3N4XA

Structure of csm1 full-length
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
163
structure length
149
Chain Sequence
SADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monopolin complex subunit CSM1
publication title The Monopolin Complex Crosslinks Kinetochore Components to Regulate Chromosome-Microtubule Attachments.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 48
structure length 149
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3n4xA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3n4xA02
3C9IA 4ZKUA 3N4SA 3VP8A 3BASA 3U59A 3VP9A 3HRNA 3U1AA 2POHA 3N4RA 5BU5A 4N78D 1NKNA 4GIFA 4N3YB 5BU8B 3U1CA 1WT6A 3P8CD 3N7NA 3OJAB 1X79B 1IC2A 3BATA 4ZKPA 2JEEA 4I1LA 4O9BA 5KTBA 3N4XA 2FXMA 5BVZA
chains in the Genus database with same CATH superfamily
3A0BH 3V2RA 3RL0C 1ASDA 4LNLA 3AEOA 2A45I 1LWUA 4H13C 2ZJSE 2ZT9C 1AFOA 1NYHA 3I56P 5KAFH 4YXWH 4PJ0E 1DX7A 3HUSA 1N8PA 3BRTB 5G09A 2VMVA 1DIPA 4JF0A 4H0LC 1KFMA 2GB3A 3CCRP 4ZWVA 1FG7A 4F5GA 4C7NA 2JO1A 4BQ0A 1VQ8P 4LLHA 1YBKA 8AATA 2YRIA 3CBFA 5EUEA 1BE3G 2KSJA 1BJOB 1PPJE 1CZEA 5E79E 5B66E 3H1JG 1NTKG 1IC2A 1NU1K 4U3FE 1N8RQ 1LS3A 3MHVA 1ORDA 3PD6B 5C6UA 4WYGA 2BCCJ 2HOXA 2HUIA 3HTKA 4XFJA 2KB7P 3H1HE 1RY3A 2VGZA 1IK7A 3RL0g 1AY4A 3L75G 1T3JA 2FYUE 4RKCA 2GUSA 1SFFA 2NPSD 5EQCA 4ZWMA 3L72J 2GMSA 2W7IA 3CMAP 1VQ5P 3DODA 1JB0J 3HD7D 3V2NA 4IFDK 2R5CA 4KAMA 3ELEA 1ZXGA 1HUCA 1R8EA 2YMKA 3TDKA 3MADA 3BN1A 1Q2NA 5F8VA 3ZDMA 3LVMA 4GE4A 2QIWA 1BE3J 1YTZI 1RF0A 1ZMEC 3KGWA 2SPZA 1C0NA 2H88C 4JF7A 3H1JJ 5KLVG 1NTKJ 4JQ0D 2GA1A 3EI6A 3WKRA 3TK1A 1SQPG 1S3JA 4RO0A 3PJ0A 3VMZA 2V7QJ 1OVRA 1LW4A 2OKJA 3GWPA 5AVRB 1S72P 2JGTA 2OYIA 3JCUH 4ZASA 2FFDC 3CWBG 5AW7B 1ASNA 1SQXE 1M90Q 4MKKA 2VRSA 4HJGH 2CPSA 1IJDB 1KC8Q 2N9BA 1M8OB 3O8ZA 1FG3A 1M1JA 1H8AA 2JISA 2YKYA 4RITA 2E75C 2KZJA 1S06A 3FGAD 2BCCD 3PDXA 2OGEA 2VIBA 5I92A 1PGPA 3EQ2A 2ZYGA 1TOGA 3UAKA 4H51A 2HODA 2BIGA 3E2YA 3CD6P 4ITGA 3USFA 3FVUA 4GT1A 1E5EA 2W8UA 1GU4A 2RH0A 1EZVG 3L72D 1GBNA 1L0LE 5CHXA 1SQPJ 2W6BA 1FZGA 3R9AA 3FQAA 2D64A 1LTJB 1BS0A 3MD0A 1VQMP 4M3LA 3N5MA 3TGUD 2DKJA 2GQNA 1KILD 4BWNA 1ASCA 5AVVB 4LW2A 3CWBJ 1RQUA 2IYOA 4WBTA 2E76B 1OX3A 4NPEA 2WSEH 2M3BA 5APWA 1PMOA 1BCCG 1ARHA 1ASBA 2VGSA 2R2NA 3P8CE 4BRYB 1GZLA 2Q9IA 1GD9A 4A7PA 3MAFB 1EXIA 2Y0EA 5APTA 1OIPA 2J58A 3KHUA 4U1TA 1YJ9P 2L91A 1USDA 1H88A 2VI9A 2ZAEB 2KLVA 1Z7DA 2O1BA 2W6JH 2NPSA 2FYFA 1ZOBA 1NTME 2P67A 1J1DB 4QMAA 2K3RA 1A02J 1LP1A 1ARSA 1V2EA 4L74A 1IUGA 1GDEA 2Z61A 1N7SD 3EUCA 3H1LG 3B5NB 3W1HA 2IDBA 3VP6A 3A9ZA 3PLNA 2JJGA 3FD0A 1SQPD 4KXKA 3GZCA 4AZKA 2E42A 2ZXXA 1BCCJ 2R0TA 2W7HA 3AE9C 1QGNA 1TOKA 2WITA 3V2PA 2J5UA 3DR7A 3K7YA 2IZ0A 3HL2A 3CWBD 2VMYA 2RFVA 3QH9A 1WSTA 3E1RA 3FTBA 3CPWO 5KJ7C 1AMSA 4K35A 1OWAA 1JF9A 4GE9A 5APQA 3B46A 5F9SA 2WPQA 1Y9BA 3MIWA 2LR2A 1M7YA 1W7MA 2N1TD 1X28A 4MKJA 4EU1A 3S4RA 4EB7A 2HR3A 3L36A 1VQKP 3H1LJ 3CQ6A 3OAKA 3EI5A 4Y99B 3LVLB 4P7YA 4ZSYA 3WCNA 3MC6C 1U08A 2HPCA 1YJYA 3AOWA 1DEEG 1L0NJ 4PD4E 1E5FA 1D7MA 2KYVA 1IX8A 1SQVG 2YCNA 1LTJC 1DH3A 3GBXA 2W8TA 1KYOH 4RAEA 1AX4A 3TSIA 3IHJA 1W2EA 2CPBA 1V2FA 3A5TA 2VMWA 2GUVA 1KTMA 3FQ7A 3KDPB 3RK3B 1FDIA 1D7RA 1IFDA 1NO4A 2E76C 4D6TG 2VMXA 5CCHD 5CJ0A 1IFMA 4WYFA 1AQTA 5B5EE 2CH1A 1N31A 5APYA 1AJRA 1GC0A 3ZZJA 2BHXA 2MKVA 3AE5C 4DOJA 2QSRA 3UWCA 1URQB 2CY8A 1PP9E 1J04A 3N4XA 3QM2A 3IFMA 2Z9WA 3CLQA 1YIJP 3AENB 3GJUA 4J5UA 1X29A 3KQGA 3AOVA 2YOBA 3GHGB 4O6ZA 1AJYA 1AVOA 1SQVJ 2YKXA 1J1DC 1HJ0A 4F5JA 3H1LD 5DB5A 2QB3A 3PH0A 3B5NC 1N7SA 2YO3A 1SQQK 2XV5A 3L70J 2AY9A 5AW9B 2KK7A 4XJLA 1L0ND 4D6TJ 3FZ8A 3HE4B 2WT7A 2JJFA 2WMMA 2PAJA 2IBZI 3E2ZB 3RL0D 3SWYA 1BSHA 1MDZA 2P7JA 2VGUA 1NHLA 2WSEJ 4HH2A 3Q1MA 1O61A 5G2QA 2VI8A 2QJKB 5GTHH 4EMYA 1FZCB 1AHFA 1KL1A 3A0HH 3K28A 1MFZA 4H0LD 1H0CA 3WGCA 4W80A 1P84E 2O01H 2R44A 1DD3A 4WD2A 1Q7YQ 2N1TA 2F8JA 3DC1A 4Y99C 4W7ZA 5E4ZA 1TASA 2AY5A 2JJHA 2EPJA 4H44B 1BQAA 3OJAB 1G7XA 4OGQC 3BCCG 4ZKPA 5AW1B 4GOEA 1MFTA 2OTJP 3M0DC 1FC4A 1CZQA 2ZUKA 3BVHA 3NXSA 2CH2A 5BVZA 3O6QB 2HP1A 1NTZG 4ASWA 3JZLA 5DJTB 4UHMA 1JY3O 3VP8A 2OQXA 3RI6A 4W1WA 1A02F 3L37A 3EZ1A 3EWKA 3L70D 2QM8A 2OTKE 4PD4I 1BGYG 1BJWA 3COGA 2E7UA 5H2FH 4DT0A 2XBNA 5CCHA 1KMKA 1FDMA 3E1IA 4I8AA 2OATA 3G4SP 1SQBK 2QA3A 3H32A 4JYBA 2QMAA 2C7TA 3GZDC 1K73Q 3EI8A 1JUNA 3E9KA 3AEMA 1CS1A 3KZIH 2B9BA 4OVNF 1PV3A 1PMMA 3GHGC 5C39A 1QJ5A 3BCCJ 2FBWC 3KGXA 4GEBA 5DJ9A 3E6GA 1BJ4A 1ZRTE 3B1EA 3GETA 3WU2E 2GSAA 4CXQA 1RE4A 2WSFH 1JY2O 1LTIC 1KQGB 1OVVA 3VMXA 1ZW0A 2QVAA 2X8UA 5D5SA 5AVQB 4UB8E 5CCGC 1MLZA 4ZDPA 1BQDA 3U1AA 1JCCA 3AEJC 1BE3E 1NU1J 4N3YB 4IFMA 3AE3C 3W68A 4UHNA 1VEFA 3H1JE 1NTKE 1VP4A 4PIWA 1AAMA 1YQ4C 1L4AC 1Q90D 1SZUA 3OKSA 3WGBA 4JEWA 5AW4B 2C44A 1CI6A 3V4WA 4EDFA 3HBXA 2Z9UA 1YNUA 1SFCA 2QJKC 1TU3F 3OW2O 1S0AA 3L74D 1FZCC 1EXJA 3L75E 3PRJA 4YTPC 2POHA 2B89A 1AJSB 2FYUK 2ZYAA 1IFNA 3K40A 1HVVA 1JTHA 2HORA 1PZQA 3AE6C 1LK9A 3FKDA 1B9HA 1IAXA 2X5DA 4CVQA 3EI7A 4FL0A 1X0MA 4H44C 3EFFK 3WUUA 1WYVA 3H1KG 2BI1A 1QIRA 1P84I 2QJYB 5KLVE 3OP7A 1LT9B 2BI2A 4IXSA 3RGUA 2A45H 4GODA 1M0OA 1NH4A 1VJOA 2W7MA 1T2KC 4ADEA 4W7YA 1KYOD 1S2EA 2VGWA 1NU1D 1ASGA 5HHYA 3G71P 1SQXK 3ISLA 5BJ3A 1FU1A 4LGDE 5EIGA 3PTZA 4CBRA 2WK8A 1N73A 1FJKA 5AVYB 5G0AA 4GOFA 3T97A 1S9KD 1FAVA 2O01J 2ZP7A 3H1KJ 5JAYA 3NU7A 3BCAA 4OMAA 1LC7A 1EZVE 2W83C 1FZAA 3RK2B 3BCBA 1X0TA 5BJ4A 1L0LK 3GF3A 3DXWA 1GL2B 2B87B 3ECDA 3H9XA 2YNYA 3ZRQA 1R5LA 1NGMB 4HB1A 2DKBA 2JJEA 1IFJA 4ITXA 1U7MA 2FFDA 4IL6H 4H63Q 2AXTH 1YJNP 3ASAA 3M5UA 1U57A 4WY4B 1MKMA 4WYCA 2OYHB 1N2TA 1QVFO 1BCCE 2AEVA 2KP8A 2O3JA 2Y0CA 2E75B 2YKPA 3USSA 2D2CB 1MUUA 3DYDA 2BCCG 4N78D 1T3UA 3R2PA 4A6RA 2VMTA 5BU8B 3D6YA 2CJDA 3IN6A 1QLED 3P1TA 3A9XA 2Q5UA 1DTYA 1I48A 4O9BA 3L72G 3FXEA 1SZSA 1NTMK 3QWOC 1WKHA 4K2BA 3TNUA 1ARIA 1RF1B 1X9VA 2CSTA 3L73E 4XQ2A 1KQSO 1LWUB 3H1KD 2X5FA 3TGUG 3GF7A 2WSFJ 3W67A 4YPCA 4NPFX 2QJYC 1LT9C 3WMM0 4PVFA 1Q81Q 3HUSB 3V6IA 3L71E 2QJPB 1S08A 3WUTA 1NAYA 2FXPA 1VF5B 2CJGA 2WPVB 4MN4C 4ZKUA 1TARA 2C81A 3DXVA 3FFHA 3WLXA 4C7NB 2AY3A 1ZV8A 1VPCA 2CTZA 4OBVA 4RJYA 1SF2A 3A2BA 5EFSA 2Q3IA 1JM0A 3LW5J 3WY7A 1RH5B 5AW8B 3H6PA 1FBMA 2YHKA 4PJ0H 4UHOA 2LXCB 2QA4P 3FFRA 2KSEA 1AY5A 1RV4A 2M3EA 3BS8A 3TGUJ 1TATA 4L75A 1QX8A 1YTZT 3HTKB 3Q3DA 1OXPA 1ECXA 4GE7A 1W5CE 3MZWB 2FM1A 4TMRA 3NYTA 5FT4A 4F5IA 3QBOA 3H1ID 3RCHA 3RK2C 1KB9E 1GL2C 1S1CX 4ZM3A 1GDTA 1PGQA 1SQVE 2NZ2A 2KNCB 3IR9A 1Y47A 1KD1Q 3G9RA 2R5CB 5E79H 3LIEA 4L76A 5KTBA 2HUUA 5B66H 2G6WA 1MAQA 1QL1A 1EZVI 1UU0A 1IO4A 4WY4C 3VOPA 4R4MA 4D6TE 3F89A 3K5BA 1PG8A 4IOIH 4DZOA 2ZY5A 2OYHC 2XH1A 2FY8A 4R5FA 3CXHE 5M4BA 1AA0A 4JEZA 3PDBA 1BW0A 4R2NA 4PV1B 4AZJA 1CQ6A 2D2CC 1KQFB 1Y4IA 3VTPC 1SZKA 2OYIB 3HDOA 3I5CA 1BDDA 1W7LA 4DGTA 4P3MA 4M2JA 3M91A 2EZ1A 5EUDA 2YO2A 3PA9A 5AVXB 2FXOA 1M1JB 4Z1MH 1G4VA 2ZFCA 1RF1C 1TPLA 2WQYC 2AY6A 3BB8A 3LWSA 1LWUC 3NDNA 3RK3D 2VMNA 2YXQB 1HBWA 3Q2YA 5FT6A 2D7YA 2WZ7A 2JEEA 3SFEC 1LW5A 2P10A 3HUSC 3NYSA 4WVZA 3RBLA 1HF9A 4A6TA 2QJPC 2HG5D 5CBNA 3RBXA 1VF5C 3M9BA 1URQD 1NKNA 3CX5E 2EZ2A 1ZODA 3Q8NA 3TYYA 1GK6A 3QPGA 3VAXA 4OBUA 3CI9A 5TISE 2Q3EA 3F5HA 4DBCA 2RKLA 2CB1A 1M32A 3JWAA 4M2KA 3VK4A 1J32A 4HYTB 4ZNCA 1YIZA 2YXRB 3HD7A 2JWAA 3NUIA 5FT8A 2Z9VA 2IBZE 1JS3A 4F5FA 2EGYA 4OTLA 4OYTA 2WB6A 1LNQA 1G2CA 5CCGD 3IF4A 2A06D 1EQBA 1LC5A 2H89C 2IFMA 3L44A 1PGOA 4K3AA 2K9YA 3AEEC 3BCCE 1DJEA 1DKAA 1L0NG 3QN6A 3ACZA 1MDOA 3NUBA 1R5SA 2NPSB 1SQQD 1NTZE 5AVZB 4JEXA 1XEYA 5APVA 1LP1B 1QGKB 3P7KA 3P8MC 1BGYE 5M49A 1RE3A 2PFXA 3MUDA 1KB9I 4NPDA 1QEXA 1RF0C 1C7GA 2AY4A 4K2IA 3D71A 1UKJA 1QZ9A 3HQTA 3H25A 3VYIA 4PV1C 4WBAA 4A0RA 1X22A 2G3AA 1IZNB 1IJIA 4MQPA 1ZOYC 3S1KA 1VQNP 1QVGO 3VK3A 2OYIC 1EDLA 3H1HG 3WKSA 2YKUA 1AHYA 4BMKA 4OCAA 3CXHI 1JY3P 3GR9A 1MDXA 1ZP0C 1ZR2A 1AICA 3MKJA 3LY1A 4OGQB 1RV3A 2PO3A 1GW4A 4F4EA 3NTNA 2QB2A 4IW7A 1M1JC 4HF8A 3C1LA 1AMQA 4ZSWA 1HH0A 5GTIE 2O0RA 2XU6A 1B5OA 2KIKA 2KS1A 4LNMA 4WXBA 1GEYA 2WPRA 1KILA 3L70G 1KL2A 3U59A 5L8RJ 3ZRRA 1LTSC 2HPCB 1LKCA 4WP0A 2K9JA 3L35A 2R5BA 4ISYA 1NTKK 2D63A 3PIUA 3FQ8A 1GC4A 5AVUB 1TOJA 1URQA 2BI9A 2W7GA 4RIZA 1VQLP 2WTYA 3H1HJ 1RVUA 1GD2E 1W3UA 1SQBD 2AY2A 1AIBA 1M0PA 3V2QA 5APSA 2AATA 4DQ6A 5J8QA 3EI9A 3CX5I 1YJWP 3JW9A 4PD4H 4AUWA 2H8PD 3EFGA 4LW4A 2BYJA 3V5BA 3TQXA 3TF5A 2EO5A 2YIUB 2Z4EA 4RJTA 1DFOA 7AATA 5KKZB 4Y0DA 3ASBA 1JNMA 1B9IA 2NPSC 4B98A 5KLVK 2UWJE 5K5GB 2IFNA 4ATQA 4CPGA 1SQPK 1I41A 1L4AB 3PHLA 4W5KA 1IK9A 4IYOA 4H13D 3AEPA 2ZT9D 4R8DA 1N7SB 5TJHA 3A8UX 2DOUA 1GEWA 4AO4A 1PPJD 1W23A 2JJLA 3CAIA 1M57D 1OMIA 2FKIA 4U3FD 1OW6A 3L74G 3KPEA 2ZYJA 1GTWA 4WB0B 4AQRD 4UB6E 4Q6RA 2WT7B 2ZY3A 4A0GA 5AVWB 5H2FE 4EYYQ 2AY8A 1V2DA 1D2FA 3AE1C 2CK3H 1H89A 4ZDLA 5APXA 3AEBC 2XDJA 3H1HD 4EFFA 1KZUB 1LTBC 2Y9ZA 2FYUD 5CJ4A 4Q76A 3CQ4A 2QG4A 1W7NA 3NTJA 2B88A 4MQRA 4W1VA 1L0LJ 1J1EB 1KKPA 4A00A 3V4QA 2GMUA 2WKAA 3JSVC 1AY8A 5E3KA 3FRKA 2N1TB 4XE5B 3CCSP 3PPLA 2CINA 4M2MA 3AV7A 2C0RA 1VQ7P 1KN7A 3KXDA 3L74J 1UU2A 1NU1G 1KMJA 1DGDA 5DJ1A 3ITKA 2YRRA 4LC1A 3UIAA 3CL3D 2KXPB 4F5LA 2P2UA 4RM1A 3NNKA 1AHXA 1OXZA 3BCXA 1ASLA 2TPLA 3VMYA 2BCCE 1S5LX 4I6MC 1SQXD 2W8VA 3DU4A 4E77A 2XZRA 1P84H 3AEAC 1JMMA 2BWOA 1JG8A 1LTGC 1NTMJ 3FXDA 4EB5A 1BSNA 1S07A 3AE7C 4W1XA 3L72E 3CCVP 4JPZB 1EQ7A 2OTLP 3BWNA 3H32B 3WZFA 1GW3A 2E74B 1MLYA 3SWKA 2YIUC 2C9LY 3N4RA 5TF5A 1C4KA 2ZY4A 1KILE 1L0LD 2FYNC 5KKZC 4GIFA 2KUBA 1XI9A 3Q5PA 4MQQA 3TCMA 2K88A 5AW6B 1AMAA 2E75D 1LJ2A 2Z20A 2D2CD 2GM4A 2O01N 4Y0IA 2Q6QA 1OW8A 4EIJA 1N7SC 2ZXEB 3GLMA 2V1PA 1YI2P 1B5PA 4F5KA 4Q31A 3NRAA 2PB0A 2JWDA 2HYNA 2VGTA 2FYZA 3HE5A 2R5EA 3EIBA 1AVYA 2W7DA 4RLGA 1H0TA 1PGJA 4HVKA 4IXOA 1DJUA 3P8CD 5KAIH 4BHDA 4JF1A 2Y0DA 4MSOA 1RQVA 2HZPA 1IFPA 5AVSB 4KJMA 4R4LA 2AY7A 1Q82Q 1UU1A 4UQVA 1CI6B 3HT4A 1SFCB 4GKGA 2M5AA 2DGMA 3N4SA 3M9HA 3WU2H 2IYPA 1AAWA 1J1EC 1NTMD 3OA7A 1KMIZ 1SQPE 1HTLC 3AECC 2I1JA 3R4YA 4UB8H 3E2FA 1VF5D 1SQVK 3FVXA 1JTHB 1WT6A 2N1TC 1G1IA 1X79B 1RHZB 2NMPA 1X2AA 1KFNA 3CWBE 3KE3A 1YQ3C 3AE4C 2DGLA 1AKAA 1WYVB 1WYUA 2QE7H 1S5LE 1C7NA 2R3SA 3VP9A 2YCTA 1MGVA 4K05A 2YKVA 2D66A 1KV4A 5CBOA 3F0HA 3FZ6A 3A9YA 1OHWA 1PP9J 1GC3A 2YCPA 3N7NA 2HOZA 1IX7A 3NU8A 3A0BE 3BATA 3C8VA 3II6A 1JCDA 2FXMA 5E5IA 3L4FA 5CCHC 5M4DA 1JS6A 1WYTA 1IVRA 2B87A 4W8IA 3AEFC 3H1IG 3B8XA 1FOSF 5AVTB 1ASMA 2AEUA 1NJIQ 5KAFE 3E7KA 5AW0B 4MY5A 1LTAC 4JYCA 2E74C 1OW7A 1N73B 3AEMC 3CQ5A 4A0HA 4WLHA 4GDOA 2ZY2A 4PD4D 2HUFA 3EIAA 1SVFA 1S4XA 3VMAA 1V72A 4ZDOA 5KJ7D 3ELPA 1C9CA 4B9BA 1SVVA 3I16A 1USEA 2RN0A 3FX0A 1RE4C 1N86A 3JTXA 1JMBA 4XJOA 2IPPA 2G8YA 3VK2A 1M4NA 1ARTA 5AW2B 3DRDA 2YKOA 1CL2A 4JBZA 3H1IJ 3JC22 2WSSH 3CCMP 2PP6A 1RF1A 1PP9D 1GU5A 3H1LE 1AQ5A 1SFCC 5CMZA 3B8EB 4IY7A 2E76D 1L2PA 1BJOA 4GRXA 3WUVA 3B4SA 1SS1A 2W7KA 1L0NE 2WK7A 3E77A 1FE6A 1ZN5A 1SP4A 1AV1A 3PD6A 3NYUA 2VGVA 1YAAA 1NTZK 3CCEP 1WMKA 1KQLA 3TNUB 4F5MA 1CSBA 2P1JA 4XJMA 1O69A 2X3LA 3AE8C 2E7IA 3F9TA 3CMEP 2A45G 4U7JA 1JOCA 5M46A 1ASFA 2PGDA 3L8AA 2W7JA 1NOHA 1Z56A 3JCUE 4WLJA 1EDIA 2WPSA 2QBTA 2L5GB 3ZZKA 2VMZA 3WCOA 3B5ND 2ZSLA 2BWNA 2JP3A 1D7UA 2AEFA 2WWWA 5APUA 2A06G 2PRRA 1DGEA 1I29A 2BEQD 1FJPA 1P84D 4WB4A 3Q5RA 1S09A 2KNCA 2A1VA 1AKCA 5G4JA 3M06A 1I43A 2QEXP 1PFFA 1SQQG 2YKQA 1AKBA 1PL5A 1N73C 1EDKA 4OH8B 3AATA 2FKWB 3L70E 4XA4A 2BI5A 1K04A 4I2LC 4IFFA 5EFWB 3VN0A 2OYOA 5KJ7A 1EG5A 4KYOA 3RCHB 2XKMA 2WSCH 2FNUA 1M7LA 3Q5SA 1AHGA 3PJSK 1OZHA 3MC6A 3L75J 1EC5A 2W8ZA 2E54A 1YJZA 3SWFA 4OGQD 5G4IA 1FOSE 4Q75A 9AATA 4ADCA 1LTJA 1YOOA 3PDBB 1SQQJ 1JO5A 5HDMA 3PGYA 1YHQP 4IX8A 3G3ZA 2JKVA 2BIEA 2ZVOB 2Q7WA 1KB9H 2HOYA 2KOGA 2Z5HA 2HODB 1M6SA 2BYLA 2W7LA 1IBJA 1FS0E 5KLVJ 4XK1A 1ZRTD 3BC8A 2D5YA 4WYDA 2G7JA 3NFQA 4BRYA 2FNIA 2W8WA 2CJHA 3MAFA 4GDYA 3T32A 2VMUA 1DD4A 1X8YA 2OQQA 4OC9A 2VIAA 4ZLVA 1P3WA 3CXHH 1BE3D 2JR8A 3H1JD 5IWQA 1NTKD 3L74E 1SQBG 3WX9A 2XNDH 1QITA 2R5DA 2AEMA 2V0YA 3JWBA 1YYCA 1OVUA 3S9OA 4B86A 1WKGA 3ZRPA 1ZR4A 2VYCA 3B5NA 2KZIA 3CCLP 1KORA 3SSUA 4Y28J 2OKKA 4YXDC 3L75D 4RKUJ 3GG2A 2BASA 3IAOA 3R4TA 1LC8A 4CBSA 1MZ9A 1D7SA 3ABVC 1L4AD 3KKIA 2V4HA 2LXBA 2ZYDA 3HVYA 2HLOA 3HD7B 4AH3A 1SLQA 1ZLLA 2M8RA 3L73G 2YMYA 1LGHB 1AHEA 3CCUP 3GMAA 3W1JA 1G2CB 5KLVD 1KYOE 1O62A 1PPJG 1SQBJ 1NU1E 4UOYA 2BKWA 3BRVB 2D7ZA 3CX5H 3UE8A 1ASEA 4U3FG 3L71G 2E5YA 1M0QA 1GK4A 2QLRA 4XAUA 1BJNA 3H7FA 5TISH 2I1KA 1E79H 4A6UA 1ELQA 4H44D 5AW3B 1S9KE 1IAYA 2D61A 5DJUB 1AMRA 4WYAA 2FN6A 2FYUG 1QISA 3M0DA 1HWTC 5EUNA 4WWIA 2N9YB 4L73A 1DEBA 2M0BA 1IX6A 1FZFA 4N0WA 1CQ7A 1OHYA 3MP7B 3LVJA 3L73J 4XEWA 1T2KD 5G2PA 2VMSA 4AOAA 2R32A 4N6JA 4ADBA 3QGUA 2K37A 3NMDA 2R3CA 2I8DA 2FQ6A 1KKJA 1EZVD 3QI6A 4A0FA 4E1OA 2BWPA 4LNJA 2KLUA 3HMUA 1BKGA 4U3FJ 2H43A 3L71J 1HJBA 2AEJA 3G6EP 4PFFA 3TATA 4Y0HA 2W90A 3GZDA 1SPAA 1D7VA 4WXGA 4WYEA 4ASVA 3AENA 2KS1B 2WSCJ 1ARGA 3LVKA 4N78E 1M56D 1SQXG 1KILB 3GHGA 2FYUJ 1Y8AA 2BI3A 3BV0A 1JY2P 4NOGA 1BCCD 4DCKA 2AY1A 5GTHE 2K9JB 1XTCC 3M0AA 4W91A 4WXFA 2Z5IA 3A7OA 3A0HE 2E74D 5KLIB 1MAPA 1QJ3A 3W1IA 1VQ9P 5CCGA 1T8ZA 3CCJP 1VQPP 4J8LA 3H1KE 1CW5A 3AEGC 2DR1A 3AEJA 3HE4A 4I7ZB 5GTIH 3EZSA 2FYNB 2E7JA 1L0LG 1YITP 4ADDA 3E2ZA 1L4AA 4FFCA 3L73D 3HD7C 4BA5A 4E3QA 3LV2A 2OGUA 1OFCX 1WRGA 3M9QA 3LG0A 5B5EH 2MJZA 3FZ7A 3RQ1A 1SQXJ 1FZCA 4CXRA 1T3IA 2E5TA 3A2AA 1UIXA 2PB2A 1HGVA 4WB0A 2AXCA 2Z9XA 1GCKA 3L71D 2W7EA 2WK9A 1T6AA 1GMJA 3VOMA 1FC2C 2KFPA 3I4JA 2O1JA 2W6AA 3FWLA 2DGKA 2J59M 2VMRA 2D65A 2ZJGA 1U7JA 4BA4A 2OGAA 3FSLA 4RESB 1KYOI 1OXOA 1SFCD 3CCQP 4IYOB 4HKZH 1CQ8A 4AO9A 4KT0J 1M1KQ 4KHXA 1RE3C 3CC4P 3MUDC 4I1LA 3G0TA 4OWFA 4EOTA 3KYQA 3O6QA 2XNXA 3C9IA 3KZIE 1NTMG 3H1IE 3MEBA 1IFIA 3AE2C 1EJIA 3FWNA 3SFDC 3TFTA 2IBZG 3B1DA 3CC2P 4ZAHA 1LT1A 1JEKA 3AELA 3D6KA 1B8GA 1GEXA 3U1CA 4ATPA 1C7OA 3G7QA 2C0WA 2Z1ZA 4L0OA 1KB9D 2EH6A 1JY3N 1SQVD 3PP5A 1Z3ZA 3GW6A 3D6ZA 3II0A 2BIAA 4AYCA 3LIDA 2DW3A 1TOEA 3RK3C 4UB6H 4D6TD 3I5TA 1KILC 3B1CA 4IL6X 3RUYA 4RKDA 3CXHD 3MGNA 1G4XA 1TOIA 1FZBA 3RK2D 1CZCA 1K05A 1B4XA 1GL2D 2VLFA 2NRGA 2WVRA 1N2DC 1VL2A 1PIXA 1J2JB 3N0LA 1E5WA 3TFUA 1URQC 5KLIC 3BASA 2H7HA 2W8JA 5KAIE 3TGUE 3DR4A 2ZVNB 3RK3E 4WY4D 4I7ZC 1EDJA 2K1AA 4IXZA 1K9MQ 1NKZB 5D95A 2QRXA 4DJGA 3RBZA 3A3YB 1YIYA 4EI2A 1JY2N 1L0NK 1MV8A 1NTZJ 3NX3A 1CJ0A 2W27A 4TLFA 1G1JA 2CANA 3RBFA 1BGYJ 4C46A 1W2BO 1OATA 2HFED 1OHVA 3MAUA 1NAFA 1AJSA 2C9NY 4E3RA 4XJPA 2EYQA 3CX5D 5AW5B 1Q86Q 3RL0B 4K2MA 2IZ1A 1XTGB 1RVYA 1QL2A 1PP9G 3N75A 4H13B 1YJSA 3LW5H 5HXXA 2ZT9B 1UIIA 3DZZA 2BEZF 2VLHA 1LT9A 2A06E 1VDFA 3HE5B 4ZM4A 5BU5A 4GSAA 4U2HA 4TN4A 3AEDC 3CC7P 3B71A 4H0LB 1H0TB 3F6TA 2IBZD 3P6KA 2LKMA 4JEVA 1SQQE 2ORDA 1HGZA 2VMPA 3QHXA 1AIAA 2ITAA 1VQ4P 5DX5A 1ELUA 3I55P 1FZEA 5K8BA 3BCCD 2W7FA 1M0NA 3ATHA 2Q1KA 2V7QH 2M5AB 1ZC9A 3BWOA 1NTZD 2RMZA 4IL6E 4OT8A 2AXTE 1FDOA 3GSBA 1BGYD 2JDIH 4R5ZA 2VMQA 1O4SA 4LC3A 4ZMDA 3FVSA 1BDCA 4C7RA 2HP2A 1G7WA 1WYUB 2Y9YA 2IX7C 5EAAA 2P58A 1GL2A 3MBBA 3HRNA 1CL1A 5M1BA 1NWQA 2O1KA 2ZC0A 5EIGB 2Z1YA 4JEYA 3P32A 1VQOP 2CFBA 2KI7B 3T97B 4PFNA 4BXLA 2E43A 1K8AQ 1PFIA 1NVOA 4F5HA 4WY4A 2O7CA 5AX8A 1H1CA 2OYHA 2Q7CA 2QSIA 1ASAA 3MTUE 1BT4A 1GC2A 1WYTB 4PV1D 1VQ6P 4A72A 2C0XA 2VMOA 3BWNC 3D70A 1KAFA 4QGRA 5EAVA 1S5LH 1DJ9A 4RJ0A 5FT5A 3FDBA 2FFDB 2ZSMA 3FCRA 3PAAA 4TT3H 1LTTC 3G8MA 1SQBE 3HLMA 1N7LA 3FDDA 2QM7A 2JG2A 2OARA
chains in the Genus database with same CATH topology
3V2RA 3RL0C 1ASDA 4LNLA 3AEOA 2A45I 1LWUA 1AFOA 1DX7A 3HUSA 1N8PA 3BRTB 5G09A 2VMVA 4JF0A 1KFMA 2GB3A 4ZWVA 1FG7A 4F5GA 4C7NA 4BQ0A 4LLHA 8AATA 2YRIA 3CBFA 5EUEA 2KSJA 1BJOB 1CZEA 1IC2A 1NU1K 1LS3A 1ORDA 3PD6B 5C6UA 4WYGA 2HOXA 2HUIA 3HTKA 2KB7P 1RY3A 2VGZA 1AY4A 1T3JA 4RKCA 2GUSA 1SFFA 2NPSD 5EQCA 4ZWMA 2GMSA 2W7IA 3DODA 3HD7D 3V2NA 4IFDK 2R5CA 4KAMA 3ELEA 1HUCA 3MADA 3BN1A 5F8VA 3LVMA 4GE4A 1YTZI 1RF0A 3KGWA 1C0NA 4JF7A 3WKRA 3EI6A 3TK1A 3PJ0A 3VMZA 3GWPA 1LW4A 2OKJA 5AVRB 2JGTA 2OYIA 4ZASA 2FFDC 5AW7B 1ASNA 4MKKA 2VRSA 2CPSA 1IJDB 2N9BA 3O8ZA 1FG3A 1M1JA 1H8AA 2JISA 2YKYA 4RITA 1S06A 3PDXA 2OGEA 2VIBA 5I92A 3EQ2A 1TOGA 3UAKA 4H51A 2HODA 2BIGA 3E2YA 4ITGA 3USFA 3FVUA 4GT1A 1E5EA 2W8UA 1GU4A 1GBNA 5CHXA 2W6BA 1FZGA 3R9AA 3FQAA 2D64A 1LTJB 1BS0A 3MD0A 4M3LA 3N5MA 2DKJA 2GQNA 1KILD 1ASCA 5AVVB 4LW2A 4WBTA 2WSEH 2M3BA 5APWA 1PMOA 1ARHA 1ASBA 2VGSA 2R2NA 3P8CE 1GD9A 1GZLA 2Q9IA 3MAFB 5APTA 2J58A 4U1TA 1H88A 2VI9A 1Z7DA 2KLVA 2O1BA 2NPSA 2FYFA 1ZOBA 2P67A 1J1DB 1A02J 1ARSA 1V2EA 1IUGA 1GDEA 2Z61A 1N7SD 3EUCA 3B5NB 3W1HA 3VP6A 3A9ZA 2JJGA 3FD0A 4KXKA 3GZCA 4AZKA 2E42A 2R0TA 2W7HA 1QGNA 1TOKA 2WITA 3V2PA 3DR7A 3K7YA 3HL2A 2VMYA 2RFVA 1WSTA 3FTBA 5KJ7C 1AMSA 1OWAA 1JF9A 4GE9A 5APQA 3B46A 5F9SA 2WPQA 3MIWA 1M7YA 1W7MA 1X28A 4MKJA 2N1TD 4EU1A 4EB7A 3L36A 3EI5A 3CQ6A 3OAKA 4Y99B 3LVLB 4P7YA 4ZSYA 3WCNA 3MC6C 1U08A 2HPCA 1YJYA 3AOWA 1E5FA 2KYVA 1IX8A 2YCNA 1LTJC 1DH3A 3GBXA 2W8TA 4RAEA 1AX4A 3TSIA 3IHJA 1W2EA 2CPBA 1V2FA 3A5TA 2VMWA 2GUVA 3FQ7A 3KDPB 3RK3B 1D7RA 1IFDA 1NO4A 2VMXA 5CCHD 5CJ0A 1IFMA 4WYFA 2CH1A 1N31A 5APYA 1AJRA 1GC0A 3ZZJA 2BHXA 4DOJA 2QSRA 3UWCA 1URQB 2CY8A 1J04A 3N4XA 3QM2A 3IFMA 2Z9WA 3CLQA 3AENB 3GJUA 4J5UA 1X29A 3KQGA 3AOVA 2YOBA 3GHGB 4O6ZA 2YKXA 1J1DC 4F5JA 5DB5A 2QB3A 3B5NC 1N7SA 2YO3A 1SQQK 2XV5A 2AY9A 5AW9B 4XJLA 3FZ8A 3HE4B 2WT7A 2JJFA 2PAJA 3E2ZB 3RL0D 3SWYA 1MDZA 2P7JA 2VGUA 1NHLA 4HH2A 1O61A 5G2QA 2VI8A 4EMYA 1FZCB 1AHFA 1KL1A 3K28A 1MFZA 1H0CA 3WGCA 4W80A 2O01H 4WD2A 2N1TA 2F8JA 3DC1A 4Y99C 4W7ZA 5E4ZA 1TASA 2AY5A 2JJHA 2EPJA 1BQAA 3OJAB 1G7XA 4ZKPA 5AW1B 3M0DC 1FC4A 1CZQA 2ZUKA 3BVHA 3NXSA 2CH2A 5BVZA 2HP1A 3JZLA 4UHMA 1JY3O 3VP8A 2OQXA 3RI6A 4W1WA 1A02F 3L37A 3EZ1A 2QM8A 1BJWA 3COGA 2E7UA 2XBNA 5CCHA 1KMKA 1FDMA 3E1IA 4I8AA 2OATA 1SQBK 2QA3A 3H32A 4JYBA 2QMAA 2C7TA 3GZDC 3EI8A 1JUNA 3E9KA 3AEMA 1CS1A 1PMMA 3GHGC 1QJ5A 3KGXA 4GEBA 5DJ9A 3E6GA 1BJ4A 3B1EA 3GETA 2GSAA 4CXQA 1RE4A 2WSFH 1JY2O 1LTIC 3VMXA 2X8UA 5D5SA 5AVQB 5CCGC 1MLZA 4ZDPA 1BQDA 3U1AA 1JCCA 3AEJC 4N3YB 4IFMA 4UHNA 1VEFA 1VP4A 4PIWA 1AAMA 1L4AC 1SZUA 3OKSA 3WGBA 4JEWA 5AW4B 2C44A 1CI6A 3V4WA 3HBXA 2Z9UA 1YNUA 1SFCA 1S0AA 1FZCC 2POHA 1AJSB 2FYUK 1IFNA 3K40A 1HVVA 1JTHA 2HORA 1LK9A 3FKDA 1B9HA 1IAXA 2X5DA 4CVQA 3EI7A 4FL0A 1X0MA 1WYVA 2BI1A 1QIRA 3OP7A 1LT9B 2BI2A 4IXSA 2A45H 1M0OA 1NH4A 1VJOA 2W7MA 1T2KC 4ADEA 4W7YA 2VGWA 1ASGA 5HHYA 1SQXK 3ISLA 5BJ3A 1FU1A 4LGDE 5EIGA 4CBRA 2WK8A 1N73A 1FJKA 5AVYB 5G0AA 3T97A 1S9KD 1FAVA 2ZP7A 5JAYA 3NU7A 3BCAA 4OMAA 1LC7A 1FZAA 3RK2B 3BCBA 5BJ4A 1L0LK 3DXWA 1GL2B 3ECDA 3H9XA 2YNYA 3ZRQA 2DKBA 2JJEA 1IFJA 4ITXA 2FFDA 4H63Q 3ASAA 3M5UA 4WY4B 4WYCA 2OYHB 1N2TA 2AEVA 2KP8A 2YKPA 1MUUA 3DYDA 4N78D 1T3UA 3R2PA 4A6RA 2VMTA 5BU8B 2CJDA 3P1TA 3A9XA 2Q5UA 1DTYA 1I48A 4O9BA 1SZSA 1NTMK 1WKHA 4K2BA 3TNUA 1ARIA 1RF1B 1X9VA 2CSTA 4XQ2A 1LWUB 2X5FA 1LT9C 3WMM0 4PVFA 3HUSB 1S08A 2CJGA 4ZKUA 1TARA 2C81A 3DXVA 3FFHA 3WLXA 4C7NB 2AY3A 1ZV8A 1VPCA 2CTZA 4OBVA 4RJYA 1SF2A 3A2BA 5EFSA 2Q3IA 3WY7A 5AW8B 3H6PA 1FBMA 2YHKA 4UHOA 3FFRA 1AY5A 1RV4A 3BS8A 1TATA 1OXPA 1YTZT 3HTKB 1ECXA 4GE7A 2FM1A 4TMRA 4F5IA 3NYTA 5FT4A 3QBOA 3RCHA 3RK2C 1GL2C 4ZM3A 1GDTA 3IR9A 2R5CB 3LIEA 2HUUA 5KTBA 2G6WA 1MAQA 1QL1A 1UU0A 1IO4A 4WY4C 3VOPA 1PG8A 4DZOA 2ZY5A 2OYHC 2XH1A 4R5FA 5M4BA 4JEZA 3PDBA 1BW0A 4R2NA 4AZJA 1CQ6A 1Y4IA 3VTPC 1SZKA 2OYIB 3HDOA 3I5CA 1W7LA 4DGTA 4P3MA 4M2JA 3M91A 2EZ1A 5EUDA 2YO2A 3PA9A 5AVXB 1M1JB 1G4VA 2ZFCA 1RF1C 1TPLA 2AY6A 3BB8A 3LWSA 1LWUC 3NDNA 3RK3D 2VMNA 1HBWA 5FT6A 2D7YA 2WZ7A 2JEEA 1LW5A 3HUSC 3NYSA 3RBLA 4A6TA 2HG5D 3M9BA 1URQD 1NKNA 2EZ2A 1ZODA 3Q8NA 3TYYA 1GK6A 3QPGA 3VAXA 4OBUA 3CI9A 4DBCA 2CB1A 1M32A 3JWAA 4M2KA 3VK4A 1J32A 4HYTB 1YIZA 3HD7A 3NUIA 5FT8A 2Z9VA 4F5FA 1JS3A 2EGYA 4OTLA 4OYTA 2WB6A 1G2CA 5CCGD 1EQBA 1LC5A 2IFMA 3L44A 1DJEA 1DKAA 3QN6A 3ACZA 1MDOA 3NUBA 2NPSB 5AVZB 4JEXA 1XEYA 5APVA 3P7KA 3P8MC 5M49A 1RE3A 3MUDA 1RF0C 1C7GA 2AY4A 4K2IA 1UKJA 1QZ9A 3HQTA 3VYIA 4WBAA 4A0RA 4MQPA 1IJIA 3VK3A 2OYIC 3WKSA 2YKUA 1AHYA 4BMKA 4OCAA 1JY3P 3GR9A 1MDXA 1ZR2A 1AICA 3MKJA 3LY1A 1RV3A 2PO3A 1GW4A 4F4EA 3NTNA 2QB2A 4IW7A 1M1JC 4HF8A 1AMQA 4ZSWA 1HH0A 2O0RA 2XU6A 1B5OA 4LNMA 4WXBA 1GEYA 2WPRA 1KILA 1KL2A 3U59A 3ZRRA 1LTSC 2HPCB 1LKCA 4WP0A 3L35A 2R5BA 4ISYA 1NTKK 2D63A 3PIUA 3FQ8A 1GC4A 5AVUB 1TOJA 1URQA 2BI9A 2W7GA 4RIZA 2WTYA 1RVUA 1GD2E 1W3UA 2AY2A 1AIBA 1M0PA 3V2QA 5APSA 2AATA 4DQ6A 5J8QA 3EI9A 3JW9A 4AUWA 2H8PD 3EFGA 4LW4A 2BYJA 3V5BA 3TQXA 2EO5A 2Z4EA 1DFOA 7AATA 4Y0DA 3ASBA 1JNMA 1B9IA 2NPSC 4B98A 5KLVK 2IFNA 4ATQA 1SQPK 1I41A 1L4AB 4W5KA 1IK9A 4IYOA 3AEPA 4R8DA 1N7SB 3A8UX 2DOUA 1GEWA 4AO4A 1W23A 2JJLA 3CAIA 2FKIA 3KPEA 2ZYJA 1GTWA 4WB0B 4AQRD 4Q6RA 2WT7B 2ZY3A 4A0GA 5AVWB 2AY8A 1V2DA 1D2FA 1H89A 4ZDLA 5APXA 2XDJA 4EFFA 1KZUB 1LTBC 5CJ4A 4Q76A 3CQ4A 1W7NA 3NTJA 4W1VA 4MQRA 1J1EB 1KKPA 4A00A 3V4QA 2GMUA 2WKAA 1AY8A 5E3KA 3FRKA 2N1TB 4XE5B 3PPLA 2CINA 4M2MA 3AV7A 2C0RA 1UU2A 1KMJA 1DGDA 5DJ1A 2YRRA 4LC1A 3UIAA 3CL3D 4F5LA 2P2UA 4RM1A 3NNKA 1AHXA 1OXZA 3BCXA 1ASLA 2TPLA 3VMYA 4I6MC 2W8VA 3DU4A 4E77A 2XZRA 1JMMA 2BWOA 1JG8A 1LTGC 4EB5A 1S07A 4W1XA 1EQ7A 3BWNA 3H32B 3WZFA 1GW3A 1MLYA 2C9LY 3N4RA 5TF5A 1C4KA 2ZY4A 4GIFA 1XI9A 4MQQA 3TCMA 5AW6B 1AMAA 2Z20A 2GM4A 4Y0IA 4EIJA 1N7SC 2ZXEB 2V1PA 1B5PA 4F5KA 4Q31A 3NRAA 2PB0A 2HYNA 2VGTA 2FYZA 3HE5A 2R5EA 3EIBA 2W7DA 4RLGA 4HVKA 4IXOA 1DJUA 3P8CD 4BHDA 4JF1A 4MSOA 2HZPA 5AVSB 2AY7A 1UU1A 4UQVA 1CI6B 3HT4A 1SFCB 4GKGA 3N4SA 2DGMA 3M9HA 1AAWA 1J1EC 3OA7A 1HTLC 2I1JA 3E2FA 1SQVK 3FVXA 1JTHB 1WT6A 2N1TC 1G1IA 1X79B 2NMPA 1X2AA 1KFNA 3KE3A 2DGLA 1AKAA 1WYVB 1WYUA 1C7NA 3VP9A 2YCTA 1MGVA 4K05A 2YKVA 2D66A 3F0HA 3FZ6A 3A9YA 1OHWA 1GC3A 2YCPA 3N7NA 2HOZA 1IX7A 3NU8A 3BATA 3II6A 1JCDA 2FXMA 5E5IA 3L4FA 5CCHC 5M4DA 1JS6A 1WYTA 1IVRA 4W8IA 3B8XA 1FOSF 5AVTB 1ASMA 2AEUA 5AW0B 4MY5A 1LTAC 4JYCA 1N73B 3AEMC 3CQ5A 4A0HA 4WLHA 2ZY2A 2HUFA 3EIAA 1SVFA 1V72A 4ZDOA 5KJ7D 3ELPA 1C9CA 4B9BA 1SVVA 3I16A 1RE4C 1N86A 3JTXA 4XJOA 2IPPA 3VK2A 1M4NA 1ARTA 5AW2B 3DRDA 2YKOA 1CL2A 2PP6A 1RF1A 1GU5A 1AQ5A 1SFCC 5CMZA 3B8EB 4IY7A 1BJOA 4GRXA 2W7KA 2WK7A 3E77A 1ZN5A 1SP4A 3PD6A 3NYUA 2VGVA 1YAAA 1NTZK 1KQLA 3TNUB 4F5MA 1CSBA 2P1JA 4XJMA 1O69A 2X3LA 2E7IA 3F9TA 2A45G 1JOCA 5M46A 1ASFA 3L8AA 2W7JA 1NOHA 1Z56A 4WLJA 2WPSA 2QBTA 2L5GB 3ZZKA 2VMZA 3WCOA 3B5ND 2ZSLA 2BWNA 1D7UA 2WWWA 5APUA 1DGEA 1I29A 1FJPA 4WB4A 1S09A 2A1VA 1AKCA 5G4JA 3M06A 1I43A 1PFFA 2YKQA 1AKBA 1N73C 4OH8B 3AATA 2FKWB 4XA4A 2BI5A 4I2LC 4IFFA 3VN0A 5KJ7A 1EG5A 4KYOA 3RCHB 2XKMA 2WSCH 2FNUA 1M7LA 1AHGA 3MC6A 2E54A 1YJZA 3SWFA 5G4IA 1FOSE 4Q75A 9AATA 4ADCA 1LTJA 1YOOA 3PDBB 1JO5A 5HDMA 3PGYA 4IX8A 3G3ZA 2BIEA 2Q7WA 2HOYA 2KOGA 2Z5HA 2HODB 1M6SA 2BYLA 2W7LA 1IBJA 4XK1A 3BC8A 2D5YA 4WYDA 2G7JA 3NFQA 2FNIA 2W8WA 2CJHA 3MAFA 4GDYA 3T32A 2VMUA 1X8YA 4OC9A 2VIAA 4ZLVA 1P3WA 5IWQA 3WX9A 1QITA 2R5DA 2V0YA 3JWBA 1YYCA 4B86A 1WKGA 3ZRPA 1ZR4A 2VYCA 3B5NA 2OKKA 2BASA 3R4TA 1LC8A 4CBSA 1MZ9A 1D7SA 1L4AD 3KKIA 3HVYA 2HLOA 3HD7B 4AH3A 1SLQA 1ZLLA 2M8RA 2YMYA 1LGHB 1AHEA 3W1JA 1G2CB 1O62A 4UOYA 2BKWA 3BRVB 2D7ZA 3UE8A 1ASEA 1M0QA 1GK4A 2QLRA 4XAUA 1BJNA 3H7FA 2I1KA 4A6UA 1ELQA 5AW3B 1S9KE 1IAYA 2D61A 1AMRA 4WYAA 2FN6A 1QISA 3M0DA 1HWTC 5EUNA 1DEBA 1IX6A 1FZFA 4N0WA 1CQ7A 1OHYA 3LVJA 4XEWA 5G2PA 1T2KD 2VMSA 4AOAA 2R32A 4N6JA 4ADBA 3QGUA 3NMDA 2R3CA 2FQ6A 1KKJA 4A0FA 3QI6A 4E1OA 2BWPA 4LNJA 3HMUA 1BKGA 2H43A 1HJBA 4PFFA 3TATA 4Y0HA 3GZDA 1SPAA 1D7VA 4WXGA 4WYEA 3AENA 1ARGA 3LVKA 4N78E 1KILB 3GHGA 2BI3A 3BV0A 1JY2P 4NOGA 2AY1A 1XTCC 3M0AA 4W91A 4WXFA 2Z5IA 3A7OA 1MAPA 1QJ3A 3W1IA 5CCGA 1T8ZA 4J8LA 1CW5A 3AEJA 2DR1A 3HE4A 3EZSA 2E7JA 4ADDA 3E2ZA 1L4AA 4FFCA 3HD7C 4BA5A 4E3QA 3LV2A 1WRGA 3M9QA 3LG0A 2MJZA 3FZ7A 3RQ1A 4CXRA 1FZCA 1T3IA 3A2AA 2PB2A 4WB0A 1HGVA 2Z9XA 1GCKA 2W7EA 2WK9A 3VOMA 2KFPA 3I4JA 2O1JA 2W6AA 2DGKA 2J59M 2VMRA 2D65A 2ZJGA 4BA4A 2OGAA 3FSLA 4RESB 1OXOA 1SFCD 4IYOB 1CQ8A 4AO9A 4KHXA 1RE3C 4I1LA 3G0TA 4EOTA 3KYQA 2XNXA 3C9IA 3MEBA 1IFIA 1EJIA 3TFTA 3B1DA 4ZAHA 3AELA 3D6KA 1B8GA 1GEXA 3U1CA 4ATPA 1C7OA 3G7QA 2C0WA 2Z1ZA 4L0OA 2EH6A 1JY3N 3PP5A 1Z3ZA 3II0A 2BIAA 4AYCA 3LIDA 1TOEA 3RK3C 3I5TA 1KILC 3B1CA 3RUYA 4RKDA 3MGNA 1G4XA 1TOIA 1FZBA 3RK2D 1CZCA 1B4XA 1GL2D 2VLFA 1N2DC 1J2JB 3N0LA 1E5WA 3TFUA 1URQC 3BASA 2H7HA 2W8JA 3DR4A 4WY4D 4IXZA 1NKZB 5D95A 3A3YB 1YIYA 1JY2N 1L0NK 1MV8A 3NX3A 1CJ0A 2W27A 1G1JA 2CANA 3RBFA 4C46A 1OATA 2HFED 1OHVA 3MAUA 1NAFA 1AJSA 2C9NY 4E3RA 4XJPA 2EYQA 5AW5B 3RL0B 4K2MA 1XTGB 1RVYA 1QL2A 3N75A 1YJSA 3LW5H 5HXXA 3DZZA 2VLHA 1LT9A 1VDFA 3HE5B 4ZM4A 5BU5A 4GSAA 4U2HA 4TN4A 3F6TA 3P6KA 2LKMA 4JEVA 2ORDA 1HGZA 2VMPA 3QHXA 1AIAA 5DX5A 1ELUA 1FZEA 5K8BA 2W7FA 1M0NA 3ATHA 1ZC9A 3BWOA 4OT8A 3GSBA 4R5ZA 2VMQA 1O4SA 4LC3A 3FVSA 4C7RA 2HP2A 1G7WA 1WYUB 2IX7C 5EAAA 1GL2A 3MBBA 3HRNA 1CL1A 2ZC0A 1NWQA 2O1KA 5EIGB 2Z1YA 4JEYA 3P32A 2CFBA 4PFNA 2E43A 1PFIA 4F5HA 4WY4A 2O7CA 5AX8A 1H1CA 2OYHA 2Q7CA 1ASAA 3MTUE 1BT4A 1GC2A 1WYTB 4A72A 2C0XA 2VMOA 3BWNC 4QGRA 5EAVA 1DJ9A 4RJ0A 5FT5A 3FDBA 2FFDB 2ZSMA 3FCRA 3PAAA 1LTTC 3G8MA 3HLMA 1N7LA 3FDDA 2QM7A 2JG2A 2OARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C9I A;  4ZKU A;  3N4S A;  3VP8 A;  3BAS A;  3U59 A;  3VP9 A;  3HRN A;  3U1A A;  2POH A;  3N4R A;  5BU5 A;  4N78 D;  1NKN A;  4GIF A;  4N3Y B;  5BU8 B;  3U1C A;  1WT6 A;  3P8C D;  3N7N A;  3OJA B;  1X79 B;  1IC2 A;  3BAT A;  4ZKP A;  2JEE A;  4I1L A;  4O9B A;  5KTB A;  3N4X A;  2FXM A;  5BVZ A; 
#chains in the Genus database with same CATH topology
 3A0B H;  3V2R A;  3RL0 C;  1ASD A;  4LNL A;  3AEO A;  2A45 I;  1LWU A;  4H13 C;  2ZJS E;  2ZT9 C;  1AFO A;  1NYH A;  3I56 P;  5KAF H;  4YXW H;  4PJ0 E;  1DX7 A;  3HUS A;  1N8P A;  3BRT B;  5G09 A;  2VMV A;  1DIP A;  4JF0 A;  4H0L C;  1KFM A;  2GB3 A;  3CCR P;  4ZWV A;  1FG7 A;  4F5G A;  4C7N A;  2JO1 A;  4BQ0 A;  1VQ8 P;  4LLH A;  1YBK A;  8AAT A;  2YRI A;  3CBF A;  5EUE A;  1BE3 G;  2KSJ A;  1BJO B;  1PPJ E;  1CZE A;  5E79 E;  5B66 E;  3H1J G;  1NTK G;  1IC2 A;  1NU1 K;  4U3F E;  1N8R Q;  1LS3 A;  3MHV A;  1ORD A;  3PD6 B;  5C6U A;  4WYG A;  2BCC J;  2HOX A;  2HUI A;  3HTK A;  4XFJ A;  2KB7 P;  3H1H E;  1RY3 A;  2VGZ A;  1IK7 A;  3RL0 g;  1AY4 A;  3L75 G;  1T3J A;  2FYU E;  4RKC A;  2GUS A;  1SFF A;  2NPS D;  5EQC A;  4ZWM A;  3L72 J;  2GMS A;  2W7I A;  3CMA P;  1VQ5 P;  3DOD A;  1JB0 J;  3HD7 D;  3V2N A;  4IFD K;  2R5C A;  4KAM A;  3ELE A;  1ZXG A;  1HUC A;  1R8E A;  2YMK A;  3TDK A;  3MAD A;  3BN1 A;  1Q2N A;  5F8V A;  3ZDM A;  3LVM A;  4GE4 A;  2QIW A;  1BE3 J;  1YTZ I;  1RF0 A;  1ZME C;  3KGW A;  2SPZ A;  1C0N A;  2H88 C;  4JF7 A;  3H1J J;  5KLV G;  1NTK J;  4JQ0 D;  2GA1 A;  3EI6 A;  3WKR A;  3TK1 A;  1SQP G;  1S3J A;  4RO0 A;  3PJ0 A;  3VMZ A;  2V7Q J;  1OVR A;  1LW4 A;  2OKJ A;  3GWP A;  5AVR B;  1S72 P;  2JGT A;  2OYI A;  3JCU H;  4ZAS A;  2FFD C;  3CWB G;  5AW7 B;  1ASN A;  1SQX E;  1M90 Q;  4MKK A;  2VRS A;  4HJG H;  2CPS A;  1IJD B;  1KC8 Q;  2N9B A;  1M8O B;  3O8Z A;  1FG3 A;  1M1J A;  1H8A A;  2JIS A;  2YKY A;  4RIT A;  2E75 C;  2KZJ A;  1S06 A;  3FGA D;  2BCC D;  3PDX A;  2OGE A;  2VIB A;  5I92 A;  1PGP A;  3EQ2 A;  2ZYG A;  1TOG A;  3UAK A;  4H51 A;  2HOD A;  2BIG A;  3E2Y A;  3CD6 P;  4ITG A;  3USF A;  3FVU A;  4GT1 A;  1E5E A;  2W8U A;  1GU4 A;  2RH0 A;  1EZV G;  3L72 D;  1GBN A;  1L0L E;  5CHX A;  1SQP J;  2W6B A;  1FZG A;  3R9A A;  3FQA A;  2D64 A;  1LTJ B;  1BS0 A;  3MD0 A;  1VQM P;  4M3L A;  3N5M A;  3TGU D;  2DKJ A;  2GQN A;  1KIL D;  4BWN A;  1ASC A;  5AVV B;  4LW2 A;  3CWB J;  1RQU A;  2IYO A;  4WBT A;  2E76 B;  1OX3 A;  4NPE A;  2WSE H;  2M3B A;  5APW A;  1PMO A;  1BCC G;  1ARH A;  1ASB A;  2VGS A;  2R2N A;  3P8C E;  4BRY B;  1GZL A;  2Q9I A;  1GD9 A;  4A7P A;  3MAF B;  1EXI A;  2Y0E A;  5APT A;  1OIP A;  2J58 A;  3KHU A;  4U1T A;  1YJ9 P;  2L91 A;  1USD A;  1H88 A;  2VI9 A;  2ZAE B;  2KLV A;  1Z7D A;  2O1B A;  2W6J H;  2NPS A;  2FYF A;  1ZOB A;  1NTM E;  2P67 A;  1J1D B;  4QMA A;  2K3R A;  1A02 J;  1LP1 A;  1ARS A;  1V2E A;  4L74 A;  1IUG A;  1GDE A;  2Z61 A;  1N7S D;  3EUC A;  3H1L G;  3B5N B;  3W1H A;  2IDB A;  3VP6 A;  3A9Z A;  3PLN A;  2JJG A;  3FD0 A;  1SQP D;  4KXK A;  3GZC A;  4AZK A;  2E42 A;  2ZXX A;  1BCC J;  2R0T A;  2W7H A;  3AE9 C;  1QGN A;  1TOK A;  2WIT A;  3V2P A;  2J5U A;  3DR7 A;  3K7Y A;  2IZ0 A;  3HL2 A;  3CWB D;  2VMY A;  2RFV A;  3QH9 A;  1WST A;  3E1R A;  3FTB A;  3CPW O;  5KJ7 C;  1AMS A;  4K35 A;  1OWA A;  1JF9 A;  4GE9 A;  5APQ A;  3B46 A;  5F9S A;  2WPQ A;  1Y9B A;  3MIW A;  2LR2 A;  1M7Y A;  1W7M A;  2N1T D;  1X28 A;  4MKJ A;  4EU1 A;  3S4R A;  4EB7 A;  2HR3 A;  3L36 A;  1VQK P;  3H1L J;  3CQ6 A;  3OAK A;  3EI5 A;  4Y99 B;  3LVL B;  4P7Y A;  4ZSY A;  3WCN A;  3MC6 C;  1U08 A;  2HPC A;  1YJY A;  3AOW A;  1DEE G;  1L0N J;  4PD4 E;  1E5F A;  1D7M A;  2KYV A;  1IX8 A;  1SQV G;  2YCN A;  1LTJ C;  1DH3 A;  3GBX A;  2W8T A;  1KYO H;  4RAE A;  1AX4 A;  3TSI A;  3IHJ A;  1W2E A;  2CPB A;  1V2F A;  3A5T A;  2VMW A;  2GUV A;  1KTM A;  3FQ7 A;  3KDP B;  3RK3 B;  1FDI A;  1D7R A;  1IFD A;  1NO4 A;  2E76 C;  4D6T G;  2VMX A;  5CCH D;  5CJ0 A;  1IFM A;  4WYF A;  1AQT A;  5B5E E;  2CH1 A;  1N31 A;  5APY A;  1AJR A;  1GC0 A;  3ZZJ A;  2BHX A;  2MKV A;  3AE5 C;  4DOJ A;  2QSR A;  3UWC A;  1URQ B;  2CY8 A;  1PP9 E;  1J04 A;  3N4X A;  3QM2 A;  3IFM A;  2Z9W A;  3CLQ A;  1YIJ P;  3AEN B;  3GJU A;  4J5U A;  1X29 A;  3KQG A;  3AOV A;  2YOB A;  3GHG B;  4O6Z A;  1AJY A;  1AVO A;  1SQV J;  2YKX A;  1J1D C;  1HJ0 A;  4F5J A;  3H1L D;  5DB5 A;  2QB3 A;  3PH0 A;  3B5N C;  1N7S A;  2YO3 A;  1SQQ K;  2XV5 A;  3L70 J;  2AY9 A;  5AW9 B;  2KK7 A;  4XJL A;  1L0N D;  4D6T J;  3FZ8 A;  3HE4 B;  2WT7 A;  2JJF A;  2WMM A;  2PAJ A;  2IBZ I;  3E2Z B;  3RL0 D;  3SWY A;  1BSH A;  1MDZ A;  2P7J A;  2VGU A;  1NHL A;  2WSE J;  4HH2 A;  3Q1M A;  1O61 A;  5G2Q A;  2VI8 A;  2QJK B;  5GTH H;  4EMY A;  1FZC B;  1AHF A;  1KL1 A;  3A0H H;  3K28 A;  1MFZ A;  4H0L D;  1H0C A;  3WGC A;  4W80 A;  1P84 E;  2O01 H;  2R44 A;  1DD3 A;  4WD2 A;  1Q7Y Q;  2N1T A;  2F8J A;  3DC1 A;  4Y99 C;  4W7Z A;  5E4Z A;  1TAS A;  2AY5 A;  2JJH A;  2EPJ A;  4H44 B;  1BQA A;  3OJA B;  1G7X A;  4OGQ C;  3BCC G;  4ZKP A;  5AW1 B;  4GOE A;  1MFT A;  2OTJ P;  3M0D C;  1FC4 A;  1CZQ A;  2ZUK A;  3BVH A;  3NXS A;  2CH2 A;  5BVZ A;  3O6Q B;  2HP1 A;  1NTZ G;  4ASW A;  3JZL A;  5DJT B;  4UHM A;  1JY3 O;  3VP8 A;  2OQX A;  3RI6 A;  4W1W A;  1A02 F;  3L37 A;  3EZ1 A;  3EWK A;  3L70 D;  2QM8 A;  2OTK E;  4PD4 I;  1BGY G;  1BJW A;  3COG A;  2E7U A;  5H2F H;  4DT0 A;  2XBN A;  5CCH A;  1KMK A;  1FDM A;  3E1I A;  4I8A A;  2OAT A;  3G4S P;  1SQB K;  2QA3 A;  3H32 A;  4JYB A;  2QMA A;  2C7T A;  3GZD C;  1K73 Q;  3EI8 A;  1JUN A;  3E9K A;  3AEM A;  1CS1 A;  3KZI H;  2B9B A;  4OVN F;  1PV3 A;  1PMM A;  3GHG C;  5C39 A;  1QJ5 A;  3BCC J;  2FBW C;  3KGX A;  4GEB A;  5DJ9 A;  3E6G A;  1BJ4 A;  1ZRT E;  3B1E A;  3GET A;  3WU2 E;  2GSA A;  4CXQ A;  1RE4 A;  2WSF H;  1JY2 O;  1LTI C;  1KQG B;  1OVV A;  3VMX A;  1ZW0 A;  2QVA A;  2X8U A;  5D5S A;  5AVQ B;  4UB8 E;  5CCG C;  1MLZ A;  4ZDP A;  1BQD A;  3U1A A;  1JCC A;  3AEJ C;  1BE3 E;  1NU1 J;  4N3Y B;  4IFM A;  3AE3 C;  3W68 A;  4UHN A;  1VEF A;  3H1J E;  1NTK E;  1VP4 A;  4PIW A;  1AAM A;  1YQ4 C;  1L4A C;  1Q90 D;  1SZU A;  3OKS A;  3WGB A;  4JEW A;  5AW4 B;  2C44 A;  1CI6 A;  3V4W A;  4EDF A;  3HBX A;  2Z9U A;  1YNU A;  1SFC A;  2QJK C;  1TU3 F;  3OW2 O;  1S0A A;  3L74 D;  1FZC C;  1EXJ A;  3L75 E;  3PRJ A;  4YTP C;  2POH A;  2B89 A;  1AJS B;  2FYU K;  2ZYA A;  1IFN A;  3K40 A;  1HVV A;  1JTH A;  2HOR A;  1PZQ A;  3AE6 C;  1LK9 A;  3FKD A;  1B9H A;  1IAX A;  2X5D A;  4CVQ A;  3EI7 A;  4FL0 A;  1X0M A;  4H44 C;  3EFF K;  3WUU A;  1WYV A;  3H1K G;  2BI1 A;  1QIR A;  1P84 I;  2QJY B;  5KLV E;  3OP7 A;  1LT9 B;  2BI2 A;  4IXS A;  3RGU A;  2A45 H;  4GOD A;  1M0O A;  1NH4 A;  1VJO A;  2W7M A;  1T2K C;  4ADE A;  4W7Y A;  1KYO D;  1S2E A;  2VGW A;  1NU1 D;  1ASG A;  5HHY A;  3G71 P;  1SQX K;  3ISL A;  5BJ3 A;  1FU1 A;  4LGD E;  5EIG A;  3PTZ A;  4CBR A;  2WK8 A;  1N73 A;  1FJK A;  5AVY B;  5G0A A;  4GOF A;  3T97 A;  1S9K D;  1FAV A;  2O01 J;  2ZP7 A;  3H1K J;  5JAY A;  3NU7 A;  3BCA A;  4OMA A;  1LC7 A;  1EZV E;  2W83 C;  1FZA A;  3RK2 B;  3BCB A;  1X0T A;  5BJ4 A;  1L0L K;  3GF3 A;  3DXW A;  1GL2 B;  2B87 B;  3ECD A;  3H9X A;  2YNY A;  3ZRQ A;  1R5L A;  1NGM B;  4HB1 A;  2DKB A;  2JJE A;  1IFJ A;  4ITX A;  1U7M A;  2FFD A;  4IL6 H;  4H63 Q;  2AXT H;  1YJN P;  3ASA A;  3M5U A;  1U57 A;  4WY4 B;  1MKM A;  4WYC A;  2OYH B;  1N2T A;  1QVF O;  1BCC E;  2AEV A;  2KP8 A;  2O3J A;  2Y0C A;  2E75 B;  2YKP A;  3USS A;  2D2C B;  1MUU A;  3DYD A;  2BCC G;  4N78 D;  1T3U A;  3R2P A;  4A6R A;  2VMT A;  5BU8 B;  3D6Y A;  2CJD A;  3IN6 A;  1QLE D;  3P1T A;  3A9X A;  2Q5U A;  1DTY A;  1I48 A;  4O9B A;  3L72 G;  3FXE A;  1SZS A;  1NTM K;  3QWO C;  1WKH A;  4K2B A;  3TNU A;  1ARI A;  1RF1 B;  1X9V A;  2CST A;  3L73 E;  4XQ2 A;  1KQS O;  1LWU B;  3H1K D;  2X5F A;  3TGU G;  3GF7 A;  2WSF J;  3W67 A;  4YPC A;  4NPF X;  2QJY C;  1LT9 C;  3WMM 0;  4PVF A;  1Q81 Q;  3HUS B;  3V6I A;  3L71 E;  2QJP B;  1S08 A;  3WUT A;  1NAY A;  2FXP A;  1VF5 B;  2CJG A;  2WPV B;  4MN4 C;  4ZKU A;  1TAR A;  2C81 A;  3DXV A;  3FFH A;  3WLX A;  4C7N B;  2AY3 A;  1ZV8 A;  1VPC A;  2CTZ A;  4OBV A;  4RJY A;  1SF2 A;  3A2B A;  5EFS A;  2Q3I A;  1JM0 A;  3LW5 J;  3WY7 A;  1RH5 B;  5AW8 B;  3H6P A;  1FBM A;  2YHK A;  4PJ0 H;  4UHO A;  2LXC B;  2QA4 P;  3FFR A;  2KSE A;  1AY5 A;  1RV4 A;  2M3E A;  3BS8 A;  3TGU J;  1TAT A;  4L75 A;  1QX8 A;  1YTZ T;  3HTK B;  3Q3D A;  1OXP A;  1ECX A;  4GE7 A;  1W5C E;  3MZW B;  2FM1 A;  4TMR A;  3NYT A;  5FT4 A;  4F5I A;  3QBO A;  3H1I D;  3RCH A;  3RK2 C;  1KB9 E;  1GL2 C;  1S1C X;  4ZM3 A;  1GDT A;  1PGQ A;  1SQV E;  2NZ2 A;  2KNC B;  3IR9 A;  1Y47 A;  1KD1 Q;  3G9R A;  2R5C B;  5E79 H;  3LIE A;  4L76 A;  5KTB A;  2HUU A;  5B66 H;  2G6W A;  1MAQ A;  1QL1 A;  1EZV I;  1UU0 A;  1IO4 A;  4WY4 C;  3VOP A;  4R4M A;  4D6T E;  3F89 A;  3K5B A;  1PG8 A;  4IOI H;  4DZO A;  2ZY5 A;  2OYH C;  2XH1 A;  2FY8 A;  4R5F A;  3CXH E;  5M4B A;  1AA0 A;  4JEZ A;  3PDB A;  1BW0 A;  4R2N A;  4PV1 B;  4AZJ A;  1CQ6 A;  2D2C C;  1KQF B;  1Y4I A;  3VTP C;  1SZK A;  2OYI B;  3HDO A;  3I5C A;  1BDD A;  1W7L A;  4DGT A;  4P3M A;  4M2J A;  3M91 A;  2EZ1 A;  5EUD A;  2YO2 A;  3PA9 A;  5AVX B;  2FXO A;  1M1J B;  4Z1M H;  1G4V A;  2ZFC A;  1RF1 C;  1TPL A;  2WQY C;  2AY6 A;  3BB8 A;  3LWS A;  1LWU C;  3NDN A;  3RK3 D;  2VMN A;  2YXQ B;  1HBW A;  3Q2Y A;  5FT6 A;  2D7Y A;  2WZ7 A;  2JEE A;  3SFE C;  1LW5 A;  2P10 A;  3HUS C;  3NYS A;  4WVZ A;  3RBL A;  1HF9 A;  4A6T A;  2QJP C;  2HG5 D;  5CBN A;  3RBX A;  1VF5 C;  3M9B A;  1URQ D;  1NKN A;  3CX5 E;  2EZ2 A;  1ZOD A;  3Q8N A;  3TYY A;  1GK6 A;  3QPG A;  3VAX A;  4OBU A;  3CI9 A;  5TIS E;  2Q3E A;  3F5H A;  4DBC A;  2RKL A;  2CB1 A;  1M32 A;  3JWA A;  4M2K A;  3VK4 A;  1J32 A;  4HYT B;  4ZNC A;  1YIZ A;  2YXR B;  3HD7 A;  2JWA A;  3NUI A;  5FT8 A;  2Z9V A;  2IBZ E;  1JS3 A;  4F5F A;  2EGY A;  4OTL A;  4OYT A;  2WB6 A;  1LNQ A;  1G2C A;  5CCG D;  3IF4 A;  2A06 D;  1EQB A;  1LC5 A;  2H89 C;  2IFM A;  3L44 A;  1PGO A;  4K3A A;  2K9Y A;  3AEE C;  3BCC E;  1DJE A;  1DKA A;  1L0N G;  3QN6 A;  3ACZ A;  1MDO A;  3NUB A;  1R5S A;  2NPS B;  1SQQ D;  1NTZ E;  5AVZ B;  4JEX A;  1XEY A;  5APV A;  1LP1 B;  1QGK B;  3P7K A;  3P8M C;  1BGY E;  5M49 A;  1RE3 A;  2PFX A;  3MUD A;  1KB9 I;  4NPD A;  1QEX A;  1RF0 C;  1C7G A;  2AY4 A;  4K2I A;  3D71 A;  1UKJ A;  1QZ9 A;  3HQT A;  3H25 A;  3VYI A;  4PV1 C;  4WBA A;  4A0R A;  1X22 A;  2G3A A;  1IZN B;  1IJI A;  4MQP A;  1ZOY C;  3S1K A;  1VQN P;  1QVG O;  3VK3 A;  2OYI C;  1EDL A;  3H1H G;  3WKS A;  2YKU A;  1AHY A;  4BMK A;  4OCA A;  3CXH I;  1JY3 P;  3GR9 A;  1MDX A;  1ZP0 C;  1ZR2 A;  1AIC A;  3MKJ A;  3LY1 A;  4OGQ B;  1RV3 A;  2PO3 A;  1GW4 A;  4F4E A;  3NTN A;  2QB2 A;  4IW7 A;  1M1J C;  4HF8 A;  3C1L A;  1AMQ A;  4ZSW A;  1HH0 A;  5GTI E;  2O0R A;  2XU6 A;  1B5O A;  2KIK A;  2KS1 A;  4LNM A;  4WXB A;  1GEY A;  2WPR A;  1KIL A;  3L70 G;  1KL2 A;  3U59 A;  5L8R J;  3ZRR A;  1LTS C;  2HPC B;  1LKC A;  4WP0 A;  2K9J A;  3L35 A;  2R5B A;  4ISY A;  1NTK K;  2D63 A;  3PIU A;  3FQ8 A;  1GC4 A;  5AVU B;  1TOJ A;  1URQ A;  2BI9 A;  2W7G A;  4RIZ A;  1VQL P;  2WTY A;  3H1H J;  1RVU A;  1GD2 E;  1W3U A;  1SQB D;  2AY2 A;  1AIB A;  1M0P A;  3V2Q A;  5APS A;  2AAT A;  4DQ6 A;  5J8Q A;  3EI9 A;  3CX5 I;  1YJW P;  3JW9 A;  4PD4 H;  4AUW A;  2H8P D;  3EFG A;  4LW4 A;  2BYJ A;  3V5B A;  3TQX A;  3TF5 A;  2EO5 A;  2YIU B;  2Z4E A;  4RJT A;  1DFO A;  7AAT A;  5KKZ B;  4Y0D A;  3ASB A;  1JNM A;  1B9I A;  2NPS C;  4B98 A;  5KLV K;  2UWJ E;  5K5G B;  2IFN A;  4ATQ A;  4CPG A;  1SQP K;  1I41 A;  1L4A B;  3PHL A;  4W5K A;  1IK9 A;  4IYO A;  4H13 D;  3AEP A;  2ZT9 D;  4R8D A;  1N7S B;  5TJH A;  3A8U X;  2DOU A;  1GEW A;  4AO4 A;  1PPJ D;  1W23 A;  2JJL A;  3CAI A;  1M57 D;  1OMI A;  2FKI A;  4U3F D;  1OW6 A;  3L74 G;  3KPE A;  2ZYJ A;  1GTW A;  4WB0 B;  4AQR D;  4UB6 E;  4Q6R A;  2WT7 B;  2ZY3 A;  4A0G A;  5AVW B;  5H2F E;  4EYY Q;  2AY8 A;  1V2D A;  1D2F A;  3AE1 C;  2CK3 H;  1H89 A;  4ZDL A;  5APX A;  3AEB C;  2XDJ A;  3H1H D;  4EFF A;  1KZU B;  1LTB C;  2Y9Z A;  2FYU D;  5CJ4 A;  4Q76 A;  3CQ4 A;  2QG4 A;  1W7N A;  3NTJ A;  2B88 A;  4MQR A;  4W1V A;  1L0L J;  1J1E B;  1KKP A;  4A00 A;  3V4Q A;  2GMU A;  2WKA A;  3JSV C;  1AY8 A;  5E3K A;  3FRK A;  2N1T B;  4XE5 B;  3CCS P;  3PPL A;  2CIN A;  4M2M A;  3AV7 A;  2C0R A;  1VQ7 P;  1KN7 A;  3KXD A;  3L74 J;  1UU2 A;  1NU1 G;  1KMJ A;  1DGD A;  5DJ1 A;  3ITK A;  2YRR A;  4LC1 A;  3UIA A;  3CL3 D;  2KXP B;  4F5L A;  2P2U A;  4RM1 A;  3NNK A;  1AHX A;  1OXZ A;  3BCX A;  1ASL A;  2TPL A;  3VMY A;  2BCC E;  1S5L X;  4I6M C;  1SQX D;  2W8V A;  3DU4 A;  4E77 A;  2XZR A;  1P84 H;  3AEA C;  1JMM A;  2BWO A;  1JG8 A;  1LTG C;  1NTM J;  3FXD A;  4EB5 A;  1BSN A;  1S07 A;  3AE7 C;  4W1X A;  3L72 E;  3CCV P;  4JPZ B;  1EQ7 A;  2OTL P;  3BWN A;  3H32 B;  3WZF A;  1GW3 A;  2E74 B;  1MLY A;  3SWK A;  2YIU C;  2C9L Y;  3N4R A;  5TF5 A;  1C4K A;  2ZY4 A;  1KIL E;  1L0L D;  2FYN C;  5KKZ C;  4GIF A;  2KUB A;  1XI9 A;  3Q5P A;  4MQQ A;  3TCM A;  2K88 A;  5AW6 B;  1AMA A;  2E75 D;  1LJ2 A;  2Z20 A;  2D2C D;  2GM4 A;  2O01 N;  4Y0I A;  2Q6Q A;  1OW8 A;  4EIJ A;  1N7S C;  2ZXE B;  3GLM A;  2V1P A;  1YI2 P;  1B5P A;  4F5K A;  4Q31 A;  3NRA A;  2PB0 A;  2JWD A;  2HYN A;  2VGT A;  2FYZ A;  3HE5 A;  2R5E A;  3EIB A;  1AVY A;  2W7D A;  4RLG A;  1H0T A;  1PGJ A;  4HVK A;  4IXO A;  1DJU A;  3P8C D;  5KAI H;  4BHD A;  4JF1 A;  2Y0D A;  4MSO A;  1RQV A;  2HZP A;  1IFP A;  5AVS B;  4KJM A;  4R4L A;  2AY7 A;  1Q82 Q;  1UU1 A;  4UQV A;  1CI6 B;  3HT4 A;  1SFC B;  4GKG A;  2M5A A;  2DGM A;  3N4S A;  3M9H A;  3WU2 H;  2IYP A;  1AAW A;  1J1E C;  1NTM D;  3OA7 A;  1KMI Z;  1SQP E;  1HTL C;  3AEC C;  2I1J A;  3R4Y A;  4UB8 H;  3E2F A;  1VF5 D;  1SQV K;  3FVX A;  1JTH B;  1WT6 A;  2N1T C;  1G1I A;  1X79 B;  1RHZ B;  2NMP A;  1X2A A;  1KFN A;  3CWB E;  3KE3 A;  1YQ3 C;  3AE4 C;  2DGL A;  1AKA A;  1WYV B;  1WYU A;  2QE7 H;  1S5L E;  1C7N A;  2R3S A;  3VP9 A;  2YCT A;  1MGV A;  4K05 A;  2YKV A;  2D66 A;  1KV4 A;  5CBO A;  3F0H A;  3FZ6 A;  3A9Y A;  1OHW A;  1PP9 J;  1GC3 A;  2YCP A;  3N7N A;  2HOZ A;  1IX7 A;  3NU8 A;  3A0B E;  3BAT A;  3C8V A;  3II6 A;  1JCD A;  2FXM A;  5E5I A;  3L4F A;  5CCH C;  5M4D A;  1JS6 A;  1WYT A;  1IVR A;  2B87 A;  4W8I A;  3AEF C;  3H1I G;  3B8X A;  1FOS F;  5AVT B;  1ASM A;  2AEU A;  1NJI Q;  5KAF E;  3E7K A;  5AW0 B;  4MY5 A;  1LTA C;  4JYC A;  2E74 C;  1OW7 A;  1N73 B;  3AEM C;  3CQ5 A;  4A0H A;  4WLH A;  4GDO A;  2ZY2 A;  4PD4 D;  2HUF A;  3EIA A;  1SVF A;  1S4X A;  3VMA A;  1V72 A;  4ZDO A;  5KJ7 D;  3ELP A;  1C9C A;  4B9B A;  1SVV A;  3I16 A;  1USE A;  2RN0 A;  3FX0 A;  1RE4 C;  1N86 A;  3JTX A;  1JMB A;  4XJO A;  2IPP A;  2G8Y A;  3VK2 A;  1M4N A;  1ART A;  5AW2 B;  3DRD A;  2YKO A;  1CL2 A;  4JBZ A;  3H1I J;  3JC2 2;  2WSS H;  3CCM P;  2PP6 A;  1RF1 A;  1PP9 D;  1GU5 A;  3H1L E;  1AQ5 A;  1SFC C;  5CMZ A;  3B8E B;  4IY7 A;  2E76 D;  1L2P A;  1BJO A;  4GRX A;  3WUV A;  3B4S A;  1SS1 A;  2W7K A;  1L0N E;  2WK7 A;  3E77 A;  1FE6 A;  1ZN5 A;  1SP4 A;  1AV1 A;  3PD6 A;  3NYU A;  2VGV A;  1YAA A;  1NTZ K;  3CCE P;  1WMK A;  1KQL A;  3TNU B;  4F5M A;  1CSB A;  2P1J A;  4XJM A;  1O69 A;  2X3L A;  3AE8 C;  2E7I A;  3F9T A;  3CME P;  2A45 G;  4U7J A;  1JOC A;  5M46 A;  1ASF A;  2PGD A;  3L8A A;  2W7J A;  1NOH A;  1Z56 A;  3JCU E;  4WLJ A;  1EDI A;  2WPS A;  2QBT A;  2L5G B;  3ZZK A;  2VMZ A;  3WCO A;  3B5N D;  2ZSL A;  2BWN A;  2JP3 A;  1D7U A;  2AEF A;  2WWW A;  5APU A;  2A06 G;  2PRR A;  1DGE A;  1I29 A;  2BEQ D;  1FJP A;  1P84 D;  4WB4 A;  3Q5R A;  1S09 A;  2KNC A;  2A1V A;  1AKC A;  5G4J A;  3M06 A;  1I43 A;  2QEX P;  1PFF A;  1SQQ G;  2YKQ A;  1AKB A;  1PL5 A;  1N73 C;  1EDK A;  4OH8 B;  3AAT A;  2FKW B;  3L70 E;  4XA4 A;  2BI5 A;  1K04 A;  4I2L C;  4IFF A;  5EFW B;  3VN0 A;  2OYO A;  5KJ7 A;  1EG5 A;  4KYO A;  3RCH B;  2XKM A;  2WSC H;  2FNU A;  1M7L A;  3Q5S A;  1AHG A;  3PJS K;  1OZH A;  3MC6 A;  3L75 J;  1EC5 A;  2W8Z A;  2E54 A;  1YJZ A;  3SWF A;  4OGQ D;  5G4I A;  1FOS E;  4Q75 A;  9AAT A;  4ADC A;  1LTJ A;  1YOO A;  3PDB B;  1SQQ J;  1JO5 A;  5HDM A;  3PGY A;  1YHQ P;  4IX8 A;  3G3Z A;  2JKV A;  2BIE A;  2ZVO B;  2Q7W A;  1KB9 H;  2HOY A;  2KOG A;  2Z5H A;  2HOD B;  1M6S A;  2BYL A;  2W7L A;  1IBJ A;  1FS0 E;  5KLV J;  4XK1 A;  1ZRT D;  3BC8 A;  2D5Y A;  4WYD A;  2G7J A;  3NFQ A;  4BRY A;  2FNI A;  2W8W A;  2CJH A;  3MAF A;  4GDY A;  3T32 A;  2VMU A;  1DD4 A;  1X8Y A;  2OQQ A;  4OC9 A;  2VIA A;  4ZLV A;  1P3W A;  3CXH H;  1BE3 D;  2JR8 A;  3H1J D;  5IWQ A;  1NTK D;  3L74 E;  1SQB G;  3WX9 A;  2XND H;  1QIT A;  2R5D A;  2AEM A;  2V0Y A;  3JWB A;  1YYC A;  1OVU A;  3S9O A;  4B86 A;  1WKG A;  3ZRP A;  1ZR4 A;  2VYC A;  3B5N A;  2KZI A;  3CCL P;  1KOR A;  3SSU A;  4Y28 J;  2OKK A;  4YXD C;  3L75 D;  4RKU J;  3GG2 A;  2BAS A;  3IAO A;  3R4T A;  1LC8 A;  4CBS A;  1MZ9 A;  1D7S A;  3ABV C;  1L4A D;  3KKI A;  2V4H A;  2LXB A;  2ZYD A;  3HVY A;  2HLO A;  3HD7 B;  4AH3 A;  1SLQ A;  1ZLL A;  2M8R A;  3L73 G;  2YMY A;  1LGH B;  1AHE A;  3CCU P;  3GMA A;  3W1J A;  1G2C B;  5KLV D;  1KYO E;  1O62 A;  1PPJ G;  1SQB J;  1NU1 E;  4UOY A;  2BKW A;  3BRV B;  2D7Z A;  3CX5 H;  3UE8 A;  1ASE A;  4U3F G;  3L71 G;  2E5Y A;  1M0Q A;  1GK4 A;  2QLR A;  4XAU A;  1BJN A;  3H7F A;  5TIS H;  2I1K A;  1E79 H;  4A6U A;  1ELQ A;  4H44 D;  5AW3 B;  1S9K E;  1IAY A;  2D61 A;  5DJU B;  1AMR A;  4WYA A;  2FN6 A;  2FYU G;  1QIS A;  3M0D A;  1HWT C;  5EUN A;  4WWI A;  2N9Y B;  4L73 A;  1DEB A;  2M0B A;  1IX6 A;  1FZF A;  4N0W A;  1CQ7 A;  1OHY A;  3MP7 B;  3LVJ A;  3L73 J;  4XEW A;  1T2K D;  5G2P A;  2VMS A;  4AOA A;  2R32 A;  4N6J A;  4ADB A;  3QGU A;  2K37 A;  3NMD A;  2R3C A;  2I8D A;  2FQ6 A;  1KKJ A;  1EZV D;  3QI6 A;  4A0F A;  4E1O A;  2BWP A;  4LNJ A;  2KLU A;  3HMU A;  1BKG A;  4U3F J;  2H43 A;  3L71 J;  1HJB A;  2AEJ A;  3G6E P;  4PFF A;  3TAT A;  4Y0H A;  2W90 A;  3GZD A;  1SPA A;  1D7V A;  4WXG A;  4WYE A;  4ASV A;  3AEN A;  2KS1 B;  2WSC J;  1ARG A;  3LVK A;  4N78 E;  1M56 D;  1SQX G;  1KIL B;  3GHG A;  2FYU J;  1Y8A A;  2BI3 A;  3BV0 A;  1JY2 P;  4NOG A;  1BCC D;  4DCK A;  2AY1 A;  5GTH E;  2K9J B;  1XTC C;  3M0A A;  4W91 A;  4WXF A;  2Z5I A;  3A7O A;  3A0H E;  2E74 D;  5KLI B;  1MAP A;  1QJ3 A;  3W1I A;  1VQ9 P;  5CCG A;  1T8Z A;  3CCJ P;  1VQP P;  4J8L A;  3H1K E;  1CW5 A;  3AEG C;  2DR1 A;  3AEJ A;  3HE4 A;  4I7Z B;  5GTI H;  3EZS A;  2FYN B;  2E7J A;  1L0L G;  1YIT P;  4ADD A;  3E2Z A;  1L4A A;  4FFC A;  3L73 D;  3HD7 C;  4BA5 A;  4E3Q A;  3LV2 A;  2OGU A;  1OFC X;  1WRG A;  3M9Q A;  3LG0 A;  5B5E H;  2MJZ A;  3FZ7 A;  3RQ1 A;  1SQX J;  1FZC A;  4CXR A;  1T3I A;  2E5T A;  3A2A A;  1UIX A;  2PB2 A;  1HGV A;  4WB0 A;  2AXC A;  2Z9X A;  1GCK A;  3L71 D;  2W7E A;  2WK9 A;  1T6A A;  1GMJ A;  3VOM A;  1FC2 C;  2KFP A;  3I4J A;  2O1J A;  2W6A A;  3FWL A;  2DGK A;  2J59 M;  2VMR A;  2D65 A;  2ZJG A;  1U7J A;  4BA4 A;  2OGA A;  3FSL A;  4RES B;  1KYO I;  1OXO A;  1SFC D;  3CCQ P;  4IYO B;  4HKZ H;  1CQ8 A;  4AO9 A;  4KT0 J;  1M1K Q;  4KHX A;  1RE3 C;  3CC4 P;  3MUD C;  4I1L A;  3G0T A;  4OWF A;  4EOT A;  3KYQ A;  3O6Q A;  2XNX A;  3C9I A;  3KZI E;  1NTM G;  3H1I E;  3MEB A;  1IFI A;  3AE2 C;  1EJI A;  3FWN A;  3SFD C;  3TFT A;  2IBZ G;  3B1D A;  3CC2 P;  4ZAH A;  1LT1 A;  1JEK A;  3AEL A;  3D6K A;  1B8G A;  1GEX A;  3U1C A;  4ATP A;  1C7O A;  3G7Q A;  2C0W A;  2Z1Z A;  4L0O A;  1KB9 D;  2EH6 A;  1JY3 N;  1SQV D;  3PP5 A;  1Z3Z A;  3GW6 A;  3D6Z A;  3II0 A;  2BIA A;  4AYC A;  3LID A;  2DW3 A;  1TOE A;  3RK3 C;  4UB6 H;  4D6T D;  3I5T A;  1KIL C;  3B1C A;  4IL6 X;  3RUY A;  4RKD A;  3CXH D;  3MGN A;  1G4X A;  1TOI A;  1FZB A;  3RK2 D;  1CZC A;  1K05 A;  1B4X A;  1GL2 D;  2VLF A;  2NRG A;  2WVR A;  1N2D C;  1VL2 A;  1PIX A;  1J2J B;  3N0L A;  1E5W A;  3TFU A;  1URQ C;  5KLI C;  3BAS A;  2H7H A;  2W8J A;  5KAI E;  3TGU E;  3DR4 A;  2ZVN B;  3RK3 E;  4WY4 D;  4I7Z C;  1EDJ A;  2K1A A;  4IXZ A;  1K9M Q;  1NKZ B;  5D95 A;  2QRX A;  4DJG A;  3RBZ A;  3A3Y B;  1YIY A;  4EI2 A;  1JY2 N;  1L0N K;  1MV8 A;  1NTZ J;  3NX3 A;  1CJ0 A;  2W27 A;  4TLF A;  1G1J A;  2CAN A;  3RBF A;  1BGY J;  4C46 A;  1W2B O;  1OAT A;  2HFE D;  1OHV A;  3MAU A;  1NAF A;  1AJS A;  2C9N Y;  4E3R A;  4XJP A;  2EYQ A;  3CX5 D;  5AW5 B;  1Q86 Q;  3RL0 B;  4K2M A;  2IZ1 A;  1XTG B;  1RVY A;  1QL2 A;  1PP9 G;  3N75 A;  4H13 B;  1YJS A;  3LW5 H;  5HXX A;  2ZT9 B;  1UII A;  3DZZ A;  2BEZ F;  2VLH A;  1LT9 A;  2A06 E;  1VDF A;  3HE5 B;  4ZM4 A;  5BU5 A;  4GSA A;  4U2H A;  4TN4 A;  3AED C;  3CC7 P;  3B71 A;  4H0L B;  1H0T B;  3F6T A;  2IBZ D;  3P6K A;  2LKM A;  4JEV A;  1SQQ E;  2ORD A;  1HGZ A;  2VMP A;  3QHX A;  1AIA A;  2ITA A;  1VQ4 P;  5DX5 A;  1ELU A;  3I55 P;  1FZE A;  5K8B A;  3BCC D;  2W7F A;  1M0N A;  3ATH A;  2Q1K A;  2V7Q H;  2M5A B;  1ZC9 A;  3BWO A;  1NTZ D;  2RMZ A;  4IL6 E;  4OT8 A;  2AXT E;  1FDO A;  3GSB A;  1BGY D;  2JDI H;  4R5Z A;  2VMQ A;  1O4S A;  4LC3 A;  4ZMD A;  3FVS A;  1BDC A;  4C7R A;  2HP2 A;  1G7W A;  1WYU B;  2Y9Y A;  2IX7 C;  5EAA A;  2P58 A;  1GL2 A;  3MBB A;  3HRN A;  1CL1 A;  5M1B A;  1NWQ A;  2O1K A;  2ZC0 A;  5EIG B;  2Z1Y A;  4JEY A;  3P32 A;  1VQO P;  2CFB A;  2KI7 B;  3T97 B;  4PFN A;  4BXL A;  2E43 A;  1K8A Q;  1PFI A;  1NVO A;  4F5H A;  4WY4 A;  2O7C A;  5AX8 A;  1H1C A;  2OYH A;  2Q7C A;  2QSI A;  1ASA A;  3MTU E;  1BT4 A;  1GC2 A;  1WYT B;  4PV1 D;  1VQ6 P;  4A72 A;  2C0X A;  2VMO A;  3BWN C;  3D70 A;  1KAF A;  4QGR A;  5EAV A;  1S5L H;  1DJ9 A;  4RJ0 A;  5FT5 A;  3FDB A;  2FFD B;  2ZSM A;  3FCR A;  3PAA A;  4TT3 H;  1LTT C;  3G8M A;  1SQB E;  3HLM A;  1N7L A;  3FDD A;  2QM7 A;  2JG2 A;  2OAR A; 
#chains in the Genus database with same CATH homology
 3V2R A;  3RL0 C;  1ASD A;  4LNL A;  3AEO A;  2A45 I;  1LWU A;  1AFO A;  1DX7 A;  3HUS A;  1N8P A;  3BRT B;  5G09 A;  2VMV A;  4JF0 A;  1KFM A;  2GB3 A;  4ZWV A;  1FG7 A;  4F5G A;  4C7N A;  4BQ0 A;  4LLH A;  8AAT A;  2YRI A;  3CBF A;  5EUE A;  2KSJ A;  1BJO B;  1CZE A;  1IC2 A;  1NU1 K;  1LS3 A;  1ORD A;  3PD6 B;  5C6U A;  4WYG A;  2HOX A;  2HUI A;  3HTK A;  2KB7 P;  1RY3 A;  2VGZ A;  1AY4 A;  1T3J A;  4RKC A;  2GUS A;  1SFF A;  2NPS D;  5EQC A;  4ZWM A;  2GMS A;  2W7I A;  3DOD A;  3HD7 D;  3V2N A;  4IFD K;  2R5C A;  4KAM A;  3ELE A;  1HUC A;  3MAD A;  3BN1 A;  5F8V A;  3LVM A;  4GE4 A;  1YTZ I;  1RF0 A;  3KGW A;  1C0N A;  4JF7 A;  3WKR A;  3EI6 A;  3TK1 A;  3PJ0 A;  3VMZ A;  3GWP A;  1LW4 A;  2OKJ A;  5AVR B;  2JGT A;  2OYI A;  4ZAS A;  2FFD C;  5AW7 B;  1ASN A;  4MKK A;  2VRS A;  2CPS A;  1IJD B;  2N9B A;  3O8Z A;  1FG3 A;  1M1J A;  1H8A A;  2JIS A;  2YKY A;  4RIT A;  1S06 A;  3PDX A;  2OGE A;  2VIB A;  5I92 A;  3EQ2 A;  1TOG A;  3UAK A;  4H51 A;  2HOD A;  2BIG A;  3E2Y A;  4ITG A;  3USF A;  3FVU A;  4GT1 A;  1E5E A;  2W8U A;  1GU4 A;  1GBN A;  5CHX A;  2W6B A;  1FZG A;  3R9A A;  3FQA A;  2D64 A;  1LTJ B;  1BS0 A;  3MD0 A;  4M3L A;  3N5M A;  2DKJ A;  2GQN A;  1KIL D;  1ASC A;  5AVV B;  4LW2 A;  4WBT A;  2WSE H;  2M3B A;  5APW A;  1PMO A;  1ARH A;  1ASB A;  2VGS A;  2R2N A;  3P8C E;  1GD9 A;  1GZL A;  2Q9I A;  3MAF B;  5APT A;  2J58 A;  4U1T A;  1H88 A;  2VI9 A;  1Z7D A;  2KLV A;  2O1B A;  2NPS A;  2FYF A;  1ZOB A;  2P67 A;  1J1D B;  1A02 J;  1ARS A;  1V2E A;  1IUG A;  1GDE A;  2Z61 A;  1N7S D;  3EUC A;  3B5N B;  3W1H A;  3VP6 A;  3A9Z A;  2JJG A;  3FD0 A;  4KXK A;  3GZC A;  4AZK A;  2E42 A;  2R0T A;  2W7H A;  1QGN A;  1TOK A;  2WIT A;  3V2P A;  3DR7 A;  3K7Y A;  3HL2 A;  2VMY A;  2RFV A;  1WST A;  3FTB A;  5KJ7 C;  1AMS A;  1OWA A;  1JF9 A;  4GE9 A;  5APQ A;  3B46 A;  5F9S A;  2WPQ A;  3MIW A;  1M7Y A;  1W7M A;  1X28 A;  4MKJ A;  2N1T D;  4EU1 A;  4EB7 A;  3L36 A;  3EI5 A;  3CQ6 A;  3OAK A;  4Y99 B;  3LVL B;  4P7Y A;  4ZSY A;  3WCN A;  3MC6 C;  1U08 A;  2HPC A;  1YJY A;  3AOW A;  1E5F A;  2KYV A;  1IX8 A;  2YCN A;  1LTJ C;  1DH3 A;  3GBX A;  2W8T A;  4RAE A;  1AX4 A;  3TSI A;  3IHJ A;  1W2E A;  2CPB A;  1V2F A;  3A5T A;  2VMW A;  2GUV A;  3FQ7 A;  3KDP B;  3RK3 B;  1D7R A;  1IFD A;  1NO4 A;  2VMX A;  5CCH D;  5CJ0 A;  1IFM A;  4WYF A;  2CH1 A;  1N31 A;  5APY A;  1AJR A;  1GC0 A;  3ZZJ A;  2BHX A;  4DOJ A;  2QSR A;  3UWC A;  1URQ B;  2CY8 A;  1J04 A;  3N4X A;  3QM2 A;  3IFM A;  2Z9W A;  3CLQ A;  3AEN B;  3GJU A;  4J5U A;  1X29 A;  3KQG A;  3AOV A;  2YOB A;  3GHG B;  4O6Z A;  2YKX A;  1J1D C;  4F5J A;  5DB5 A;  2QB3 A;  3B5N C;  1N7S A;  2YO3 A;  1SQQ K;  2XV5 A;  2AY9 A;  5AW9 B;  4XJL A;  3FZ8 A;  3HE4 B;  2WT7 A;  2JJF A;  2PAJ A;  3E2Z B;  3RL0 D;  3SWY A;  1MDZ A;  2P7J A;  2VGU A;  1NHL A;  4HH2 A;  1O61 A;  5G2Q A;  2VI8 A;  4EMY A;  1FZC B;  1AHF A;  1KL1 A;  3K28 A;  1MFZ A;  1H0C A;  3WGC A;  4W80 A;  2O01 H;  4WD2 A;  2N1T A;  2F8J A;  3DC1 A;  4Y99 C;  4W7Z A;  5E4Z A;  1TAS A;  2AY5 A;  2JJH A;  2EPJ A;  1BQA A;  3OJA B;  1G7X A;  4ZKP A;  5AW1 B;  3M0D C;  1FC4 A;  1CZQ A;  2ZUK A;  3BVH A;  3NXS A;  2CH2 A;  5BVZ A;  2HP1 A;  3JZL A;  4UHM A;  1JY3 O;  3VP8 A;  2OQX A;  3RI6 A;  4W1W A;  1A02 F;  3L37 A;  3EZ1 A;  2QM8 A;  1BJW A;  3COG A;  2E7U A;  2XBN A;  5CCH A;  1KMK A;  1FDM A;  3E1I A;  4I8A A;  2OAT A;  1SQB K;  2QA3 A;  3H32 A;  4JYB A;  2QMA A;  2C7T A;  3GZD C;  3EI8 A;  1JUN A;  3E9K A;  3AEM A;  1CS1 A;  1PMM A;  3GHG C;  1QJ5 A;  3KGX A;  4GEB A;  5DJ9 A;  3E6G A;  1BJ4 A;  3B1E A;  3GET A;  2GSA A;  4CXQ A;  1RE4 A;  2WSF H;  1JY2 O;  1LTI C;  3VMX A;  2X8U A;  5D5S A;  5AVQ B;  5CCG C;  1MLZ A;  4ZDP A;  1BQD A;  3U1A A;  1JCC A;  3AEJ C;  4N3Y B;  4IFM A;  4UHN A;  1VEF A;  1VP4 A;  4PIW A;  1AAM A;  1L4A C;  1SZU A;  3OKS A;  3WGB A;  4JEW A;  5AW4 B;  2C44 A;  1CI6 A;  3V4W A;  3HBX A;  2Z9U A;  1YNU A;  1SFC A;  1S0A A;  1FZC C;  2POH A;  1AJS B;  2FYU K;  1IFN A;  3K40 A;  1HVV A;  1JTH A;  2HOR A;  1LK9 A;  3FKD A;  1B9H A;  1IAX A;  2X5D A;  4CVQ A;  3EI7 A;  4FL0 A;  1X0M A;  1WYV A;  2BI1 A;  1QIR A;  3OP7 A;  1LT9 B;  2BI2 A;  4IXS A;  2A45 H;  1M0O A;  1NH4 A;  1VJO A;  2W7M A;  1T2K C;  4ADE A;  4W7Y A;  2VGW A;  1ASG A;  5HHY A;  1SQX K;  3ISL A;  5BJ3 A;  1FU1 A;  4LGD E;  5EIG A;  4CBR A;  2WK8 A;  1N73 A;  1FJK A;  5AVY B;  5G0A A;  3T97 A;  1S9K D;  1FAV A;  2ZP7 A;  5JAY A;  3NU7 A;  3BCA A;  4OMA A;  1LC7 A;  1FZA A;  3RK2 B;  3BCB A;  5BJ4 A;  1L0L K;  3DXW A;  1GL2 B;  3ECD A;  3H9X A;  2YNY A;  3ZRQ A;  2DKB A;  2JJE A;  1IFJ A;  4ITX A;  2FFD A;  4H63 Q;  3ASA A;  3M5U A;  4WY4 B;  4WYC A;  2OYH B;  1N2T A;  2AEV A;  2KP8 A;  2YKP A;  1MUU A;  3DYD A;  4N78 D;  1T3U A;  3R2P A;  4A6R A;  2VMT A;  5BU8 B;  2CJD A;  3P1T A;  3A9X A;  2Q5U A;  1DTY A;  1I48 A;  4O9B A;  1SZS A;  1NTM K;  1WKH A;  4K2B A;  3TNU A;  1ARI A;  1RF1 B;  1X9V A;  2CST A;  4XQ2 A;  1LWU B;  2X5F A;  1LT9 C;  3WMM 0;  4PVF A;  3HUS B;  1S08 A;  2CJG A;  4ZKU A;  1TAR A;  2C81 A;  3DXV A;  3FFH A;  3WLX A;  4C7N B;  2AY3 A;  1ZV8 A;  1VPC A;  2CTZ A;  4OBV A;  4RJY A;  1SF2 A;  3A2B A;  5EFS A;  2Q3I A;  3WY7 A;  5AW8 B;  3H6P A;  1FBM A;  2YHK A;  4UHO A;  3FFR A;  1AY5 A;  1RV4 A;  3BS8 A;  1TAT A;  1OXP A;  1YTZ T;  3HTK B;  1ECX A;  4GE7 A;  2FM1 A;  4TMR A;  4F5I A;  3NYT A;  5FT4 A;  3QBO A;  3RCH A;  3RK2 C;  1GL2 C;  4ZM3 A;  1GDT A;  3IR9 A;  2R5C B;  3LIE A;  2HUU A;  5KTB A;  2G6W A;  1MAQ A;  1QL1 A;  1UU0 A;  1IO4 A;  4WY4 C;  3VOP A;  1PG8 A;  4DZO A;  2ZY5 A;  2OYH C;  2XH1 A;  4R5F A;  5M4B A;  4JEZ A;  3PDB A;  1BW0 A;  4R2N A;  4AZJ A;  1CQ6 A;  1Y4I A;  3VTP C;  1SZK A;  2OYI B;  3HDO A;  3I5C A;  1W7L A;  4DGT A;  4P3M A;  4M2J A;  3M91 A;  2EZ1 A;  5EUD A;  2YO2 A;  3PA9 A;  5AVX B;  1M1J B;  1G4V A;  2ZFC A;  1RF1 C;  1TPL A;  2AY6 A;  3BB8 A;  3LWS A;  1LWU C;  3NDN A;  3RK3 D;  2VMN A;  1HBW A;  5FT6 A;  2D7Y A;  2WZ7 A;  2JEE A;  1LW5 A;  3HUS C;  3NYS A;  3RBL A;  4A6T A;  2HG5 D;  3M9B A;  1URQ D;  1NKN A;  2EZ2 A;  1ZOD A;  3Q8N A;  3TYY A;  1GK6 A;  3QPG A;  3VAX A;  4OBU A;  3CI9 A;  4DBC A;  2CB1 A;  1M32 A;  3JWA A;  4M2K A;  3VK4 A;  1J32 A;  4HYT B;  1YIZ A;  3HD7 A;  3NUI A;  5FT8 A;  2Z9V A;  4F5F A;  1JS3 A;  2EGY A;  4OTL A;  4OYT A;  2WB6 A;  1G2C A;  5CCG D;  1EQB A;  1LC5 A;  2IFM A;  3L44 A;  1DJE A;  1DKA A;  3QN6 A;  3ACZ A;  1MDO A;  3NUB A;  2NPS B;  5AVZ B;  4JEX A;  1XEY A;  5APV A;  3P7K A;  3P8M C;  5M49 A;  1RE3 A;  3MUD A;  1RF0 C;  1C7G A;  2AY4 A;  4K2I A;  1UKJ A;  1QZ9 A;  3HQT A;  3VYI A;  4WBA A;  4A0R A;  4MQP A;  1IJI A;  3VK3 A;  2OYI C;  3WKS A;  2YKU A;  1AHY A;  4BMK A;  4OCA A;  1JY3 P;  3GR9 A;  1MDX A;  1ZR2 A;  1AIC A;  3MKJ A;  3LY1 A;  1RV3 A;  2PO3 A;  1GW4 A;  4F4E A;  3NTN A;  2QB2 A;  4IW7 A;  1M1J C;  4HF8 A;  1AMQ A;  4ZSW A;  1HH0 A;  2O0R A;  2XU6 A;  1B5O A;  4LNM A;  4WXB A;  1GEY A;  2WPR A;  1KIL A;  1KL2 A;  3U59 A;  3ZRR A;  1LTS C;  2HPC B;  1LKC A;  4WP0 A;  3L35 A;  2R5B A;  4ISY A;  1NTK K;  2D63 A;  3PIU A;  3FQ8 A;  1GC4 A;  5AVU B;  1TOJ A;  1URQ A;  2BI9 A;  2W7G A;  4RIZ A;  2WTY A;  1RVU A;  1GD2 E;  1W3U A;  2AY2 A;  1AIB A;  1M0P A;  3V2Q A;  5APS A;  2AAT A;  4DQ6 A;  5J8Q A;  3EI9 A;  3JW9 A;  4AUW A;  2H8P D;  3EFG A;  4LW4 A;  2BYJ A;  3V5B A;  3TQX A;  2EO5 A;  2Z4E A;  1DFO A;  7AAT A;  4Y0D A;  3ASB A;  1JNM A;  1B9I A;  2NPS C;  4B98 A;  5KLV K;  2IFN A;  4ATQ A;  1SQP K;  1I41 A;  1L4A B;  4W5K A;  1IK9 A;  4IYO A;  3AEP A;  4R8D A;  1N7S B;  3A8U X;  2DOU A;  1GEW A;  4AO4 A;  1W23 A;  2JJL A;  3CAI A;  2FKI A;  3KPE A;  2ZYJ A;  1GTW A;  4WB0 B;  4AQR D;  4Q6R A;  2WT7 B;  2ZY3 A;  4A0G A;  5AVW B;  2AY8 A;  1V2D A;  1D2F A;  1H89 A;  4ZDL A;  5APX A;  2XDJ A;  4EFF A;  1KZU B;  1LTB C;  5CJ4 A;  4Q76 A;  3CQ4 A;  1W7N A;  3NTJ A;  4W1V A;  4MQR A;  1J1E B;  1KKP A;  4A00 A;  3V4Q A;  2GMU A;  2WKA A;  1AY8 A;  5E3K A;  3FRK A;  2N1T B;  4XE5 B;  3PPL A;  2CIN A;  4M2M A;  3AV7 A;  2C0R A;  1UU2 A;  1KMJ A;  1DGD A;  5DJ1 A;  2YRR A;  4LC1 A;  3UIA A;  3CL3 D;  4F5L A;  2P2U A;  4RM1 A;  3NNK A;  1AHX A;  1OXZ A;  3BCX A;  1ASL A;  2TPL A;  3VMY A;  4I6M C;  2W8V A;  3DU4 A;  4E77 A;  2XZR A;  1JMM A;  2BWO A;  1JG8 A;  1LTG C;  4EB5 A;  1S07 A;  4W1X A;  1EQ7 A;  3BWN A;  3H32 B;  3WZF A;  1GW3 A;  1MLY A;  2C9L Y;  3N4R A;  5TF5 A;  1C4K A;  2ZY4 A;  4GIF A;  1XI9 A;  4MQQ A;  3TCM A;  5AW6 B;  1AMA A;  2Z20 A;  2GM4 A;  4Y0I A;  4EIJ A;  1N7S C;  2ZXE B;  2V1P A;  1B5P A;  4F5K A;  4Q31 A;  3NRA A;  2PB0 A;  2HYN A;  2VGT A;  2FYZ A;  3HE5 A;  2R5E A;  3EIB A;  2W7D A;  4RLG A;  4HVK A;  4IXO A;  1DJU A;  3P8C D;  4BHD A;  4JF1 A;  4MSO A;  2HZP A;  5AVS B;  2AY7 A;  1UU1 A;  4UQV A;  1CI6 B;  3HT4 A;  1SFC B;  4GKG A;  3N4S A;  2DGM A;  3M9H A;  1AAW A;  1J1E C;  3OA7 A;  1HTL C;  2I1J A;  3E2F A;  1SQV K;  3FVX A;  1JTH B;  1WT6 A;  2N1T C;  1G1I A;  1X79 B;  2NMP A;  1X2A A;  1KFN A;  3KE3 A;  2DGL A;  1AKA A;  1WYV B;  1WYU A;  1C7N A;  3VP9 A;  2YCT A;  1MGV A;  4K05 A;  2YKV A;  2D66 A;  3F0H A;  3FZ6 A;  3A9Y A;  1OHW A;  1GC3 A;  2YCP A;  3N7N A;  2HOZ A;  1IX7 A;  3NU8 A;  3BAT A;  3II6 A;  1JCD A;  2FXM A;  5E5I A;  3L4F A;  5CCH C;  5M4D A;  1JS6 A;  1WYT A;  1IVR A;  4W8I A;  3B8X A;  1FOS F;  5AVT B;  1ASM A;  2AEU A;  5AW0 B;  4MY5 A;  1LTA C;  4JYC A;  1N73 B;  3AEM C;  3CQ5 A;  4A0H A;  4WLH A;  2ZY2 A;  2HUF A;  3EIA A;  1SVF A;  1V72 A;  4ZDO A;  5KJ7 D;  3ELP A;  1C9C A;  4B9B A;  1SVV A;  3I16 A;  1RE4 C;  1N86 A;  3JTX A;  4XJO A;  2IPP A;  3VK2 A;  1M4N A;  1ART A;  5AW2 B;  3DRD A;  2YKO A;  1CL2 A;  2PP6 A;  1RF1 A;  1GU5 A;  1AQ5 A;  1SFC C;  5CMZ A;  3B8E B;  4IY7 A;  1BJO A;  4GRX A;  2W7K A;  2WK7 A;  3E77 A;  1ZN5 A;  1SP4 A;  3PD6 A;  3NYU A;  2VGV A;  1YAA A;  1NTZ K;  1KQL A;  3TNU B;  4F5M A;  1CSB A;  2P1J A;  4XJM A;  1O69 A;  2X3L A;  2E7I A;  3F9T A;  2A45 G;  1JOC A;  5M46 A;  1ASF A;  3L8A A;  2W7J A;  1NOH A;  1Z56 A;  4WLJ A;  2WPS A;  2QBT A;  2L5G B;  3ZZK A;  2VMZ A;  3WCO A;  3B5N D;  2ZSL A;  2BWN A;  1D7U A;  2WWW A;  5APU A;  1DGE A;  1I29 A;  1FJP A;  4WB4 A;  1S09 A;  2A1V A;  1AKC A;  5G4J A;  3M06 A;  1I43 A;  1PFF A;  2YKQ A;  1AKB A;  1N73 C;  4OH8 B;  3AAT A;  2FKW B;  4XA4 A;  2BI5 A;  4I2L C;  4IFF A;  3VN0 A;  5KJ7 A;  1EG5 A;  4KYO A;  3RCH B;  2XKM A;  2WSC H;  2FNU A;  1M7L A;  1AHG A;  3MC6 A;  2E54 A;  1YJZ A;  3SWF A;  5G4I A;  1FOS E;  4Q75 A;  9AAT A;  4ADC A;  1LTJ A;  1YOO A;  3PDB B;  1JO5 A;  5HDM A;  3PGY A;  4IX8 A;  3G3Z A;  2BIE A;  2Q7W A;  2HOY A;  2KOG A;  2Z5H A;  2HOD B;  1M6S A;  2BYL A;  2W7L A;  1IBJ A;  4XK1 A;  3BC8 A;  2D5Y A;  4WYD A;  2G7J A;  3NFQ A;  2FNI A;  2W8W A;  2CJH A;  3MAF A;  4GDY A;  3T32 A;  2VMU A;  1X8Y A;  4OC9 A;  2VIA A;  4ZLV A;  1P3W A;  5IWQ A;  3WX9 A;  1QIT A;  2R5D A;  2V0Y A;  3JWB A;  1YYC A;  4B86 A;  1WKG A;  3ZRP A;  1ZR4 A;  2VYC A;  3B5N A;  2OKK A;  2BAS A;  3R4T A;  1LC8 A;  4CBS A;  1MZ9 A;  1D7S A;  1L4A D;  3KKI A;  3HVY A;  2HLO A;  3HD7 B;  4AH3 A;  1SLQ A;  1ZLL A;  2M8R A;  2YMY A;  1LGH B;  1AHE A;  3W1J A;  1G2C B;  1O62 A;  4UOY A;  2BKW A;  3BRV B;  2D7Z A;  3UE8 A;  1ASE A;  1M0Q A;  1GK4 A;  2QLR A;  4XAU A;  1BJN A;  3H7F A;  2I1K A;  4A6U A;  1ELQ A;  5AW3 B;  1S9K E;  1IAY A;  2D61 A;  1AMR A;  4WYA A;  2FN6 A;  1QIS A;  3M0D A;  1HWT C;  5EUN A;  1DEB A;  1IX6 A;  1FZF A;  4N0W A;  1CQ7 A;  1OHY A;  3LVJ A;  4XEW A;  5G2P A;  1T2K D;  2VMS A;  4AOA A;  2R32 A;  4N6J A;  4ADB A;  3QGU A;  3NMD A;  2R3C A;  2FQ6 A;  1KKJ A;  4A0F A;  3QI6 A;  4E1O A;  2BWP A;  4LNJ A;  3HMU A;  1BKG A;  2H43 A;  1HJB A;  4PFF A;  3TAT A;  4Y0H A;  3GZD A;  1SPA A;  1D7V A;  4WXG A;  4WYE A;  3AEN A;  1ARG A;  3LVK A;  4N78 E;  1KIL B;  3GHG A;  2BI3 A;  3BV0 A;  1JY2 P;  4NOG A;  2AY1 A;  1XTC C;  3M0A A;  4W91 A;  4WXF A;  2Z5I A;  3A7O A;  1MAP A;  1QJ3 A;  3W1I A;  5CCG A;  1T8Z A;  4J8L A;  1CW5 A;  3AEJ A;  2DR1 A;  3HE4 A;  3EZS A;  2E7J A;  4ADD A;  3E2Z A;  1L4A A;  4FFC A;  3HD7 C;  4BA5 A;  4E3Q A;  3LV2 A;  1WRG A;  3M9Q A;  3LG0 A;  2MJZ A;  3FZ7 A;  3RQ1 A;  4CXR A;  1FZC A;  1T3I A;  3A2A A;  2PB2 A;  4WB0 A;  1HGV A;  2Z9X A;  1GCK A;  2W7E A;  2WK9 A;  3VOM A;  2KFP A;  3I4J A;  2O1J A;  2W6A A;  2DGK A;  2J59 M;  2VMR A;  2D65 A;  2ZJG A;  4BA4 A;  2OGA A;  3FSL A;  4RES B;  1OXO A;  1SFC D;  4IYO B;  1CQ8 A;  4AO9 A;  4KHX A;  1RE3 C;  4I1L A;  3G0T A;  4EOT A;  3KYQ A;  2XNX A;  3C9I A;  3MEB A;  1IFI A;  1EJI A;  3TFT A;  3B1D A;  4ZAH A;  3AEL A;  3D6K A;  1B8G A;  1GEX A;  3U1C A;  4ATP A;  1C7O A;  3G7Q A;  2C0W A;  2Z1Z A;  4L0O A;  2EH6 A;  1JY3 N;  3PP5 A;  1Z3Z A;  3II0 A;  2BIA A;  4AYC A;  3LID A;  1TOE A;  3RK3 C;  3I5T A;  1KIL C;  3B1C A;  3RUY A;  4RKD A;  3MGN A;  1G4X A;  1TOI A;  1FZB A;  3RK2 D;  1CZC A;  1B4X A;  1GL2 D;  2VLF A;  1N2D C;  1J2J B;  3N0L A;  1E5W A;  3TFU A;  1URQ C;  3BAS A;  2H7H A;  2W8J A;  3DR4 A;  4WY4 D;  4IXZ A;  1NKZ B;  5D95 A;  3A3Y B;  1YIY A;  1JY2 N;  1L0N K;  1MV8 A;  3NX3 A;  1CJ0 A;  2W27 A;  1G1J A;  2CAN A;  3RBF A;  4C46 A;  1OAT A;  2HFE D;  1OHV A;  3MAU A;  1NAF A;  1AJS A;  2C9N Y;  4E3R A;  4XJP A;  2EYQ A;  5AW5 B;  3RL0 B;  4K2M A;  1XTG B;  1RVY A;  1QL2 A;  3N75 A;  1YJS A;  3LW5 H;  5HXX A;  3DZZ A;  2VLH A;  1LT9 A;  1VDF A;  3HE5 B;  4ZM4 A;  5BU5 A;  4GSA A;  4U2H A;  4TN4 A;  3F6T A;  3P6K A;  2LKM A;  4JEV A;  2ORD A;  1HGZ A;  2VMP A;  3QHX A;  1AIA A;  5DX5 A;  1ELU A;  1FZE A;  5K8B A;  2W7F A;  1M0N A;  3ATH A;  1ZC9 A;  3BWO A;  4OT8 A;  3GSB A;  4R5Z A;  2VMQ A;  1O4S A;  4LC3 A;  3FVS A;  4C7R A;  2HP2 A;  1G7W A;  1WYU B;  2IX7 C;  5EAA A;  1GL2 A;  3MBB A;  3HRN A;  1CL1 A;  2ZC0 A;  1NWQ A;  2O1K A;  5EIG B;  2Z1Y A;  4JEY A;  3P32 A;  2CFB A;  4PFN A;  2E43 A;  1PFI A;  4F5H A;  4WY4 A;  2O7C A;  5AX8 A;  1H1C A;  2OYH A;  2Q7C A;  1ASA A;  3MTU E;  1BT4 A;  1GC2 A;  1WYT B;  4A72 A;  2C0X A;  2VMO A;  3BWN C;  4QGR A;  5EAV A;  1DJ9 A;  4RJ0 A;  5FT5 A;  3FDB A;  2FFD B;  2ZSM A;  3FCR A;  3PAA A;  1LTT C;  3G8M A;  3HLM A;  1N7L A;  3FDD A;  2QM7 A;  2JG2 A;  2OAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...