3N5GA

Crystal structure of histidine-tagged human thymidylate synthase
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
285
structure length
259
Chain Sequence
PPHGELQYLGQIQHILRGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMAWNPRDLPLMALPPHALQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein-protein interface-binding peptides inhibit the cancer therapy target human thymidylate synthase.
pubmed doi rcsb
molecule keywords Thymidylate synthase
molecule tags Transferase
source organism Homo sapiens
total genus 75
structure length 259
sequence length 285
ec nomenclature ec 2.1.1.45: Thymidylate synthase.
pdb deposition date 2010-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00303 Thymidylat_synt Thymidylate synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.572.10 Alpha Beta 2-Layer Sandwich Thymidylate Synthase; Chain A Thymidylate synthase/dCMP hydroxymethylase domain 3n5gA00
3IROA 1NJEA 2RDAA 3EJLA 4PSGA 1TDAA 4H1IA 1BPJA 3DG8C 4H0RA 3K2HA 1JU6A 4Q0EA 4DPHA 3TMSA 3BNZA 1BKPA 4O7UA 4EB4A 1JMIA 1NCEA 3IX6A 1SYNA 1THYA 5FCTA 2TSRA 1CI7A 1JG0A 1BQ1A 1TVVA 1J3JC 1TLSA 3EAWX 3KJSA 4Q0DA 4DQ1A 1B5EA 1QQQA 1VZEA 3B9HA 4G6WX 5H3AA 1BSFA 3DL5A 1SEJA 4KYAA 4EILA 4ISKA 4FOAA 1TSMA 1EV8A 4XSEA 1F4DA 1EVGA 1TSNA 4ECKA 4XSCA 1I00A 1BDUA 3BZ0A 1NJDA 3IRNA 1F4EA 4GYHA 4JEFA 3HB8A 1B49A 2G8AA 1AXWA 4KPWA 3KGBA 3NRRA 3CL9A 1TRGA 4KY4A 5HS3A 2VF0A 1NJBA 1DNAA 3H9KA 3UM5A 3UM8A 4O1XA 3GH2X 4KNZA 1NJCA 1TSZA 1LCBA 1YPVA 2ONBA 2H2QA 3N5GA 1VZAA 1BQ2A 1HW4A 1TSLA 1F4GA 3V8HA 2AAZA 3CLBA 3IHIA 1F4FA 1TSDA 4EINA 1LCEA 4IRRA 2FTNA 3QGTA 1F4BA 1KZJA 2VETA 2G8XA 2FTQA 4O1UA 4UP1A 1FWMA 1AIQA 3UM6A 3HBBA 1JTQA 4H0UA 1TDBA 4E28A 1LCAA 1JUTA 1TISA 1KCEA 1HW3A 3IK1A 5H38A 1TDUA 3B5BA 4G2OX 4ISWA 3BHLA 3IK0A 4GEVA 1TYSA 1BO8A 2OIPA 4IQQA 4FGTA 1BIDA 2G89A 1NJAA 1J3KC 1F28A 2TDMA 1KZIA 4GD7A 1B02A 2TDDA 2A9WA 4XSDA 1TVUA 3KJRA 3QG2A 3OB7A 4DPDA 1TSVA 2KCEA 3IRMA 1TJSA 4IQBA 4DP3A 1EV5A 1J3IC 1ZPRA 3BFIA 4E5OA 3UWLB 1JMHA 2RD8B 4KY8A 3C06A 2BBQA 1BKOA 4EZ8A 4FOGA 1BO7A 3IJZA 1BSPA 1JTUA 3JSUA 3GG5A 1TLCA 1JMFA 1HVYA 2G86A 3EF9A 1BJGA 1TSYA 3EGYX 3HJ3A 3N5EB 4FOXA 4LRRA 5J7WA 1AOBA 3DGAC 2G8DA 3UWLA 2FTOX 2RD8A 4O1XD 4TMSA 3DL6A 3C0AA 4F2VA 1QZFA 5H39A 1RTSA 3I3RA 3QJ7A 3BYXA 4FQSA 1F4CA 5WRNA 1TDCA 1VZCA 3N5EA 1AN5A 1DDUA 3EHIX 3INVA 3BGXA 1VZBA 3EBUA 1EVFA 5BY6A 2TSCA 1TSWA 1B5DA 1AJMA 1TSXA 3EDWX 1BP6A 1BP0A 1FFLA 1TVWA 3GH0A 1JMGA 1HZWA 1JUJA 3BHRA 3ED7A 1VZDA
chains in the Genus database with same CATH superfamily
3IROA 1NJEA 2RDAA 3EJLA 4PSGA 1TDAA 4H1IA 1BPJA 3DG8C 4H0RA 3K2HA 1JU6A 4Q0EA 4DPHA 3TMSA 3BNZA 1BKPA 4O7UA 4EB4A 1JMIA 1NCEA 3IX6A 1SYNA 1THYA 5FCTA 2TSRA 1CI7A 1JG0A 1BQ1A 1TVVA 1J3JC 1TLSA 3EAWX 3KJSA 4Q0DA 4DQ1A 1B5EA 1QQQA 1VZEA 3B9HA 4G6WX 5H3AA 1BSFA 3DL5A 1SEJA 4KYAA 4EILA 4ISKA 4FOAA 1TSMA 1EV8A 4XSEA 1F4DA 1EVGA 1TSNA 4ECKA 4XSCA 1I00A 1BDUA 3BZ0A 1NJDA 3IRNA 1F4EA 4GYHA 4JEFA 3HB8A 1B49A 2G8AA 1AXWA 4KPWA 3KGBA 3NRRA 3CL9A 1TRGA 4KY4A 5HS3A 2VF0A 1NJBA 1DNAA 3H9KA 3UM5A 3UM8A 4O1XA 3GH2X 4KNZA 1NJCA 1TSZA 1LCBA 1YPVA 2ONBA 2H2QA 3N5GA 1VZAA 1BQ2A 1HW4A 1TSLA 1F4GA 3V8HA 2AAZA 3CLBA 3IHIA 1F4FA 1TSDA 4EINA 1LCEA 4IRRA 2FTNA 3QGTA 1F4BA 1KZJA 2VETA 2G8XA 2FTQA 4O1UA 4UP1A 1FWMA 1AIQA 3UM6A 3HBBA 1JTQA 4H0UA 1TDBA 4E28A 1LCAA 1JUTA 1TISA 1KCEA 1HW3A 3IK1A 5H38A 1TDUA 3B5BA 4G2OX 4ISWA 3BHLA 3IK0A 4GEVA 1TYSA 1BO8A 2OIPA 4IQQA 4FGTA 1BIDA 2G89A 1NJAA 1J3KC 1F28A 2TDMA 1KZIA 4GD7A 1B02A 2TDDA 2A9WA 4XSDA 1TVUA 3KJRA 3QG2A 3OB7A 4DPDA 1TSVA 2KCEA 3IRMA 1TJSA 4IQBA 4DP3A 1EV5A 1J3IC 1ZPRA 3BFIA 4E5OA 3UWLB 1JMHA 2RD8B 4KY8A 3C06A 2BBQA 1BKOA 4EZ8A 4FOGA 1BO7A 3IJZA 1BSPA 1JTUA 3JSUA 3GG5A 1TLCA 1JMFA 1HVYA 2G86A 3EF9A 1BJGA 1TSYA 3EGYX 3HJ3A 3N5EB 4FOXA 4LRRA 5J7WA 1AOBA 3DGAC 2G8DA 3UWLA 2FTOX 2RD8A 4O1XD 4TMSA 3DL6A 3C0AA 4F2VA 1QZFA 5H39A 1RTSA 3I3RA 3QJ7A 3BYXA 4FQSA 1F4CA 5WRNA 1TDCA 1VZCA 3N5EA 1AN5A 1DDUA 3EHIX 3INVA 3BGXA 1VZBA 3EBUA 1EVFA 5BY6A 2TSCA 1TSWA 1B5DA 1AJMA 1TSXA 3EDWX 1BP6A 1BP0A 1FFLA 1TVWA 3GH0A 1JMGA 1HZWA 1JUJA 3BHRA 3ED7A 1VZDA
chains in the Genus database with same CATH topology
3IROA 1NJEA 2RDAA 3EJLA 4PSGA 1TDAA 4H1IA 1BPJA 3DG8C 4H0RA 3K2HA 1JU6A 4Q0EA 4DPHA 3TMSA 3BNZA 1BKPA 4O7UA 4EB4A 1JMIA 1NCEA 3IX6A 1SYNA 1THYA 5FCTA 2TSRA 1CI7A 1JG0A 1BQ1A 1TVVA 1J3JC 1TLSA 3EAWX 3KJSA 4Q0DA 4DQ1A 1B5EA 1QQQA 1VZEA 3B9HA 4G6WX 5H3AA 1BSFA 3DL5A 1SEJA 4KYAA 4EILA 4ISKA 4FOAA 1TSMA 1EV8A 4XSEA 1F4DA 1EVGA 1TSNA 4ECKA 4XSCA 1I00A 1BDUA 3BZ0A 1NJDA 3IRNA 1F4EA 4GYHA 4JEFA 3HB8A 1B49A 2G8AA 1AXWA 4KPWA 3KGBA 3NRRA 3CL9A 1TRGA 4KY4A 5HS3A 2VF0A 1NJBA 1DNAA 3H9KA 3UM5A 3UM8A 4O1XA 3GH2X 4KNZA 1NJCA 1TSZA 1LCBA 1YPVA 2ONBA 2H2QA 3N5GA 1VZAA 1BQ2A 1HW4A 1TSLA 1F4GA 3V8HA 2AAZA 3CLBA 3IHIA 1F4FA 1TSDA 4EINA 1LCEA 4IRRA 2FTNA 3QGTA 1F4BA 1KZJA 2VETA 2G8XA 2FTQA 4O1UA 4UP1A 1FWMA 1AIQA 3UM6A 3HBBA 1JTQA 4H0UA 1TDBA 4E28A 1LCAA 1JUTA 1TISA 1KCEA 1HW3A 3IK1A 5H38A 1TDUA 3B5BA 4G2OX 4ISWA 3BHLA 3IK0A 4GEVA 1TYSA 1BO8A 2OIPA 4IQQA 4FGTA 1BIDA 2G89A 1NJAA 1J3KC 1F28A 2TDMA 1KZIA 4GD7A 1B02A 2TDDA 2A9WA 4XSDA 1TVUA 3KJRA 3QG2A 3OB7A 4DPDA 1TSVA 2KCEA 3IRMA 1TJSA 4IQBA 4DP3A 1EV5A 1J3IC 1ZPRA 3BFIA 4E5OA 3UWLB 1JMHA 2RD8B 4KY8A 3C06A 2BBQA 1BKOA 4EZ8A 4FOGA 1BO7A 3IJZA 1BSPA 1JTUA 3JSUA 3GG5A 1TLCA 1JMFA 1HVYA 2G86A 3EF9A 1BJGA 1TSYA 3EGYX 3HJ3A 3N5EB 4FOXA 4LRRA 5J7WA 1AOBA 3DGAC 2G8DA 3UWLA 2FTOX 2RD8A 4O1XD 4TMSA 3DL6A 3C0AA 4F2VA 1QZFA 5H39A 1RTSA 3I3RA 3QJ7A 3BYXA 4FQSA 1F4CA 5WRNA 1TDCA 1VZCA 3N5EA 1AN5A 1DDUA 3EHIX 3INVA 3BGXA 1VZBA 3EBUA 1EVFA 5BY6A 2TSCA 1TSWA 1B5DA 1AJMA 1TSXA 3EDWX 1BP6A 1BP0A 1FFLA 1TVWA 3GH0A 1JMGA 1HZWA 1JUJA 3BHRA 3ED7A 1VZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IRO A;  1NJE A;  2RDA A;  3EJL A;  4PSG A;  1TDA A;  4H1I A;  1BPJ A;  3DG8 C;  4H0R A;  3K2H A;  1JU6 A;  4Q0E A;  4DPH A;  3TMS A;  3BNZ A;  1BKP A;  4O7U A;  4EB4 A;  1JMI A;  1NCE A;  3IX6 A;  1SYN A;  1THY A;  5FCT A;  2TSR A;  1CI7 A;  1JG0 A;  1BQ1 A;  1TVV A;  1J3J C;  1TLS A;  3EAW X;  3KJS A;  4Q0D A;  4DQ1 A;  1B5E A;  1QQQ A;  1VZE A;  3B9H A;  4G6W X;  5H3A A;  1BSF A;  3DL5 A;  1SEJ A;  4KYA A;  4EIL A;  4ISK A;  4FOA A;  1TSM A;  1EV8 A;  4XSE A;  1F4D A;  1EVG A;  1TSN A;  4ECK A;  4XSC A;  1I00 A;  1BDU A;  3BZ0 A;  1NJD A;  3IRN A;  1F4E A;  4GYH A;  4JEF A;  3HB8 A;  1B49 A;  2G8A A;  1AXW A;  4KPW A;  3KGB A;  3NRR A;  3CL9 A;  1TRG A;  4KY4 A;  5HS3 A;  2VF0 A;  1NJB A;  1DNA A;  3H9K A;  3UM5 A;  3UM8 A;  4O1X A;  3GH2 X;  4KNZ A;  1NJC A;  1TSZ A;  1LCB A;  1YPV A;  2ONB A;  2H2Q A;  3N5G A;  1VZA A;  1BQ2 A;  1HW4 A;  1TSL A;  1F4G A;  3V8H A;  2AAZ A;  3CLB A;  3IHI A;  1F4F A;  1TSD A;  4EIN A;  1LCE A;  4IRR A;  2FTN A;  3QGT A;  1F4B A;  1KZJ A;  2VET A;  2G8X A;  2FTQ A;  4O1U A;  4UP1 A;  1FWM A;  1AIQ A;  3UM6 A;  3HBB A;  1JTQ A;  4H0U A;  1TDB A;  4E28 A;  1LCA A;  1JUT A;  1TIS A;  1KCE A;  1HW3 A;  3IK1 A;  5H38 A;  1TDU A;  3B5B A;  4G2O X;  4ISW A;  3BHL A;  3IK0 A;  4GEV A;  1TYS A;  1BO8 A;  2OIP A;  4IQQ A;  4FGT A;  1BID A;  2G89 A;  1NJA A;  1J3K C;  1F28 A;  2TDM A;  1KZI A;  4GD7 A;  1B02 A;  2TDD A;  2A9W A;  4XSD A;  1TVU A;  3KJR A;  3QG2 A;  3OB7 A;  4DPD A;  1TSV A;  2KCE A;  3IRM A;  1TJS A;  4IQB A;  4DP3 A;  1EV5 A;  1J3I C;  1ZPR A;  3BFI A;  4E5O A;  3UWL B;  1JMH A;  2RD8 B;  4KY8 A;  3C06 A;  2BBQ A;  1BKO A;  4EZ8 A;  4FOG A;  1BO7 A;  3IJZ A;  1BSP A;  1JTU A;  3JSU A;  3GG5 A;  1TLC A;  1JMF A;  1HVY A;  2G86 A;  3EF9 A;  1BJG A;  1TSY A;  3EGY X;  3HJ3 A;  3N5E B;  4FOX A;  4LRR A;  5J7W A;  1AOB A;  3DGA C;  2G8D A;  3UWL A;  2FTO X;  2RD8 A;  4O1X D;  4TMS A;  3DL6 A;  3C0A A;  4F2V A;  1QZF A;  5H39 A;  1RTS A;  3I3R A;  3QJ7 A;  3BYX A;  4FQS A;  1F4C A;  5WRN A;  1TDC A;  1VZC A;  3N5E A;  1AN5 A;  1DDU A;  3EHI X;  3INV A;  3BGX A;  1VZB A;  3EBU A;  1EVF A;  5BY6 A;  2TSC A;  1TSW A;  1B5D A;  1AJM A;  1TSX A;  3EDW X;  1BP6 A;  1BP0 A;  1FFL A;  1TVW A;  3GH0 A;  1JMG A;  1HZW A;  1JUJ A;  3BHR A;  3ED7 A;  1VZD A; 
#chains in the Genus database with same CATH topology
 3IRO A;  1NJE A;  2RDA A;  3EJL A;  4PSG A;  1TDA A;  4H1I A;  1BPJ A;  3DG8 C;  4H0R A;  3K2H A;  1JU6 A;  4Q0E A;  4DPH A;  3TMS A;  3BNZ A;  1BKP A;  4O7U A;  4EB4 A;  1JMI A;  1NCE A;  3IX6 A;  1SYN A;  1THY A;  5FCT A;  2TSR A;  1CI7 A;  1JG0 A;  1BQ1 A;  1TVV A;  1J3J C;  1TLS A;  3EAW X;  3KJS A;  4Q0D A;  4DQ1 A;  1B5E A;  1QQQ A;  1VZE A;  3B9H A;  4G6W X;  5H3A A;  1BSF A;  3DL5 A;  1SEJ A;  4KYA A;  4EIL A;  4ISK A;  4FOA A;  1TSM A;  1EV8 A;  4XSE A;  1F4D A;  1EVG A;  1TSN A;  4ECK A;  4XSC A;  1I00 A;  1BDU A;  3BZ0 A;  1NJD A;  3IRN A;  1F4E A;  4GYH A;  4JEF A;  3HB8 A;  1B49 A;  2G8A A;  1AXW A;  4KPW A;  3KGB A;  3NRR A;  3CL9 A;  1TRG A;  4KY4 A;  5HS3 A;  2VF0 A;  1NJB A;  1DNA A;  3H9K A;  3UM5 A;  3UM8 A;  4O1X A;  3GH2 X;  4KNZ A;  1NJC A;  1TSZ A;  1LCB A;  1YPV A;  2ONB A;  2H2Q A;  3N5G A;  1VZA A;  1BQ2 A;  1HW4 A;  1TSL A;  1F4G A;  3V8H A;  2AAZ A;  3CLB A;  3IHI A;  1F4F A;  1TSD A;  4EIN A;  1LCE A;  4IRR A;  2FTN A;  3QGT A;  1F4B A;  1KZJ A;  2VET A;  2G8X A;  2FTQ A;  4O1U A;  4UP1 A;  1FWM A;  1AIQ A;  3UM6 A;  3HBB A;  1JTQ A;  4H0U A;  1TDB A;  4E28 A;  1LCA A;  1JUT A;  1TIS A;  1KCE A;  1HW3 A;  3IK1 A;  5H38 A;  1TDU A;  3B5B A;  4G2O X;  4ISW A;  3BHL A;  3IK0 A;  4GEV A;  1TYS A;  1BO8 A;  2OIP A;  4IQQ A;  4FGT A;  1BID A;  2G89 A;  1NJA A;  1J3K C;  1F28 A;  2TDM A;  1KZI A;  4GD7 A;  1B02 A;  2TDD A;  2A9W A;  4XSD A;  1TVU A;  3KJR A;  3QG2 A;  3OB7 A;  4DPD A;  1TSV A;  2KCE A;  3IRM A;  1TJS A;  4IQB A;  4DP3 A;  1EV5 A;  1J3I C;  1ZPR A;  3BFI A;  4E5O A;  3UWL B;  1JMH A;  2RD8 B;  4KY8 A;  3C06 A;  2BBQ A;  1BKO A;  4EZ8 A;  4FOG A;  1BO7 A;  3IJZ A;  1BSP A;  1JTU A;  3JSU A;  3GG5 A;  1TLC A;  1JMF A;  1HVY A;  2G86 A;  3EF9 A;  1BJG A;  1TSY A;  3EGY X;  3HJ3 A;  3N5E B;  4FOX A;  4LRR A;  5J7W A;  1AOB A;  3DGA C;  2G8D A;  3UWL A;  2FTO X;  2RD8 A;  4O1X D;  4TMS A;  3DL6 A;  3C0A A;  4F2V A;  1QZF A;  5H39 A;  1RTS A;  3I3R A;  3QJ7 A;  3BYX A;  4FQS A;  1F4C A;  5WRN A;  1TDC A;  1VZC A;  3N5E A;  1AN5 A;  1DDU A;  3EHI X;  3INV A;  3BGX A;  1VZB A;  3EBU A;  1EVF A;  5BY6 A;  2TSC A;  1TSW A;  1B5D A;  1AJM A;  1TSX A;  3EDW X;  1BP6 A;  1BP0 A;  1FFL A;  1TVW A;  3GH0 A;  1JMG A;  1HZW A;  1JUJ A;  3BHR A;  3ED7 A;  1VZD A; 
#chains in the Genus database with same CATH homology
 3IRO A;  1NJE A;  2RDA A;  3EJL A;  4PSG A;  1TDA A;  4H1I A;  1BPJ A;  3DG8 C;  4H0R A;  3K2H A;  1JU6 A;  4Q0E A;  4DPH A;  3TMS A;  3BNZ A;  1BKP A;  4O7U A;  4EB4 A;  1JMI A;  1NCE A;  3IX6 A;  1SYN A;  1THY A;  5FCT A;  2TSR A;  1CI7 A;  1JG0 A;  1BQ1 A;  1TVV A;  1J3J C;  1TLS A;  3EAW X;  3KJS A;  4Q0D A;  4DQ1 A;  1B5E A;  1QQQ A;  1VZE A;  3B9H A;  4G6W X;  5H3A A;  1BSF A;  3DL5 A;  1SEJ A;  4KYA A;  4EIL A;  4ISK A;  4FOA A;  1TSM A;  1EV8 A;  4XSE A;  1F4D A;  1EVG A;  1TSN A;  4ECK A;  4XSC A;  1I00 A;  1BDU A;  3BZ0 A;  1NJD A;  3IRN A;  1F4E A;  4GYH A;  4JEF A;  3HB8 A;  1B49 A;  2G8A A;  1AXW A;  4KPW A;  3KGB A;  3NRR A;  3CL9 A;  1TRG A;  4KY4 A;  5HS3 A;  2VF0 A;  1NJB A;  1DNA A;  3H9K A;  3UM5 A;  3UM8 A;  4O1X A;  3GH2 X;  4KNZ A;  1NJC A;  1TSZ A;  1LCB A;  1YPV A;  2ONB A;  2H2Q A;  3N5G A;  1VZA A;  1BQ2 A;  1HW4 A;  1TSL A;  1F4G A;  3V8H A;  2AAZ A;  3CLB A;  3IHI A;  1F4F A;  1TSD A;  4EIN A;  1LCE A;  4IRR A;  2FTN A;  3QGT A;  1F4B A;  1KZJ A;  2VET A;  2G8X A;  2FTQ A;  4O1U A;  4UP1 A;  1FWM A;  1AIQ A;  3UM6 A;  3HBB A;  1JTQ A;  4H0U A;  1TDB A;  4E28 A;  1LCA A;  1JUT A;  1TIS A;  1KCE A;  1HW3 A;  3IK1 A;  5H38 A;  1TDU A;  3B5B A;  4G2O X;  4ISW A;  3BHL A;  3IK0 A;  4GEV A;  1TYS A;  1BO8 A;  2OIP A;  4IQQ A;  4FGT A;  1BID A;  2G89 A;  1NJA A;  1J3K C;  1F28 A;  2TDM A;  1KZI A;  4GD7 A;  1B02 A;  2TDD A;  2A9W A;  4XSD A;  1TVU A;  3KJR A;  3QG2 A;  3OB7 A;  4DPD A;  1TSV A;  2KCE A;  3IRM A;  1TJS A;  4IQB A;  4DP3 A;  1EV5 A;  1J3I C;  1ZPR A;  3BFI A;  4E5O A;  3UWL B;  1JMH A;  2RD8 B;  4KY8 A;  3C06 A;  2BBQ A;  1BKO A;  4EZ8 A;  4FOG A;  1BO7 A;  3IJZ A;  1BSP A;  1JTU A;  3JSU A;  3GG5 A;  1TLC A;  1JMF A;  1HVY A;  2G86 A;  3EF9 A;  1BJG A;  1TSY A;  3EGY X;  3HJ3 A;  3N5E B;  4FOX A;  4LRR A;  5J7W A;  1AOB A;  3DGA C;  2G8D A;  3UWL A;  2FTO X;  2RD8 A;  4O1X D;  4TMS A;  3DL6 A;  3C0A A;  4F2V A;  1QZF A;  5H39 A;  1RTS A;  3I3R A;  3QJ7 A;  3BYX A;  4FQS A;  1F4C A;  5WRN A;  1TDC A;  1VZC A;  3N5E A;  1AN5 A;  1DDU A;  3EHI X;  3INV A;  3BGX A;  1VZB A;  3EBU A;  1EVF A;  5BY6 A;  2TSC A;  1TSW A;  1B5D A;  1AJM A;  1TSX A;  3EDW X;  1BP6 A;  1BP0 A;  1FFL A;  1TVW A;  3GH0 A;  1JMG A;  1HZW A;  1JUJ A;  3BHR A;  3ED7 A;  1VZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...