3N4ZA

Crystal structure of quintuple arg-to-lys variant of t. celer l30e
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
97
structure length
97
Chain Sequence
MVDFAFELKKAQDTGKIVMGAKKSIQYAKMGGAKLIIVARNAKPDIKEDIEYYAKLSGIPVYEFEGTSVELGTLLGKPHTVSALAVVDPGESRILAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L30e
publication title Electrostatic contribution of surface charge residues to the stability of a thermophilic protein: benchmarking experimental and predicted pKa values
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 28
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3n4zA00
3JAMM 1VQ8F 3CCQF 3CCVF 1VQ4F 1YI2F 1NJIH 3E20B 3RA6A 1QVFF 2VGMA 1VQNF 1M1KH 5GANK 3G71F 1W40A 1SDSA 2QI2A 3CD6F 3N4ZA 3VMFB 1RA4A 5GAPK 1VQMF 3OBYA 2BO1A 3ON1A 5GIPC 1Q86H 1K9MH 1DT9A 1VQ6F 4BW0B 3SIVA 3V7QA 1W2BF 1YJNF 3CPQA 1NMUB 4TZZA 3O85A 1H7MA 3VI6A 1T0KB 2OZBA 2LBWA 3AGKA 1X7OA 1XBIA 3LWVC 1VQLF 3IR9A 3LWOC 1VQ7F 2HVYD 3MCAB 1S72F 4NUTA 3CCUF 3LWQC 2OTJF 3CC7F 1CN7A 3LWRC 1VQ5F 3GYQA 3NK7A 1W41A 4X3LA 5IT9M 3J80M 3I55F 3NMUC 1PXWA 2ALEA 1KD1H 3CCMF 2CZWA 5FLXM 1YJWF 3J81M 1N8RH 3G4SF 1YIJF 2AIFA 5G4UC 2KG4A 3G6EF 1QVGF 3JCMM 1VQKF 2KTUA 1RLGA 3V7EA 3CG6A 3HJWC 2I6DA 1ZWZA 1K8AH 1CK2A 2KTVA 5GIOC 3CCJF 2OHWA 3LFOA 1Q81H 4X3MA 3RA5A 3FFMA 3SIUA 5DCVA 3WXMB 3CC2F 2QA4F 5GINC 3HAXD 3CCEF 3CCLF 1GZ0A 5EO3A 1X52A 1M90H 1Q7YH 1X7PA 3CXCF 1E7KA 3CC4F 2QEXF 3PAFA 3CPWF 3NK6A 2VGNA 1JJ2F 2OTLF 1VQ9F 2LBXA 3N4YA 1VQOF 1YJ9F 3NVIB 3CMEF 1KQSF 3OW2F 4LCKA 3CMAF 1W42A 1YITF 3CCRF 3E1YA 5FJ4C 1GO0A 1Q82H 1W3EX 3I56F 5A2QM 3PLAC 5G4VC 2WALA 3NVKE 4C4WC 1YHQF 3OBWA 1IPAA 2FC3A 1VQPF 3CCSF 2JNBA 3LWPC 4BY9D 3J7AR 1KC8H 5EWRA 1GO1A 1K73H
chains in the Genus database with same CATH superfamily
3N2GA 3CCVF 1VQ4F 1H48A 5GONB 2N48A 4RHAA 4X1IA 3ZP7A 1PF5A 4BVSA 1VQNF 3K2XA 5GANK 3G71F 1W40A 2HS4A 2QI2A 4TV8B 3CD6F 1NQ3A 1TUBA 3VMFB 5HXZA 5KX5B 2BO1A 5FNVB 3N2KB 4I50A 2UYPA 1DT9A 3TD4A 4BW0B 3SIVA 3JATB 5KMGB 4O4JA 3JALB 2CVLA 3VYUC 2IQQA 2ZVZA 4B62A 3KJKA 3AGKA 4G88A 4NQ3A 3VCZA 3LWVC 3IR9A 3UT5B 2HVYD 3JAKB 1S72F 4TUYA 4X20A 4YJ3A 2UZHA 1CN7A 1SZQA 1IV3A 3WGKA 2HRYA 3WPXA 4BT4A 4O4HA 2HX0A 4ZHQA 3WGMA 2ALEA 3QHDA 1Q8RA 3HKDB 1YJWF 2UYKA 2Z1TA 3I7TA 1W5FA 3D54A 3RYIB 1YIJF 4FFBB 1W5BA 1RQ2A 2KG4A 3LDTA 1CLIA 3N2GB 3D01A 1RLGA 4X1IB 3K12A 3CG6A 3VYTC 2VAWA 2NMUA 1K8AH 1CK2A 2KTVA 4O2BA 3KIZA 1VHAA 1YGYA 1TUBB 3C9SA 1IV2A 3WXMB 3JAWA 4I50B 3CCLF 3RYCB 3RYFA 4BVQA 1M90H 1XHOA 3ERNA 3P0ZA 2EWCA 2CWJA 2R751 4O4JB 4YJ2A 3DDNA 3C9RA 2Q1YA 3BYQA 2QEXF 2L26A 3MQWA 1VQVA 3WPWA 2VXYA 4C8EA 2B33A 5JCOA 3NVIB 3CMEF 1FFXA 2RB9A 3VOBA 3CMAF 1W55A 1W42A 4TV9A 3CCRF 1YITF 3OONA 4X20B 4YJ3B 4G4YA 2Z01A 4O4LA 3VO8A 3HKBB 4LNUA 2JNBA 3LWPC 1T0AA 4EI7A 4O4HB 4ZHYB 3J7AR 1KC8H 1VQ8F 1FNKA 3C8LA 5BMVB 3CCQF 5LOVA 4X1KB 2BTUA 4BT3A 1COMA 1QVFF 4DRXA 5EB1B 2VGMA 5IYZB 1M1KH 3U0OA 3K14A 1SDSA 1IV1A 3N4ZA 5GAPK 1VQMF 5GIPC 1VQ6F 3S0YA 3IKEA 3V7QA 1U3LA 4O2BB 5LA6A 1YJNF 2HP0A 3IEWA 3CPQA 3VYSC 2I6RA 5LXTB 5MN5A 3O85A 1H7MA 3VI6A 1T0KB 3DC2A 5CB4A 2LBWA 5EYPA 1XBIA 1RQ7A 1X25A 4YJ2B 3M84A 3LWOC 3MCQA 4ZOLA 4NUTA 5HY0A 1JY8A 2PHNA 3JARA 3LWQC 1R1MA 2VAMA 3CC7F 2BTQB 2HRUA 2ZVYA 2IAFA 5LYJA 3V4DA 1FFXB 1W41A 3T80A 4TV9B 4X3LA 1TVKA 4F6RB 3J80M 3I55F 1PXWA 2UYNB 2F9ZC 1KD1H 1H47A 2CZWA 4I55A 5IJ9B 3Q8HA 3WJPA 1XV2A 3HKEA 2UYJA 2AIFA 4LNUB 1ODEA 3G6EF 4O2AB 4BT5A 1KNJA 5LOVB 2P6YA 3WJRA 1VQKF 2KTUA 2K1SA 3HJWC 1ZWZA 4KWEA 3WJQA 4U3JA 4BT7A 1Q81H 1U43A 4G4VA 3SIUA 3HTNA 1Z5VA 4ZK7A 3I3FA 1VK3A 5HY2A 5HY1A 5HP8A 2RHOA 2VAPA 1Q7YH 5LA6B 4ZI7A 3CXCF 5J2UA 5CA1B 1GX1A 2R6R1 3PAFA 1QU9A 3RYHA 3CPWF 3NK6A 1JN1A 4B5CA 3CYPB 2HP3A 1JJ2F 2QTPA 5EYPB 3S02A 2OTLF 1VQ9F 1YJ9F 5HXUA 4EI9A 4I4TA 1KQSF 4U39A 3TD3A 4ZOLB 2Q1XA 3GHZA 5A2QM 3JARB 5G4VC 4NWOB 1IPAA 3LMEA 5LYJB 1VQPF 5LP6A 3CCSF 2H6LA 2LCAA 4BY9D 2CHSA 4EB6A 3C9UA 3D00A 1NJIH 5JCOC 4C81A 4I55B 3RA6A 3FBAA 3HKEB 3MBMA 5C8YA 3KE1A 4B45A 3VTIC 3KJJA 2YXZA 4C8GA 1UI9A 1RA4A 3OBYA 4C82A 4G4XA 1K9MH 4TUYB 4HNAA 5CA0A 4U3JB 3C9TA 1NMUB 1KNKA 2ZOVA 1FNJA 3WGNA 1SA0A 5JQGA 2CW4A 4ZHQB 2GLZA 5EAZA 2KGWA 1X7OA 1VQLF 4BT2A 4ZI7B 5J2UB 5EIBC 3MCAB 3RYHB 3JATA 5KMGA 3QUWA 4G4WA 3MDOA 3S06A 3LWRC 1UFYA 5B8FA 3S03A 1VQ5F 2LBTA 3GYQA 5EB0A 1RLUA 2MQEA 3S0WA 4BVTA 1QD9A 3F0FA 3ZOPA 5JVDA 2PMPA 2IG8A 1FSZA 2HS3A 3F0DA 4ZHWA 3CCMF 3EORA 5FLXM 3UT5A 3JAKA 3J81M 4E6EA 3JAWB 2ZAUA 5LP6B 5MN4A 5AVMA 3G4SF 3RYFB 3HKCA 5HP7A 3CB2A 2G9IA 3FD6A 4IHJA 3JCMM 2CHTA 1U3PA 3V7EA 2I6DA 2HQSC 3P4EA 3S0HA 3CCJF 3L7QA 1VH8A 3RA5A 2CSLA 1OFUA 3FFMA 1W59A 5DCVA 3HAXD 2QA4F 5GINC 3CCEF 4HNAB 1GZ0A 5EO3A 5CA0B 4FFBA 3B6NA 3VOAA 2H8EA 1X7PA 1U40A 4O4LB 1SA0B 3CYQA 5JQGB 3FPIA 4G4ZA 4PWTA 2LBXA 3IEQA 1VQOF 2DT4A 3F6MA 1YQNA 3HWUA 4DRXB 5FJ4C 3F0EA 4O4IA 3RYCA 3M4SA 1W3EX 3I56F 5HY4A 2WALA 3NVKE 3K0TA 3VIUA 4C4WC 4WBNA 3OBWA 2FC3A 3IMPA 2Z1FA 3R0PA 2ZODA 3E22A 5JH7A 3PLAC 1K73H 3JAMM 5JVDB 2HP0B 1YI2F 1W5EA 4DXDA 2GVIA 4BT6A 3E20B 1W5AA 2AMTA 5CB4B 5IJ0A 3HKCB 4IHJB 3ESJA 4R40B 1Q86H 3ON1A 1ONIA 3HKBA 5LP6C 4EI8A 1W2BF 5BMVA 2Z1EA 2ZF8A 4X1KA 4TZZA 4IIJA 4BVRA 1J7HA 4C8IA 5EZYA 5MN6A 1TVKB 5IYZA 4ZHVA 5ITZA 2OZBA 3FD5A 2AIZP 3RE3A 2RHHA 2W8BC 5J2TA 1VQ7F 1XRGA 1W57A 1JFFA 3CCUF 2OTJF 3JASA 1OAPA 2BTOA 4XCQA 3NK7A 5LXTA 3QTYA 3JVHA 4O4IB 3ZO8A 5IT9M 4X1YA 3V3TA 3NMUC 3ELCA 4ERHA 1W581 4RQOA 5GONA 4WBNB 1N8RH 3GTZA 3P10A 5G4UC 3E22B 5JH7B 1QVGF 4TV8A 3KHNA 3WGJA 1JD1A 4B46A 2DYYA 3LYBA 5KX5A 2HS0A 2RHLA 4M8IA 5EIBD 3N2KA 5FNVA 4F6RA 5GIOC 5IJ0B 3IKFA 2OHWA 2UYNA 1IV4A 3JALA 3LFOA 4I4TB 4X3MA 5IJ9A 3CC2F 1X52A 4O2AA 1E7KA 3CC4F 4IIJB 5EZYB 3F0GA 5ITZB 1QAHA 2VGNA 1Z5WA 2Z1UA 4EB6B 2H8CA 5HWEA 3N4YA 3M1XA 3OW2F 4LCKA 5J2TB 5C8YB 3E1YA 1GO0A 1DBFA 3ZP4A 1Q82H 1JFFB 2OTMA 2V9YA 3JASB 3HKDA 3TD5A 2FGYA 1YHQF 5CA1A 2GZLA 3RYIA 2YYEA 3WGLA 2RHJA 5EWRA 1GO1A 4X1YB
chains in the Genus database with same CATH topology
3JAMM 1VQ8F 3CCQF 3CCVF 3D00A 1VQ4F 1YI2F 1NJIH 3E20B 3RA6A 1QVFF 4BVSA 2VGMA 1VQNF 1M1KH 5GANK 3G71F 1W40A 1SDSA 2QI2A 3CD6F 3N4ZA 3VMFB 1RA4A 5HXZA 5GAPK 1VQMF 3OBYA 2BO1A 3ON1A 5GIPC 1Q86H 1K9MH 1DT9A 1VQ6F 4BW0B 3SIVA 3V7QA 4EI8A 1W2BF 1YJNF 3CPQA 1NMUB 4TZZA 4BVRA 3O85A 1H7MA 3VI6A 1T0KB 2OZBA 2GLZA 2LBWA 3AGKA 1X7OA 1XBIA 4NQ3A 3LWVC 1VQLF 3IR9A 3LWOC 1VQ7F 2HVYD 3MCAB 1S72F 4NUTA 5HY0A 3CCUF 3LWQC 2OTJF 3CC7F 1CN7A 3LWRC 4XCQA 1VQ5F 3GYQA 3NK7A 1W41A 4BVTA 4X3LA 5IT9M 3J80M 3V3TA 3I55F 3NMUC 1PXWA 2ALEA 2F9ZC 1KD1H 3CCMF 2CZWA 5FLXM 1YJWF 3J81M 1N8RH 3G4SF 1YIJF 2AIFA 5G4UC 2KG4A 3G6EF 1QVGF 3JCMM 1VQKF 2KTUA 1RLGA 3V7EA 3CG6A 3HJWC 2I6DA 1ZWZA 1K8AH 1CK2A 2KTVA 5GIOC 3CCJF 2OHWA 3LFOA 1Q81H 4X3MA 3RA5A 3FFMA 3SIUA 5DCVA 3WXMB 5HY2A 5HY1A 5GINC 3CC2F 2QA4F 3CCEF 3HAXD 3CCLF 1GZ0A 5EO3A 4BVQA 1X52A 1M90H 1Q7YH 1X7PA 3CXCF 1E7KA 3CC4F 2QEXF 3PAFA 3CPWF 3NK6A 2VGNA 1JJ2F 2OTLF 1VQ9F 5HWEA 2LBXA 3N4YA 1VQOF 5HXUA 4EI9A 1YJ9F 3CMEF 1KQSF 3NVIB 3OW2F 4LCKA 3CMAF 1W42A 1YITF 3CCRF 3E1YA 5FJ4C 1GO0A 1Q82H 1W3EX 3I56F 5HY4A 5A2QM 3PLAC 5G4VC 2WALA 3NVKE 4C4WC 2FGYA 1YHQF 3OBWA 1IPAA 2FC3A 1VQPF 3CCSF 2JNBA 3LWPC 4EI7A 4BY9D 3J7AR 1KC8H 5EWRA 1GO1A 1K73H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JAM M;  1VQ8 F;  3CCQ F;  3CCV F;  1VQ4 F;  1YI2 F;  1NJI H;  3E20 B;  3RA6 A;  1QVF F;  2VGM A;  1VQN F;  1M1K H;  5GAN K;  3G71 F;  1W40 A;  1SDS A;  2QI2 A;  3CD6 F;  3N4Z A;  3VMF B;  1RA4 A;  5GAP K;  1VQM F;  3OBY A;  2BO1 A;  3ON1 A;  5GIP C;  1Q86 H;  1K9M H;  1DT9 A;  1VQ6 F;  4BW0 B;  3SIV A;  3V7Q A;  1W2B F;  1YJN F;  3CPQ A;  1NMU B;  4TZZ A;  3O85 A;  1H7M A;  3VI6 A;  1T0K B;  2OZB A;  2LBW A;  3AGK A;  1X7O A;  1XBI A;  3LWV C;  1VQL F;  3IR9 A;  3LWO C;  1VQ7 F;  2HVY D;  3MCA B;  1S72 F;  4NUT A;  3CCU F;  3LWQ C;  2OTJ F;  3CC7 F;  1CN7 A;  3LWR C;  1VQ5 F;  3GYQ A;  3NK7 A;  1W41 A;  4X3L A;  5IT9 M;  3J80 M;  3I55 F;  3NMU C;  1PXW A;  2ALE A;  1KD1 H;  3CCM F;  2CZW A;  5FLX M;  1YJW F;  3J81 M;  1N8R H;  3G4S F;  1YIJ F;  2AIF A;  5G4U C;  2KG4 A;  3G6E F;  1QVG F;  3JCM M;  1VQK F;  2KTU A;  1RLG A;  3V7E A;  3CG6 A;  3HJW C;  2I6D A;  1ZWZ A;  1K8A H;  1CK2 A;  2KTV A;  5GIO C;  3CCJ F;  2OHW A;  3LFO A;  1Q81 H;  4X3M A;  3RA5 A;  3FFM A;  3SIU A;  5DCV A;  3WXM B;  3CC2 F;  2QA4 F;  5GIN C;  3HAX D;  3CCE F;  3CCL F;  1GZ0 A;  5EO3 A;  1X52 A;  1M90 H;  1Q7Y H;  1X7P A;  3CXC F;  1E7K A;  3CC4 F;  2QEX F;  3PAF A;  3CPW F;  3NK6 A;  2VGN A;  1JJ2 F;  2OTL F;  1VQ9 F;  2LBX A;  3N4Y A;  1VQO F;  1YJ9 F;  3NVI B;  3CME F;  1KQS F;  3OW2 F;  4LCK A;  3CMA F;  1W42 A;  1YIT F;  3CCR F;  3E1Y A;  5FJ4 C;  1GO0 A;  1Q82 H;  1W3E X;  3I56 F;  5A2Q M;  3PLA C;  5G4V C;  2WAL A;  3NVK E;  4C4W C;  1YHQ F;  3OBW A;  1IPA A;  2FC3 A;  1VQP F;  3CCS F;  2JNB A;  3LWP C;  4BY9 D;  3J7A R;  1KC8 H;  5EWR A;  1GO1 A;  1K73 H; 
#chains in the Genus database with same CATH topology
 3N2G A;  3CCV F;  1VQ4 F;  1H48 A;  5GON B;  2N48 A;  4RHA A;  4X1I A;  3ZP7 A;  1PF5 A;  4BVS A;  1VQN F;  3K2X A;  5GAN K;  3G71 F;  1W40 A;  2HS4 A;  2QI2 A;  4TV8 B;  3CD6 F;  1NQ3 A;  1TUB A;  3VMF B;  5HXZ A;  5KX5 B;  2BO1 A;  5FNV B;  3N2K B;  4I50 A;  2UYP A;  1DT9 A;  3TD4 A;  4BW0 B;  3SIV A;  3JAT B;  5KMG B;  4O4J A;  3JAL B;  2CVL A;  3VYU C;  2IQQ A;  2ZVZ A;  4B62 A;  3KJK A;  3AGK A;  4G88 A;  4NQ3 A;  3VCZ A;  3LWV C;  3IR9 A;  3UT5 B;  2HVY D;  3JAK B;  1S72 F;  4TUY A;  4X20 A;  4YJ3 A;  2UZH A;  1CN7 A;  1SZQ A;  1IV3 A;  3WGK A;  2HRY A;  3WPX A;  4BT4 A;  4O4H A;  2HX0 A;  4ZHQ A;  3WGM A;  2ALE A;  3QHD A;  1Q8R A;  3HKD B;  1YJW F;  2UYK A;  2Z1T A;  3I7T A;  1W5F A;  3D54 A;  3RYI B;  1YIJ F;  4FFB B;  1W5B A;  1RQ2 A;  2KG4 A;  3LDT A;  1CLI A;  3N2G B;  3D01 A;  1RLG A;  4X1I B;  3K12 A;  3CG6 A;  3VYT C;  2VAW A;  2NMU A;  1K8A H;  1CK2 A;  2KTV A;  4O2B A;  3KIZ A;  1VHA A;  1YGY A;  1TUB B;  3C9S A;  1IV2 A;  3WXM B;  3JAW A;  4I50 B;  3CCL F;  3RYC B;  3RYF A;  4BVQ A;  1M90 H;  1XHO A;  3ERN A;  3P0Z A;  2EWC A;  2CWJ A;  2R75 1;  4O4J B;  4YJ2 A;  3DDN A;  3C9R A;  2Q1Y A;  3BYQ A;  2QEX F;  2L26 A;  3MQW A;  1VQV A;  3WPW A;  2VXY A;  4C8E A;  2B33 A;  5JCO A;  3NVI B;  3CME F;  1FFX A;  2RB9 A;  3VOB A;  3CMA F;  1W55 A;  1W42 A;  4TV9 A;  3CCR F;  1YIT F;  3OON A;  4X20 B;  4YJ3 B;  4G4Y A;  2Z01 A;  4O4L A;  3VO8 A;  3HKB B;  4LNU A;  2JNB A;  3LWP C;  1T0A A;  4EI7 A;  4O4H B;  4ZHY B;  3J7A R;  1KC8 H;  1VQ8 F;  1FNK A;  3C8L A;  5BMV B;  3CCQ F;  5LOV A;  4X1K B;  2BTU A;  4BT3 A;  1COM A;  1QVF F;  4DRX A;  5EB1 B;  2VGM A;  5IYZ B;  1M1K H;  3U0O A;  3K14 A;  1SDS A;  1IV1 A;  3N4Z A;  5GAP K;  1VQM F;  5GIP C;  1VQ6 F;  3S0Y A;  3IKE A;  3V7Q A;  1U3L A;  4O2B B;  5LA6 A;  1YJN F;  2HP0 A;  3IEW A;  3CPQ A;  3VYS C;  2I6R A;  5LXT B;  5MN5 A;  3O85 A;  1H7M A;  3VI6 A;  1T0K B;  3DC2 A;  5CB4 A;  2LBW A;  5EYP A;  1XBI A;  1RQ7 A;  1X25 A;  4YJ2 B;  3M84 A;  3LWO C;  3MCQ A;  4ZOL A;  4NUT A;  5HY0 A;  1JY8 A;  2PHN A;  3JAR A;  3LWQ C;  1R1M A;  2VAM A;  3CC7 F;  2BTQ B;  2HRU A;  2ZVY A;  2IAF A;  5LYJ A;  3V4D A;  1FFX B;  1W41 A;  3T80 A;  4TV9 B;  4X3L A;  1TVK A;  4F6R B;  3J80 M;  3I55 F;  1PXW A;  2UYN B;  2F9Z C;  1KD1 H;  1H47 A;  2CZW A;  4I55 A;  5IJ9 B;  3Q8H A;  3WJP A;  1XV2 A;  3HKE A;  2UYJ A;  2AIF A;  4LNU B;  1ODE A;  3G6E F;  4O2A B;  4BT5 A;  1KNJ A;  5LOV B;  2P6Y A;  3WJR A;  1VQK F;  2KTU A;  2K1S A;  3HJW C;  1ZWZ A;  4KWE A;  3WJQ A;  4U3J A;  4BT7 A;  1Q81 H;  1U43 A;  4G4V A;  3SIU A;  3HTN A;  1Z5V A;  4ZK7 A;  3I3F A;  1VK3 A;  5HY2 A;  5HY1 A;  5HP8 A;  2RHO A;  2VAP A;  1Q7Y H;  5LA6 B;  4ZI7 A;  3CXC F;  5J2U A;  5CA1 B;  1GX1 A;  2R6R 1;  3PAF A;  1QU9 A;  3RYH A;  3CPW F;  3NK6 A;  1JN1 A;  4B5C A;  3CYP B;  2HP3 A;  1JJ2 F;  2QTP A;  5EYP B;  3S02 A;  2OTL F;  1VQ9 F;  1YJ9 F;  5HXU A;  4EI9 A;  4I4T A;  1KQS F;  4U39 A;  3TD3 A;  4ZOL B;  2Q1X A;  3GHZ A;  5A2Q M;  3JAR B;  5G4V C;  4NWO B;  1IPA A;  3LME A;  5LYJ B;  1VQP F;  5LP6 A;  3CCS F;  2H6L A;  2LCA A;  4BY9 D;  2CHS A;  4EB6 A;  3C9U A;  3D00 A;  1NJI H;  5JCO C;  4C81 A;  4I55 B;  3RA6 A;  3FBA A;  3HKE B;  3MBM A;  5C8Y A;  3KE1 A;  4B45 A;  3VTI C;  3KJJ A;  2YXZ A;  4C8G A;  1UI9 A;  1RA4 A;  3OBY A;  4C82 A;  4G4X A;  1K9M H;  4TUY B;  4HNA A;  5CA0 A;  4U3J B;  3C9T A;  1NMU B;  1KNK A;  2ZOV A;  1FNJ A;  3WGN A;  1SA0 A;  5JQG A;  2CW4 A;  4ZHQ B;  2GLZ A;  5EAZ A;  2KGW A;  1X7O A;  1VQL F;  4BT2 A;  4ZI7 B;  5J2U B;  5EIB C;  3MCA B;  3RYH B;  3JAT A;  5KMG A;  3QUW A;  4G4W A;  3MDO A;  3S06 A;  3LWR C;  1UFY A;  5B8F A;  3S03 A;  1VQ5 F;  2LBT A;  3GYQ A;  5EB0 A;  1RLU A;  2MQE A;  3S0W A;  4BVT A;  1QD9 A;  3F0F A;  3ZOP A;  5JVD A;  2PMP A;  2IG8 A;  1FSZ A;  2HS3 A;  3F0D A;  4ZHW A;  3CCM F;  3EOR A;  5FLX M;  3UT5 A;  3JAK A;  3J81 M;  4E6E A;  3JAW B;  2ZAU A;  5LP6 B;  5MN4 A;  5AVM A;  3G4S F;  3RYF B;  3HKC A;  5HP7 A;  3CB2 A;  2G9I A;  3FD6 A;  4IHJ A;  3JCM M;  2CHT A;  1U3P A;  3V7E A;  2I6D A;  2HQS C;  3P4E A;  3S0H A;  3CCJ F;  3L7Q A;  1VH8 A;  3RA5 A;  2CSL A;  1OFU A;  3FFM A;  1W59 A;  5DCV A;  3HAX D;  2QA4 F;  5GIN C;  3CCE F;  4HNA B;  1GZ0 A;  5EO3 A;  5CA0 B;  4FFB A;  3B6N A;  3VOA A;  2H8E A;  1X7P A;  1U40 A;  4O4L B;  1SA0 B;  3CYQ A;  5JQG B;  3FPI A;  4G4Z A;  4PWT A;  2LBX A;  3IEQ A;  1VQO F;  2DT4 A;  3F6M A;  1YQN A;  3HWU A;  4DRX B;  5FJ4 C;  3F0E A;  4O4I A;  3RYC A;  3M4S A;  1W3E X;  3I56 F;  5HY4 A;  2WAL A;  3NVK E;  3K0T A;  3VIU A;  4C4W C;  4WBN A;  3OBW A;  2FC3 A;  3IMP A;  2Z1F A;  3R0P A;  2ZOD A;  3E22 A;  5JH7 A;  3PLA C;  1K73 H;  3JAM M;  5JVD B;  2HP0 B;  1YI2 F;  1W5E A;  4DXD A;  2GVI A;  4BT6 A;  3E20 B;  1W5A A;  2AMT A;  5CB4 B;  5IJ0 A;  3HKC B;  4IHJ B;  3ESJ A;  4R40 B;  1Q86 H;  3ON1 A;  1ONI A;  3HKB A;  5LP6 C;  4EI8 A;  1W2B F;  5BMV A;  2Z1E A;  2ZF8 A;  4X1K A;  4TZZ A;  4IIJ A;  4BVR A;  1J7H A;  4C8I A;  5EZY A;  5MN6 A;  1TVK B;  5IYZ A;  4ZHV A;  5ITZ A;  2OZB A;  3FD5 A;  2AIZ P;  3RE3 A;  2RHH A;  2W8B C;  5J2T A;  1VQ7 F;  1XRG A;  1W57 A;  1JFF A;  3CCU F;  2OTJ F;  3JAS A;  1OAP A;  2BTO A;  4XCQ A;  3NK7 A;  5LXT A;  3QTY A;  3JVH A;  4O4I B;  3ZO8 A;  5IT9 M;  4X1Y A;  3V3T A;  3NMU C;  3ELC A;  4ERH A;  1W58 1;  4RQO A;  5GON A;  4WBN B;  1N8R H;  3GTZ A;  3P10 A;  5G4U C;  3E22 B;  5JH7 B;  1QVG F;  4TV8 A;  3KHN A;  3WGJ A;  1JD1 A;  4B46 A;  2DYY A;  3LYB A;  5KX5 A;  2HS0 A;  2RHL A;  4M8I A;  5EIB D;  3N2K A;  5FNV A;  4F6R A;  5GIO C;  5IJ0 B;  3IKF A;  2OHW A;  2UYN A;  1IV4 A;  3JAL A;  3LFO A;  4I4T B;  4X3M A;  5IJ9 A;  3CC2 F;  1X52 A;  4O2A A;  1E7K A;  3CC4 F;  4IIJ B;  5EZY B;  3F0G A;  5ITZ B;  1QAH A;  2VGN A;  1Z5W A;  2Z1U A;  4EB6 B;  2H8C A;  5HWE A;  3N4Y A;  3M1X A;  3OW2 F;  4LCK A;  5J2T B;  5C8Y B;  3E1Y A;  1GO0 A;  1DBF A;  3ZP4 A;  1Q82 H;  1JFF B;  2OTM A;  2V9Y A;  3JAS B;  3HKD A;  3TD5 A;  2FGY A;  1YHQ F;  5CA1 A;  2GZL A;  3RYI A;  2YYE A;  3WGL A;  2RHJ A;  5EWR A;  1GO1 A;  4X1Y B; 
#chains in the Genus database with same CATH homology
 3JAM M;  1VQ8 F;  3CCQ F;  3CCV F;  3D00 A;  1VQ4 F;  1YI2 F;  1NJI H;  3E20 B;  3RA6 A;  1QVF F;  4BVS A;  2VGM A;  1VQN F;  1M1K H;  5GAN K;  3G71 F;  1W40 A;  1SDS A;  2QI2 A;  3CD6 F;  3N4Z A;  3VMF B;  1RA4 A;  5HXZ A;  5GAP K;  1VQM F;  3OBY A;  2BO1 A;  3ON1 A;  5GIP C;  1Q86 H;  1K9M H;  1DT9 A;  1VQ6 F;  4BW0 B;  3SIV A;  3V7Q A;  4EI8 A;  1W2B F;  1YJN F;  3CPQ A;  1NMU B;  4TZZ A;  4BVR A;  3O85 A;  1H7M A;  3VI6 A;  1T0K B;  2OZB A;  2GLZ A;  2LBW A;  3AGK A;  1X7O A;  1XBI A;  4NQ3 A;  3LWV C;  1VQL F;  3IR9 A;  3LWO C;  1VQ7 F;  2HVY D;  3MCA B;  1S72 F;  4NUT A;  5HY0 A;  3CCU F;  3LWQ C;  2OTJ F;  3CC7 F;  1CN7 A;  3LWR C;  4XCQ A;  1VQ5 F;  3GYQ A;  3NK7 A;  1W41 A;  4BVT A;  4X3L A;  5IT9 M;  3J80 M;  3V3T A;  3I55 F;  3NMU C;  1PXW A;  2ALE A;  2F9Z C;  1KD1 H;  3CCM F;  2CZW A;  5FLX M;  1YJW F;  3J81 M;  1N8R H;  3G4S F;  1YIJ F;  2AIF A;  5G4U C;  2KG4 A;  3G6E F;  1QVG F;  3JCM M;  1VQK F;  2KTU A;  1RLG A;  3V7E A;  3CG6 A;  3HJW C;  2I6D A;  1ZWZ A;  1K8A H;  1CK2 A;  2KTV A;  5GIO C;  3CCJ F;  2OHW A;  3LFO A;  1Q81 H;  4X3M A;  3RA5 A;  3FFM A;  3SIU A;  5DCV A;  3WXM B;  5HY2 A;  5HY1 A;  5GIN C;  3CC2 F;  2QA4 F;  3CCE F;  3HAX D;  3CCL F;  1GZ0 A;  5EO3 A;  4BVQ A;  1X52 A;  1M90 H;  1Q7Y H;  1X7P A;  3CXC F;  1E7K A;  3CC4 F;  2QEX F;  3PAF A;  3CPW F;  3NK6 A;  2VGN A;  1JJ2 F;  2OTL F;  1VQ9 F;  5HWE A;  2LBX A;  3N4Y A;  1VQO F;  5HXU A;  4EI9 A;  1YJ9 F;  3CME F;  1KQS F;  3NVI B;  3OW2 F;  4LCK A;  3CMA F;  1W42 A;  1YIT F;  3CCR F;  3E1Y A;  5FJ4 C;  1GO0 A;  1Q82 H;  1W3E X;  3I56 F;  5HY4 A;  5A2Q M;  3PLA C;  5G4V C;  2WAL A;  3NVK E;  4C4W C;  2FGY A;  1YHQ F;  3OBW A;  1IPA A;  2FC3 A;  1VQP F;  3CCS F;  2JNB A;  3LWP C;  4EI7 A;  4BY9 D;  3J7A R;  1KC8 H;  5EWR A;  1GO1 A;  1K73 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...