3N4XA

Structure of csm1 full-length
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
163
structure length
149
Chain Sequence
b'SADLLVANLVNENFVLSEKLDTKATEIKQLQKQIDSLNAQVKELKTQTSQQAENSEVIKDLYEYLCNVRVHKSYEDDSGLWFDISQGTHIMDYKLGFVVTEVIYAPVLKQRSTEELYSLQSKLPEYLFETLSFPLSSLNQFYNKIAKSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Monopolin complex subunit CSM1
publication title The Monopolin Complex Crosslinks Kinetochore Components to Regulate Chromosome-Microtubule Attachments.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Replication
total genus 48
structure length 149
sequence length 163
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12539 Csm1 Chromosome segregation protein Csm1/Pcs1
A PF18504 Csm1_N Csm1 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3n4xA01
3.90.1150.80 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3n4xA02
3BATA 3N4SA 3N7NA 3VP9A 4ZKUA 2JEEA 3OJAB 1X79B 3N4RA 4I1LA 5KTBA 4GIFA 3U1CA 1NKNA 3U1AA 3N4XA 1IC2A 4N78D 4O9BA 3HRNA 4ZKPA 3U59A 5BU8B 3VP8A 3C9IA 2FXMA 3BASA 4N3YB 5BU5A 3P8CD 2POHA 5BVZA 1WT6A
chains in the Genus database with same CATH superfamily
1DGEA 1M6SA 1M32A 3RL0B 3UE8A 2O1JA 3WU2H 3ISLA 1SQVK 4Y99B 3QHXA 2A1VA 1I29A 2ZXEB 1KKJA 4AOAA 5EFWB 1NO4A 4PD4E 1IVRA 4KAMA 1PIXA 4WWIA 1N73B 1HJ0A 2NPSC 1VQLP 1AKBA 4A00A 4NPFX 3GMAA 3L75D 1ZODA 4EOTA 3BCXA 3A0HE 2R5EA 4ADDA 4LGDE 1ZMEC 3DXWA 2E75D 3R4TA 4RKDA 3Q2YA 1CZCA 2DGKA 3L8AA 4U1TA 2QM8A 2K1AA 3CCUP 3L72D 3ITKA 1NTZJ 4B9BA 1X9VA 2OARA 3HD7D 2WSEJ 3L4FA 5M4BA 1SPAA 1HVVA 5K5GB 3VMZA 2FYNC 2CTZA 3E2ZA 1YJYA 4OT8A 5CCGA 2AXCA 5HXXA 1U08A 2Z9WA 1NU1K 1JY2P 4NPEA 1S07A 4ADBA 4YPCA 3AOWA 3KKIA 4TN4A 2QSIA 3JTXA 4AO9A 1AQTA 3PRJA 2W83C 2FFDB 2BIEA 2VGSA 4C7RA 1GDEA 2ZT9B 3WU2E 3BASA 2IYPA 5EQCA 4L73A 3FD0A 1R5LA 4MN4C 4MY5A 3RGUA 1OHYA 3NDNA 2N1TB 4OBVA 1KYOI 2IBZI 1L2PA 1ZP0C 1SQVJ 1ZW0A 4ZKUA 1RF1B 1SZSA 1M0QA 2JO1A 2G7JA 1WYVB 1QIRA 3F0HA 3N75A 1EZVG 2FN6A 4R2NA 3HTKA 5KJ7A 1FDIA 1AJSA 2KSEA 4XJOA 2N9YB 2FXMA 1BQDA 1OWAA 7AATA 3A2AA 5CCGD 4WXBA 4JEYA 2Z5IA 4U3FJ 1EZVE 1ASGA 4R5ZA 5E5IA 2BYJA 1NTMG 3OP7A 2L5GB 1GEWA 3H1KG 1ARIA 1IJIA 1XEYA 5B66H 1TOIA 4RJTA 2C81A 1M4NA 2YO2A 4H0LB 2VMTA 4XQ2A 4UHOA 2CFBA 3OA7A 1JTHB 3BB8A 1GK4A 2EYQA 3AEAC 1PL5A 3MP7B 1L0LD 1AHGA 4BA5A 1N86A 3H1KE 2FYUE 1PFFA 1DJUA 2EZ2A 3H6PA 1O62A 3A9ZA 5AVWB 3N7NA 3L74E 5K8BA 3OJAB 1SS1A 1G7WA 3K5BA 1NYHA 3TK1A 2J59M 3HRNA 1S0AA 2Z4EA 4YXWH 3LG0A 3BRVB 2WPVB 5G2QA 4GOFA 5KLVG 1KFNA 2QG4A 1ZLLA 4GE9A 5KJ7D 1G2CB 3AE7C 3FKDA 1VQ8P 1I43A 2V0YA 4WY4A 2BKWA 1RE3C 1KTMA 4R4LA 4ZASA 3MUDC 4HVKA 5APVA 5KLVE 3VN0A 1FOSE 2FNUA 3AEJA 4GRXA 4Q31A 3HUSC 3E6GA 4D6TD 4L74A 3AE9C 2WITA 3V2QA 3DC1A 4MQPA 3PPLA 1BGYD 2GQNA 1RVUA 2WK9A 3GHGB 2QE7H 1WYUB 4DOJA 3FZ6A 3KGXA 4O6ZA 3TFTA 1Q86Q 3CX5H 5B66E 1AHFA 1DD3A 4ZLVA 2D61A 1RQUA 3RL0g 1IJDB 4LNMA 4IY7A 1KQLA 1Z56A 3FRKA 2QEXP 3BWNC 4A0RA 3RK3C 1JCDA 2I1KA 3B8EB 1W23A 1H0TA 1YQ4C 2E76C 4ZNCA 2CJDA 1W2EA 1HJBA 3WUVA 3V4WA 1LTIC 1SZUA 3AV7A 2ZYJA 1TU3F 4LLHA 4UOYA 3HLMA 4UB6H 2WTYA 3MBBA 4WY4D 1W2BO 3NYUA 3MGNA 2YXRB 2E54A 3TFUA 3H25A 1SQXG 3D6KA 2HG5D 3G6EP 2BYLA 3T97B 1C4KA 1VQPP 3JCUH 3MIWA 3E7KA 1L0NG 2R5BA 1IO4A 2VGWA 1USDA 1AMQA 3WGBA 3WLXA 3PD6B 1FU1A 1KYOH 1VF5B 3RL0C 1OHVA 3BCAA 4ITXA 2OYHC 1X29A 2Q5UA 1Y8AA 2D7ZA 2XH1A 2Y9ZA 1X0MA 3H1LJ 1L0NE 3GF3A 4HB1A 3SWKA 3WUTA 4H63Q 1ZC9A 8AATA 4EDFA 4BRYB 1SFCA 1O4SA 2EO5A 2X8UA 1ORDA 2QM7A 1IFJA 3N4RA 2HFED 1GU4A 1QVFO 4K2IA 1KMKA 3NTNA 4UHMA 4E3RA 2CANA 2EGYA 2NMPA 1LTSC 4LNJA 3DZZA 1URQA 1OZHA 2BHXA 1KC8Q 1GEXA 2K9JB 3WY7A 2D2CC 4PVFA 4RKCA 3N5MA 3KDPB 1N73A 3IFMA 1YJ9P 5AVZB 4CXRA 1CJ0A 1YBKA 4J5UA 2HR3A 3CWBJ 2WQYC 1JG8A 4ITGA 1Z3ZA 3H1JE 4UB6E 3BWOA 3EIAA 5KKZB 3LWSA 4CBRA 3U59A 1GW3A 3JCUE 1FZAA 5APUA 4BXLA 3FQAA 3EZ1A 4P7YA 3T32A 3KE3A 1SFCD 4GSAA 2O1BA 1KB9I 2IBZE 1S5LX 5DJTB 2YKOA 3JW9A 2WSCH 3CI9A 2GA1A 5AVUB 1M7YA 2D66A 1MUUA 4CXQA 1PP9E 5EUEA 3P8CE 3Q8NA 2D7YA 5AW9B 4B86A 4DGTA 4R5FA 1EZVD 1URQD 2IX7C 2CINA 4PV1B 4M2MA 4ZDOA 1JY3P 3KQGA 4A6RA 1KQFB 3WUUA 1RY3A 5BVZA 4N6JA 3L70G 1OXPA 5FT8A 1MFZA 1YI2P 3M0DA 5AVQB 3N0LA 1DEBA 1NTMD 3ZRPA 1LWUC 1SQBE 3F9TA 3H1KD 3KXDA 1J1EC 2N1TA 3A7OA 1MV8A 1RF1A 1LT9C 2HOZA 1GC3A 2OKJA 1PG8A 2XNXA 1VJOA 1CI6A 2K3RA 3L74D 1PMOA 3L37A 1BSHA 1AAWA 3RBXA 1YJZA 2POHA 2KS1B 3CCJP 3C8VA 4PJ0H 5KAIH 4JEXA 1I41A 2NPSB 5AW8B 5C39A 4AZJA 2YCPA 4ADCA 1YQ3C 1D2FA 1W7NA 3EFFK 4ASWA 4W1WA 5KLVD 1LT1A 3OAKA 3WMM0 1O69A 4ZWMA 2A06G 1BE3J 2GSAA 4XEWA 2V4HA 1K9MQ 3UAKA 2CJHA 2ZT9D 3VP9A 3IN6A 1S72P 5EUNA 1OATA 1AHEA 1U7JA 2A06E 3EZSA 5JAYA 2JDIH 3LVKA 4ZDLA 4C46A 3WCNA 2N1TD 2KFPA 1SQQK 1B9HA 1JEKA 1ASFA 2FYNB 3KZIH 2FM1A 1OVUA 1FDMA 3RBLA 1S9KE 2JG2A 5EUDA 3NFQA 2R5CA 3GHGC 1VQ5P 4OVNF 1AJRA 3QM2A 3VK4A 2ZAEB 1G2CA 3IR9A 1VDFA 1AY4A 2QA3A 1O61A 5APQA 1CQ6A 1SQPJ 2XV5A 1OIPA 3CL3D 1QGKB 3L71G 1S5LE 2QSRA 3I56P 4XAUA 4PJ0E 4RITA 2BI2A 5APTA 5KAIE 2JJGA 5CHXA 1T6AA 1DIPA 1WYUA 4TMRA 3GF7A 2M3EA 2Z61A 3BCCG 3MAFA 1PZQA 1SQXD 2OGUA 4OGQC 3L71E 3EI7A 1L0ND 5TJHA 5EIGB 2WSFJ 2WT7B 5HHYA 4IXOA 3WZFA 3UIAA 1QL1A 1EG5A 1Y47A 2BI5A 2ORDA 3MC6A 2H88C 3IF4A 1QGNA 1SF2A 3L44A 2WWWA 4N3YB 3SSUA 5CCHC 1HTLC 4A7PA 1MAPA 1QJ5A 1FZCC 1OW8A 2DKBA 1AMSA 4WLJA 3KZIE 3F6TA 1SQQJ 4Z1MH 2VMPA 1S09A 2KK7A 1RQVA 2KNCB 3CCLP 3PTZA 4BMKA 1AHYA 1DFOA 4GODA 4WB0A 2K37A 2FXPA 3H7FA 3PD6A 2BCCJ 2VYCA 1YJNP 1JS6A 2C0WA 5FT4A 4OWFA 5AW3B 1ZOBA 1EDIA 1T2KC 4JEZA 3M9BA 1L4AA 1OHWA 3M91A 4WVZA 3AEFC 4BRYA 2WMMA 2H43A 2HODB 3H1HJ 3FVSA 2CH1A 2YMKA 5DX5A 3L73J 1JF9A 2AEVA 3HVYA 2G3AA 4OMAA 5HDMA 1W5CE 3FX0A 1V72A 4N0WA 3HUSB 1UKJA 3P8CD 4EIJA 3PDBA 1KB9E 1RF0C 3A3YB 3Q1MA 3K7YA 3PJSK 1OVRA 4AQRD 1C9CA 1SVFA 1NJIQ 2CPBA 2E5TA 2WPQA 3A0HH 1NGMB 3RQ1A 3GZDA 1LS3A 1AY8A 2Y0EA 3H1IJ 1PFIA 1B4XA 1JM0A 1P84I 1VF5D 3P7KA 3AE4C 5AX8A 3QGUA 4GKGA 3L70D 1LGHB 1BGYE 1KQSO 3C1LA 1GC0A 1DJEA 1L4AD 1LTTC 2QA4P 1K73Q 1D7UA 2Q3EA 2E76B 2JWDA 4WYAA 1HGVA 4JF7A 2CK3H 2ZFCA 4E77A 3DRDA 4WYFA 1TOKA 4MQRA 2C0XA 1RVYA 1KD1Q 2CY8A 3S4RA 3PH0A 5CBNA 1VQ9P 2DW3A 4M3LA 1BCCG 2EZ1A 2QVAA 3CC7P 1J2JB 4IYOB 2OYHB 3FSLA 1KL2A 2YKXA 2H7HA 4RAEA 4GOEA 3E9KA 3K40A 4N78D 2JWAA 2GB3A 3P8MC 2KI7B 2KIKA 5H2FH 3USFA 1HF9A 4BHDA 2A06D 1RE4C 2KP8A 4CBSA 1NTZG 1BCCJ 2W7EA 3CMAP 3GSBA 4P3MA 2DKJA 1FZEA 3G71P 2PGDA 1N7SC 1S9KD 3EI6A 2LXBA 2KS1A 2FXOA 2V7QJ 2YRRA 1IFIA 1IFPA 4LW4A 2D2CB 2K9YA 5GTIH 4WBTA 2Z9XA 1N8RQ 4M2JA 1U7MA 4GDOA 4ATQA 2AEMA 4F5KA 3V2RA 3GETA 5D5SA 2KSJA 2HOYA 2YIUC 1Y9BA 2QIWA 4PV1D 4RESB 1YTZI 2AY3A 4EMYA 1EQBA 3CCRP 2BWPA 5DB5A 2OTLP 1HBWA 3DR7A 2TPLA 4Y0DA 3CQ5A 2FYFA 5M4DA 4F5MA 2QLRA 1SQVG 1LTBC 3ZRRA 5AVTB 1KILC 3L71D 1LK9A 1Q90D 3OW2O 1DKAA 2Z5HA 1KN7A 1GCKA 2R5DA 1S3JA 2HORA 3RK3E 3AEGC 2VMUA 3BCCD 3AEOA 1GD2E 2FYUK 2VMVA 1Q82Q 1J1DC 4H44D 2Z9UA 3FFHA 2GM4A 1M57D 4RO0A 3AEPA 3EFGA 5H2FE 3AECC 3TCMA 1D7SA 4U3FG 4Y0IA 3LIDA 1GC4A 2HZPA 1K04A 1FS0E 3A9YA 1SZKA 3NU8A 3VAXA 1HUCA 1B8GA 2R44A 3QPGA 1WT6A 1QLED 3E1IA 4U3FE 3CD6P 3NYSA 2VMZA 5AW6B 1LWUB 3H32B 2K88A 1J1EB 1P84H 1CS1A 4K05A 1RH5B 5BJ4A 5GTIE 3AE8C 1LT9B 4RIZA 1FDOA 3LVJA 1MDXA 4WB4A 2PRRA 3M06A 2JGTA 1VQOP 4LNLA 3N4XA 1NU1G 1KFMA 5AVYB 4IW7A 4O9BA 2XDJA 1SVVA 2R32A 3V2NA 1R8EA 4I8AA 3BC8A 2Z1ZA 2XBNA 2WT7A 2YRIA 2YXQB 2E7JA 1LJ2A 1NTME 2ZY4A 3A9XA 3TGUG 5G4IA 4W91A 1BJOB 5DJ9A 1LTJC 2BIAA 2VIAA 1UU1A 2DGMA 1NU1J 1X0TA 2BASA 2WPRA 2BI9A 1AKAA 1IFDA 5AW5B 2IDBA 2DR1A 2PAJA 1UIXA 5AVRB 1KB9D 4ZKPA 4UHNA 2JP3A 1M7LA 2R3CA 3TGUJ 1QJ3A 2KLVA 2IZ0A 2E42A 2RFVA 2KNCA 2C44A 2VIBA 4WXGA 2FYUJ 1CSBA 4UB8H 3N4SA 2WB6A 3CBFA 2ZVOB 3GZCA 1X22A 4Q6RA 1IC2A 4PIWA 4ZM4A 2W7LA 4MKKA 3PP5A 2W7KA 4PFNA 2H89C 1JMBA 2HYNA 2HODA 1N2DC 1P84E 2YHKA 2OQQA 4J8LA 2AY7A 1L0NK 4QMAA 1MFTA 1OW7A 2R0TA 4HF8A 1RE3A 5EAAA 4FL0A 4BWNA 3MD0A 5FT5A 1YYCA 4Y28J 2B88A 3L35A 5EFSA 1IX6A 2X5DA 1YIYA 2P2UA 3IAOA 5CMZA 1BT4A 3JC22 1BJ4A 4OGQB 1ZV8A 3BV0A 2NZ2A 1JY2O 1NTKK 4MSOA 4U7JA 3FCRA 3H1LG 3CCQP 1JO5A 4I7ZC 1T8ZA 4XE5B 3AE2C 1TOEA 2E74B 1EDKA 3U1CA 3BWNA 1TASA 1M0PA 1SP4A 2D64A 4GE4A 2JJHA 1SQXE 4UB8E 1FZCB 1NTZD 1FC4A 2W6JH 1JNMA 1OX3A 2ZYGA 3HMUA 4E3QA 1E5FA 2AEJA 3HE5B 4HJGH 1YOOA 4NOGA 2AEFA 5C6UA 3BS8A 4U2HA 1M1JC 1WYTB 2QJPC 1B9IA 1URQC 3CWBG 5BU8B 2OYHA 1AJYA 1AX4A 4ZSWA 3ASBA 2IFNA 1UU2A 1GL2B 1PV3A 2ZSLA 4RKUJ 2R3SA 1MLZA 1XI9A 2OTJP 2LKMA 2WK7A 3RK2C 2BEZF 4WYDA 4CVQA 2JISA 2HUFA 3CWBE 3CXHD 1C7NA 4JYCA 1IK7A 3RK3D 1H0CA 3A0BH 1SQVD 2M5AB 2E76D 1SQBK 4AZKA 5GTHH 2B87B 1NTKJ 2OQXA 3EUCA 2W90A 1WSTA 2OYIC 1AQ5A 1EJIA 1NAYA 1G4VA 5E3KA 1ZXGA 3LW5J 2AXTH 1BSNA 1S2EA 3NUBA 1VEFA 2JJEA 2V1PA 3NX3A 1LKCA 3W68A 4U3FD 3RL0D 1X8YA 3CC2P 1JUNA 3H1JJ 3EWKA 3B1DA 4XJPA 3Q5PA 1IZNB 2P10A 3F5HA 4KHXA 2ITAA 2Z1YA 3GJUA 3NYTA 1LTAC 3MAUA 1T3UA 2E7UA 5AW4B 2FFDA 1IAYA 3TF5A 3HD7B 1M0OA 2AEUA 1LC8A 2KYVA 3W1JA 1C0NA 2RKLA 3TNUB 1VPCA 1PP9J 3JWAA 4ZAHA 3AEMA 3L70E 2B9BA 3QWOC 2Q3IA 1AKCA 2CSTA 1FJKA 1LNQA 1WYVA 1BQAA 3I16A 4A0FA 3A0BE 1S5LH 1BE3G 2IPPA 4OCAA 3SFEC 4KJMA 2LXCB 3PHLA 5GTHE 2OATA 3EI5A 4B98A 3GG2A 3COGA 1LWUA 1RHZB 3H32A 1ASLA 2PO3A 3QI6A 1SQBJ 1OFCX 1GD9A 2BWNA 4LC3A 1LT9A 5M46A 2WSFH 3B5NC 5AVXB 2KB7P 2FNIA 4DCKA 3CCEP 3II6A 1H8AA 1N7SB 3FDBA 1KMJA 1TARA 1C7GA 2AXTE 3CAIA 4N78E 3VMYA 1FG3A 1JTHA 2JEEA 1OXZA 2KZIA 1P84D 2C9NY 1BJOA 5G09A 3UWCA 3E2ZB 1ZR4A 5KAFH 1GBNA 3TDKA 2KOGA 2YIUB 3AE1C 1MDOA 2J5UA 1EDJA 4H13C 2C7TA 4DQ6A 4W5KA 1SQPG 2WSCJ 1ZR2A 2Q1KA 1JOCA 1JB0J 2I8DA 4ATPA 2AY4A 3AENB 3Q5RA 1KILB 1USEA 3L72G 5J8QA 1SQPE 2AY1A 3L75J 1UIIA 1IK9A 2W8UA 3FWNA 1MZ9A 3ZZJA 3R4YA 4LC1A 2D5YA 3QH9A 3C9IA 3RCHB 3CXHI 2P7JA 3EI9A 1MLYA 3ELEA 3DODA 3KPEA 1J1DB 1ASMA 3GHGA 3CQ4A 1VQKP 4H0LD 4K2MA 3H1LD 3L72J 1RV3A 3HL2A 3AEDC 3K28A 3R9AA 5AW2B 4EYYQ 1Q7YQ 2CB1A 4GIFA 1AJSB 2HPCB 3AEBC 5BJ3A 1KB9H 2HOXA 3QN6A 4MKJA 2E74C 4IFMA 1L0LK 3BCCE 1SQQG 2A45I 4OTLA 1WKGA 1PGOA 1EXJA 1DTYA 1J04A 1YAAA 1U57A 4IOIH 2BCCG 5KAFE 3MHVA 5AVSB 4XJMA 1XTGB 5G0AA 2FYZA 3P1TA 1HWTC 3M5UA 2WPSA 1AHXA 1QISA 3DR4A 1JY3O 3V4QA 1QZ9A 4HKZH 4WLHA 3T97A 2W7JA 2BCCE 3V6IA 3II0A 4JEWA 2W7MA 2XKMA 3CWBD 3H1HG 4W1VA 4DT0A 1LTJB 1H1CA 4LW2A 3O8ZA 1PGPA 3SWFA 2B89A 3AEEC 3L73G 5G2PA 1K05A 1L4AC 5CCHA 1GTWA 1YIJP 2P67A 1GL2C 1IAXA 1BJWA 1YHQP 1ASEA 1Y4IA 1OW6A 1LTGC 1H89A 2WVRA 1LW5A 4IXSA 2BWOA 1S4XA 3L73E 2GUSA 2HLOA 2RN0A 3FTBA 4PFFA 5D95A 1MGVA 3ECDA 2ZXXA 3NXSA 2BI1A 3A8UX 2ZYDA 1FBMA 3G7QA 1AVYA 1WYTA 1KMIZ 2W8VA 1LC5A 4F5GA 2RH0A 3H1IG 2ZJSE 1D7MA 4OGQD 1M56D 1PPJG 3M9HA 3FQ7A 2K9JA 3GZDC 1GC2A 1C7OA 5APXA 1VP4A 4KXKA 1AAMA 3FXDA 1L0LJ 4ZDPA 4IX8A 4JYBA 3H1IE 4HYTB 4EB7A 2X3LA 1FJPA 3PIUA 2WSEH 3FVUA 1ECXA 2M5AA 3HE4B 5CCHD 2E75C 2W27A 5CBOA 4D6TG 2YKUA 3WX9A 3I5CA 4WBAA 3JWBA 1FC2C 5KLIC 1GK6A 4DBCA 3GBXA 2O01J 2M8RA 3FWLA 2RMZA 3HD7C 3VMXA 1B5PA 3AE3C 1N31A 1V2DA 4W1XA 3WGCA 2AATA 4I7ZB 1YITP 2VMQA 1ZN5A 1I48A 4D6TJ 4XK1A 4F5HA 3RBFA 2W8JA 3CXHH 2ZY2A 1BGYJ 1BE3D 3KGWA 4TT3H 1DJ9A 2F8JA 1MDZA 4R8DA 2AY2A 4GEBA 1X28A 1VQMP 1Q81Q 2Z20A 5APYA 4F5JA 1BJNA 4JBZA 1BCCE 3B4SA 2QMAA 4RM1A 1NHLA 1QEXA 3FGAD 4W7YA 2A45H 4OYTA 4H44C 1M1JB 4A0HA 2QJPB 4JF0A 2Q6QA 2QB2A 2M3BA 3GW6A 1URQB 1BKGA 3FVXA 4EFFA 3U1AA 4OH8B 1NTZE 3FZ7A 5I92A 2L91A 4A6TA 2YKPA 1JCCA 3O6QB 3RK2B 2NPSA 4XFJA 1P3WA 1RE4A 3BRTB 3S9OA 2OGAA 1SQPD 2QJYC 3W1IA 2VGTA 5CCGC 1OMIA 2Z9VA 2JJLA 3CPWO 9AATA 1N7SA 3VTPC 3NU7A 3RBZA 4A72A 2R2NA 3MEBA 2PB0A 3PAAA 2HP2A 1NKZB 1N8PA 3ASAA 3CX5I 3VOPA 1YJSA 1ASNA 1W7MA 4JF1A 3AE6C 3CXHE 2OYOA 2YCNA 2QBTA 2OYIB 1TOJA 2VI8A 3SFDC 2FY8A 1SQVE 1NTMK 2A45G 3Q5SA 1ZRTE 4FFCA 3MADA 3NTJA 1OVVA 3WCOA 4EU1A 2N9BA 2G8YA 4K3AA 1DX7A 1AICA 2CJGA 5M49A 2W8TA 1WKHA 1GMJA 3CMEP 1GU5A 3AENA 2Y0DA 5KJ7C 1SQQD 1KILA 2NPSD 1JMMA 2XZRA 3G0TA 3D6ZA 1KORA 3USSA 1FAVA 5CJ4A 3GLMA 1AMAA 4IFFA 2E5YA 3RCHA 2BCCD 2YCTA 3H9XA 2O0RA 2KZJA 1N7SD 1CI6B 1T3JA 1W7LA 2YKVA 2VMRA 3NMDA 5DJ1A 5KLVK 4ISYA 5TISH 1HGZA 2Q7CA 3P6KA 3B1EA 4KT0J 3A5TA 3I55P 3H1HD 2HPCA 3JSVC 1MKMA 2I1JA 5EIGA 1CQ7A 2YKYA 3EI8A 3L73D 4IXZA 4JPZB 1NU1E 2BI3A 4JEVA 4R4MA 2VMSA 2O1KA 2QRXA 2CPSA 2VI9A 5AW7B 1B5OA 1CZEA 2C0RA 2VGUA 3V2PA 2BIGA 2FYUG 3B5NB 4MQQA 2W7GA 2P1JA 4WYCA 3TGUE 5M1BA 3ATHA 3L74G 1ELUA 1A02J 3WKRA 1KILD 1NWQA 1IFNA 3VYIA 3HQTA 1E5EA 4WY4C 5BU5A 4ADEA 4AH3A 1NTMJ 2Y0CA 1AIBA 3H1KJ 2SPZA 3AEJC 3H1ID 1DEEG 4EI2A 1LTJA 1M90Q 2VMOA 2W7IA 1CL1A 1PPJD 3L74J 3W1HA 4NPDA 3PDXA 2R5CB 3VK3A 2ZP7A 3KYQA 3PJ0A 4H13B 1NVOA 2DOUA 5CJ0A 4F5LA 2VGZA 1BW0A 3RI6A 1XTCC 3PLNA 1WMKA 3CQ6A 1SQXK 1FZFA 2GMUA 4ASVA 5TISE 2QJKC 1X79B 3MUDA 5KLVJ 3TQXA 3HUSA 1CL2A 1G4XA 1TATA 4K35A 1IFMA 1IBJA 4ZWVA 3VMAA 3AATA 3GR9A 3MAFB 1KQGB 1DGDA 3ZDMA 3ACZA 3CLQA 2O7CA 3PGYA 3NNKA 1AY5A 1E5WA 4GE7A 1KV4A 3NUIA 1BCCD 4IFDK 1BDCA 3HE4A 4GDYA 2PP6A 1SLQA 1VQ7P 3S1KA 3LW5H 2O3JA 3ZRQA 3H1LE 1ZOYC 1ASAA 1MAQA 1DH3A 2UWJE 1SFCC 5IWQA 4PD4D 1JS3A 3B1CA 1ARHA 4AO4A 1W3UA 3DYDA 4WB0B 1KKPA 1ASDA 3EQ2A 3MKJA 3AELA 1LC7A 4TLFA 4Y99C 1LP1B 1HH0A 2IYOA 1L4AB 4CPGA 1QITA 4IYOA 1A02F 2HUUA 4WXFA 1SQXJ 3LY1A 2X5FA 1G1JA 1T3IA 1L0NJ 2ZVNB 3CCVP 4AUWA 4C7NB 3B71A 1N73C 1EQ7A 2VRSA 1ASBA 2FBWC 1NTKG 3FFRA 1QVGO 4I1LA 1ARSA 3R2PA 4OC9A 1NKNA 3NRAA 2OKKA 3MZWB 5DJUB 3G8MA 1M1JA 1FE6A 3CX5E 3PDBB 3ELPA 5F9SA 4EB5A 1NTKE 2P58A 1ZRTD 1PGJA 2Y9YA 1Q2NA 3AE5C 1J32A 2ZSMA 5B5EH 2VMYA 3E2YA 1PGQA 3M0AA 3H1JG 4IL6X 2ZY3A 2W8WA 3V5BA 3O6QA 1WRGA 1AMRA 4F4EA 4RLGA 3TYYA 1FG7A 1S06A 2W7HA 2NRGA 4E1OA 2J58A 1FOSF 2VMXA 2IBZG 1EXIA 1D7RA 4I2LC 4JQ0D 2VLHA 1Z7DA 1GZLA 2E75B 1PP9G 3OKSA 2XNDH 4YXDC 1JY2N 2FFDC 3QBOA 1KYOE 5KLIB 2ZT9C 3M0DC 5E4ZA 2PFXA 2FKIA 4DZOA 2VLFA 3E1RA 2OYIA 1LW4A 1NAFA 1EC5A 1TOGA 3VK2A 4F5IA 2N1TC 3AEMC 1RF1C 1NU1D 5EAVA 4WYGA 1NH4A 2DGLA 3G9RA 2AY5A 1SQBG 4IL6H 4H51A 4BA4A 2D2CD 1ARTA 1RV4A 3TGUD 3RK2D 2IFMA 3W67A 4RJ0A 1GEYA 1SFFA 3E2FA 2FYUD 5B5EE 3IHJA 2ZC0A 5FT6A 4WP0A 4YTPC 2JR8A 3HDOA 1UU0A 1SQPK 1N7LA 3L70J 1BE3E 1KAFA 3G4SP 4H44B 3WKSA 1S1CX 3D71A 2FKWB 1VL2A 4H0LC 3CCMP 1M1KQ 4F5FA 3D70A 2EPJA 5TF5A 2PB2A 3BATA 1YTZT 2H8PD 4WYEA 4I6MC 1QX8A 4GT1A 2ZYAA 3ZZKA 2FQ6A 1AVOA 3VP6A 1BDDA 2VGVA 4PD4I 2KXPB 2QJYB 2GMSA 1KL1A 2D65A 3VP8A 2JJFA 1YNUA 3B5NA 3L75G 3LIEA 2KLUA 3TATA 3D6YA 2MJZA 1G1IA 3CC4P 4XA4A 2WK8A 3GWPA 3KHUA 3FXEA 3L75E 4IL6E 5AVVB 2AY8A 2VMNA 2OGEA 1AFOA 4ZMDA 1K8AQ 3DXVA 4A0GA 4WD2A 2ZY5A 3DU4A 4ZSYA 3L72E 2QB3A 2YO3A 1PMMA 4K2BA 1N2TA 3PA9A 4RJYA 5KTBA 5L8RJ 2E43A 3HTKB 2WZ7A 4W7ZA 3MC6C 1IX8A 1NOHA 2JKVA 3G3ZA 2HP1A 1FZGA 2KUBA 3B5ND 2O01N 1VQNP 3E77A 2IZ1A 3HT4A 2XU6A 3FDDA 5APSA 1AIAA 4BQ0A 3RUYA 3LV2A 2LR2A 3BCBA 1SQQE 3L71J 2HUIA 1IUGA 1M8OB 5AW1B 2YOBA 2W6BA 3JZLA 1D7VA 4UQVA 3CCSP 3FZ8A 2O01H 4A6UA 3BCCJ 5G4JA 1VF5C 2VMWA 1H88A 3VOMA 1CZQA 4H13D 1GW4A 3CX5D 3BVHA 1NTKD 3BN1A 1EZVI 2YKQA 1FZCA 1CQ8A 3LVLB 3H1HE 2Q9IA 2E7IA 3B46A 1VQ4P 4M2KA 2EH6A 5E79H 3MTUE 3HE5A 4WY4B 1V2FA 2M0BA 3AOVA 4QGRA 1L0LG 2W6AA 3B8XA 3H1JD 3ABVC 1LP1A 1X2AA 1G7XA 3P32A 2G6WA 2W8ZA 4Q76A 3TSIA 4AYCA 1GL2A 1KILE 1S08A 2W7DA 1V2EA 3EIBA 4Q75A 4C7NA 3F89A 1TPLA 1L0LE 2C9LY 3FQ8A 1AA0A 4W8IA 2ZUKA 1ASCA 1KYOD 2IBZD 1AV1A 2V7QH 4ZM3A 1R5SA 2D63A 2E74D 3I4JA 1OXOA 1YIZA 4HH2A 1PPJE 5KKZC 1PP9D 4PD4H 2QJKB 1VQ6P 4KYOA 4OBUA 1H0TB 1RF0A 2B87A 3A2BA 1GDTA 4DJGA 1FZBA 2CH2A 2YMYA 4Y0HA 2GUVA 1BGYG 4L0OA 2AY9A 1M0NA 2BEQD 3HBXA 1NTZK 1ARGA 2Q7WA 1YJWP 5F8VA 4D6TE 2WSSH 1SQBD 1QL2A 3M9QA 2AY6A 1CW5A 3RK3B 4PV1C 4L75A 1E79H 5AW0B 4L76A 1ELQA 5E79E 1T2KD 1GL2D 3I5TA 2OTKE 2MKVA 3LVMA 3L36A 4XJLA 1JY3N 1KZUB 1DD4A 2YNYA 1SFCB 1EDLA 3HD7A 2W7FA 4W80A 3SWYA 2ZJGA 1BS0A 2WKAA 1IX7A 5APWA 3TNUA 3Q3DA
chains in the Genus database with same CATH topology
1DGEA 1M6SA 1M32A 3RL0B 3UE8A 2O1JA 3ISLA 1SQVK 4Y99B 3QHXA 2A1VA 1I29A 2ZXEB 1KKJA 4AOAA 1NO4A 1IVRA 4KAMA 1N73B 1AKBA 2NPSC 4A00A 1ZODA 4EOTA 3BCXA 2R5EA 4ADDA 4LGDE 3DXWA 3R4TA 4RKDA 1CZCA 2DGKA 3L8AA 4U1TA 2QM8A 4B9BA 1X9VA 2OARA 3HD7D 3L4FA 5M4BA 1SPAA 1HVVA 3VMZA 2CTZA 3E2ZA 1YJYA 4OT8A 5CCGA 5HXXA 1U08A 2Z9WA 1NU1K 1JY2P 1S07A 4ADBA 3KKIA 3AOWA 4TN4A 3JTXA 4AO9A 2FFDB 2BIEA 2VGSA 4C7RA 1GDEA 3BASA 5EQCA 3FD0A 4MY5A 1OHYA 3NDNA 2N1TB 4OBVA 4ZKUA 1RF1B 1SZSA 1M0QA 2G7JA 1WYVB 1QIRA 3F0HA 3N75A 2FN6A 4R2NA 3HTKA 5KJ7A 1AJSA 4XJOA 2FXMA 1BQDA 1OWAA 7AATA 3A2AA 5CCGD 4WXBA 4JEYA 2Z5IA 1ASGA 4R5ZA 5E5IA 2BYJA 3OP7A 2L5GB 1GEWA 1ARIA 1IJIA 1XEYA 1TOIA 2C81A 1M4NA 2YO2A 2VMTA 4XQ2A 4UHOA 2CFBA 3OA7A 1JTHB 3BB8A 1GK4A 2EYQA 1AHGA 4BA5A 1N86A 1PFFA 1DJUA 2EZ2A 3H6PA 1O62A 3A9ZA 5AVWB 3N7NA 5K8BA 3OJAB 1G7WA 3TK1A 2J59M 3HRNA 1S0AA 2Z4EA 3LG0A 3BRVB 5G2QA 1KFNA 1ZLLA 4GE9A 5KJ7D 1G2CB 3FKDA 1I43A 2V0YA 4WY4A 2BKWA 1RE3C 4ZASA 4HVKA 5APVA 3AEJA 3VN0A 1FOSE 2FNUA 4GRXA 4Q31A 3HUSC 3E6GA 2WITA 3V2QA 3DC1A 4MQPA 3PPLA 2GQNA 1RVUA 2WK9A 3GHGB 1WYUB 4DOJA 3FZ6A 3KGXA 4O6ZA 3TFTA 1AHFA 4ZLVA 2D61A 4LNMA 1IJDB 4IY7A 1KQLA 1Z56A 3FRKA 3BWNC 4A0RA 3RK3C 1JCDA 2I1KA 3B8EB 1W23A 2CJDA 1W2EA 1HJBA 3V4WA 1LTIC 1SZUA 3AV7A 2ZYJA 4LLHA 4UOYA 3HLMA 2WTYA 3MBBA 4WY4D 3NYUA 3MGNA 2E54A 3TFUA 3D6KA 2HG5D 2BYLA 1C4KA 3MIWA 2R5BA 1IO4A 2VGWA 1AMQA 3WGBA 3WLXA 3PD6B 1FU1A 3RL0C 1OHVA 3BCAA 4ITXA 2OYHC 1X29A 2Q5UA 2D7ZA 2XH1A 1X0MA 4H63Q 1ZC9A 8AATA 1SFCA 1O4SA 2EO5A 2X8UA 1ORDA 2QM7A 3N4RA 1IFJA 2HFED 1GU4A 4K2IA 1KMKA 3NTNA 4UHMA 4E3RA 2CANA 2EGYA 2NMPA 1LTSC 4LNJA 3DZZA 1URQA 2BHXA 1GEXA 3WY7A 4PVFA 4RKCA 3N5MA 3KDPB 1N73A 3IFMA 5AVZB 4CXRA 1CJ0A 4J5UA 1JG8A 4ITGA 1Z3ZA 3BWOA 3EIAA 3LWSA 4CBRA 3U59A 1GW3A 1FZAA 5APUA 3FQAA 4P7YA 3EZ1A 3T32A 3KE3A 1SFCD 4GSAA 2O1BA 2YKOA 3JW9A 2WSCH 3CI9A 5AVUB 1M7YA 2D66A 1MUUA 4CXQA 5EUEA 3P8CE 3Q8NA 2D7YA 5AW9B 4B86A 4DGTA 4R5FA 1URQD 2IX7C 2CINA 4M2MA 4ZDOA 1JY3P 3KQGA 4A6RA 1RY3A 5BVZA 4N6JA 1OXPA 5FT8A 1MFZA 3M0DA 5AVQB 3N0LA 1DEBA 3ZRPA 1LWUC 3F9TA 1J1EC 2N1TA 3A7OA 1MV8A 1RF1A 1LT9C 2HOZA 1GC3A 2OKJA 1PG8A 2XNXA 1VJOA 1CI6A 1PMOA 3L37A 1AAWA 1YJZA 2POHA 4JEXA 1I41A 2NPSB 5AW8B 4AZJA 2YCPA 4ADCA 1D2FA 1W7NA 4W1WA 3OAKA 3WMM0 1O69A 4ZWMA 2GSAA 4XEWA 3UAKA 2CJHA 3VP9A 5EUNA 1OATA 1AHEA 3EZSA 5JAYA 3LVKA 4ZDLA 4C46A 3WCNA 2N1TD 2KFPA 1SQQK 1B9HA 1ASFA 2FM1A 1FDMA 3RBLA 1S9KE 2JG2A 5EUDA 3NFQA 2R5CA 3GHGC 1AJRA 3QM2A 3VK4A 3IR9A 1G2CA 1VDFA 1AY4A 2QA3A 1O61A 5APQA 1CQ6A 2XV5A 3CL3D 2QSRA 4XAUA 4RITA 2BI2A 5APTA 2JJGA 5CHXA 1WYUA 4TMRA 2Z61A 3MAFA 3EI7A 5EIGB 2WT7B 5HHYA 4IXOA 3WZFA 3UIAA 1QL1A 1EG5A 2BI5A 2ORDA 3MC6A 1QGNA 1SF2A 3L44A 2WWWA 4N3YB 5CCHC 1HTLC 1MAPA 1QJ5A 1FZCC 2DKBA 1AMSA 4WLJA 3F6TA 2VMPA 1S09A 4BMKA 1AHYA 1DFOA 4WB0A 3PD6A 3H7FA 2VYCA 1JS6A 2C0WA 5FT4A 5AW3B 1ZOBA 1T2KC 4JEZA 3M9BA 1L4AA 1OHWA 3M91A 2H43A 2HODB 3FVSA 2CH1A 5DX5A 1JF9A 2AEVA 3HVYA 4OMAA 5HDMA 1V72A 4N0WA 3HUSB 1UKJA 3P8CD 4EIJA 3PDBA 1RF0C 3A3YB 3K7YA 4AQRD 1C9CA 1SVFA 2CPBA 2WPQA 3RQ1A 3GZDA 1LS3A 1AY8A 1PFIA 1B4XA 3P7KA 5AX8A 3QGUA 4GKGA 1LGHB 1GC0A 1DJEA 1L4AD 1LTTC 1D7UA 4WYAA 1HGVA 4JF7A 2ZFCA 4E77A 3DRDA 4WYFA 1TOKA 4MQRA 2C0XA 1RVYA 2CY8A 4M3LA 2EZ1A 1J2JB 4IYOB 2OYHB 3FSLA 1KL2A 2YKXA 2H7HA 4RAEA 3E9KA 3K40A 4N78D 2GB3A 3P8MC 3USFA 4BHDA 1RE4C 2KP8A 4CBSA 2W7EA 3GSBA 4P3MA 2DKJA 1FZEA 1N7SC 1S9KD 3EI6A 2YRRA 1IFIA 4LW4A 4WBTA 2Z9XA 4M2JA 4ATQA 4F5KA 3V2RA 3GETA 5D5SA 2KSJA 2HOYA 4RESB 1YTZI 2AY3A 4EMYA 1EQBA 2BWPA 5DB5A 1HBWA 3DR7A 2TPLA 4Y0DA 3CQ5A 2FYFA 5M4DA 4F5MA 2QLRA 1LTBC 3ZRRA 5AVTB 1KILC 1LK9A 1DKAA 2Z5HA 1GCKA 2R5DA 2HORA 2VMUA 3AEOA 1GD2E 2FYUK 2VMVA 1J1DC 2Z9UA 3FFHA 2GM4A 3AEPA 3EFGA 3TCMA 1D7SA 4Y0IA 3LIDA 1GC4A 2HZPA 3A9YA 1SZKA 3NU8A 3VAXA 1HUCA 1B8GA 3QPGA 1WT6A 3E1IA 3NYSA 2VMZA 5AW6B 1LWUB 3H32B 1J1EB 1CS1A 4K05A 5BJ4A 1LT9B 4RIZA 3LVJA 1MDXA 4WB4A 3M06A 2JGTA 4LNLA 3N4XA 1KFMA 5AVYB 4IW7A 4O9BA 2XDJA 1SVVA 2R32A 3V2NA 4I8AA 3BC8A 2Z1ZA 2XBNA 2WT7A 2YRIA 2E7JA 2ZY4A 3A9XA 5G4IA 4W91A 1BJOB 5DJ9A 1LTJC 2BIAA 2VIAA 1UU1A 2DGMA 2BASA 2WPRA 2BI9A 1AKAA 1IFDA 5AW5B 2DR1A 2PAJA 5AVRB 4ZKPA 4UHNA 1M7LA 2R3CA 1QJ3A 2KLVA 2E42A 2RFVA 2C44A 2VIBA 4WXGA 1CSBA 3N4SA 2WB6A 3CBFA 3GZCA 4Q6RA 1IC2A 4PIWA 4ZM4A 2W7LA 4MKKA 3PP5A 2W7KA 4PFNA 2HYNA 2HODA 1N2DC 2YHKA 4J8LA 2AY7A 1L0NK 2R0TA 4HF8A 1RE3A 5EAAA 4FL0A 3MD0A 5FT5A 1YYCA 3L35A 5EFSA 1IX6A 2X5DA 1YIYA 2P2UA 5CMZA 1BT4A 1BJ4A 1ZV8A 3BV0A 1JY2O 1NTKK 4MSOA 3FCRA 1JO5A 1T8ZA 4XE5B 1TOEA 3U1CA 3BWNA 1TASA 1M0PA 1SP4A 2D64A 4GE4A 2JJHA 1FZCB 1FC4A 1JNMA 3HMUA 4E3QA 1E5FA 3HE5B 1YOOA 4NOGA 5C6UA 3BS8A 4U2HA 1M1JC 1WYTB 1B9IA 1URQC 5BU8B 2OYHA 1AX4A 4ZSWA 3ASBA 2IFNA 1UU2A 1GL2B 2ZSLA 1MLZA 1XI9A 2LKMA 2WK7A 3RK2C 4WYDA 4CVQA 2JISA 2HUFA 1C7NA 4JYCA 3RK3D 1H0CA 1SQBK 4AZKA 2OQXA 3EUCA 1WSTA 2OYIC 1AQ5A 1EJIA 1G4VA 5E3KA 3NUBA 1VEFA 2JJEA 2V1PA 3NX3A 1LKCA 3RL0D 1X8YA 1JUNA 3B1DA 4XJPA 4KHXA 2Z1YA 3GJUA 3NYTA 1LTAC 3MAUA 1T3UA 2E7UA 5AW4B 2FFDA 1IAYA 3HD7B 1M0OA 2AEUA 1LC8A 2KYVA 3W1JA 1C0NA 3JWAA 3TNUB 1VPCA 4ZAHA 3AEMA 2Q3IA 1AKCA 2CSTA 1FJKA 1WYVA 1BQAA 3I16A 4A0FA 2IPPA 4OCAA 2OATA 3EI5A 4B98A 3COGA 1LWUA 3H32A 1ASLA 2PO3A 3QI6A 1GD9A 2BWNA 4LC3A 1LT9A 5M46A 2WSFH 3B5NC 5AVXB 2KB7P 2FNIA 3II6A 1H8AA 1N7SB 3FDBA 1KMJA 1TARA 1C7GA 3CAIA 4N78E 3VMYA 1FG3A 1JTHA 2JEEA 1OXZA 2C9NY 1BJOA 5G09A 3UWCA 3E2ZB 1ZR4A 1GBNA 2KOGA 1MDOA 2C7TA 4DQ6A 4W5KA 1ZR2A 1JOCA 4ATPA 2AY4A 3AENB 1KILB 5J8QA 2AY1A 1IK9A 2W8UA 1MZ9A 3ZZJA 2D5YA 4LC1A 3RCHB 3C9IA 2P7JA 3EI9A 1MLYA 3ELEA 3DODA 3KPEA 1J1DB 1ASMA 3GHGA 3CQ4A 4K2MA 1RV3A 3HL2A 3K28A 3R9AA 5AW2B 2CB1A 4GIFA 1AJSB 2HPCB 5BJ3A 2HOXA 3QN6A 4MKJA 4IFMA 1L0LK 2A45I 4OTLA 1WKGA 1DTYA 1J04A 1YAAA 5AVSB 4XJMA 1XTGB 5G0AA 2FYZA 3P1TA 1HWTC 3M5UA 2WPSA 1AHXA 1QISA 3DR4A 1JY3O 3V4QA 1QZ9A 4WLHA 3T97A 2W7JA 3II0A 4JEWA 2W7MA 2XKMA 4W1VA 1LTJB 1H1CA 4LW2A 3O8ZA 3SWFA 5G2PA 1L4AC 5CCHA 1GTWA 2P67A 1GL2C 1IAXA 1BJWA 1ASEA 1Y4IA 1LTGC 1H89A 1LW5A 4IXSA 2BWOA 2GUSA 2HLOA 3FTBA 4PFFA 5D95A 1MGVA 3ECDA 3NXSA 2BI1A 3A8UX 1FBMA 3G7QA 1WYTA 2W8VA 1LC5A 4F5GA 3M9HA 3FQ7A 3GZDC 1GC2A 1C7OA 5APXA 1VP4A 4KXKA 1AAMA 4ZDPA 4IX8A 4JYBA 4HYTB 4EB7A 2X3LA 1FJPA 3PIUA 2WSEH 3FVUA 1ECXA 3HE4B 5CCHD 2W27A 2YKUA 3WX9A 3I5CA 4WBAA 3JWBA 1GK6A 4DBCA 3GBXA 2M8RA 3HD7C 3VMXA 1B5PA 1N31A 1V2DA 4W1XA 3WGCA 2AATA 2VMQA 1ZN5A 1I48A 4XK1A 4F5HA 3RBFA 2W8JA 2ZY2A 3KGWA 1DJ9A 2F8JA 1MDZA 4R8DA 2AY2A 4GEBA 1X28A 2Z20A 5APYA 4F5JA 1BJNA 2QMAA 4RM1A 1NHLA 4W7YA 2A45H 4OYTA 1M1JB 4A0HA 4JF0A 2QB2A 2M3BA 1URQB 1BKGA 3FVXA 4EFFA 3U1AA 4OH8B 3FZ7A 5I92A 4A6TA 2YKPA 1JCCA 3RK2B 2NPSA 1P3WA 1RE4A 3BRTB 2OGAA 3W1IA 2VGTA 5CCGC 2Z9VA 2JJLA 9AATA 1N7SA 3VTPC 3NU7A 4A72A 2R2NA 3MEBA 2PB0A 3PAAA 2HP2A 1NKZB 1N8PA 3ASAA 3VOPA 1YJSA 1ASNA 1W7MA 4JF1A 2YCNA 2QBTA 2OYIB 1TOJA 2VI8A 1NTMK 2A45G 4FFCA 3MADA 3NTJA 3WCOA 4EU1A 2N9BA 1DX7A 1AICA 2CJGA 5M49A 2W8TA 1WKHA 1GU5A 3AENA 5KJ7C 1KILA 2NPSD 1JMMA 2XZRA 3G0TA 5CJ4A 1FAVA 1AMAA 4IFFA 3RCHA 2YCTA 3H9XA 2O0RA 1N7SD 1CI6B 1T3JA 1W7LA 2YKVA 2VMRA 3NMDA 5DJ1A 5KLVK 4ISYA 1HGZA 2Q7CA 3P6KA 3B1EA 3A5TA 2HPCA 2I1JA 5EIGA 1CQ7A 2YKYA 3EI8A 4IXZA 2BI3A 4JEVA 2VMSA 2O1KA 2CPSA 2VI9A 5AW7B 1B5OA 1CZEA 2C0RA 2VGUA 3V2PA 2BIGA 3B5NB 4MQQA 2W7GA 2P1JA 4WYCA 3ATHA 1ELUA 1A02J 3WKRA 1KILD 1NWQA 1IFNA 3VYIA 3HQTA 1E5EA 4WY4C 5BU5A 4ADEA 4AH3A 1AIBA 3AEJC 2VMOA 2W7IA 1LTJA 1CL1A 3W1HA 3PDXA 2R5CB 3VK3A 2ZP7A 3KYQA 3PJ0A 2DOUA 5CJ0A 4F5LA 2VGZA 1BW0A 3RI6A 1XTCC 3CQ6A 1SQXK 1FZFA 2GMUA 1X79B 3MUDA 3TQXA 3HUSA 1CL2A 1G4XA 1TATA 1IFMA 1IBJA 4ZWVA 3AATA 3GR9A 3MAFB 1DGDA 3ACZA 3CLQA 2O7CA 3PGYA 3NNKA 1AY5A 1E5WA 4GE7A 3NUIA 4IFDK 3HE4A 4GDYA 2PP6A 1SLQA 3LW5H 3ZRQA 1ASAA 1MAQA 1DH3A 1SFCC 5IWQA 1JS3A 3B1CA 1ARHA 4AO4A 1W3UA 3DYDA 4WB0B 1KKPA 1ASDA 3EQ2A 3MKJA 3AELA 1LC7A 4Y99C 1HH0A 1L4AB 1QITA 4IYOA 1A02F 2HUUA 4WXFA 3LY1A 2X5FA 1G1JA 1T3IA 4AUWA 4C7NB 1N73C 1EQ7A 2VRSA 1ASBA 3FFRA 4I1LA 1ARSA 3R2PA 4OC9A 1NKNA 3NRAA 2OKKA 3G8MA 1M1JA 3PDBB 3ELPA 5F9SA 4EB5A 1J32A 2ZSMA 2VMYA 3E2YA 3M0AA 2ZY3A 2W8WA 3V5BA 1WRGA 1AMRA 4F4EA 4RLGA 3TYYA 1FG7A 1S06A 2W7HA 4E1OA 2J58A 1FOSF 2VMXA 1D7RA 4I2LC 2VLHA 1Z7DA 1GZLA 3OKSA 1JY2N 2FFDC 3QBOA 3M0DC 5E4ZA 2FKIA 4DZOA 2VLFA 2OYIA 1LW4A 1NAFA 1TOGA 3VK2A 4F5IA 2N1TC 3AEMC 1RF1C 5EAVA 4WYGA 1NH4A 2DGLA 2AY5A 4H51A 4BA4A 1ARTA 1RV4A 3RK2D 2IFMA 4RJ0A 1GEYA 1SFFA 3E2FA 3IHJA 2ZC0A 5FT6A 4WP0A 3HDOA 1UU0A 1SQPK 1N7LA 3WKSA 2FKWB 4F5FA 5TF5A 2EPJA 2PB2A 3BATA 1YTZT 2H8PD 4WYEA 4I6MC 4GT1A 3ZZKA 2FQ6A 3VP6A 2VGVA 2GMSA 1KL1A 2D65A 3VP8A 2JJFA 1YNUA 3B5NA 3LIEA 3TATA 2MJZA 1G1IA 4XA4A 2WK8A 3GWPA 5AVVB 2AY8A 2VMNA 2OGEA 1AFOA 3DXVA 4A0GA 4WD2A 2ZY5A 3DU4A 4ZSYA 2QB3A 2YO3A 1PMMA 4K2BA 1N2TA 3PA9A 4RJYA 5KTBA 2E43A 3HTKB 2WZ7A 4W7ZA 3MC6C 1IX8A 1NOHA 3G3ZA 2HP1A 1FZGA 3B5ND 3E77A 3HT4A 2XU6A 3FDDA 5APSA 1AIAA 4BQ0A 3RUYA 3LV2A 3BCBA 2HUIA 1IUGA 5AW1B 2YOBA 2W6BA 3JZLA 1D7VA 4UQVA 3FZ8A 2O01H 4A6UA 5G4JA 2VMWA 1H88A 3VOMA 1CZQA 1GW4A 3BVHA 3BN1A 1FZCA 2YKQA 1CQ8A 3LVLB 2Q9IA 2E7IA 3B46A 4M2KA 2EH6A 3MTUE 3HE5A 4WY4B 1V2FA 3AOVA 4QGRA 2W6AA 3B8XA 1X2AA 1G7XA 3P32A 2G6WA 4Q76A 3TSIA 4AYCA 1GL2A 1S08A 2W7DA 1V2EA 3EIBA 4Q75A 4C7NA 1TPLA 2C9LY 3FQ8A 4W8IA 2ZUKA 1ASCA 4ZM3A 2D63A 3I4JA 1OXOA 1YIZA 4HH2A 4KYOA 4OBUA 1RF0A 3A2BA 1GDTA 1FZBA 2CH2A 2YMYA 4Y0HA 2GUVA 4L0OA 2AY9A 1M0NA 3HBXA 1NTZK 1ARGA 2Q7WA 5F8VA 1QL2A 3M9QA 2AY6A 1CW5A 3RK3B 5AW0B 1ELQA 1T2KD 1GL2D 3I5TA 3LVMA 3L36A 4XJLA 1JY3N 1KZUB 2YNYA 1SFCB 3HD7A 2W7FA 4W80A 3SWYA 2ZJGA 1BS0A 2WKAA 1IX7A 5APWA 3TNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BAT A;  3N4S A;  3N7N A;  3VP9 A;  4ZKU A;  2JEE A;  3OJA B;  1X79 B;  3N4R A;  4I1L A;  5KTB A;  4GIF A;  3U1C A;  1NKN A;  3U1A A;  3N4X A;  1IC2 A;  4N78 D;  4O9B A;  3HRN A;  4ZKP A;  3U59 A;  5BU8 B;  3VP8 A;  3C9I A;  2FXM A;  3BAS A;  4N3Y B;  5BU5 A;  3P8C D;  2POH A;  5BVZ A;  1WT6 A; 
#chains in the Genus database with same CATH topology
 1DGE A;  1M6S A;  1M32 A;  3RL0 B;  3UE8 A;  2O1J A;  3WU2 H;  3ISL A;  1SQV K;  4Y99 B;  3QHX A;  2A1V A;  1I29 A;  2ZXE B;  1KKJ A;  4AOA A;  5EFW B;  1NO4 A;  4PD4 E;  1IVR A;  4KAM A;  1PIX A;  4WWI A;  1N73 B;  1HJ0 A;  2NPS C;  1VQL P;  1AKB A;  4A00 A;  4NPF X;  3GMA A;  3L75 D;  1ZOD A;  4EOT A;  3BCX A;  3A0H E;  2R5E A;  4ADD A;  4LGD E;  1ZME C;  3DXW A;  2E75 D;  3R4T A;  4RKD A;  3Q2Y A;  1CZC A;  2DGK A;  3L8A A;  4U1T A;  2QM8 A;  2K1A A;  3CCU P;  3L72 D;  3ITK A;  1NTZ J;  4B9B A;  1X9V A;  2OAR A;  3HD7 D;  2WSE J;  3L4F A;  5M4B A;  1SPA A;  1HVV A;  5K5G B;  3VMZ A;  2FYN C;  2CTZ A;  3E2Z A;  1YJY A;  4OT8 A;  5CCG A;  2AXC A;  5HXX A;  1U08 A;  2Z9W A;  1NU1 K;  1JY2 P;  4NPE A;  1S07 A;  4ADB A;  4YPC A;  3AOW A;  3KKI A;  4TN4 A;  2QSI A;  3JTX A;  4AO9 A;  1AQT A;  3PRJ A;  2W83 C;  2FFD B;  2BIE A;  2VGS A;  4C7R A;  1GDE A;  2ZT9 B;  3WU2 E;  3BAS A;  2IYP A;  5EQC A;  4L73 A;  3FD0 A;  1R5L A;  4MN4 C;  4MY5 A;  3RGU A;  1OHY A;  3NDN A;  2N1T B;  4OBV A;  1KYO I;  2IBZ I;  1L2P A;  1ZP0 C;  1SQV J;  1ZW0 A;  4ZKU A;  1RF1 B;  1SZS A;  1M0Q A;  2JO1 A;  2G7J A;  1WYV B;  1QIR A;  3F0H A;  3N75 A;  1EZV G;  2FN6 A;  4R2N A;  3HTK A;  5KJ7 A;  1FDI A;  1AJS A;  2KSE A;  4XJO A;  2N9Y B;  2FXM A;  1BQD A;  1OWA A;  7AAT A;  3A2A A;  5CCG D;  4WXB A;  4JEY A;  2Z5I A;  4U3F J;  1EZV E;  1ASG A;  4R5Z A;  5E5I A;  2BYJ A;  1NTM G;  3OP7 A;  2L5G B;  1GEW A;  3H1K G;  1ARI A;  1IJI A;  1XEY A;  5B66 H;  1TOI A;  4RJT A;  2C81 A;  1M4N A;  2YO2 A;  4H0L B;  2VMT A;  4XQ2 A;  4UHO A;  2CFB A;  3OA7 A;  1JTH B;  3BB8 A;  1GK4 A;  2EYQ A;  3AEA C;  1PL5 A;  3MP7 B;  1L0L D;  1AHG A;  4BA5 A;  1N86 A;  3H1K E;  2FYU E;  1PFF A;  1DJU A;  2EZ2 A;  3H6P A;  1O62 A;  3A9Z A;  5AVW B;  3N7N A;  3L74 E;  5K8B A;  3OJA B;  1SS1 A;  1G7W A;  3K5B A;  1NYH A;  3TK1 A;  2J59 M;  3HRN A;  1S0A A;  2Z4E A;  4YXW H;  3LG0 A;  3BRV B;  2WPV B;  5G2Q A;  4GOF A;  5KLV G;  1KFN A;  2QG4 A;  1ZLL A;  4GE9 A;  5KJ7 D;  1G2C B;  3AE7 C;  3FKD A;  1VQ8 P;  1I43 A;  2V0Y A;  4WY4 A;  2BKW A;  1RE3 C;  1KTM A;  4R4L A;  4ZAS A;  3MUD C;  4HVK A;  5APV A;  5KLV E;  3VN0 A;  1FOS E;  2FNU A;  3AEJ A;  4GRX A;  4Q31 A;  3HUS C;  3E6G A;  4D6T D;  4L74 A;  3AE9 C;  2WIT A;  3V2Q A;  3DC1 A;  4MQP A;  3PPL A;  1BGY D;  2GQN A;  1RVU A;  2WK9 A;  3GHG B;  2QE7 H;  1WYU B;  4DOJ A;  3FZ6 A;  3KGX A;  4O6Z A;  3TFT A;  1Q86 Q;  3CX5 H;  5B66 E;  1AHF A;  1DD3 A;  4ZLV A;  2D61 A;  1RQU A;  3RL0 g;  1IJD B;  4LNM A;  4IY7 A;  1KQL A;  1Z56 A;  3FRK A;  2QEX P;  3BWN C;  4A0R A;  3RK3 C;  1JCD A;  2I1K A;  3B8E B;  1W23 A;  1H0T A;  1YQ4 C;  2E76 C;  4ZNC A;  2CJD A;  1W2E A;  1HJB A;  3WUV A;  3V4W A;  1LTI C;  1SZU A;  3AV7 A;  2ZYJ A;  1TU3 F;  4LLH A;  4UOY A;  3HLM A;  4UB6 H;  2WTY A;  3MBB A;  4WY4 D;  1W2B O;  3NYU A;  3MGN A;  2YXR B;  2E54 A;  3TFU A;  3H25 A;  1SQX G;  3D6K A;  2HG5 D;  3G6E P;  2BYL A;  3T97 B;  1C4K A;  1VQP P;  3JCU H;  3MIW A;  3E7K A;  1L0N G;  2R5B A;  1IO4 A;  2VGW A;  1USD A;  1AMQ A;  3WGB A;  3WLX A;  3PD6 B;  1FU1 A;  1KYO H;  1VF5 B;  3RL0 C;  1OHV A;  3BCA A;  4ITX A;  2OYH C;  1X29 A;  2Q5U A;  1Y8A A;  2D7Z A;  2XH1 A;  2Y9Z A;  1X0M A;  3H1L J;  1L0N E;  3GF3 A;  4HB1 A;  3SWK A;  3WUT A;  4H63 Q;  1ZC9 A;  8AAT A;  4EDF A;  4BRY B;  1SFC A;  1O4S A;  2EO5 A;  2X8U A;  1ORD A;  2QM7 A;  1IFJ A;  3N4R A;  2HFE D;  1GU4 A;  1QVF O;  4K2I A;  1KMK A;  3NTN A;  4UHM A;  4E3R A;  2CAN A;  2EGY A;  2NMP A;  1LTS C;  4LNJ A;  3DZZ A;  1URQ A;  1OZH A;  2BHX A;  1KC8 Q;  1GEX A;  2K9J B;  3WY7 A;  2D2C C;  4PVF A;  4RKC A;  3N5M A;  3KDP B;  1N73 A;  3IFM A;  1YJ9 P;  5AVZ B;  4CXR A;  1CJ0 A;  1YBK A;  4J5U A;  2HR3 A;  3CWB J;  2WQY C;  1JG8 A;  4ITG A;  1Z3Z A;  3H1J E;  4UB6 E;  3BWO A;  3EIA A;  5KKZ B;  3LWS A;  4CBR A;  3U59 A;  1GW3 A;  3JCU E;  1FZA A;  5APU A;  4BXL A;  3FQA A;  3EZ1 A;  4P7Y A;  3T32 A;  3KE3 A;  1SFC D;  4GSA A;  2O1B A;  1KB9 I;  2IBZ E;  1S5L X;  5DJT B;  2YKO A;  3JW9 A;  2WSC H;  3CI9 A;  2GA1 A;  5AVU B;  1M7Y A;  2D66 A;  1MUU A;  4CXQ A;  1PP9 E;  5EUE A;  3P8C E;  3Q8N A;  2D7Y A;  5AW9 B;  4B86 A;  4DGT A;  4R5F A;  1EZV D;  1URQ D;  2IX7 C;  2CIN A;  4PV1 B;  4M2M A;  4ZDO A;  1JY3 P;  3KQG A;  4A6R A;  1KQF B;  3WUU A;  1RY3 A;  5BVZ A;  4N6J A;  3L70 G;  1OXP A;  5FT8 A;  1MFZ A;  1YI2 P;  3M0D A;  5AVQ B;  3N0L A;  1DEB A;  1NTM D;  3ZRP A;  1LWU C;  1SQB E;  3F9T A;  3H1K D;  3KXD A;  1J1E C;  2N1T A;  3A7O A;  1MV8 A;  1RF1 A;  1LT9 C;  2HOZ A;  1GC3 A;  2OKJ A;  1PG8 A;  2XNX A;  1VJO A;  1CI6 A;  2K3R A;  3L74 D;  1PMO A;  3L37 A;  1BSH A;  1AAW A;  3RBX A;  1YJZ A;  2POH A;  2KS1 B;  3CCJ P;  3C8V A;  4PJ0 H;  5KAI H;  4JEX A;  1I41 A;  2NPS B;  5AW8 B;  5C39 A;  4AZJ A;  2YCP A;  4ADC A;  1YQ3 C;  1D2F A;  1W7N A;  3EFF K;  4ASW A;  4W1W A;  5KLV D;  1LT1 A;  3OAK A;  3WMM 0;  1O69 A;  4ZWM A;  2A06 G;  1BE3 J;  2GSA A;  4XEW A;  2V4H A;  1K9M Q;  3UAK A;  2CJH A;  2ZT9 D;  3VP9 A;  3IN6 A;  1S72 P;  5EUN A;  1OAT A;  1AHE A;  1U7J A;  2A06 E;  3EZS A;  5JAY A;  2JDI H;  3LVK A;  4ZDL A;  4C46 A;  3WCN A;  2N1T D;  2KFP A;  1SQQ K;  1B9H A;  1JEK A;  1ASF A;  2FYN B;  3KZI H;  2FM1 A;  1OVU A;  1FDM A;  3RBL A;  1S9K E;  2JG2 A;  5EUD A;  3NFQ A;  2R5C A;  3GHG C;  1VQ5 P;  4OVN F;  1AJR A;  3QM2 A;  3VK4 A;  2ZAE B;  1G2C A;  3IR9 A;  1VDF A;  1AY4 A;  2QA3 A;  1O61 A;  5APQ A;  1CQ6 A;  1SQP J;  2XV5 A;  1OIP A;  3CL3 D;  1QGK B;  3L71 G;  1S5L E;  2QSR A;  3I56 P;  4XAU A;  4PJ0 E;  4RIT A;  2BI2 A;  5APT A;  5KAI E;  2JJG A;  5CHX A;  1T6A A;  1DIP A;  1WYU A;  4TMR A;  3GF7 A;  2M3E A;  2Z61 A;  3BCC G;  3MAF A;  1PZQ A;  1SQX D;  2OGU A;  4OGQ C;  3L71 E;  3EI7 A;  1L0N D;  5TJH A;  5EIG B;  2WSF J;  2WT7 B;  5HHY A;  4IXO A;  3WZF A;  3UIA A;  1QL1 A;  1EG5 A;  1Y47 A;  2BI5 A;  2ORD A;  3MC6 A;  2H88 C;  3IF4 A;  1QGN A;  1SF2 A;  3L44 A;  2WWW A;  4N3Y B;  3SSU A;  5CCH C;  1HTL C;  4A7P A;  1MAP A;  1QJ5 A;  1FZC C;  1OW8 A;  2DKB A;  1AMS A;  4WLJ A;  3KZI E;  3F6T A;  1SQQ J;  4Z1M H;  2VMP A;  1S09 A;  2KK7 A;  1RQV A;  2KNC B;  3CCL P;  3PTZ A;  4BMK A;  1AHY A;  1DFO A;  4GOD A;  4WB0 A;  2K37 A;  2FXP A;  3H7F A;  3PD6 A;  2BCC J;  2VYC A;  1YJN P;  1JS6 A;  2C0W A;  5FT4 A;  4OWF A;  5AW3 B;  1ZOB A;  1EDI A;  1T2K C;  4JEZ A;  3M9B A;  1L4A A;  1OHW A;  3M91 A;  4WVZ A;  3AEF C;  4BRY A;  2WMM A;  2H43 A;  2HOD B;  3H1H J;  3FVS A;  2CH1 A;  2YMK A;  5DX5 A;  3L73 J;  1JF9 A;  2AEV A;  3HVY A;  2G3A A;  4OMA A;  5HDM A;  1W5C E;  3FX0 A;  1V72 A;  4N0W A;  3HUS B;  1UKJ A;  3P8C D;  4EIJ A;  3PDB A;  1KB9 E;  1RF0 C;  3A3Y B;  3Q1M A;  3K7Y A;  3PJS K;  1OVR A;  4AQR D;  1C9C A;  1SVF A;  1NJI Q;  2CPB A;  2E5T A;  2WPQ A;  3A0H H;  1NGM B;  3RQ1 A;  3GZD A;  1LS3 A;  1AY8 A;  2Y0E A;  3H1I J;  1PFI A;  1B4X A;  1JM0 A;  1P84 I;  1VF5 D;  3P7K A;  3AE4 C;  5AX8 A;  3QGU A;  4GKG A;  3L70 D;  1LGH B;  1BGY E;  1KQS O;  3C1L A;  1GC0 A;  1DJE A;  1L4A D;  1LTT C;  2QA4 P;  1K73 Q;  1D7U A;  2Q3E A;  2E76 B;  2JWD A;  4WYA A;  1HGV A;  4JF7 A;  2CK3 H;  2ZFC A;  4E77 A;  3DRD A;  4WYF A;  1TOK A;  4MQR A;  2C0X A;  1RVY A;  1KD1 Q;  2CY8 A;  3S4R A;  3PH0 A;  5CBN A;  1VQ9 P;  2DW3 A;  4M3L A;  1BCC G;  2EZ1 A;  2QVA A;  3CC7 P;  1J2J B;  4IYO B;  2OYH B;  3FSL A;  1KL2 A;  2YKX A;  2H7H A;  4RAE A;  4GOE A;  3E9K A;  3K40 A;  4N78 D;  2JWA A;  2GB3 A;  3P8M C;  2KI7 B;  2KIK A;  5H2F H;  3USF A;  1HF9 A;  4BHD A;  2A06 D;  1RE4 C;  2KP8 A;  4CBS A;  1NTZ G;  1BCC J;  2W7E A;  3CMA P;  3GSB A;  4P3M A;  2DKJ A;  1FZE A;  3G71 P;  2PGD A;  1N7S C;  1S9K D;  3EI6 A;  2LXB A;  2KS1 A;  2FXO A;  2V7Q J;  2YRR A;  1IFI A;  1IFP A;  4LW4 A;  2D2C B;  2K9Y A;  5GTI H;  4WBT A;  2Z9X A;  1N8R Q;  4M2J A;  1U7M A;  4GDO A;  4ATQ A;  2AEM A;  4F5K A;  3V2R A;  3GET A;  5D5S A;  2KSJ A;  2HOY A;  2YIU C;  1Y9B A;  2QIW A;  4PV1 D;  4RES B;  1YTZ I;  2AY3 A;  4EMY A;  1EQB A;  3CCR P;  2BWP A;  5DB5 A;  2OTL P;  1HBW A;  3DR7 A;  2TPL A;  4Y0D A;  3CQ5 A;  2FYF A;  5M4D A;  4F5M A;  2QLR A;  1SQV G;  1LTB C;  3ZRR A;  5AVT B;  1KIL C;  3L71 D;  1LK9 A;  1Q90 D;  3OW2 O;  1DKA A;  2Z5H A;  1KN7 A;  1GCK A;  2R5D A;  1S3J A;  2HOR A;  3RK3 E;  3AEG C;  2VMU A;  3BCC D;  3AEO A;  1GD2 E;  2FYU K;  2VMV A;  1Q82 Q;  1J1D C;  4H44 D;  2Z9U A;  3FFH A;  2GM4 A;  1M57 D;  4RO0 A;  3AEP A;  3EFG A;  5H2F E;  3AEC C;  3TCM A;  1D7S A;  4U3F G;  4Y0I A;  3LID A;  1GC4 A;  2HZP A;  1K04 A;  1FS0 E;  3A9Y A;  1SZK A;  3NU8 A;  3VAX A;  1HUC A;  1B8G A;  2R44 A;  3QPG A;  1WT6 A;  1QLE D;  3E1I A;  4U3F E;  3CD6 P;  3NYS A;  2VMZ A;  5AW6 B;  1LWU B;  3H32 B;  2K88 A;  1J1E B;  1P84 H;  1CS1 A;  4K05 A;  1RH5 B;  5BJ4 A;  5GTI E;  3AE8 C;  1LT9 B;  4RIZ A;  1FDO A;  3LVJ A;  1MDX A;  4WB4 A;  2PRR A;  3M06 A;  2JGT A;  1VQO P;  4LNL A;  3N4X A;  1NU1 G;  1KFM A;  5AVY B;  4IW7 A;  4O9B A;  2XDJ A;  1SVV A;  2R32 A;  3V2N A;  1R8E A;  4I8A A;  3BC8 A;  2Z1Z A;  2XBN A;  2WT7 A;  2YRI A;  2YXQ B;  2E7J A;  1LJ2 A;  1NTM E;  2ZY4 A;  3A9X A;  3TGU G;  5G4I A;  4W91 A;  1BJO B;  5DJ9 A;  1LTJ C;  2BIA A;  2VIA A;  1UU1 A;  2DGM A;  1NU1 J;  1X0T A;  2BAS A;  2WPR A;  2BI9 A;  1AKA A;  1IFD A;  5AW5 B;  2IDB A;  2DR1 A;  2PAJ A;  1UIX A;  5AVR B;  1KB9 D;  4ZKP A;  4UHN A;  2JP3 A;  1M7L A;  2R3C A;  3TGU J;  1QJ3 A;  2KLV A;  2IZ0 A;  2E42 A;  2RFV A;  2KNC A;  2C44 A;  2VIB A;  4WXG A;  2FYU J;  1CSB A;  4UB8 H;  3N4S A;  2WB6 A;  3CBF A;  2ZVO B;  3GZC A;  1X22 A;  4Q6R A;  1IC2 A;  4PIW A;  4ZM4 A;  2W7L A;  4MKK A;  3PP5 A;  2W7K A;  4PFN A;  2H89 C;  1JMB A;  2HYN A;  2HOD A;  1N2D C;  1P84 E;  2YHK A;  2OQQ A;  4J8L A;  2AY7 A;  1L0N K;  4QMA A;  1MFT A;  1OW7 A;  2R0T A;  4HF8 A;  1RE3 A;  5EAA A;  4FL0 A;  4BWN A;  3MD0 A;  5FT5 A;  1YYC A;  4Y28 J;  2B88 A;  3L35 A;  5EFS A;  1IX6 A;  2X5D A;  1YIY A;  2P2U A;  3IAO A;  5CMZ A;  1BT4 A;  3JC2 2;  1BJ4 A;  4OGQ B;  1ZV8 A;  3BV0 A;  2NZ2 A;  1JY2 O;  1NTK K;  4MSO A;  4U7J A;  3FCR A;  3H1L G;  3CCQ P;  1JO5 A;  4I7Z C;  1T8Z A;  4XE5 B;  3AE2 C;  1TOE A;  2E74 B;  1EDK A;  3U1C A;  3BWN A;  1TAS A;  1M0P A;  1SP4 A;  2D64 A;  4GE4 A;  2JJH A;  1SQX E;  4UB8 E;  1FZC B;  1NTZ D;  1FC4 A;  2W6J H;  1JNM A;  1OX3 A;  2ZYG A;  3HMU A;  4E3Q A;  1E5F A;  2AEJ A;  3HE5 B;  4HJG H;  1YOO A;  4NOG A;  2AEF A;  5C6U A;  3BS8 A;  4U2H A;  1M1J C;  1WYT B;  2QJP C;  1B9I A;  1URQ C;  3CWB G;  5BU8 B;  2OYH A;  1AJY A;  1AX4 A;  4ZSW A;  3ASB A;  2IFN A;  1UU2 A;  1GL2 B;  1PV3 A;  2ZSL A;  4RKU J;  2R3S A;  1MLZ A;  1XI9 A;  2OTJ P;  2LKM A;  2WK7 A;  3RK2 C;  2BEZ F;  4WYD A;  4CVQ A;  2JIS A;  2HUF A;  3CWB E;  3CXH D;  1C7N A;  4JYC A;  1IK7 A;  3RK3 D;  1H0C A;  3A0B H;  1SQV D;  2M5A B;  2E76 D;  1SQB K;  4AZK A;  5GTH H;  2B87 B;  1NTK J;  2OQX A;  3EUC A;  2W90 A;  1WST A;  2OYI C;  1AQ5 A;  1EJI A;  1NAY A;  1G4V A;  5E3K A;  1ZXG A;  3LW5 J;  2AXT H;  1BSN A;  1S2E A;  3NUB A;  1VEF A;  2JJE A;  2V1P A;  3NX3 A;  1LKC A;  3W68 A;  4U3F D;  3RL0 D;  1X8Y A;  3CC2 P;  1JUN A;  3H1J J;  3EWK A;  3B1D A;  4XJP A;  3Q5P A;  1IZN B;  2P10 A;  3F5H A;  4KHX A;  2ITA A;  2Z1Y A;  3GJU A;  3NYT A;  1LTA C;  3MAU A;  1T3U A;  2E7U A;  5AW4 B;  2FFD A;  1IAY A;  3TF5 A;  3HD7 B;  1M0O A;  2AEU A;  1LC8 A;  2KYV A;  3W1J A;  1C0N A;  2RKL A;  3TNU B;  1VPC A;  1PP9 J;  3JWA A;  4ZAH A;  3AEM A;  3L70 E;  2B9B A;  3QWO C;  2Q3I A;  1AKC A;  2CST A;  1FJK A;  1LNQ A;  1WYV A;  1BQA A;  3I16 A;  4A0F A;  3A0B E;  1S5L H;  1BE3 G;  2IPP A;  4OCA A;  3SFE C;  4KJM A;  2LXC B;  3PHL A;  5GTH E;  2OAT A;  3EI5 A;  4B98 A;  3GG2 A;  3COG A;  1LWU A;  1RHZ B;  3H32 A;  1ASL A;  2PO3 A;  3QI6 A;  1SQB J;  1OFC X;  1GD9 A;  2BWN A;  4LC3 A;  1LT9 A;  5M46 A;  2WSF H;  3B5N C;  5AVX B;  2KB7 P;  2FNI A;  4DCK A;  3CCE P;  3II6 A;  1H8A A;  1N7S B;  3FDB A;  1KMJ A;  1TAR A;  1C7G A;  2AXT E;  3CAI A;  4N78 E;  3VMY A;  1FG3 A;  1JTH A;  2JEE A;  1OXZ A;  2KZI A;  1P84 D;  2C9N Y;  1BJO A;  5G09 A;  3UWC A;  3E2Z B;  1ZR4 A;  5KAF H;  1GBN A;  3TDK A;  2KOG A;  2YIU B;  3AE1 C;  1MDO A;  2J5U A;  1EDJ A;  4H13 C;  2C7T A;  4DQ6 A;  4W5K A;  1SQP G;  2WSC J;  1ZR2 A;  2Q1K A;  1JOC A;  1JB0 J;  2I8D A;  4ATP A;  2AY4 A;  3AEN B;  3Q5R A;  1KIL B;  1USE A;  3L72 G;  5J8Q A;  1SQP E;  2AY1 A;  3L75 J;  1UII A;  1IK9 A;  2W8U A;  3FWN A;  1MZ9 A;  3ZZJ A;  3R4Y A;  4LC1 A;  2D5Y A;  3QH9 A;  3C9I A;  3RCH B;  3CXH I;  2P7J A;  3EI9 A;  1MLY A;  3ELE A;  3DOD A;  3KPE A;  1J1D B;  1ASM A;  3GHG A;  3CQ4 A;  1VQK P;  4H0L D;  4K2M A;  3H1L D;  3L72 J;  1RV3 A;  3HL2 A;  3AED C;  3K28 A;  3R9A A;  5AW2 B;  4EYY Q;  1Q7Y Q;  2CB1 A;  4GIF A;  1AJS B;  2HPC B;  3AEB C;  5BJ3 A;  1KB9 H;  2HOX A;  3QN6 A;  4MKJ A;  2E74 C;  4IFM A;  1L0L K;  3BCC E;  1SQQ G;  2A45 I;  4OTL A;  1WKG A;  1PGO A;  1EXJ A;  1DTY A;  1J04 A;  1YAA A;  1U57 A;  4IOI H;  2BCC G;  5KAF E;  3MHV A;  5AVS B;  4XJM A;  1XTG B;  5G0A A;  2FYZ A;  3P1T A;  1HWT C;  3M5U A;  2WPS A;  1AHX A;  1QIS A;  3DR4 A;  1JY3 O;  3V4Q A;  1QZ9 A;  4HKZ H;  4WLH A;  3T97 A;  2W7J A;  2BCC E;  3V6I A;  3II0 A;  4JEW A;  2W7M A;  2XKM A;  3CWB D;  3H1H G;  4W1V A;  4DT0 A;  1LTJ B;  1H1C A;  4LW2 A;  3O8Z A;  1PGP A;  3SWF A;  2B89 A;  3AEE C;  3L73 G;  5G2P A;  1K05 A;  1L4A C;  5CCH A;  1GTW A;  1YIJ P;  2P67 A;  1GL2 C;  1IAX A;  1BJW A;  1YHQ P;  1ASE A;  1Y4I A;  1OW6 A;  1LTG C;  1H89 A;  2WVR A;  1LW5 A;  4IXS A;  2BWO A;  1S4X A;  3L73 E;  2GUS A;  2HLO A;  2RN0 A;  3FTB A;  4PFF A;  5D95 A;  1MGV A;  3ECD A;  2ZXX A;  3NXS A;  2BI1 A;  3A8U X;  2ZYD A;  1FBM A;  3G7Q A;  1AVY A;  1WYT A;  1KMI Z;  2W8V A;  1LC5 A;  4F5G A;  2RH0 A;  3H1I G;  2ZJS E;  1D7M A;  4OGQ D;  1M56 D;  1PPJ G;  3M9H A;  3FQ7 A;  2K9J A;  3GZD C;  1GC2 A;  1C7O A;  5APX A;  1VP4 A;  4KXK A;  1AAM A;  3FXD A;  1L0L J;  4ZDP A;  4IX8 A;  4JYB A;  3H1I E;  4HYT B;  4EB7 A;  2X3L A;  1FJP A;  3PIU A;  2WSE H;  3FVU A;  1ECX A;  2M5A A;  3HE4 B;  5CCH D;  2E75 C;  2W27 A;  5CBO A;  4D6T G;  2YKU A;  3WX9 A;  3I5C A;  4WBA A;  3JWB A;  1FC2 C;  5KLI C;  1GK6 A;  4DBC A;  3GBX A;  2O01 J;  2M8R A;  3FWL A;  2RMZ A;  3HD7 C;  3VMX A;  1B5P A;  3AE3 C;  1N31 A;  1V2D A;  4W1X A;  3WGC A;  2AAT A;  4I7Z B;  1YIT P;  2VMQ A;  1ZN5 A;  1I48 A;  4D6T J;  4XK1 A;  4F5H A;  3RBF A;  2W8J A;  3CXH H;  2ZY2 A;  1BGY J;  1BE3 D;  3KGW A;  4TT3 H;  1DJ9 A;  2F8J A;  1MDZ A;  4R8D A;  2AY2 A;  4GEB A;  1X28 A;  1VQM P;  1Q81 Q;  2Z20 A;  5APY A;  4F5J A;  1BJN A;  4JBZ A;  1BCC E;  3B4S A;  2QMA A;  4RM1 A;  1NHL A;  1QEX A;  3FGA D;  4W7Y A;  2A45 H;  4OYT A;  4H44 C;  1M1J B;  4A0H A;  2QJP B;  4JF0 A;  2Q6Q A;  2QB2 A;  2M3B A;  3GW6 A;  1URQ B;  1BKG A;  3FVX A;  4EFF A;  3U1A A;  4OH8 B;  1NTZ E;  3FZ7 A;  5I92 A;  2L91 A;  4A6T A;  2YKP A;  1JCC A;  3O6Q B;  3RK2 B;  2NPS A;  4XFJ A;  1P3W A;  1RE4 A;  3BRT B;  3S9O A;  2OGA A;  1SQP D;  2QJY C;  3W1I A;  2VGT A;  5CCG C;  1OMI A;  2Z9V A;  2JJL A;  3CPW O;  9AAT A;  1N7S A;  3VTP C;  3NU7 A;  3RBZ A;  4A72 A;  2R2N A;  3MEB A;  2PB0 A;  3PAA A;  2HP2 A;  1NKZ B;  1N8P A;  3ASA A;  3CX5 I;  3VOP A;  1YJS A;  1ASN A;  1W7M A;  4JF1 A;  3AE6 C;  3CXH E;  2OYO A;  2YCN A;  2QBT A;  2OYI B;  1TOJ A;  2VI8 A;  3SFD C;  2FY8 A;  1SQV E;  1NTM K;  2A45 G;  3Q5S A;  1ZRT E;  4FFC A;  3MAD A;  3NTJ A;  1OVV A;  3WCO A;  4EU1 A;  2N9B A;  2G8Y A;  4K3A A;  1DX7 A;  1AIC A;  2CJG A;  5M49 A;  2W8T A;  1WKH A;  1GMJ A;  3CME P;  1GU5 A;  3AEN A;  2Y0D A;  5KJ7 C;  1SQQ D;  1KIL A;  2NPS D;  1JMM A;  2XZR A;  3G0T A;  3D6Z A;  1KOR A;  3USS A;  1FAV A;  5CJ4 A;  3GLM A;  1AMA A;  4IFF A;  2E5Y A;  3RCH A;  2BCC D;  2YCT A;  3H9X A;  2O0R A;  2KZJ A;  1N7S D;  1CI6 B;  1T3J A;  1W7L A;  2YKV A;  2VMR A;  3NMD A;  5DJ1 A;  5KLV K;  4ISY A;  5TIS H;  1HGZ A;  2Q7C A;  3P6K A;  3B1E A;  4KT0 J;  3A5T A;  3I55 P;  3H1H D;  2HPC A;  3JSV C;  1MKM A;  2I1J A;  5EIG A;  1CQ7 A;  2YKY A;  3EI8 A;  3L73 D;  4IXZ A;  4JPZ B;  1NU1 E;  2BI3 A;  4JEV A;  4R4M A;  2VMS A;  2O1K A;  2QRX A;  2CPS A;  2VI9 A;  5AW7 B;  1B5O A;  1CZE A;  2C0R A;  2VGU A;  3V2P A;  2BIG A;  2FYU G;  3B5N B;  4MQQ A;  2W7G A;  2P1J A;  4WYC A;  3TGU E;  5M1B A;  3ATH A;  3L74 G;  1ELU A;  1A02 J;  3WKR A;  1KIL D;  1NWQ A;  1IFN A;  3VYI A;  3HQT A;  1E5E A;  4WY4 C;  5BU5 A;  4ADE A;  4AH3 A;  1NTM J;  2Y0C A;  1AIB A;  3H1K J;  2SPZ A;  3AEJ C;  3H1I D;  1DEE G;  4EI2 A;  1LTJ A;  1M90 Q;  2VMO A;  2W7I A;  1CL1 A;  1PPJ D;  3L74 J;  3W1H A;  4NPD A;  3PDX A;  2R5C B;  3VK3 A;  2ZP7 A;  3KYQ A;  3PJ0 A;  4H13 B;  1NVO A;  2DOU A;  5CJ0 A;  4F5L A;  2VGZ A;  1BW0 A;  3RI6 A;  1XTC C;  3PLN A;  1WMK A;  3CQ6 A;  1SQX K;  1FZF A;  2GMU A;  4ASV A;  5TIS E;  2QJK C;  1X79 B;  3MUD A;  5KLV J;  3TQX A;  3HUS A;  1CL2 A;  1G4X A;  1TAT A;  4K35 A;  1IFM A;  1IBJ A;  4ZWV A;  3VMA A;  3AAT A;  3GR9 A;  3MAF B;  1KQG B;  1DGD A;  3ZDM A;  3ACZ A;  3CLQ A;  2O7C A;  3PGY A;  3NNK A;  1AY5 A;  1E5W A;  4GE7 A;  1KV4 A;  3NUI A;  1BCC D;  4IFD K;  1BDC A;  3HE4 A;  4GDY A;  2PP6 A;  1SLQ A;  1VQ7 P;  3S1K A;  3LW5 H;  2O3J A;  3ZRQ A;  3H1L E;  1ZOY C;  1ASA A;  1MAQ A;  1DH3 A;  2UWJ E;  1SFC C;  5IWQ A;  4PD4 D;  1JS3 A;  3B1C A;  1ARH A;  4AO4 A;  1W3U A;  3DYD A;  4WB0 B;  1KKP A;  1ASD A;  3EQ2 A;  3MKJ A;  3AEL A;  1LC7 A;  4TLF A;  4Y99 C;  1LP1 B;  1HH0 A;  2IYO A;  1L4A B;  4CPG A;  1QIT A;  4IYO A;  1A02 F;  2HUU A;  4WXF A;  1SQX J;  3LY1 A;  2X5F A;  1G1J A;  1T3I A;  1L0N J;  2ZVN B;  3CCV P;  4AUW A;  4C7N B;  3B71 A;  1N73 C;  1EQ7 A;  2VRS A;  1ASB A;  2FBW C;  1NTK G;  3FFR A;  1QVG O;  4I1L A;  1ARS A;  3R2P A;  4OC9 A;  1NKN A;  3NRA A;  2OKK A;  3MZW B;  5DJU B;  3G8M A;  1M1J A;  1FE6 A;  3CX5 E;  3PDB B;  3ELP A;  5F9S A;  4EB5 A;  1NTK E;  2P58 A;  1ZRT D;  1PGJ A;  2Y9Y A;  1Q2N A;  3AE5 C;  1J32 A;  2ZSM A;  5B5E H;  2VMY A;  3E2Y A;  1PGQ A;  3M0A A;  3H1J G;  4IL6 X;  2ZY3 A;  2W8W A;  3V5B A;  3O6Q A;  1WRG A;  1AMR A;  4F4E A;  4RLG A;  3TYY A;  1FG7 A;  1S06 A;  2W7H A;  2NRG A;  4E1O A;  2J58 A;  1FOS F;  2VMX A;  2IBZ G;  1EXI A;  1D7R A;  4I2L C;  4JQ0 D;  2VLH A;  1Z7D A;  1GZL A;  2E75 B;  1PP9 G;  3OKS A;  2XND H;  4YXD C;  1JY2 N;  2FFD C;  3QBO A;  1KYO E;  5KLI B;  2ZT9 C;  3M0D C;  5E4Z A;  2PFX A;  2FKI A;  4DZO A;  2VLF A;  3E1R A;  2OYI A;  1LW4 A;  1NAF A;  1EC5 A;  1TOG A;  3VK2 A;  4F5I A;  2N1T C;  3AEM C;  1RF1 C;  1NU1 D;  5EAV A;  4WYG A;  1NH4 A;  2DGL A;  3G9R A;  2AY5 A;  1SQB G;  4IL6 H;  4H51 A;  4BA4 A;  2D2C D;  1ART A;  1RV4 A;  3TGU D;  3RK2 D;  2IFM A;  3W67 A;  4RJ0 A;  1GEY A;  1SFF A;  3E2F A;  2FYU D;  5B5E E;  3IHJ A;  2ZC0 A;  5FT6 A;  4WP0 A;  4YTP C;  2JR8 A;  3HDO A;  1UU0 A;  1SQP K;  1N7L A;  3L70 J;  1BE3 E;  1KAF A;  3G4S P;  4H44 B;  3WKS A;  1S1C X;  3D71 A;  2FKW B;  1VL2 A;  4H0L C;  3CCM P;  1M1K Q;  4F5F A;  3D70 A;  2EPJ A;  5TF5 A;  2PB2 A;  3BAT A;  1YTZ T;  2H8P D;  4WYE A;  4I6M C;  1QX8 A;  4GT1 A;  2ZYA A;  3ZZK A;  2FQ6 A;  1AVO A;  3VP6 A;  1BDD A;  2VGV A;  4PD4 I;  2KXP B;  2QJY B;  2GMS A;  1KL1 A;  2D65 A;  3VP8 A;  2JJF A;  1YNU A;  3B5N A;  3L75 G;  3LIE A;  2KLU A;  3TAT A;  3D6Y A;  2MJZ A;  1G1I A;  3CC4 P;  4XA4 A;  2WK8 A;  3GWP A;  3KHU A;  3FXE A;  3L75 E;  4IL6 E;  5AVV B;  2AY8 A;  2VMN A;  2OGE A;  1AFO A;  4ZMD A;  1K8A Q;  3DXV A;  4A0G A;  4WD2 A;  2ZY5 A;  3DU4 A;  4ZSY A;  3L72 E;  2QB3 A;  2YO3 A;  1PMM A;  4K2B A;  1N2T A;  3PA9 A;  4RJY A;  5KTB A;  5L8R J;  2E43 A;  3HTK B;  2WZ7 A;  4W7Z A;  3MC6 C;  1IX8 A;  1NOH A;  2JKV A;  3G3Z A;  2HP1 A;  1FZG A;  2KUB A;  3B5N D;  2O01 N;  1VQN P;  3E77 A;  2IZ1 A;  3HT4 A;  2XU6 A;  3FDD A;  5APS A;  1AIA A;  4BQ0 A;  3RUY A;  3LV2 A;  2LR2 A;  3BCB A;  1SQQ E;  3L71 J;  2HUI A;  1IUG A;  1M8O B;  5AW1 B;  2YOB A;  2W6B A;  3JZL A;  1D7V A;  4UQV A;  3CCS P;  3FZ8 A;  2O01 H;  4A6U A;  3BCC J;  5G4J A;  1VF5 C;  2VMW A;  1H88 A;  3VOM A;  1CZQ A;  4H13 D;  1GW4 A;  3CX5 D;  3BVH A;  1NTK D;  3BN1 A;  1EZV I;  2YKQ A;  1FZC A;  1CQ8 A;  3LVL B;  3H1H E;  2Q9I A;  2E7I A;  3B46 A;  1VQ4 P;  4M2K A;  2EH6 A;  5E79 H;  3MTU E;  3HE5 A;  4WY4 B;  1V2F A;  2M0B A;  3AOV A;  4QGR A;  1L0L G;  2W6A A;  3B8X A;  3H1J D;  3ABV C;  1LP1 A;  1X2A A;  1G7X A;  3P32 A;  2G6W A;  2W8Z A;  4Q76 A;  3TSI A;  4AYC A;  1GL2 A;  1KIL E;  1S08 A;  2W7D A;  1V2E A;  3EIB A;  4Q75 A;  4C7N A;  3F89 A;  1TPL A;  1L0L E;  2C9L Y;  3FQ8 A;  1AA0 A;  4W8I A;  2ZUK A;  1ASC A;  1KYO D;  2IBZ D;  1AV1 A;  2V7Q H;  4ZM3 A;  1R5S A;  2D63 A;  2E74 D;  3I4J A;  1OXO A;  1YIZ A;  4HH2 A;  1PPJ E;  5KKZ C;  1PP9 D;  4PD4 H;  2QJK B;  1VQ6 P;  4KYO A;  4OBU A;  1H0T B;  1RF0 A;  2B87 A;  3A2B A;  1GDT A;  4DJG A;  1FZB A;  2CH2 A;  2YMY A;  4Y0H A;  2GUV A;  1BGY G;  4L0O A;  2AY9 A;  1M0N A;  2BEQ D;  3HBX A;  1NTZ K;  1ARG A;  2Q7W A;  1YJW P;  5F8V A;  4D6T E;  2WSS H;  1SQB D;  1QL2 A;  3M9Q A;  2AY6 A;  1CW5 A;  3RK3 B;  4PV1 C;  4L75 A;  1E79 H;  5AW0 B;  4L76 A;  1ELQ A;  5E79 E;  1T2K D;  1GL2 D;  3I5T A;  2OTK E;  2MKV A;  3LVM A;  3L36 A;  4XJL A;  1JY3 N;  1KZU B;  1DD4 A;  2YNY A;  1SFC B;  1EDL A;  3HD7 A;  2W7F A;  4W80 A;  3SWY A;  2ZJG A;  1BS0 A;  2WKA A;  1IX7 A;  5APW A;  3TNU A;  3Q3D A; 
#chains in the Genus database with same CATH homology
 1DGE A;  1M6S A;  1M32 A;  3RL0 B;  3UE8 A;  2O1J A;  3ISL A;  1SQV K;  4Y99 B;  3QHX A;  2A1V A;  1I29 A;  2ZXE B;  1KKJ A;  4AOA A;  1NO4 A;  1IVR A;  4KAM A;  1N73 B;  1AKB A;  2NPS C;  4A00 A;  1ZOD A;  4EOT A;  3BCX A;  2R5E A;  4ADD A;  4LGD E;  3DXW A;  3R4T A;  4RKD A;  1CZC A;  2DGK A;  3L8A A;  4U1T A;  2QM8 A;  4B9B A;  1X9V A;  2OAR A;  3HD7 D;  3L4F A;  5M4B A;  1SPA A;  1HVV A;  3VMZ A;  2CTZ A;  3E2Z A;  1YJY A;  4OT8 A;  5CCG A;  5HXX A;  1U08 A;  2Z9W A;  1NU1 K;  1JY2 P;  1S07 A;  4ADB A;  3KKI A;  3AOW A;  4TN4 A;  3JTX A;  4AO9 A;  2FFD B;  2BIE A;  2VGS A;  4C7R A;  1GDE A;  3BAS A;  5EQC A;  3FD0 A;  4MY5 A;  1OHY A;  3NDN A;  2N1T B;  4OBV A;  4ZKU A;  1RF1 B;  1SZS A;  1M0Q A;  2G7J A;  1WYV B;  1QIR A;  3F0H A;  3N75 A;  2FN6 A;  4R2N A;  3HTK A;  5KJ7 A;  1AJS A;  4XJO A;  2FXM A;  1BQD A;  1OWA A;  7AAT A;  3A2A A;  5CCG D;  4WXB A;  4JEY A;  2Z5I A;  1ASG A;  4R5Z A;  5E5I A;  2BYJ A;  3OP7 A;  2L5G B;  1GEW A;  1ARI A;  1IJI A;  1XEY A;  1TOI A;  2C81 A;  1M4N A;  2YO2 A;  2VMT A;  4XQ2 A;  4UHO A;  2CFB A;  3OA7 A;  1JTH B;  3BB8 A;  1GK4 A;  2EYQ A;  1AHG A;  4BA5 A;  1N86 A;  1PFF A;  1DJU A;  2EZ2 A;  3H6P A;  1O62 A;  3A9Z A;  5AVW B;  3N7N A;  5K8B A;  3OJA B;  1G7W A;  3TK1 A;  2J59 M;  3HRN A;  1S0A A;  2Z4E A;  3LG0 A;  3BRV B;  5G2Q A;  1KFN A;  1ZLL A;  4GE9 A;  5KJ7 D;  1G2C B;  3FKD A;  1I43 A;  2V0Y A;  4WY4 A;  2BKW A;  1RE3 C;  4ZAS A;  4HVK A;  5APV A;  3AEJ A;  3VN0 A;  1FOS E;  2FNU A;  4GRX A;  4Q31 A;  3HUS C;  3E6G A;  2WIT A;  3V2Q A;  3DC1 A;  4MQP A;  3PPL A;  2GQN A;  1RVU A;  2WK9 A;  3GHG B;  1WYU B;  4DOJ A;  3FZ6 A;  3KGX A;  4O6Z A;  3TFT A;  1AHF A;  4ZLV A;  2D61 A;  4LNM A;  1IJD B;  4IY7 A;  1KQL A;  1Z56 A;  3FRK A;  3BWN C;  4A0R A;  3RK3 C;  1JCD A;  2I1K A;  3B8E B;  1W23 A;  2CJD A;  1W2E A;  1HJB A;  3V4W A;  1LTI C;  1SZU A;  3AV7 A;  2ZYJ A;  4LLH A;  4UOY A;  3HLM A;  2WTY A;  3MBB A;  4WY4 D;  3NYU A;  3MGN A;  2E54 A;  3TFU A;  3D6K A;  2HG5 D;  2BYL A;  1C4K A;  3MIW A;  2R5B A;  1IO4 A;  2VGW A;  1AMQ A;  3WGB A;  3WLX A;  3PD6 B;  1FU1 A;  3RL0 C;  1OHV A;  3BCA A;  4ITX A;  2OYH C;  1X29 A;  2Q5U A;  2D7Z A;  2XH1 A;  1X0M A;  4H63 Q;  1ZC9 A;  8AAT A;  1SFC A;  1O4S A;  2EO5 A;  2X8U A;  1ORD A;  2QM7 A;  3N4R A;  1IFJ A;  2HFE D;  1GU4 A;  4K2I A;  1KMK A;  3NTN A;  4UHM A;  4E3R A;  2CAN A;  2EGY A;  2NMP A;  1LTS C;  4LNJ A;  3DZZ A;  1URQ A;  2BHX A;  1GEX A;  3WY7 A;  4PVF A;  4RKC A;  3N5M A;  3KDP B;  1N73 A;  3IFM A;  5AVZ B;  4CXR A;  1CJ0 A;  4J5U A;  1JG8 A;  4ITG A;  1Z3Z A;  3BWO A;  3EIA A;  3LWS A;  4CBR A;  3U59 A;  1GW3 A;  1FZA A;  5APU A;  3FQA A;  4P7Y A;  3EZ1 A;  3T32 A;  3KE3 A;  1SFC D;  4GSA A;  2O1B A;  2YKO A;  3JW9 A;  2WSC H;  3CI9 A;  5AVU B;  1M7Y A;  2D66 A;  1MUU A;  4CXQ A;  5EUE A;  3P8C E;  3Q8N A;  2D7Y A;  5AW9 B;  4B86 A;  4DGT A;  4R5F A;  1URQ D;  2IX7 C;  2CIN A;  4M2M A;  4ZDO A;  1JY3 P;  3KQG A;  4A6R A;  1RY3 A;  5BVZ A;  4N6J A;  1OXP A;  5FT8 A;  1MFZ A;  3M0D A;  5AVQ B;  3N0L A;  1DEB A;  3ZRP A;  1LWU C;  3F9T A;  1J1E C;  2N1T A;  3A7O A;  1MV8 A;  1RF1 A;  1LT9 C;  2HOZ A;  1GC3 A;  2OKJ A;  1PG8 A;  2XNX A;  1VJO A;  1CI6 A;  1PMO A;  3L37 A;  1AAW A;  1YJZ A;  2POH A;  4JEX A;  1I41 A;  2NPS B;  5AW8 B;  4AZJ A;  2YCP A;  4ADC A;  1D2F A;  1W7N A;  4W1W A;  3OAK A;  3WMM 0;  1O69 A;  4ZWM A;  2GSA A;  4XEW A;  3UAK A;  2CJH A;  3VP9 A;  5EUN A;  1OAT A;  1AHE A;  3EZS A;  5JAY A;  3LVK A;  4ZDL A;  4C46 A;  3WCN A;  2N1T D;  2KFP A;  1SQQ K;  1B9H A;  1ASF A;  2FM1 A;  1FDM A;  3RBL A;  1S9K E;  2JG2 A;  5EUD A;  3NFQ A;  2R5C A;  3GHG C;  1AJR A;  3QM2 A;  3VK4 A;  3IR9 A;  1G2C A;  1VDF A;  1AY4 A;  2QA3 A;  1O61 A;  5APQ A;  1CQ6 A;  2XV5 A;  3CL3 D;  2QSR A;  4XAU A;  4RIT A;  2BI2 A;  5APT A;  2JJG A;  5CHX A;  1WYU A;  4TMR A;  2Z61 A;  3MAF A;  3EI7 A;  5EIG B;  2WT7 B;  5HHY A;  4IXO A;  3WZF A;  3UIA A;  1QL1 A;  1EG5 A;  2BI5 A;  2ORD A;  3MC6 A;  1QGN A;  1SF2 A;  3L44 A;  2WWW A;  4N3Y B;  5CCH C;  1HTL C;  1MAP A;  1QJ5 A;  1FZC C;  2DKB A;  1AMS A;  4WLJ A;  3F6T A;  2VMP A;  1S09 A;  4BMK A;  1AHY A;  1DFO A;  4WB0 A;  3PD6 A;  3H7F A;  2VYC A;  1JS6 A;  2C0W A;  5FT4 A;  5AW3 B;  1ZOB A;  1T2K C;  4JEZ A;  3M9B A;  1L4A A;  1OHW A;  3M91 A;  2H43 A;  2HOD B;  3FVS A;  2CH1 A;  5DX5 A;  1JF9 A;  2AEV A;  3HVY A;  4OMA A;  5HDM A;  1V72 A;  4N0W A;  3HUS B;  1UKJ A;  3P8C D;  4EIJ A;  3PDB A;  1RF0 C;  3A3Y B;  3K7Y A;  4AQR D;  1C9C A;  1SVF A;  2CPB A;  2WPQ A;  3RQ1 A;  3GZD A;  1LS3 A;  1AY8 A;  1PFI A;  1B4X A;  3P7K A;  5AX8 A;  3QGU A;  4GKG A;  1LGH B;  1GC0 A;  1DJE A;  1L4A D;  1LTT C;  1D7U A;  4WYA A;  1HGV A;  4JF7 A;  2ZFC A;  4E77 A;  3DRD A;  4WYF A;  1TOK A;  4MQR A;  2C0X A;  1RVY A;  2CY8 A;  4M3L A;  2EZ1 A;  1J2J B;  4IYO B;  2OYH B;  3FSL A;  1KL2 A;  2YKX A;  2H7H A;  4RAE A;  3E9K A;  3K40 A;  4N78 D;  2GB3 A;  3P8M C;  3USF A;  4BHD A;  1RE4 C;  2KP8 A;  4CBS A;  2W7E A;  3GSB A;  4P3M A;  2DKJ A;  1FZE A;  1N7S C;  1S9K D;  3EI6 A;  2YRR A;  1IFI A;  4LW4 A;  4WBT A;  2Z9X A;  4M2J A;  4ATQ A;  4F5K A;  3V2R A;  3GET A;  5D5S A;  2KSJ A;  2HOY A;  4RES B;  1YTZ I;  2AY3 A;  4EMY A;  1EQB A;  2BWP A;  5DB5 A;  1HBW A;  3DR7 A;  2TPL A;  4Y0D A;  3CQ5 A;  2FYF A;  5M4D A;  4F5M A;  2QLR A;  1LTB C;  3ZRR A;  5AVT B;  1KIL C;  1LK9 A;  1DKA A;  2Z5H A;  1GCK A;  2R5D A;  2HOR A;  2VMU A;  3AEO A;  1GD2 E;  2FYU K;  2VMV A;  1J1D C;  2Z9U A;  3FFH A;  2GM4 A;  3AEP A;  3EFG A;  3TCM A;  1D7S A;  4Y0I A;  3LID A;  1GC4 A;  2HZP A;  3A9Y A;  1SZK A;  3NU8 A;  3VAX A;  1HUC A;  1B8G A;  3QPG A;  1WT6 A;  3E1I A;  3NYS A;  2VMZ A;  5AW6 B;  1LWU B;  3H32 B;  1J1E B;  1CS1 A;  4K05 A;  5BJ4 A;  1LT9 B;  4RIZ A;  3LVJ A;  1MDX A;  4WB4 A;  3M06 A;  2JGT A;  4LNL A;  3N4X A;  1KFM A;  5AVY B;  4IW7 A;  4O9B A;  2XDJ A;  1SVV A;  2R32 A;  3V2N A;  4I8A A;  3BC8 A;  2Z1Z A;  2XBN A;  2WT7 A;  2YRI A;  2E7J A;  2ZY4 A;  3A9X A;  5G4I A;  4W91 A;  1BJO B;  5DJ9 A;  1LTJ C;  2BIA A;  2VIA A;  1UU1 A;  2DGM A;  2BAS A;  2WPR A;  2BI9 A;  1AKA A;  1IFD A;  5AW5 B;  2DR1 A;  2PAJ A;  5AVR B;  4ZKP A;  4UHN A;  1M7L A;  2R3C A;  1QJ3 A;  2KLV A;  2E42 A;  2RFV A;  2C44 A;  2VIB A;  4WXG A;  1CSB A;  3N4S A;  2WB6 A;  3CBF A;  3GZC A;  4Q6R A;  1IC2 A;  4PIW A;  4ZM4 A;  2W7L A;  4MKK A;  3PP5 A;  2W7K A;  4PFN A;  2HYN A;  2HOD A;  1N2D C;  2YHK A;  4J8L A;  2AY7 A;  1L0N K;  2R0T A;  4HF8 A;  1RE3 A;  5EAA A;  4FL0 A;  3MD0 A;  5FT5 A;  1YYC A;  3L35 A;  5EFS A;  1IX6 A;  2X5D A;  1YIY A;  2P2U A;  5CMZ A;  1BT4 A;  1BJ4 A;  1ZV8 A;  3BV0 A;  1JY2 O;  1NTK K;  4MSO A;  3FCR A;  1JO5 A;  1T8Z A;  4XE5 B;  1TOE A;  3U1C A;  3BWN A;  1TAS A;  1M0P A;  1SP4 A;  2D64 A;  4GE4 A;  2JJH A;  1FZC B;  1FC4 A;  1JNM A;  3HMU A;  4E3Q A;  1E5F A;  3HE5 B;  1YOO A;  4NOG A;  5C6U A;  3BS8 A;  4U2H A;  1M1J C;  1WYT B;  1B9I A;  1URQ C;  5BU8 B;  2OYH A;  1AX4 A;  4ZSW A;  3ASB A;  2IFN A;  1UU2 A;  1GL2 B;  2ZSL A;  1MLZ A;  1XI9 A;  2LKM A;  2WK7 A;  3RK2 C;  4WYD A;  4CVQ A;  2JIS A;  2HUF A;  1C7N A;  4JYC A;  3RK3 D;  1H0C A;  1SQB K;  4AZK A;  2OQX A;  3EUC A;  1WST A;  2OYI C;  1AQ5 A;  1EJI A;  1G4V A;  5E3K A;  3NUB A;  1VEF A;  2JJE A;  2V1P A;  3NX3 A;  1LKC A;  3RL0 D;  1X8Y A;  1JUN A;  3B1D A;  4XJP A;  4KHX A;  2Z1Y A;  3GJU A;  3NYT A;  1LTA C;  3MAU A;  1T3U A;  2E7U A;  5AW4 B;  2FFD A;  1IAY A;  3HD7 B;  1M0O A;  2AEU A;  1LC8 A;  2KYV A;  3W1J A;  1C0N A;  3JWA A;  3TNU B;  1VPC A;  4ZAH A;  3AEM A;  2Q3I A;  1AKC A;  2CST A;  1FJK A;  1WYV A;  1BQA A;  3I16 A;  4A0F A;  2IPP A;  4OCA A;  2OAT A;  3EI5 A;  4B98 A;  3COG A;  1LWU A;  3H32 A;  1ASL A;  2PO3 A;  3QI6 A;  1GD9 A;  2BWN A;  4LC3 A;  1LT9 A;  5M46 A;  2WSF H;  3B5N C;  5AVX B;  2KB7 P;  2FNI A;  3II6 A;  1H8A A;  1N7S B;  3FDB A;  1KMJ A;  1TAR A;  1C7G A;  3CAI A;  4N78 E;  3VMY A;  1FG3 A;  1JTH A;  2JEE A;  1OXZ A;  2C9N Y;  1BJO A;  5G09 A;  3UWC A;  3E2Z B;  1ZR4 A;  1GBN A;  2KOG A;  1MDO A;  2C7T A;  4DQ6 A;  4W5K A;  1ZR2 A;  1JOC A;  4ATP A;  2AY4 A;  3AEN B;  1KIL B;  5J8Q A;  2AY1 A;  1IK9 A;  2W8U A;  1MZ9 A;  3ZZJ A;  2D5Y A;  4LC1 A;  3RCH B;  3C9I A;  2P7J A;  3EI9 A;  1MLY A;  3ELE A;  3DOD A;  3KPE A;  1J1D B;  1ASM A;  3GHG A;  3CQ4 A;  4K2M A;  1RV3 A;  3HL2 A;  3K28 A;  3R9A A;  5AW2 B;  2CB1 A;  4GIF A;  1AJS B;  2HPC B;  5BJ3 A;  2HOX A;  3QN6 A;  4MKJ A;  4IFM A;  1L0L K;  2A45 I;  4OTL A;  1WKG A;  1DTY A;  1J04 A;  1YAA A;  5AVS B;  4XJM A;  1XTG B;  5G0A A;  2FYZ A;  3P1T A;  1HWT C;  3M5U A;  2WPS A;  1AHX A;  1QIS A;  3DR4 A;  1JY3 O;  3V4Q A;  1QZ9 A;  4WLH A;  3T97 A;  2W7J A;  3II0 A;  4JEW A;  2W7M A;  2XKM A;  4W1V A;  1LTJ B;  1H1C A;  4LW2 A;  3O8Z A;  3SWF A;  5G2P A;  1L4A C;  5CCH A;  1GTW A;  2P67 A;  1GL2 C;  1IAX A;  1BJW A;  1ASE A;  1Y4I A;  1LTG C;  1H89 A;  1LW5 A;  4IXS A;  2BWO A;  2GUS A;  2HLO A;  3FTB A;  4PFF A;  5D95 A;  1MGV A;  3ECD A;  3NXS A;  2BI1 A;  3A8U X;  1FBM A;  3G7Q A;  1WYT A;  2W8V A;  1LC5 A;  4F5G A;  3M9H A;  3FQ7 A;  3GZD C;  1GC2 A;  1C7O A;  5APX A;  1VP4 A;  4KXK A;  1AAM A;  4ZDP A;  4IX8 A;  4JYB A;  4HYT B;  4EB7 A;  2X3L A;  1FJP A;  3PIU A;  2WSE H;  3FVU A;  1ECX A;  3HE4 B;  5CCH D;  2W27 A;  2YKU A;  3WX9 A;  3I5C A;  4WBA A;  3JWB A;  1GK6 A;  4DBC A;  3GBX A;  2M8R A;  3HD7 C;  3VMX A;  1B5P A;  1N31 A;  1V2D A;  4W1X A;  3WGC A;  2AAT A;  2VMQ A;  1ZN5 A;  1I48 A;  4XK1 A;  4F5H A;  3RBF A;  2W8J A;  2ZY2 A;  3KGW A;  1DJ9 A;  2F8J A;  1MDZ A;  4R8D A;  2AY2 A;  4GEB A;  1X28 A;  2Z20 A;  5APY A;  4F5J A;  1BJN A;  2QMA A;  4RM1 A;  1NHL A;  4W7Y A;  2A45 H;  4OYT A;  1M1J B;  4A0H A;  4JF0 A;  2QB2 A;  2M3B A;  1URQ B;  1BKG A;  3FVX A;  4EFF A;  3U1A A;  4OH8 B;  3FZ7 A;  5I92 A;  4A6T A;  2YKP A;  1JCC A;  3RK2 B;  2NPS A;  1P3W A;  1RE4 A;  3BRT B;  2OGA A;  3W1I A;  2VGT A;  5CCG C;  2Z9V A;  2JJL A;  9AAT A;  1N7S A;  3VTP C;  3NU7 A;  4A72 A;  2R2N A;  3MEB A;  2PB0 A;  3PAA A;  2HP2 A;  1NKZ B;  1N8P A;  3ASA A;  3VOP A;  1YJS A;  1ASN A;  1W7M A;  4JF1 A;  2YCN A;  2QBT A;  2OYI B;  1TOJ A;  2VI8 A;  1NTM K;  2A45 G;  4FFC A;  3MAD A;  3NTJ A;  3WCO A;  4EU1 A;  2N9B A;  1DX7 A;  1AIC A;  2CJG A;  5M49 A;  2W8T A;  1WKH A;  1GU5 A;  3AEN A;  5KJ7 C;  1KIL A;  2NPS D;  1JMM A;  2XZR A;  3G0T A;  5CJ4 A;  1FAV A;  1AMA A;  4IFF A;  3RCH A;  2YCT A;  3H9X A;  2O0R A;  1N7S D;  1CI6 B;  1T3J A;  1W7L A;  2YKV A;  2VMR A;  3NMD A;  5DJ1 A;  5KLV K;  4ISY A;  1HGZ A;  2Q7C A;  3P6K A;  3B1E A;  3A5T A;  2HPC A;  2I1J A;  5EIG A;  1CQ7 A;  2YKY A;  3EI8 A;  4IXZ A;  2BI3 A;  4JEV A;  2VMS A;  2O1K A;  2CPS A;  2VI9 A;  5AW7 B;  1B5O A;  1CZE A;  2C0R A;  2VGU A;  3V2P A;  2BIG A;  3B5N B;  4MQQ A;  2W7G A;  2P1J A;  4WYC A;  3ATH A;  1ELU A;  1A02 J;  3WKR A;  1KIL D;  1NWQ A;  1IFN A;  3VYI A;  3HQT A;  1E5E A;  4WY4 C;  5BU5 A;  4ADE A;  4AH3 A;  1AIB A;  3AEJ C;  2VMO A;  2W7I A;  1LTJ A;  1CL1 A;  3W1H A;  3PDX A;  2R5C B;  3VK3 A;  2ZP7 A;  3KYQ A;  3PJ0 A;  2DOU A;  5CJ0 A;  4F5L A;  2VGZ A;  1BW0 A;  3RI6 A;  1XTC C;  3CQ6 A;  1SQX K;  1FZF A;  2GMU A;  1X79 B;  3MUD A;  3TQX A;  3HUS A;  1CL2 A;  1G4X A;  1TAT A;  1IFM A;  1IBJ A;  4ZWV A;  3AAT A;  3GR9 A;  3MAF B;  1DGD A;  3ACZ A;  3CLQ A;  2O7C A;  3PGY A;  3NNK A;  1AY5 A;  1E5W A;  4GE7 A;  3NUI A;  4IFD K;  3HE4 A;  4GDY A;  2PP6 A;  1SLQ A;  3LW5 H;  3ZRQ A;  1ASA A;  1MAQ A;  1DH3 A;  1SFC C;  5IWQ A;  1JS3 A;  3B1C A;  1ARH A;  4AO4 A;  1W3U A;  3DYD A;  4WB0 B;  1KKP A;  1ASD A;  3EQ2 A;  3MKJ A;  3AEL A;  1LC7 A;  4Y99 C;  1HH0 A;  1L4A B;  1QIT A;  4IYO A;  1A02 F;  2HUU A;  4WXF A;  3LY1 A;  2X5F A;  1G1J A;  1T3I A;  4AUW A;  4C7N B;  1N73 C;  1EQ7 A;  2VRS A;  1ASB A;  3FFR A;  4I1L A;  1ARS A;  3R2P A;  4OC9 A;  1NKN A;  3NRA A;  2OKK A;  3G8M A;  1M1J A;  3PDB B;  3ELP A;  5F9S A;  4EB5 A;  1J32 A;  2ZSM A;  2VMY A;  3E2Y A;  3M0A A;  2ZY3 A;  2W8W A;  3V5B A;  1WRG A;  1AMR A;  4F4E A;  4RLG A;  3TYY A;  1FG7 A;  1S06 A;  2W7H A;  4E1O A;  2J58 A;  1FOS F;  2VMX A;  1D7R A;  4I2L C;  2VLH A;  1Z7D A;  1GZL A;  3OKS A;  1JY2 N;  2FFD C;  3QBO A;  3M0D C;  5E4Z A;  2FKI A;  4DZO A;  2VLF A;  2OYI A;  1LW4 A;  1NAF A;  1TOG A;  3VK2 A;  4F5I A;  2N1T C;  3AEM C;  1RF1 C;  5EAV A;  4WYG A;  1NH4 A;  2DGL A;  2AY5 A;  4H51 A;  4BA4 A;  1ART A;  1RV4 A;  3RK2 D;  2IFM A;  4RJ0 A;  1GEY A;  1SFF A;  3E2F A;  3IHJ A;  2ZC0 A;  5FT6 A;  4WP0 A;  3HDO A;  1UU0 A;  1SQP K;  1N7L A;  3WKS A;  2FKW B;  4F5F A;  5TF5 A;  2EPJ A;  2PB2 A;  3BAT A;  1YTZ T;  2H8P D;  4WYE A;  4I6M C;  4GT1 A;  3ZZK A;  2FQ6 A;  3VP6 A;  2VGV A;  2GMS A;  1KL1 A;  2D65 A;  3VP8 A;  2JJF A;  1YNU A;  3B5N A;  3LIE A;  3TAT A;  2MJZ A;  1G1I A;  4XA4 A;  2WK8 A;  3GWP A;  5AVV B;  2AY8 A;  2VMN A;  2OGE A;  1AFO A;  3DXV A;  4A0G A;  4WD2 A;  2ZY5 A;  3DU4 A;  4ZSY A;  2QB3 A;  2YO3 A;  1PMM A;  4K2B A;  1N2T A;  3PA9 A;  4RJY A;  5KTB A;  2E43 A;  3HTK B;  2WZ7 A;  4W7Z A;  3MC6 C;  1IX8 A;  1NOH A;  3G3Z A;  2HP1 A;  1FZG A;  3B5N D;  3E77 A;  3HT4 A;  2XU6 A;  3FDD A;  5APS A;  1AIA A;  4BQ0 A;  3RUY A;  3LV2 A;  3BCB A;  2HUI A;  1IUG A;  5AW1 B;  2YOB A;  2W6B A;  3JZL A;  1D7V A;  4UQV A;  3FZ8 A;  2O01 H;  4A6U A;  5G4J A;  2VMW A;  1H88 A;  3VOM A;  1CZQ A;  1GW4 A;  3BVH A;  3BN1 A;  1FZC A;  2YKQ A;  1CQ8 A;  3LVL B;  2Q9I A;  2E7I A;  3B46 A;  4M2K A;  2EH6 A;  3MTU E;  3HE5 A;  4WY4 B;  1V2F A;  3AOV A;  4QGR A;  2W6A A;  3B8X A;  1X2A A;  1G7X A;  3P32 A;  2G6W A;  4Q76 A;  3TSI A;  4AYC A;  1GL2 A;  1S08 A;  2W7D A;  1V2E A;  3EIB A;  4Q75 A;  4C7N A;  1TPL A;  2C9L Y;  3FQ8 A;  4W8I A;  2ZUK A;  1ASC A;  4ZM3 A;  2D63 A;  3I4J A;  1OXO A;  1YIZ A;  4HH2 A;  4KYO A;  4OBU A;  1RF0 A;  3A2B A;  1GDT A;  1FZB A;  2CH2 A;  2YMY A;  4Y0H A;  2GUV A;  4L0O A;  2AY9 A;  1M0N A;  3HBX A;  1NTZ K;  1ARG A;  2Q7W A;  5F8V A;  1QL2 A;  3M9Q A;  2AY6 A;  1CW5 A;  3RK3 B;  5AW0 B;  1ELQ A;  1T2K D;  1GL2 D;  3I5T A;  3LVM A;  3L36 A;  4XJL A;  1JY3 N;  1KZU B;  2YNY A;  1SFC B;  3HD7 A;  2W7F A;  4W80 A;  3SWY A;  2ZJG A;  1BS0 A;  2WKA A;  1IX7 A;  5APW A;  3TNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...