A;  3JZL A;  1QIS A;  2OGA A;  2R5B A;  1ASG A;  2Q7W A;  3HMU A;  2QMA A;  3WLX A;  4LC1 A;  2BWP A;  4WYD A;  2CPB A;  3RK2 C;  4IXS A;  4FFC A;  2AY3 A;  4RIT A;  3A2A A;  4NOG A;  1AMS A;  2YRR A;  2FKW B;  2GQN A;  1AIB A;  1BJ4 A;  2HP2 A;  4Y0D A;  1LC8 A;  3L44 A;  4E1O A;  1BS0 A;  1C7O A;  2OYH A;  2JJF A;  2VLH A;  3MKJ A;  1XTG B;  1KL2 A;  4EOT A;  4ZAS A;  1KIL C;  3BB8 A;  2MJZ A;  3WY7 A;  5APS A;  2E7J A;  3EI6 A;  1G7X A;  1FG3 A;  4ZDL A;  1OHV A;  3E9K A;  2QA3 A;  1W7M A;  1NAF A;  1N7L A;  2YKO A;  2BIG A;  3M9Q A;  1DX7 A;  2EGY A;  3JTX A;  4B98 A;  2AEU A;  5HXX A;  5EIG A;  1JY3 N;  4ADE A;  3AEN A;  3RK3 B;  1E5F A;  2BYL A;  1AAM A;  1DH3 A;  2HYN A;  4QGR A;  3ATH A;  2CJD A;  1YTZ T;  1NTK K;  3M0A A;  3LVJ A;  1DEB A;  2NPS B;  1S08 A;  5JAY A;  1AQ5 A;  3L4F A;  1YYC A;  4IW7 A;  4ZM3 A;  1IFJ A;  1G1J A;  4JYC A;  3RL0 B;  5D95 A;  2R0T A;  3TFU A;  1J1D B;  3G7Q A;  3E2Y A;  1RF1 A;  2CH1 A;  2C0W A;  3T32 A;  4GT1 A;  5AW1 B;  3VP6 A;  4LW4 A;  1GDE A;  4GEB A;  4CXR A;  2JJH A;  3A9X A;  2WK9 A;  1OAT A;  1PG8 A;  3ZRQ A;  5AW5 B;  1ASF A;  5I92 A;  1JY3 O;  2A45 I;  3TCM A;  3HTK B;  5M49 A;  2W7J A;  3VMY A;  5F8V A;  1BJO B;  5APQ A;  3RCH A;  4ZSY A;  2XNX A;  3RQ1 A;  4A6T A;  1X8Y A;  3K40 A;  4M2M A;  3FZ8 A;  2N1T C;  4KAM A;  1GC0 A;  3EZS A;  3PIU A;  1TOE A;  1QL1 A;  1FU1 A;  4BHD A;  3GHG B;  1S9K E;  2FYZ A;  3VN0 A;  1RE4 A;  3EUC A;  3CQ5 A;  3PA9 A;  3PGY A;  2LKM A;  2CPS A;  3II0 A;  2G6W A;  1U08 A;  1FBM A;  4L0O A;  2Z5H A;  4LLH A;  1O61 A;  1G7W A;  5AVV B;  4A6R A;  4WYE A;  4F5J A;  1C7N A;  4WP0 A;  2BHX A;  4XQ2 A;  2VYC A;  1MGV A;  1MUU A;  1NO4 A;  2C9N Y;  1S07 A;  5AVT B;  3HE4 A;  3QM2 A;  1SFC D;  3E1I A;  3OKS A;  3USF A;  3W1J A;  1GEX A;  2WSF H;  1RVU A;  4WBT A;  3HRN A;  3DYD A;  3M9B A;  1YJS A;  4MKK A;  2FNU A;  5AW4 B;  2JEE A;  2HUF A;  3OJA B;  1TOG A;  3EIB A;  3VP9 A;  3NU8 A;  3OA7 A;  1NTZ K;  1RV3 A;  1SQV K;  1CI6 A;  1CS1 A;  3B1D A;  1HVV A;  1P3W A;  2WSC H;  4JEZ A;  4EFF A;  3B5N A;  3V2R A;  4R5Z A;  1OXZ A;  5APY A;  2KOG A;  3T97 A;  3DR7 A;  4OMA A;  1X28 A;  5TF5 A;  1GK4 A;  3WGC A;  4ZDO A;  2O1K A;  2YKQ A;  3NTJ A;  2J59 M;  3WMM 0;  5AW0 B;  3PDB A;  3CL3 D;  1NKZ B;  1YTZ I;  3WZF A;  1AKB A;  2C0X A;  3WCN A;  3FCR A;  1GEW A;  4C7N A;  1N73 A;  1EQB A;  3PD6 B;  3M91 A;  3G3Z A;  4U1T A;  4DBC A;  4W5K A;  1ORD A;  4R8D A;  4W80 A;  2W8W A;  4EU1 A;  3N4S A;  2KLV A;  5KLV K;  3VMX A;  2VRS A;  4MY5 A;  3MEB A;  5AVQ B;  4N0W A;  4WLH A;  3ZZK A;  2JJL A;  1OXP A;  4WXG A;  2VMW A;  2KYV A;  3TFT A;  5AVR B;  2EO5 A;  1WT6 A;  1N86 A;  1HGV A;  4U2H A;  5AW8 B;  2EZ2 A;  1SQP K;  2QB2 A;  1BT4 A;  2O7C A;  3GZD A;  4WY4 C;  3FD0 A;  1M7L A;  1KL1 A;  1RF0 C;  1Z7D A;  2VI8 A;  5APT A;  4N78 D;  2RFV A;  2X5D A;  1T3U A;  2Q5U A;  3DC1 A;  3L37 A;  3TYY A;  1ASN A;  1D7S A;  3FQA A;  1IO4 A;  2PO3 A;  4IFF A;  3FQ7 A;  3HUS A;  3GBX A;  2JJE A;  1AHY A;  3RL0 D;  1URQ C;  4F5H A;  3HD7 B;  4I2L C;  4GE9 A;  1CZQ A;  2OYI B;  1YNU A;  3W1H A;  3JWB A;  1JCC A;  1HBW A;  2AEV A;  4UHO A;  3BWN C;  1JCD A;  2CST A;  1AJS B;  2Z20 A;  3HVY A;  1LTA C;  3FDD A;  4N6J A;  1LTI C;  1ASC A;  3MIW A;  3EI8 A;  5IWQ A;  1EQ7 A;  1GL2 A;  2GSA A;  2OYI C;  2FYU K;  2NMP A;  5DJ9 A;  2FFD C;  1C0N A;  1OHY A;  1QIR A;  2ZJG A;  1ZV8 A;  2E42 A;  3TQX A;  5HHY A;  3KDP B;  1ARG A;  3AAT A;  3TNU A;  4IYO B;  4Y99 C;  4ITG A;  2BI9 A;  1ASD A;  4HYT B;  1JG8 A;  4RM1 A;  4JYB A;  4B9B A;  2XKM A;  3DRD A;  4ZLV A;  2R3C A;  3DU4 A;  4IXZ A;  3ACZ A;  1FJP A;  3NFQ A;  5EFS A;  1I29 A;  1AMQ A;  2DR1 A;  2H7H A;  4TMR A;  1WYU B;  4W91 A;  1CJ0 A;  3AEP A;  2VMR A;  1DGE A;  2QB3 A;  4Q6R A;  1PFI A;  2OYI A;  2AAT A;  4ATP A;  2R5C B;  2VI9 A;  2QBT A;  3P32 A;  1KMJ A;  3VK2 A;  3VP8 A;  3EI9 A;  3VOP A;  2D63 A;  3FSL A;  1UKJ A;  4Y99 B;  4AOA A;  1W2E A;  1TAS A;  2W7L A;  2JGT A;  3RK2 D;  2PB0 A;  2PP6 A;  4WYF A;  2W27 A;  1O62 A;  2WT7 B;  1SQQ K;  2X5F A;  3ASA A;  4Q31 A;  4A0R A;  4JEY A;  3QGU A;  3U1A A;  1ARH A;  3ZRR A;  1IFI A;  4RJ0 A;  2V1P A;  4W1W A;  2DGL A;  2W7K A;  2Z9X A;  2GMU A;  4GDY A;  3GR9 A;  1QGN A;  4A72 A;  2W7F A;  1M1J B;  5CCH D;  2EPJ A;  3HE5 A;  2JG2 A;  1AHF A;  2FN6 A;  1L4A B;  1RE4 C;  1RV4 A;  1EG5 A;  1HGZ A;  3ECD A;  3CLQ A;  1T3J A;  1KKJ A;  1CQ8 A;  1D7V A;  2R5D A;  2O0R A;  2ZY4 A;  1GL2 D;  2A45 H;  4WY4 D;  1AMR A;  3OP7 A;  2FYF A;  1FZC A;  1AHX A;  3SWY A;  1RF1 C;  2V0Y A;  4CVQ A;  1B8G A;  3DR4 A;  4DZO A;  2BAS A;  1RE3 A;  3N4R A;  1UU0 A;  3HE4 B;  4JF1 A;  1KIL B;  1LT9 A;  1ZOB A;  4FL0 A;  3IR9 A;  4KHX A;  4J5U A;  2D61 A;  3LVL B;  4F5F A;  3AEO A;  3JWA A;  2YHK A;  4AO4 A;  1S9K D;  5EUD A;  3P6K A;  3RI6 A;  1NH4 A;  4W1X A;  2JJG A;  3RBF A;  2NPS D;  2QM7 A;  5FT5 A;  5KJ7 D;  1GL2 B;  2FFD A;  2W8J A;  5DX5 A;  1EJI A;  3AEJ C;  2NPS C;  3AOV A;  3AEL A;  4WLJ A;  4ZSW A;  1DFO A;  3N0L A;  4F4E A;  1SP4 A;  4TN4 A;  1IX8 A;  3NYU A;  3CBF A;  4ATQ A;  3BCX A;  2BYJ A;  1LC5 A;  3NDN A;  1V72 A;  4B86 A;  5EUE A;  1N73 C;  1MZ9 A;  4E3Q A;  4C7R A;  3HBX A;  2E7U A;  1G4V A;  1KFM A;  1H1C A;  5AVY B;  1C7G A;  1DGD A;  1JNM A;  5CJ0 A;  1GBN A;  1PMO A;  3WKR A;  2Z9U A;  1GCK A;  1KIL A;  3V4W A;  1SFC C;  2HUI A;  2ZFC A;  3AEJ A;  3U59 A;  3FVX A;  2W7M A;  1QL2 A;  1LWU B;  3P7K A;  3II6 A;  1NHL A;  2C9L Y;  2HG5 D;  3FFR A;  1W7L A;  3A9Z A;  3HTK A;  3QHX A;  1VPC A;  1TAR A;  3CAI A;  1SFC A;  1LW4 A;  2P1J A;  5E4Z A;  5G4J A;  3VAX A;  2VMX A;  1RF0 A;  2BIE A;  3PPL A;  1V2E A;  3ZZJ A;  1NTM K;  1IJD B;  1M1J C;  8AAT A;  1AY5 A;  3MD0 A;  3ZRP A;  1AMA A;  3CQ4 A;  3LY1 A;  4JEV A;  3A3Y B;  2ZY5 A;  1GC3 A;  2BI5 A;  1CSB A;  3P8C D;  2VIB A;  1N2D C;  1RF1 B;  3MBB A;  1H8A A;  2XZR A;  1G4X A;  1N2T A;  2TPL A;  4EB5 A;  3HD7 C;  2XH1 A;  2WPR A;  3LV2 A;  3QI6 A;  2HP1 A;  5G2Q A;  2AY1 A;  1IFN A;  1LGH B;  1N7S A;  3BAS A;  2DGK A;  2VGT A;  1IVR A;  2ZY2 A;  1IFM A;  1AKC A;  3EI7 A;  1JTH B;  4XJO A;  4EMY A;  2FQ6 A;  3LVK A;  3VYI A;  1YOO A;  3A5T A;  4WXB A;  1WKH A;  1TOJ A;  3GHG C;  1IBJ A;  1LKC A;  2Q9I A;  1DTY A;  2EYQ A;  2Q7C A;  3RK3 D;  1D7U A;  4PIW A;  2O1J A;  3A8U X;  5C6U A;  2PAJ A;  4WB0 B;  1GU5 A;  2O1B A;  3G8M A;  2AY8 A;  1GW4 A;  4AZK A;  2NPS A;  3Q8N A;  2BIA A;  1N8P A;  1YJY A;  2CAN A;  1LTG C;  2QSR A;  3K28 A;  4Q76 A;  1I48 A;  4UOY A;  1FZA A;  1ARS A;  1LS3 A;  4PVF A;  1YJZ A;  2YCP A;  2HPC A;  1TOK A;  1CW5 A;  3B5N C;  1YIY A;  5CCG A;  1KZU B;  4O9B A;  2W7G A;  4OC9 A;  3F0H A;  1KFN A;  4J8L A;  3HUS C;  1SZU A;  3GWP A;  3C9I A;  1IJI A;  3E6G A;  1N7S C;  5EUN A;  1D2F A;  4A0F A;  1M0Q A;  3UE8 A;  3RUY A;  5APX A;  1XEY A;  5F9S A;  3HQT A;  5BJ4 A;  4I8A A;  4JEX A;  4RAE A;  1CQ7 A;  3FVU A;  1GL2 C;  1JY3 P;  2VMP A;  3I5C A;  1BKG A;  3MUD A;  4N78 E;  1J1E C;  2AY5 A;  2VMV A;  5G09 A;  4HF8 A;  1HWT C;  1IAY A;  2W8T A;  1OHW A;  4WY4 B;  3O8Z A;  1VP4 A;  5AVU B;  4XJM A;  1CQ6 A;  4K2I A;  2EZ1 A;  1WYT A;  1LK9 A;  2HOY A;  1M0N A;  3PAA A;  2CJH A;  3SWF A;  3A7O A;  4PFF A;  1RVY A;  2VMZ A;  3BCA A;  3WGB A;  2VGZ A;  2Z4E A;  3MAF B;  4IX8 A;  3V4Q A;  3G0T A;  2CIN A;  4F5I A;  2OAR A;  3QPG A;  1TOI A;  1ZLL A;  1I43 A;  1H89 A;  1B5O A;  4BA5 A;  1GK6 A;  1KMK A;  9AAT A;  4OTL A;  1T3I A;  3EIA A;  2I1K A;  1HH0 A;  4WY4 A;  1QJ3 A;  1XTC C;  1JY2 N;  2WIT A;  2CFB A;  3V2P A;  3B8X A;  3R4T A;  1AKA A;  3CI9 A;  2GB3 A;  4ZKP A;  2GM4 A;  4Y0I A;  1IX7 A;  2VMT A;  3NUB A;  3QN6 A;  4P7Y A;  1X9V A;  1LTJ C;  2R5C A;  2EH6 A;  3WCO A;  1HJB A;  3M0D A;  4MQQ A;  3P8M C;  4BMK A;  4M2K A;  1BJO A;  2WTY A;  1FZB A;  3LG0 A;  1IX6 A;  1WYV A;  1GD2 E;  1LW5 A;  5AVS B;  2BI1 A;  4XA4 A;  1JF9 A;  4MQP A;  1GTW A;  1GEY A;  4M2J A;  2IX7 C;  3PP5 A;  4AH3 A;  2O01 H;  2W6B A;  1TAT A;  1YIZ A;  1W23 A;  3W1I A;  1OWA A;  1IUG A;  2AY6 A;  1MAQ A;  3MAF A;  4RKD A;  2FNI A;  4W1V A;  4WB0 A;  5DB5 A;  3WX9 A;  5EIG B;  3NX3 A;  3AEN B;  4RJY A;  3BN1 A;  2OAT A;  4R2N A;  4C7N B;  1N73 B;  5AVX B;  1S0A A;  2P67 A;  3PD6 A;  1SQX K;  1J2J B;  1AIA A;  4AO9 A;  2VGU A;  3LID A;  1O69 A;  3IHJ A;  2WK8 A;  4IYO A;  1Z3Z A;  1JOC A;  2G7J A;  3A9Y A;  3CQ6 A;  1NOH A;  2VGV A;  3P1T A;  1T2K C;  4F5G A;  1G2C A;  1FC4 A;  3KGX A;  3RL0 C;  2A1V A;  2WK7 A;  3LW5 H;  1CL1 A;  2E54 A;  2D64 A;  3UIA A;  2YRI A;  3H9X A;  1JMM A;  1O4S A;  3HD7 D;  1T2K D;  3F6T A;  1SFC B;  3HLM A;  3QBO A;  4XJP A;  4RKC A;  2FM1 A;  4BQ0 A;  4ZAH A;  1WYU A;  1AHE A;  4GRX A;  3HE5 B;  1V2D A;  3D6K A;  3DXV A;  2HOR A;  3M9H A;  2AY2 A;  1AHG A;  4RIZ A;  2XBN A;  1PFF A;  1G2C B;  3HL2 A;  2GUS A;  1JTH A;  2Z1Z A;  1WYT B;  1Z56 A;  1LTB C;  1FG7 A;  3VK4 A;  2BWN A;  5G0A A;  5APW A;  4UHM A;  2YKV A;  3N5M A;  2W6A A;  2H8P D;  5AW6 B;  1X79 B;  2D65 A;  3BCB A;  3KQG A;  3ELP A;  2WT7 A;  2YKY A;  1M4N A;  4LNL A;  1QJ5 A;  1TPL A;  4PFN A;  4XJL A;  5CMZ A;  3UWC A;  2C0R A;  3H7F A;  1M7Y A;  3L8A A;  1ECX A;  1HTL C;  3K7Y A;  3E2F A;  3N7N A;  1N7S D;  1E5W A;  1J04 A;  2BI3 A;  3KPE A;  1ASA A;  4BA4 A;  1JY2 P;  1KIL D;  2FFD B;  3FZ6 A;  1NKN A;  3MAU A;  2YKU A;  1L0N K;  2HPC B;  1AY8 A;  4GIF A;  3AOW A;  2AY9 A;  2N1T B;  4A00 A;  2BI2 A;  1X29 A;  3N75 A;  1LTS C;  3BRT B;  2L5G B;  4OYT A;  5DJ1 A;  4GE4 A;  1C4K A;  1NU1 K;  1C9C A;  5M46 A;  4LGD E;  3B46 A;  5APV A;  4UHN A;  3FZ7 A;  3R2P A;  5AW3 B;  1GDT A;  5APU A;  3NU7 A;  2R32 A;  5KJ7 C;  1GU4 A;  2N1T A;  5FT8 A;  1SLQ A;  4IFM A;  3JW9 A;  4ZDP A;  2OYH C;  1XI9 A;  3B5N B;  1L4A D;  1RE3 C;  4LC3 A;  2WPQ A;  2M3B A;  5CHX A;  3BC8 A;  2ZUK A;  5AVW B;  1S09 A;  3PDX A;  4WYC A;  5J8Q A;  3VTP C;  3TSI A;  1FZE A;  2WWW A;  2CY8 A;  4ITX A;  3NXS A;  1OXO A;  2FKI A;  3TAT A;  5CCH A;  1VJO A;  3FFH A;  3MGN A;  1L4A C;  3B1C A;  2N9B A;  3FQ8 A;  1SF2 A;  2ORD A;  3PDB B;  3WKS A;  4F5L A;  2QM8 A;  5BU5 A;  4ZWV A;  2D66 A;  2C44 A;  3V2Q A;  4WXF A;  3NUI A;  3N4X A;  3A2B A;  3AEM C;  4E3R A;  1KKP A;  1S06 A;  4RLG A;  2XDJ A;  3H32 A;  3OAK A;  3BVH A;  2C81 A;  3HT4 A;  3L36 A;  2YOB A;  1N31 A;  1A02 F;  1YAA A;  1H88 A;  1AY4 A;  2Z9V A;  4A0H A;  1ASB A;  1UU1 A;  2XV5 A;  5BVZ A;  4K05 A;  4CBS A;  4OBU A;  1ART A;  3RCH B;  2YCN A;  5AW2 B;  2R5E A;  3H32 B;  4IY7 A;  3DZZ A;  4E77 A;  1W7N A;  5EAV A;  3KYQ A;  4AUW A;  3M06 A;  4AYC A;  3U1C A;  2HOD B;  2C7T A;  1FZF A;  2OYH B;  5G4I A;  1B9H A;  2D7Y A;  2WKA A;  2W7I A;  7AAT A;  3GET A;  1JS3 A;  3KE3 A;  4GE7 A;  3FRK A;  2AY4 A;  3MC6 C;  1ZC9 A;  1NWQ A;  1AIC A;  3LVM A;  1VEF A;  3E77 A;  4XAU A;  3NYT A;  4WB4 A;  4O6Z A;  3E2Z B;  3GHG A;  2YCT A;  2E7I A;  3VOM A;  2DGM A;  5CJ4 A;  4XE5 B;  4ZKU A;  5EQC A;  2HZP A;  1GW3 A;  2YNY A;  2M8R A;  1ASL A;  2N1T D;  3UAK A;  1JUN A;  4W8I A;  4A6U A;  2W7E A;  3F9T A;  2ZY3 A;  2KP8 A;  1M6S A;  1DJ9 A;  2ZC0 A;  5BJ3 A;  1FZG A;  1MLY A;  1E5E A;  2YO2 A;  3FTB A;  1V2F A;  3H6P A;  4ZM4 A;  4KXK A;  4KYO A;  3NYS A;  3E2Z A;  1B5P A;  4I6M C;  1AAW A;  1JY2 O;  3GJU A;  1WYV B;  1WST A;  3MC6 A;  3I5T A;  3KKI A;  2ZYJ A;  2HOD A;  4CXQ A;  1ASM A;  3BAT A;  4XK1 A;  2YKX A;  1URQ B;  3RK2 B;  1M0P A;  5D5S A;  4F5K A;  2DOU A;  1LT9 B;  3BRV B;  2YO3 A;  1KQL A;  4ZWM A;  1GZL A;  1N7S B;  4GSA A;  2DKJ A;  1SQB K;  1Y4I A;  1GD9 A;  1ARI A;  1IC2 A;  1MAP A;  5EAA A;  4JEW A;  3V2N A;  3HUS B;  5CCG C;  1M1J A;  4LNJ A;  5AW9 B;  3DOD A;  1LTJ B;  2IFN A;  1MDZ A;  5AW7 B;  3EFG A;  5M4D A;  2Z9W A;  2VLF A;  1LWU C;  2HOX A;  2VGW A;  4EIJ A;  3GZD C;  1JS6 A;  1MDX A;  4A0G A;  1FOS F;  1M0O A;  3DXW A;  2Z1Y A;  4W7Z A;  2CH2 A;  3MTU E;  1CL2 A;  3NRA A;  4LNM A;  2ZSL A;  2OKK A;  5M4B A;  1URQ D;  4DQ6 A;  3HDO A;  2VMU A;  1T8Z A;  4MQR A;  1AFO A;  4OH8 B;  1VDF A;  4N3Y B;  1MFZ A;  4Y0H A;  1MDO A;  3PJ0 A;  3AV7 A;  4M3L A;  1FAV A;  3V5B A;  1SVF A;  2IPP A;  1FJK A;  1X2A A;  1SZK A;  2ZP7 A;  5E5I A;  2W7H A;  1URQ A;  3EI5 A;  1FZC B;  3ASB A;  1J1D C;  2CTZ A;  2W7D A;  5AX8 A;  3IFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...