3N4ZA

Crystal structure of quintuple arg-to-lys variant of t. celer l30e
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
97
structure length
97
Chain Sequence
b'MVDFAFELKKAQDTGKIVMGAKKSIQYAKMGGAKLIIVARNAKPDIKEDIEYYAKLSGIPVYEFEGTSVELGTLLGKPHTVSALAVVDPGESRILAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L30e
publication title Electrostatic contribution of surface charge residues to the stability of a thermophilic protein: benchmarking experimental and predicted pKa values
pubmed doi rcsb
source organism Thermococcus celer
molecule tags Ribosomal protein
total genus 28
structure length 97
sequence length 97
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.30 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; 60s Ribosomal Protein L30; Chain: A; 3n4zA00
1YI2F 3V7QA 3RA6A 1N8RH 3MCAB 4X3MA 3PAFA 1K73H 5GAPK 1S72F 3CPQA 3LFOA 1YHQF 4TZZA 1X7OA 4BW0B 1KQSF 3G4SF 2LBXA 1GZ0A 3IR9A 4X3LA 3LWRC 3CCMF 1Q7YH 5EWRA 1QVFF 1W42A 4C4WC 3O85A 1KC8H 2KTVA 1KD1H 3SIUA 1W41A 1W2BF 5GINC 3CCJF 2OTJF 3J7AR 3N4YA 1X7PA 1GO1A 3J80M 5A2QM 5FJ4C 2OHWA 1NMUB 3OW2F 1M90H 3G71F 2QEXF 1VQ4F 1VQ9F 3G6EF 1W3EX 5GANK 4LCKA 2ALEA 3CCVF 1K8AH 3HAXD 5DCVA 3SIVA 2FC3A 4BY9D 1JJ2F 3NK6A 1CK2A 1RLGA 1VQ6F 1VQ7F 2OTLF 1DT9A 3V7EA 1IPAA 1YITF 3CC4F 1W40A 2WALA 3I55F 3E20B 3CCRF 1YJ9F 2KG4A 3CD6F 3CPWF 5G4UC 2BO1A 1YIJF 1YJWF 1YJNF 3J81M 1H7MA 1ZWZA 5GIPC 2KTUA 1VQ8F 1Q86H 3CC7F 1SDSA 3LWVC 2QA4F 3NK7A 1E7KA 1VQ5F 3CCLF 1PXWA 3CG6A 2VGMA 3JCMM 3OBWA 3VMFB 1NJIH 3WXMB 3VI6A 3CMEF 1VQOF 3AGKA 3NVIB 1CN7A 2I6DA 2JNBA 3JAMM 3RA5A 1RA4A 3CCSF 5GIOC 3ON1A 2OZBA 1Q81H 3GYQA 4NUTA 3E1YA 1QVGF 1Q82H 3I56F 1VQLF 1VQNF 5EO3A 3CXCF 3LWPC 3LWOC 3NVKE 2VGNA 1VQMF 3N4ZA 3OBYA 1GO0A 3CC2F 2AIFA 5IT9M 5FLXM 3CCQF 3NMUC 3CCEF 5G4VC 2HVYD 3PLAC 3LWQC 2CZWA 2QI2A 3CMAF 1VQPF 3CCUF 2LBWA 1VQKF 1K9MH 1X52A 3HJWC 1T0KB 3FFMA 1XBIA 1M1KH
chains in the Genus database with same CATH superfamily
1YI2F 3V7QA 4BT6A 4O2AA 3KJKA 3JAWA 2HX0A 3R0PA 3BYQA 1KNJA 3PAFA 5B8FA 1K73H 4HNAA 5J2TB 4R40B 3TD5A 4X1YB 2RHJA 5JCOC 1YHQF 4FFBB 1VQVA 4BVRA 5CB4A 1FSZA 3LWRC 4C82A 4ZHQA 5MN6A 1W42A 4C4WC 3O85A 4ZHWA 3B6NA 5GINC 2RB9A 1X7PA 1GO1A 4IIJB 5A2QM 2IG8A 3IKFA 5LYJA 2QEXF 5HY0A 3G6EF 1FNJA 1H48A 1W581 3HAXD 3HWUA 2H8CA 3VYTC 2FC3A 4M8IA 1JJ2F 4BT7A 4I4TB 3HKEA 3HKBB 5LOVB 1IV3A 1QD9A 3CCRF 2KG4A 3C9UA 3CD6F 3K14A 4ZHYB 2ZODA 2UYNA 3J81M 5IJ0A 3TD3A 1H7MA 3IKEA 5GIPC 5JH7A 1Q86H 3C8LA 3TD4A 3FD6A 5J2TA 4X1YA 2CVLA 3K0TA 4FFBA 1VH8A 4C8IA 3VI6A 1YGYA 2BTOA 3AGKA 1CN7A 5IYZB 2I6DA 3RA5A 5IJ9B 5LXTA 1U43A 5GIOC 3ELCA 1JD1A 1ONIA 2HP3A 2ZVYA 1Q81H 3GYQA 5KX5B 2RHOA 2R751 1QVGF 1XHOA 4IIJA 5KMGB 2CSLA 3U0OA 5LA6B 3LWPC 3DC2A 3NVKE 2IAFA 3OBYA 2AIFA 4I55B 3VTIC 5G4VC 4I4TA 4O4IA 3LWQC 2QTPA 3CMAF 3HKBA 1VQPF 3FD5A 2RHLA 5LOVA 2V9YA 2LBWA 4BVSA 5CB4B 3D00A 2VAMA 1QU9A 3HJWC 5GONB 3JATB 2CHSA 3RYIB 4ZOLB 3WJQA 3RA6A 3WGLA 3DDNA 1X25A 4X3MA 4O2BB 4BT4A 3F6MA 5GAPK 5HXUA 2UYPA 1S72F 2Z1EA 4PWTA 1VHAA 4DRXB 4BW0B 3S02A 3G4SF 5IYZA 5HY1A 3MQWA 1GZ0A 4G4ZA 3WPWA 1Q7YH 5IJ9A 5ITZB 1H47A 2KTVA 3QTYA 3KE1A 5KX5A 1JFFB 2OTJF 5CA1B 5KMGA 2LCAA 2HQSC 2HS3A 1OAPA 2H8EA 3WGNA 5LA6A 5JH7B 1W59A 1VQ9F 1W3EX 3OONA 5GANK 1UI9A 2ALEA 5LP6B 4I55A 4O4LB 3GTZA 2RHHA 1CK2A 5MN4A 4TUYA 1VQ7F 4NQ3A 2OTLF 2Z1TA 5BMVA 1IPAA 3V7EA 1OFUA 2H6LA 3E20B 5JVDB 3WGJA 5LXTB 1YJ9F 5GONA 3CPWF 3JATA 1W5BA 2BO1A 4BT2A 1YIJF 5EAZA 3RYIA 4ZOLA 4B45A 3Q8HA 1RQ2A 3IEQA 2ZF8A 1ZWZA 3KIZA 1CLIA 3RE3A 3S0YA 4G4YA 3S06A 3FBAA 4NWOB 4O2BA 3LWVC 2QA4F 3NK7A 2HRYA 4C8GA 5MN5A 1IV2A 3CCLF 3RYFA 4X1IB 3QHDA 2VGMA 3LDTA 3JCMM 1T0AA 1SZQA 2BTUA 4DRXA 2KGWA 4O4IB 1NQ3A 5J2UB 1PF5A 2UYKA 2GLZA 3VOBA 2CHTA 4RHAA 3CCSF 2VAPA 5ITZA 4BVQA 2OZBA 4NUTA 4ZI7A 4O4HB 1JFFA 1SA0B 1Q82H 3JVHA 4RQOA 5CA1A 3IMPA 1VQLF 3CXCF 4ERHA 3LWOC 1VQMF 2CWJA 1GO0A 3M84A 5AVMA 3CC2F 3T80A 5LP6A 4O4LA 4ZK7A 3NMUC 1Z5WA 3C9TA 2F9ZC 4TV9B 2HVYD 3PLAC 2QI2A 4G88A 3WPXA 4EI8A 3ERNA 5JVDA 1X52A 2UZHA 2N48A 5EYPB 1QAHA 3QUWA 5EIBC 4DXDA 1W55A 3MCAB 2DYYA 2B33A 1UFYA 5C8YB 4WBNB 4X1IA 3WGKA 3HKCB 4I50B 4TUYB 4TV8A 4B5CA 5J2UA 2LBXA 3IR9A 5BMVB 1XV2A 2L26A 4LNUA 3ESJA 1U3LA 4C8EA 2Q1XA 4EB6B 3L7QA 1RQ7A 1KD1H 1JN1A 4O4HA 1W2BF 2ZOVA 3CCJF 1SA0A 3KJJA 3J80M 1NMUB 3MDOA 2OTMA 3D54A 1W5EA 3OW2F 4C81A 3V3TA 1VQ4F 4XCQA 4LCKA 4U39A 3I3FA 3VYUC 3RYFB 3VCZA 4TV9A 4BY9D 2HP0B 1VK3A 3NK6A 3FPIA 4EI9A 1VQ6F 2MQEA 3K12A 3K2XA 5JCOA 1DT9A 1YITF 5EIBD 3UT5B 2HRUA 4F6RA 5G4UC 4X1KB 3VO8A 1COMA 2YXZA 2W8BC 4ZI7B 5EYPA 1YJNF 2AIZP 1W5AA 3CC7F 3F0GA 4ZHVA 3EORA 3HTNA 4X20B 3GHZA 5EZYB 5C8YA 1Q8RA 4WBNA 3CYPB 2DT4A 3HKCA 4O4JB 3VMFB 4I50A 1VQOF 3N2GB 5JQGB 2JNBA 3JAMM 4G4XA 3ZP4A 3WJRA 2P6YA 3F0FA 3ON1A 3V4DA 3S0HA 4EB6A 4BVTA 3RYCA 2CW4A 3LMEA 4YJ3B 1FNKA 1GX1A 3JARB 3P10A 1VQNF 1IV1A 4IHJB 2HS4A 5FNVB 3HKDB 5IT9M 3P4EA 3CCQF 4BT3A 2HP0A 4YJ2B 4G4WA 4TV8B 3F0EA 1W57A 5EB0A 1K9MH 1TUBB 3UT5A 2AMTA 4LNUB 4X1KA 2YYEA 3WJPA 4BT5A 1U40A 1T0KB 3FFMA 2IQQA 3D01A 1M1KH 2UYJA 3N2KB 1N8RH 3JASB 4X20A 4G4VA 5HY2A 5EZYA 4E6EA 2Z1UA 3CPQA 3LFOA 2Q1YA 4TZZA 1X7OA 4O4JA 1KQSF 5EB1B 3VOAA 5CA0B 2LBTA 3N2GA 5HP7A 5JQGA 1TVKB 4X3LA 3C9SA 3F0DA 1JY8A 3CCMF 2G9IA 5EWRA 1QVFF 1FFXB 2HS0A 4F6RB 1KC8H 4U3JB 3SIUA 1W41A 3JALB 1ODEA 4YJ3A 3J7AR 1XRGA 3N4YA 3M1XA 3JAKB 3JARA 5FJ4C 2OHWA 2FGYA 1M90H 4IHJA 3G71F 2I6RA 5FNVA 3CCVF 1K8AH 5DCVA 3S0WA 3HKDA 3SIVA 1DBFA 1R1MA 4YJ2A 1RLGA 3E22B 3CC4F 1J7HA 1W40A 2WALA 1TUBA 3P0ZA 3I55F 3CB2A 3RYHB 3I7TA 1YJWF 3RYCB 3VYSC 2Z01A 3N2KA 2KTUA 5LP6C 3LYBA 2ZVZA 4O2AB 1VQ8F 3JASA 1SDSA 3JAWB 1E7KA 2ZAUA 4HNAB 1VQ5F 3S03A 5HWEA 1IV4A 1KNKA 1PXWA 3CG6A 3VIUA 1W5FA 1YQNA 3OBWA 1NJIH 5HP8A 3WXMB 2GVIA 3CMEF 3NVIB 5CA0A 4KWEA 1TVKA 2PHNA 1U3PA 3KHNA 1RA4A 4ZHQB 1FFXA 2BTQB 2EWCA 3ZO8A 4U3JA 3ZP7A 3CYQA 3JALA 3E1YA 2R6R1 5HXZA 3JAKA 3I56F 3C9RA 5EO3A 1RLUA 2GZLA 4B62A 5LYJB 2VGNA 3N4ZA 2VAWA 2K1SA 5FLXM 3CCEF 3HKEB 2VXYA 2CZWA 3CCUF 3E22A 3ZOPA 1VQKF 5HY4A 3IEWA 3MCQA 2PMPA 3RYHA 4B46A 2NMUA 3MBMA 4EI7A 2UYNB 1XBIA 3WGMA 3M4SA 2Z1FA 5IJ0B 1Z5VA
chains in the Genus database with same CATH topology
1YI2F 3V7QA 3RA6A 1N8RH 3MCAB 4X3MA 5HY2A 3PAFA 1K73H 5GAPK 5HXUA 1S72F 3CPQA 3LFOA 1YHQF 4TZZA 1X7OA 4BW0B 1KQSF 3G4SF 4BVRA 2LBXA 5HY1A 1GZ0A 3IR9A 4X3LA 3LWRC 3CCMF 1Q7YH 5EWRA 1QVFF 1W42A 4C4WC 3O85A 1KC8H 2KTVA 1KD1H 3SIUA 1W41A 1W2BF 5GINC 3CCJF 2OTJF 3J7AR 3N4YA 1X7PA 1GO1A 3J80M 5A2QM 5FJ4C 2OHWA 1NMUB 2FGYA 3OW2F 1M90H 3G71F 3V3TA 2QEXF 1VQ4F 4XCQA 1W3EX 5HY0A 5GANK 3G6EF 1VQ9F 4LCKA 2ALEA 3CCVF 1K8AH 3HAXD 5DCVA 3SIVA 2FC3A 4BY9D 1JJ2F 3NK6A 1CK2A 1RLGA 4EI9A 1VQ6F 1VQ7F 4NQ3A 2OTLF 1DT9A 3V7EA 1IPAA 1YITF 3CC4F 1W40A 2WALA 3I55F 3E20B 3CCRF 1YJ9F 2KG4A 3CD6F 3CPWF 5G4UC 2BO1A 1YIJF 1YJWF 1YJNF 3J81M 1H7MA 1ZWZA 5GIPC 2KTUA 1VQ8F 1Q86H 3CC7F 1SDSA 3LWVC 2QA4F 3NK7A 1E7KA 1VQ5F 3CCLF 5HWEA 1PXWA 3CG6A 2VGMA 3JCMM 3OBWA 3VMFB 1NJIH 3WXMB 3VI6A 3CMEF 1VQOF 3AGKA 3NVIB 1CN7A 2I6DA 2JNBA 2GLZA 3RA5A 3JAMM 1RA4A 3CCSF 5GIOC 3ON1A 4BVQA 2OZBA 1Q81H 3GYQA 4NUTA 4BVTA 3E1YA 5HXZA 1QVGF 1Q82H 3I56F 1VQLF 1VQNF 5EO3A 3CXCF 3LWPC 3LWOC 3NVKE 2VGNA 1VQMF 3N4ZA 3OBYA 1GO0A 3CC2F 2AIFA 5IT9M 5FLXM 3CCQF 3NMUC 3CCEF 2F9ZC 5G4VC 2HVYD 3PLAC 3LWQC 2CZWA 2QI2A 3CMAF 1VQPF 3CCUF 2LBWA 4BVSA 4EI8A 5HY4A 1VQKF 1K9MH 3D00A 1X52A 3HJWC 4EI7A 1T0KB 3FFMA 1XBIA 1M1KH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YI2 F;  3V7Q A;  3RA6 A;  1N8R H;  3MCA B;  4X3M A;  3PAF A;  1K73 H;  5GAP K;  1S72 F;  3CPQ A;  3LFO A;  1YHQ F;  4TZZ A;  1X7O A;  4BW0 B;  1KQS F;  3G4S F;  2LBX A;  1GZ0 A;  3IR9 A;  4X3L A;  3LWR C;  3CCM F;  1Q7Y H;  5EWR A;  1QVF F;  1W42 A;  4C4W C;  3O85 A;  1KC8 H;  2KTV A;  1KD1 H;  3SIU A;  1W41 A;  1W2B F;  5GIN C;  3CCJ F;  2OTJ F;  3J7A R;  3N4Y A;  1X7P A;  1GO1 A;  3J80 M;  5A2Q M;  5FJ4 C;  2OHW A;  1NMU B;  3OW2 F;  1M90 H;  3G71 F;  2QEX F;  1VQ4 F;  1VQ9 F;  3G6E F;  1W3E X;  5GAN K;  4LCK A;  2ALE A;  3CCV F;  1K8A H;  3HAX D;  5DCV A;  3SIV A;  2FC3 A;  4BY9 D;  1JJ2 F;  3NK6 A;  1CK2 A;  1RLG A;  1VQ6 F;  1VQ7 F;  2OTL F;  1DT9 A;  3V7E A;  1IPA A;  1YIT F;  3CC4 F;  1W40 A;  2WAL A;  3I55 F;  3E20 B;  3CCR F;  1YJ9 F;  2KG4 A;  3CD6 F;  3CPW F;  5G4U C;  2BO1 A;  1YIJ F;  1YJW F;  1YJN F;  3J81 M;  1H7M A;  1ZWZ A;  5GIP C;  2KTU A;  1VQ8 F;  1Q86 H;  3CC7 F;  1SDS A;  3LWV C;  2QA4 F;  3NK7 A;  1E7K A;  1VQ5 F;  3CCL F;  1PXW A;  3CG6 A;  2VGM A;  3JCM M;  3OBW A;  3VMF B;  1NJI H;  3WXM B;  3VI6 A;  3CME F;  1VQO F;  3AGK A;  3NVI B;  1CN7 A;  2I6D A;  2JNB A;  3JAM M;  3RA5 A;  1RA4 A;  3CCS F;  5GIO C;  3ON1 A;  2OZB A;  1Q81 H;  3GYQ A;  4NUT A;  3E1Y A;  1QVG F;  1Q82 H;  3I56 F;  1VQL F;  1VQN F;  5EO3 A;  3CXC F;  3LWP C;  3LWO C;  3NVK E;  2VGN A;  1VQM F;  3N4Z A;  3OBY A;  1GO0 A;  3CC2 F;  2AIF A;  5IT9 M;  5FLX M;  3CCQ F;  3NMU C;  3CCE F;  5G4V C;  2HVY D;  3PLA C;  3LWQ C;  2CZW A;  2QI2 A;  3CMA F;  1VQP F;  3CCU F;  2LBW A;  1VQK F;  1K9M H;  1X52 A;  3HJW C;  1T0K B;  3FFM A;  1XBI A;  1M1K H; 
#chains in the Genus database with same CATH topology
 1YI2 F;  3V7Q A;  4BT6 A;  4O2A A;  3KJK A;  3JAW A;  2HX0 A;  3R0P A;  3BYQ A;  1KNJ A;  3PAF A;  5B8F A;  1K73 H;  4HNA A;  5J2T B;  4R40 B;  3TD5 A;  4X1Y B;  2RHJ A;  5JCO C;  1YHQ F;  4FFB B;  1VQV A;  4BVR A;  5CB4 A;  1FSZ A;  3LWR C;  4C82 A;  4ZHQ A;  5MN6 A;  1W42 A;  4C4W C;  3O85 A;  4ZHW A;  3B6N A;  5GIN C;  2RB9 A;  1X7P A;  1GO1 A;  4IIJ B;  5A2Q M;  2IG8 A;  3IKF A;  5LYJ A;  2QEX F;  5HY0 A;  3G6E F;  1FNJ A;  1H48 A;  1W58 1;  3HAX D;  3HWU A;  2H8C A;  3VYT C;  2FC3 A;  4M8I A;  1JJ2 F;  4BT7 A;  4I4T B;  3HKE A;  3HKB B;  5LOV B;  1IV3 A;  1QD9 A;  3CCR F;  2KG4 A;  3C9U A;  3CD6 F;  3K14 A;  4ZHY B;  2ZOD A;  2UYN A;  3J81 M;  5IJ0 A;  3TD3 A;  1H7M A;  3IKE A;  5GIP C;  5JH7 A;  1Q86 H;  3C8L A;  3TD4 A;  3FD6 A;  5J2T A;  4X1Y A;  2CVL A;  3K0T A;  4FFB A;  1VH8 A;  4C8I A;  3VI6 A;  1YGY A;  2BTO A;  3AGK A;  1CN7 A;  5IYZ B;  2I6D A;  3RA5 A;  5IJ9 B;  5LXT A;  1U43 A;  5GIO C;  3ELC A;  1JD1 A;  1ONI A;  2HP3 A;  2ZVY A;  1Q81 H;  3GYQ A;  5KX5 B;  2RHO A;  2R75 1;  1QVG F;  1XHO A;  4IIJ A;  5KMG B;  2CSL A;  3U0O A;  5LA6 B;  3LWP C;  3DC2 A;  3NVK E;  2IAF A;  3OBY A;  2AIF A;  4I55 B;  3VTI C;  5G4V C;  4I4T A;  4O4I A;  3LWQ C;  2QTP A;  3CMA F;  3HKB A;  1VQP F;  3FD5 A;  2RHL A;  5LOV A;  2V9Y A;  2LBW A;  4BVS A;  5CB4 B;  3D00 A;  2VAM A;  1QU9 A;  3HJW C;  5GON B;  3JAT B;  2CHS A;  3RYI B;  4ZOL B;  3WJQ A;  3RA6 A;  3WGL A;  3DDN A;  1X25 A;  4X3M A;  4O2B B;  4BT4 A;  3F6M A;  5GAP K;  5HXU A;  2UYP A;  1S72 F;  2Z1E A;  4PWT A;  1VHA A;  4DRX B;  4BW0 B;  3S02 A;  3G4S F;  5IYZ A;  5HY1 A;  3MQW A;  1GZ0 A;  4G4Z A;  3WPW A;  1Q7Y H;  5IJ9 A;  5ITZ B;  1H47 A;  2KTV A;  3QTY A;  3KE1 A;  5KX5 A;  1JFF B;  2OTJ F;  5CA1 B;  5KMG A;  2LCA A;  2HQS C;  2HS3 A;  1OAP A;  2H8E A;  3WGN A;  5LA6 A;  5JH7 B;  1W59 A;  1VQ9 F;  1W3E X;  3OON A;  5GAN K;  1UI9 A;  2ALE A;  5LP6 B;  4I55 A;  4O4L B;  3GTZ A;  2RHH A;  1CK2 A;  5MN4 A;  4TUY A;  1VQ7 F;  4NQ3 A;  2OTL F;  2Z1T A;  5BMV A;  1IPA A;  3V7E A;  1OFU A;  2H6L A;  3E20 B;  5JVD B;  3WGJ A;  5LXT B;  1YJ9 F;  5GON A;  3CPW F;  3JAT A;  1W5B A;  2BO1 A;  4BT2 A;  1YIJ F;  5EAZ A;  3RYI A;  4ZOL A;  4B45 A;  3Q8H A;  1RQ2 A;  3IEQ A;  2ZF8 A;  1ZWZ A;  3KIZ A;  1CLI A;  3RE3 A;  3S0Y A;  4G4Y A;  3S06 A;  3FBA A;  4NWO B;  4O2B A;  3LWV C;  2QA4 F;  3NK7 A;  2HRY A;  4C8G A;  5MN5 A;  1IV2 A;  3CCL F;  3RYF A;  4X1I B;  3QHD A;  2VGM A;  3LDT A;  3JCM M;  1T0A A;  1SZQ A;  2BTU A;  4DRX A;  2KGW A;  4O4I B;  1NQ3 A;  5J2U B;  1PF5 A;  2UYK A;  2GLZ A;  3VOB A;  2CHT A;  4RHA A;  3CCS F;  2VAP A;  5ITZ A;  4BVQ A;  2OZB A;  4NUT A;  4ZI7 A;  4O4H B;  1JFF A;  1SA0 B;  1Q82 H;  3JVH A;  4RQO A;  5CA1 A;  3IMP A;  1VQL F;  3CXC F;  4ERH A;  3LWO C;  1VQM F;  2CWJ A;  1GO0 A;  3M84 A;  5AVM A;  3CC2 F;  3T80 A;  5LP6 A;  4O4L A;  4ZK7 A;  3NMU C;  1Z5W A;  3C9T A;  2F9Z C;  4TV9 B;  2HVY D;  3PLA C;  2QI2 A;  4G88 A;  3WPX A;  4EI8 A;  3ERN A;  5JVD A;  1X52 A;  2UZH A;  2N48 A;  5EYP B;  1QAH A;  3QUW A;  5EIB C;  4DXD A;  1W55 A;  3MCA B;  2DYY A;  2B33 A;  1UFY A;  5C8Y B;  4WBN B;  4X1I A;  3WGK A;  3HKC B;  4I50 B;  4TUY B;  4TV8 A;  4B5C A;  5J2U A;  2LBX A;  3IR9 A;  5BMV B;  1XV2 A;  2L26 A;  4LNU A;  3ESJ A;  1U3L A;  4C8E A;  2Q1X A;  4EB6 B;  3L7Q A;  1RQ7 A;  1KD1 H;  1JN1 A;  4O4H A;  1W2B F;  2ZOV A;  3CCJ F;  1SA0 A;  3KJJ A;  3J80 M;  1NMU B;  3MDO A;  2OTM A;  3D54 A;  1W5E A;  3OW2 F;  4C81 A;  3V3T A;  1VQ4 F;  4XCQ A;  4LCK A;  4U39 A;  3I3F A;  3VYU C;  3RYF B;  3VCZ A;  4TV9 A;  4BY9 D;  2HP0 B;  1VK3 A;  3NK6 A;  3FPI A;  4EI9 A;  1VQ6 F;  2MQE A;  3K12 A;  3K2X A;  5JCO A;  1DT9 A;  1YIT F;  5EIB D;  3UT5 B;  2HRU A;  4F6R A;  5G4U C;  4X1K B;  3VO8 A;  1COM A;  2YXZ A;  2W8B C;  4ZI7 B;  5EYP A;  1YJN F;  2AIZ P;  1W5A A;  3CC7 F;  3F0G A;  4ZHV A;  3EOR A;  3HTN A;  4X20 B;  3GHZ A;  5EZY B;  5C8Y A;  1Q8R A;  4WBN A;  3CYP B;  2DT4 A;  3HKC A;  4O4J B;  3VMF B;  4I50 A;  1VQO F;  3N2G B;  5JQG B;  2JNB A;  3JAM M;  4G4X A;  3ZP4 A;  3WJR A;  2P6Y A;  3F0F A;  3ON1 A;  3V4D A;  3S0H A;  4EB6 A;  4BVT A;  3RYC A;  2CW4 A;  3LME A;  4YJ3 B;  1FNK A;  1GX1 A;  3JAR B;  3P10 A;  1VQN F;  1IV1 A;  4IHJ B;  2HS4 A;  5FNV B;  3HKD B;  5IT9 M;  3P4E A;  3CCQ F;  4BT3 A;  2HP0 A;  4YJ2 B;  4G4W A;  4TV8 B;  3F0E A;  1W57 A;  5EB0 A;  1K9M H;  1TUB B;  3UT5 A;  2AMT A;  4LNU B;  4X1K A;  2YYE A;  3WJP A;  4BT5 A;  1U40 A;  1T0K B;  3FFM A;  2IQQ A;  3D01 A;  1M1K H;  2UYJ A;  3N2K B;  1N8R H;  3JAS B;  4X20 A;  4G4V A;  5HY2 A;  5EZY A;  4E6E A;  2Z1U A;  3CPQ A;  3LFO A;  2Q1Y A;  4TZZ A;  1X7O A;  4O4J A;  1KQS F;  5EB1 B;  3VOA A;  5CA0 B;  2LBT A;  3N2G A;  5HP7 A;  5JQG A;  1TVK B;  4X3L A;  3C9S A;  3F0D A;  1JY8 A;  3CCM F;  2G9I A;  5EWR A;  1QVF F;  1FFX B;  2HS0 A;  4F6R B;  1KC8 H;  4U3J B;  3SIU A;  1W41 A;  3JAL B;  1ODE A;  4YJ3 A;  3J7A R;  1XRG A;  3N4Y A;  3M1X A;  3JAK B;  3JAR A;  5FJ4 C;  2OHW A;  2FGY A;  1M90 H;  4IHJ A;  3G71 F;  2I6R A;  5FNV A;  3CCV F;  1K8A H;  5DCV A;  3S0W A;  3HKD A;  3SIV A;  1DBF A;  1R1M A;  4YJ2 A;  1RLG A;  3E22 B;  3CC4 F;  1J7H A;  1W40 A;  2WAL A;  1TUB A;  3P0Z A;  3I55 F;  3CB2 A;  3RYH B;  3I7T A;  1YJW F;  3RYC B;  3VYS C;  2Z01 A;  3N2K A;  2KTU A;  5LP6 C;  3LYB A;  2ZVZ A;  4O2A B;  1VQ8 F;  3JAS A;  1SDS A;  3JAW B;  1E7K A;  2ZAU A;  4HNA B;  1VQ5 F;  3S03 A;  5HWE A;  1IV4 A;  1KNK A;  1PXW A;  3CG6 A;  3VIU A;  1W5F A;  1YQN A;  3OBW A;  1NJI H;  5HP8 A;  3WXM B;  2GVI A;  3CME F;  3NVI B;  5CA0 A;  4KWE A;  1TVK A;  2PHN A;  1U3P A;  3KHN A;  1RA4 A;  4ZHQ B;  1FFX A;  2BTQ B;  2EWC A;  3ZO8 A;  4U3J A;  3ZP7 A;  3CYQ A;  3JAL A;  3E1Y A;  2R6R 1;  5HXZ A;  3JAK A;  3I56 F;  3C9R A;  5EO3 A;  1RLU A;  2GZL A;  4B62 A;  5LYJ B;  2VGN A;  3N4Z A;  2VAW A;  2K1S A;  5FLX M;  3CCE F;  3HKE B;  2VXY A;  2CZW A;  3CCU F;  3E22 A;  3ZOP A;  1VQK F;  5HY4 A;  3IEW A;  3MCQ A;  2PMP A;  3RYH A;  4B46 A;  2NMU A;  3MBM A;  4EI7 A;  2UYN B;  1XBI A;  3WGM A;  3M4S A;  2Z1F A;  5IJ0 B;  1Z5V A; 
#chains in the Genus database with same CATH homology
 1YI2 F;  3V7Q A;  3RA6 A;  1N8R H;  3MCA B;  4X3M A;  5HY2 A;  3PAF A;  1K73 H;  5GAP K;  5HXU A;  1S72 F;  3CPQ A;  3LFO A;  1YHQ F;  4TZZ A;  1X7O A;  4BW0 B;  1KQS F;  3G4S F;  4BVR A;  2LBX A;  5HY1 A;  1GZ0 A;  3IR9 A;  4X3L A;  3LWR C;  3CCM F;  1Q7Y H;  5EWR A;  1QVF F;  1W42 A;  4C4W C;  3O85 A;  1KC8 H;  2KTV A;  1KD1 H;  3SIU A;  1W41 A;  1W2B F;  5GIN C;  3CCJ F;  2OTJ F;  3J7A R;  3N4Y A;  1X7P A;  1GO1 A;  3J80 M;  5A2Q M;  5FJ4 C;  2OHW A;  1NMU B;  2FGY A;  3OW2 F;  1M90 H;  3G71 F;  3V3T A;  2QEX F;  1VQ4 F;  4XCQ A;  1W3E X;  5HY0 A;  5GAN K;  3G6E F;  1VQ9 F;  4LCK A;  2ALE A;  3CCV F;  1K8A H;  3HAX D;  5DCV A;  3SIV A;  2FC3 A;  4BY9 D;  1JJ2 F;  3NK6 A;  1CK2 A;  1RLG A;  4EI9 A;  1VQ6 F;  1VQ7 F;  4NQ3 A;  2OTL F;  1DT9 A;  3V7E A;  1IPA A;  1YIT F;  3CC4 F;  1W40 A;  2WAL A;  3I55 F;  3E20 B;  3CCR F;  1YJ9 F;  2KG4 A;  3CD6 F;  3CPW F;  5G4U C;  2BO1 A;  1YIJ F;  1YJW F;  1YJN F;  3J81 M;  1H7M A;  1ZWZ A;  5GIP C;  2KTU A;  1VQ8 F;  1Q86 H;  3CC7 F;  1SDS A;  3LWV C;  2QA4 F;  3NK7 A;  1E7K A;  1VQ5 F;  3CCL F;  5HWE A;  1PXW A;  3CG6 A;  2VGM A;  3JCM M;  3OBW A;  3VMF B;  1NJI H;  3WXM B;  3VI6 A;  3CME F;  1VQO F;  3AGK A;  3NVI B;  1CN7 A;  2I6D A;  2JNB A;  2GLZ A;  3RA5 A;  3JAM M;  1RA4 A;  3CCS F;  5GIO C;  3ON1 A;  4BVQ A;  2OZB A;  1Q81 H;  3GYQ A;  4NUT A;  4BVT A;  3E1Y A;  5HXZ A;  1QVG F;  1Q82 H;  3I56 F;  1VQL F;  1VQN F;  5EO3 A;  3CXC F;  3LWP C;  3LWO C;  3NVK E;  2VGN A;  1VQM F;  3N4Z A;  3OBY A;  1GO0 A;  3CC2 F;  2AIF A;  5IT9 M;  5FLX M;  3CCQ F;  3NMU C;  3CCE F;  2F9Z C;  5G4V C;  2HVY D;  3PLA C;  3LWQ C;  2CZW A;  2QI2 A;  3CMA F;  1VQP F;  3CCU F;  2LBW A;  4BVS A;  4EI8 A;  5HY4 A;  1VQK F;  1K9M H;  3D00 A;  1X52 A;  3HJW C;  4EI7 A;  1T0K B;  3FFM A;  1XBI A;  1M1K H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...