3N6XA

Crystal structure of a putative glutathionylspermidine synthase (mfla_0391) from methylobacillus flagellatus kt at 2.35 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
467
structure length
451
Chain Sequence
TKPFDEMFLQDEVIRPIYAEYAAWLQDVPHQQLESKRQEAELLFRRVGITFLIPFDVVPRILSASEWARLSDGAIQRVKALNMFLHDVYHDQEIIKAGIVPSSILANAQYRPEMFGVDVPGGVYAHIAGVDLVRTGENDFYVLEDNLRTPSGVSYMLENRKMMMRLFPELFRRYPVAPVEHYPQVLLNNLRAVAQAGVHEPTVVLLTPGAYNSAYFEHAFIAQQMGIELVEGQDLFVRNNAVYMRTTEGPKRVDVIYRRIDDDFIDPLSFRPDSMLGVPGLLSVYRNGGVTLANAVGTGVADDKDTYIYVPEMIRFYLGEEPILSNVPTYQLSKADDLKYVLDNLAELVVKEVQGMLVGPAASKQELEDFRQRILANPANYIAQPTLALSTCPTLVETGIAPRHVDLRPFVLSGKTVSLVPGALCRVALREGSLVVNSSQGGGTKDTWILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative glutathionylspermidine synthase
publication title Crystal structure of a Putative glutathionylspermidine synthase (Mfla_0391) from METHYLOBACILLUS FLAGELLATUS KT at 2.35 A resolution
rcsb
source organism Methylobacillus flagellatus
molecule tags Ligase
total genus 132
structure length 451
sequence length 467
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14403 CP_ATPgrasp_2 Circularly permuted ATP-grasp type 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.270 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3n6xA03
3.40.50.11290 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3n6xA02
3N6XA
chains in the Genus database with same CATH superfamily
4JEIA 4KJXA 1N32H 2FSVA 3KB8A 1HDRA 1V16B 1W5BA 3MTEA 4J0EA 2VNJA 2ZBDA 4NTZA 2PMKA 4RMHA 1XXHB 1P62B 3UCEA 4RKQA 5DCUA 2OCKA 3GRUA 2F9FA 3HBAA 5IDXA 1W581 1EJ0A 1J8DA 2H7XA 3BB1A 1G18A 4RK0A 2IXGA 3EMKA 3WJAA 1SUSA 3CVWA 4QGAA 2C2XA 3OF2A 3VISA 1ZJYA 1U1DA 1TM5E 3KOUA 5LFAA 1L7VC 3FJYA 1LBTA 4BO3A 2ZSIA 3AFIA 1MG0A 1VECA 3JWIA 4ZEXA 1E1MA 1JX4A 2XE7A 1JB1A 1UBJS 3QX9A 3GVIA 5IT0A 4E1VA 1L8LA 3L41A 2QSYA 3KFXA 1NBWB 4ZKDA 3A1FA 5LXTA 3CUTA 5DLDA 1ODKA 4DIEA 1LSUA 1P9WA 1PE0A 4ZI7F 5TE9A 1Y8CA 1WF6A 1E9DA 3TVYA 4PZAA 5G0WA 3W3AD 4V0NA 3DJYA 1J8YF 3TTYA 4UEOA 5L3VA 1OX4B 1A8PA 3WV4A 2DYKA 3B1JA 3HOUG 3ND8A 4LY9A 3OH8A 2HDOA 1XT6A 5EIBC 3MFIA 1NATA 1AMNA 1OZGA 1WCIB 2P27A 3QZUA 1YTUA 5D1PA 3KJNA 4AG5A 1AKMA 3BWEA 4FFRA 1Y6RA 4PYKA 5H83A 4J94A 3LC0A 3Q7TA 3INTA 1U8ZA 3TLBA 3MHTA 2G71A 3PZRA 1Q0PA 2L0XA 3X1MA 3RTGA 3MR3A 1OWTA 1L1EA 2V6FA 4LCBA 4CTNA 1JSZA 1IBLH 4AXXA 5AW4A 3VHXB 2FWMX 4OO3A 2HW8A 1BGXT 5BYJA 3M3HA 1FXWA 1ZH8A 2C5LA 4PTLA 3W06A 5GJWC 4DR4B 1KYYA 4YJ2B 5F21A 1UDAA 1FJHA 5ANRB 1P7YA 4E12A 4IO0A 3PXGA 1NRXA 3DDNA 2NTJA 5EINA 4HH0A 3ORSA 4D8XA 1XMOH 2C9OA 4QQ8A 4DC0A 2OSVA 3AONB 4ZTBA 3V7FA 1U8AA 1E6EA 2IDJA 1RYZA 1MU0A 1ZM9A 3JYQA 1YASA 3CEAA 3TIIA 2I80A 3JZIA 1WZ2A 2HRRA 3REQB 2CLLB 3U56A 4C9BA 2MWMA 1U8TA 2AG5A 3FPBA 3G2HA 1TFRA 2YX1A 1T25A 3C3DA 3SHTA 1YL6A 2BFBB 3IE0A 5DI3B 1ZLYA 3S5JA 1YL7A 1ZVJA 4CE6A 2JDIA 5KS2A 4JFRA 1P4JA 5TNXA 4QYIB 5HIKA 3VI4B 5D3MA 4JIMA 5KDDA 3W6PA 5C7IO 3D1LA 1KIAA 3JQFC 2BUAA 2ZPUA 3E7WA 4N0QA 3TPZA 3D54D 1O6BA 3ZEAA 5DLPA 2PV7A 2GASA 4KXNA 1Y1RA 4MZXA 4AKIA 4IP0A 2GZDA 2QR3A 3EGDA 4DL5A 2HY7A 3CGWA 4PZPA 4P7BA 4BBSG 1NUAA 4LOAA 2F59A 2FPKA 5JMWA 1N2ZA 4B45A 4AP9A 4IGKA 2K2QB 3ZY4A 5B6PA 4M7RA 3F71A 4YJGA 5GVSA 1O6CA 1TECE 2X5KO 3NHYA 1SHJA 1U7ZA 3I92A 5L6LB 3IOYA 2CW8A 4JLOA 2OAGA 4AMZA 3HYTA 3J7AC 4N12A 5CEFA 1ZA2A 5A9TA 1KFBB 4EECA 1DXOA 8OHMA 1RAEA 3TQSA 3GGDA 4QOSA 2XDQA 3IDAA 3WNVA 1P73A 3HADA 3HP4A 1BFKA 1KQ3A 3AVWA 4A82A 3BN3A 2ZKLA 2XMCA 1KR5A 1YL5A 4G1BA 4FMPA 2ZBGA 2P9ZA 1EZZA 4DDVA 4DUYB 1R12A 2EX1A 4E22A 5T7BA 2X1VA 2JLSA 1TK2A 2JEGA 1QV6A 3QWIA 1PL8A 5KFDA 3CTPA 2F8TA 5CH8A 3X43A 2GN4A 3KEQA 3NAZA 3H8SA 4WT7A 4ZKEA 3CS3A 4A8TA 1PNTA 4IEEA 1DJOA 2PLWA 4OK5A 2W71A 1WY5A 1ZK1A 3DBHA 4LMRA 1NQ5A 3AJAA 1AQLA 3E22B 2E85A 5GINE 1Q21A 1F17A 3ICPA 4X62H 2V45A 2JFPA 3K9BA 4TS9A 3TD6A 2W6MA 2FK8A 1I32A 3EDRA 1PO7A 3RS4A 3UCXA 2Q1XA 2W9XA 1GGHA 3PDIA 4RZXA 1PLLA 3I4MG 5J9FA 4D74A 5C0OE 1ECFA 5EXSA 3IXQA 1XJWA 4U8GA 5GPBA 3NH6A 1H0RA 1J0AA 4I3GA 3B13B 3ODGA 3ROQA 1RNLA 2ECPA 5TDHA 4DV3B 4M9ZA 4ZOBA 3F6YA 2CD9A 3HJAA 2IH4A 1BXRA 1NQOA 1CE8A 4FKBA 3EXHA 2ISSD 3PJFA 3Q5GA 2VPIA 4COOA 2QMZA 4WA7A 4D9IA 1AV7A 3G85A 4XIYA 3BL5A 3G2LA 2OLEA 2CFTA 3HBJA 3KHUA 2PBLA 1UJ2A 4BZPA 4EVQA 3UN1A 5EUCA 3PJRA 4BX9A 2ZYRA 2NMVA 4D92A 2ZYGA 1OV6A 2CYBA 1DJPA 2P2LA 1M1NB 4W4TA 3VSDA 5JNTA 2EKPA 4EY6A 3TWOA 1QFXA 5DN6A 3ETJA 4I3FA 3ITKA 3GIDA 2JGAA 4RLHA 3VO9A 4XUGB 4ZXFA 2HT6A 1RAHA 5AW8A 2WE7A 3HCEA 4ER6A 1F2DA 2X40A 2FW7A 4BVBA 2X4DA 1UK8A 5BQ5A 7REQB 3CINA 4M55A 2O2SA 1GCIA 5C8VA 4L8GA 5IJ0B 3OLWA 2N1MA 2D1SA 1DMRA 3N0RA 3T41A 1QH1A 5FEUA 4RMNA 3U7GA 2EZ8A 3OCCA 2JATA 4P33A 5IH7A 4UUPA 4N3GA 4US2R 2GHRA 5EQFA 2O6HA 2QB5A 4WGGA 5JLAA 3CLRC 4AG3A 3UF0A 5C52B 2A7XA 1RIFA 1XTPA 2AEMA 4Y9RA 3ZHYA 4ZYXA 4A3BG 1GFWA 4ZZ3A 4JT2A 5AP9A 5BW8A 1LI5A 2UU9B 3UT5B 2PL3A 3JQAD 5FI3A 4PQRA 1N32B 2FI1A 3QZ7A 3NTVA 2RJ3A 3BMQB 1I5EA 4EJSC 5BT8A 3DULA 1A9SA 1OXBB 3DF7A 3OU6A 5KU7A 1G59A 2IBTA 1HL7A 2NU7B 2F2TA 1KZGB 2G4VA 3FKSA 2FW6A 2QAGC 4FCCA 3IP5A 1TAUA 5KNLA 3LOUA 3NEYA 4I6GA 1ACLA 5CLHA 5A02A 4MQEA 4NDZA 1L7AA 2GJ8A 1DQYA 3WMFA 4MPDA 4G0QA 2QK4A 3BGVA 1G5QA 3JD4A 3T1VA 4ER7A 3SEFA 5JAHA 3IAUA 1M66A 2CMFA 3Q3CA 2C03A 3VNRA 2X0DA 1WXQA 4FE4A 1YGPA 5CW1A 3BUSA 3X0DA 3DFMA 1E3IA 2WWWA 3O8OA 3V42A 2GBGA 2A9FA 1LVUA 2JKZA 1N48A 2C84A 3E9EA 2Q3EA 3PW0A 2IE8A 1DIRA 2YWBA 4FOSA 2I6GA 3GPBA 4PSCA 3QOXA 2BH9A 3K72B 4LH6A 3BHIA 1B41A 2CV0A 4CV3A 4ED1A 3CF4A 3V5NA 1DC7A 1HY3A 3SBDA 4TQ9A 2Q45A 2I03A 3G9XA 3I6YA 1YJQA 3D5EA 1GCGA 3H5LA 4HQ0A 4QXMA 2QLTA 1ZN2A 5JO9A 5B6IA 4TZ0A 3F6BX 2RBEA 4Z9AA 3LCVB 1OGYA 3UPDA 1JFRA 4U2CA 3P2MA 5ES3A 1P7WA 1SQFA 2IDMA 4YLGA 1PQPA 3MUFA 3GTLA 3VOAA 1RI3A 1LSJA 1IZ7A 1AN0A 4FCTA 4L6IA 2OV8A 3A1SA 1V7PC 1PGPA 5KFRA 1TB4A 3UJPA 2BEUA 3T9EA 1VSVA 1IBLB 2J0QA 3WBKA 4OAOA 1TE2A 1EUDA 2XB2A 2W2KB 3OIFA 1ZJWA 4DMCA 2ORWA 2OGSA 5EEGA 4F7DA 3NKFA 1RXSA 3J7TA 5DWVA 3MRXA 3VH2A 3N28A 3FYDA 4OP2A 1Z16A 3X1XA 3A7EA 1TTQB 5DEOA 3TFQA 1YFLA 1XMOB 4YT8A 5B1IA 2FPMA 4NR0A 3N2IA 4URWR 4ECWA 3R5KA 5JLJA 1MFPA 4W99A 2JGIA 1I4TD 1ORHA 5KFHA 1RM4A 1VIYA 3TLXA 3GNTA 4Z9FA 2X0EA 4IKEA 4X6UA 4B6OA 5FULA 3QFCA 3HB7A 3L06A 4DLTA 2BWJA 1Q17A 5JJLA 1CQXA 4MI3A 4BP9A 3EOZA 3PHJA 5ALKA 3WFZA 3FMPB 3ASVA 1D2GA 1SKUA 1RT9A 2IZ5A 5IKXA 3OWOA 1N2SA 2AZMA 2FSSA 2JK1A 2VJYA 4TKUA 4AJLA 1SCUA 5CVUA 4J0MA 3GILA 2Y4NA 2AYXA 2VWGA 1K7SN 4IFEA 2Y68A 2AX3A 4L57A 4XARA 5LIPA 4XWAA 3IUPA 5C51B 1JALA 2YIDA 1DFIA 3Q8SB 2P4EA 3LF1A 4CFYA 2JW5A 4LMYA 3C4VA 3I2YX 5G40A 3REGA 2WEKA 1U28A 4XR4A 1OBHA 5J47A 3LGXA 1BS2A 3DE5X 5DNUA 4HH4A 4E6EA 4M49A 1UMBB 1B43A 3S6JA 2OHVA 3Q9LA 1U02A 2Z0MA 3HMQA 3UXMA 3AOGA 2W42A 1F51E 2VH2A 4YECA 2CYAA 1H1LA 1DRWA 3VGPA 3DZFA 4CMCA 1UQUA 4P36A 2PSEA 2GTIA 2G09A 3CH7A 2I4TA 5SYMA 4PZEA 3ASUA 3DV0B 5K8LA 2IYFA 1SOVA 3T12A 5HF9A 3VKVA 2C7VA 4RXTA 1YNOA 3TFWA 2PPVA 4ME6A 1QC5B 3HB1A 1FS4A 2UVRA 3NHBA 3WQBA 4XDGA 3REFA 3K0FB 3VR0A 4EY5A 4B3IA 4G67A 5AI0A 5FT9A 3D6FA 1WEKA 4LF7H 3AJEA 4EO4A 4B3RH 3HXLA 4EDFA 4X7BA 1BFUA 4YR2A 3RVMA 2NSHA 4DT1A 2OKCA 1QDLB 3OTWA 1EE2A 2ZRFA 5EIFA 1ML3A 2O3TA 2VRNA 3J81W 4XPZA 3UPUA 2C4WA 3ZDFA 3A4LA 3GZNA 4YR9A 1VOTA 3W5HA 1JZTA 4I1SA 5K0EA 4JP2A 1A95A 1L8OA 3KTAB 3G7NA 4LTDA 3JRWA 1OXSC 3C15C 2FDRA 4FTWA 5LLTA 4ZC8A 1EGQA 1RWVA 3AUXA 3BAAA 1B00A 3KJHA 4CLRB 1DL5A 4Q34A 4X62B 3HGTA 1R16A 4KJZA 1KE2A 1A5SB 3WA6A 4YIKA 2Q6LA 1GG9A 3GEGA 2XW6A 4RQTA 4YRCA 3T95A 4ID9A 4IZIA 2QN9A 3D4PA 3ZWVA 4DL2A 2GN1A 4XM2A 3MBOA 3WHKA 4H2DA 1F4PA 3B9RA 1IY9A 1S89A 2IEYA 5IANA 4DA8A 3AMVA 3ZZ0A 3HB0A 1PIWA 4TTPA 4UXIA 3CF0A 2XTMA 2VDJA 4XDZA 1A9PA 2KSQA 4FW8A 1QHXA 3A06A 2R8IA 3L5OA 1PZNA 1XUOA 1DELA 2H1IA 3CLHA 4L9RA 4URHA 4C01A 5SY6A 2P4SA 3BBLA 2JZOA 2GHIA 5I3ZA 2OTCA 2OCBA 2GETA 4G8BA 2GVNA 3KR0A 2VS1A 1XMPA 1AQNA 3M6AA 1TJNA 1E6LA 3JAKB 1SG0A 3JASA 3F4KA 4XFKA 5K0LA 2ZB2A 1EP1B 3MMSA 4R8UA 3OPMA 1WULS 2R1TB 3VMFA 2R60A 1W1UA 3EAGA 5HXAA 5H82A 4YEDA 1QE5A 4G0MA 4DAOA 3FHCB 4YAJA 2BLNA 3MR6A 4WGFA 1NWHA 1JXLA 3STXA 1L7QA 3UA3A 4FI3C 1Q57A 5I7AA 1W2HA 3N8GA 1B2RA 2BJWA 2J5RA 2W4QA 4OJYA 4UU7A 2V1XA 2QRQA 3TAHA 4W5HA 1GN8A 4L8VA 1X7XA 3H4MA 2IYNA 2QR5A 3TFOA 4C4OA 2CLFB 5EE1A 4DGQA 2N9UA 3TNDA 2V74B 3DUWA 3MUEA 2WW8A 1U5BA 1I2MA 4AY6A 3K70D 4FJ2A 4D6YA 1PQYA 3DQQA 1ZD3A 3MK31 2OMEA 2RONA 1NQTA 7AT1A 2I67A 5HNKA 3UK1A 2C2WA 1YUMA 4Q4JB 1JZQA 2WAQE 5DK6A 2QRUA 4HEJA 1Z33A 1J09A 1I3CA 3RRMA 4YRSA 5C5DA 2PO7A 4EX7A 4CM5A 4CLDA 3WRXC 1PR5A 3G7SA 1SBHA 4RXMA 5EJFA 1LJ8A 5AK0A 4BASA 3R5HA 4LWOA 2H5IA 5E6SA 1GGEA 3ZLJA 3OQOA 2HRDA 4F2GA 4LHVA 1QANA 3R0XA 4L9SA 4MW9A 1KEVA 1H9CA 2R87A 1V1RB 1W36C 4FGKA 3VC1A 1GUFA 2O23A 1KP9A 4J3FA 5IC5A 2O20A 6ABPA 1GPKA 3DCYA 1K1QA 2JAOA 1B15A 1D9ZA 4HGQA 2HIGA 2IE0A 4YQEA 1UJ5A 1BMTA 1EQ2A 2EX4A 3IAAA 5HQ3B 3ZNNA 2XNKA 4GI2A 5LUBA 2P3SA 3A8TA 1Z5UA 5TC4A 3NATA 4UTNA 1X7WA 1OZ0A 2BFMA 4GKBA 2ADFA 2RHDA 4GZ5A 2NLOA 5ALZA 1YCHA 2PQ6A 2QUAA 3HNOA 3TO5A 4AYWA 3AUSA 1Y9AA 4BUCA 3QA9A 4BYGA 2VPQA 3L7AA 4G65A 4NEQA 3MB5A 1D2RA 3TL2A 5IVPA 5KFOA 3DMFA 2PGAA 2O8EA 4TL6A 2H4YA 2E89A 1CUIA 5GWXA 1X86B 2XE4A 5AK5A 4LDRA 5DIFA 4HVLA 4Q4CA 4Q5IA 1N78A 3IAEA 3Q5EA 3CWZA 2BMJA 1UOOA 2HMWA 5KT7A 1FK8A 5ELXA 4LRUA 3OZTA 2UZ0A 4PWZA 4D8VA 4J3JA 1J70A 1X7ZB 4K28A 1LV8A 4NENA 4K6KA 3W6OA 3TEFA 1K0UA 3ZOKA 4I4LA 3C24A 4Q39A 3T7AA 3RB4A 4PF1A 1U7WA 4GXQA 3P0IA 2PX8A 2XWSA 4NNJA 2IELA 2Q5CA 3HP7A 1PFYA 3L7NA 3KSDO 3ZDCA 3G6VA 2JLCA 1KDOA 1XMXA 1AMOA 4IV0A 2WIJA 5E6RB 4E15A 3P52A 2CJYA 4PIVA 4FBLA 3NEAA 3L7CA 1D0SA 2XVYA 4A0GA 3VC7A 4U7JA 2AA3A 1TEZA 1Z5OA 1J9GA 3PVSA 4UDNA 2IBSA 3AB7A 1DQRA 1AHIA 3QPAA 4BX2A 3KT8A 3F6SA 3F67A 1IY8A 4TTVA 1XPOA 4R40A 1JFTA 3DZBA 2BD0A 3IN5A 5KQMA 4MGYR 3NBQA 1ZMOA 4IIJB 4BEVA 4EUSA 2JLBA 4IX1A 1A71A 4O08A 1SA0B 2JVKA 4JJIA 1G8HA 3K6JA 5FX2A 3V1TC 3N6RA 2ATXA 3LQ4A 4NI5A 1PCXA 2GBLA 2R4TA 1F8FA 4GZMA 1QGZA 5FB3A 3H4BA 1XNJA 5IEBA 3SMVA 2EQ5A 4UVHA 2PUVA 4ABYA 5T67A 3TGLA 1B2LA 1OAKA 3N2KA 3QBJA 1I7QB 1BDIA 5GP1A 2OBYA 2ZB3A 3CXRA 2DGDA 5L1JA 1IEQA 1T26A 4LSMA 3ZWWA 4RWZA 1ESNA 4QJBA 5FV4A 4F93B 3OX4A 3JATB 4XRGA 1HDYA 4X1KA 2HU7A 3ZIDA 1BMFD 1XYYA 4WKPA 2H29A 1DDIA 1FRQA 4M1TA 4CMJA 3W90A 2WM8A 2E5FA 2HYDA 1NMQA 3Q40A 1Z36A 4K2HA 1E6UA 4XB2A 5LQSA 2FUEA 4GP9A 2HEIA 3WK9A 1D4AA 4YCAA 2ZUEA 1GLGA 4H4EA 4H0FA 2O8FA 5COQA 3IRUA 1Q14A 1PK7A 3Q8XB 2Q1UA 1A9OA 4L76A 3GG2A 2VJMB 1A2OA 1KZ1A 1Z07A 2H2DA 4KIFA 3C0FB 1NUPA 1AD2A 2P5SA 2VQ6A 2IP2A 1KMIY 3FCXA 1Z08A 1NJSA 4WN3A 2C9YA 1R64A 2V9PA 1JIKA 2WSSD 4LF7B 2F7SA 5GONA 3MEQA 4B3RB 4K2AA 3VVMA 3VVLA 1TTHA 1KERA 2J9RA 1ZNYA 3TXXA 1TAGA 1WUYA 1NI3A 3LBYA 2VXOA 3HPRA 1GP2A 4ZAXA 5DHFA 5AWFC 1KEKA 2OCLA 1JEJA 1OFGA 5H5JA 2P30A 4JJ4A 5F5XA 2ROQA 1TD1A 1NR7A 1OKKD 4C04A 2C20A 4WOPA 1WAMA 4NCHA 2J3JA 1GRVA 4GEGA 1JG7A 2IBMA 2O7RA 1YHNA 2XMQA 4PYQA 1QZZA 1TWCA 3CVJA 2Q2UA 4YUXA 4E1AA 3IMGA 1K8YB 1ZNXA 1N7GA 3ISJA 4DSUA 3V4OA 3C97A 1VJRA 5F77A 3GUYA 4X6XA 2ZYIA 4A2QA 4BNXA 1I1HA 1W4ZA 4FIDA 4GZ6A 3RVRA 3V2GA 3LHSA 4N40A 4HOYA 2WJVA 4F8EA 1YC2A 4MA5A 1WABA 4WW0A 3FN4A 4D9MA 1UNNC 4I1RA 2Q21A 4MQ4A 5DYIA 3Q15C 2WTEA 2CHGA 1TLFA 5ALPA 3TOVA 4ZZIA 3PG5A 3UIEA 2WWVD 3WB1A 2I91A 2WTMA 1ZBDA 3FOWA 5CT8A 4RQBA 4C88A 3R40A 3DMNA 1OYYA 4ZT3A 1SBQA 1VIMA 2VP5A 5CT5A 1W30A 4OLHA 1Z8DA 3I3OA 2QTCA 3O3MB 5D3ZA 1SJ9A 5ARCA 2ZR8A 2ZS7A 2JLQA 4FGSA 1WHSA 1MR3F 1YQQA 4BQSA 3IQDB 4OSEA 2GILA 1XEWY 1Z4OA 3U60B 3W5IA 3IP3A 2OBLA 1E3QA 4JOSA 2DHQA 4DIUA 2W9CA 4YUYA 4UASA 4ZT7A 2JCGA 1U7HA 4KYIB 3VUFA 1PSZA 3FZGA 1EXVA 1RWXA 1G2PA 2IOQA 1KMQA 5BR8H 1HE4A 5YASA 5TPZD 3FLEA 4K86A 5FA5A 4N1AA 1A8QA 2BZGA 1VLMA 3IYLW 1V43A 1ENYA 4R83A 2VJKA 1XSEA 3E2MA 3QBDA 1SU8A 2QRVB 4AJPA 2GPAA 3K92A 1V9CA 5KWJA 3AM5A 3QPUA 3AL0C 4FYKA 2J3QA 3LKZA 3U49A 4YQZA 3MAAC 1IONA 2XCQA 3I9KA 1V48A 3R24A 3FVRA 1FUUA 3KIPA 5ILGA 2V0CA 4DHWA 3GLKA 4GDFA 3C3YA 2VWHA 1U31A 2HOQA 4NJMA 1R5OA 1V8DA 4F5DA 5EAIA 1Z5GA 1BW9A 3BAZA 3G2MA 1R6BX 4QUJA 3PT5A 3ESCA 3KJXA 5L4SA 4WE3A 1RXCA 2X6TA 4HB4A 4LDPA 4F72A 2LCIA 2X42A 2QV0A 4DLUA 2HF7A 3EVBA 4YRNA 1X38A 2W22A 1OU4A 3K0AA 5JS7A 2WM3A 3B78A 4LJYA 4C0LA 3DE0X 2GZMA 4QTUB 5KX5B 5AJHA 1K97A 1SHUX 4I55A 4F84A 2DPGA 3LYHA 3K5HA 1ML4A 2XTAA 4IDFA 2ZVDA 3QEKA 1RMYA 1K66A 1E9AA 3WGMA 2PXCA 1UBHS 2FK7A 3HABA 4PRKA 2X0JA 3RSHA 3CEMA 5FPQA 5CIQA 2WNSA 5BNFA 3EF3A 1U94A 2VUMA 3ZWQA 4JI0H 5J4KA 3O8LA 1QH8B 1T6NA 1T5SA 1XQYA 4QPZA 2WTBA 2AC2A 3CE9A 4FR0A 2ABWA 3SYNA 2YFYA 5JHGB 3SZLA 1K7XB 4BFSA 3ASYA 4RDCA 2R0QC 1QK3A 4PRLA 3B8HA 1U7XA 1C4KA 4TMFA 2M32A 1KO5A 3HK2A 3CFYA 4GX0A 4R2MA 2OWEA 3RGGA 3ELBA 1D4FA 3ZHCA 4Q1EA 5IYCG 2A1TR 4B74A 5DBIA 2PUBA 4JNKA 2G1JA 3FTNA 2EFYA 2NZJA 5DGXA 4KWEA 3QU7A 4XPIB 3SIPA 1TW3A 2WJPA 4D3ZA 4ABTA 3SDSA 3BSYA 1HQDA 1X8LA 1FB5A 4N41A 1IBCA 5LMZA 1JG3A 2J3KA 3D4NA 4KQ1A 4EUNA 2KBFA 1AS0A 4PICA 1D7AA 3A37A 3UNXA 2AH5A 4BJ6A 1ZSVA 5IJZA 1PFVA 4WK6A 1N2CE 5DO9A 3WLQA 1M33A 2A2ZA 4MR9A 3GLVA 3I30X 2OFPA 4Y6RA 1KSGA 3M5CA 4HDCA 3GIMA 1FSFA 3X1DA 1I7SB 2W11A 1COWA 3GN1A 4GMGA 2F3RA 1Y9ZA 3LBNA 2PHZA 4GS5A 3WJ7A 1KH2A 4UMFA 1Z75A 2GD6A 2OZLB 2QN1A 1CIVA 2Y2VA 1U0JA 3U4HA 3COZA 1UP7A 2XCUA 4HUJA 1RWPA 3F49S 3FYUB 1P7PA 1S9HA 5ILQA 1P2FA 2O8DB 2OPBA 3LC1O 4RJKA 3FCYA 1C8BA 3AU8A 3RTBA 2P11A 3UK0A 3CNNA 4WY2A 1P0MA 1GQYA 1ODFA 3R3WA 2VLBA 1DKNA 1D9XA 2ZJTA 4JQYA 1OD6A 4Y0AA 1Y1SA 3WGIA 4O2AA 4F06A 1FPMA 1T4MA 5IUJC 4IIEA 2Y27A 3SE0A 2OAP1 4FI3F 1ABBA 2W7OA 1XWWA 5T14A 5CLQA 2J3EA 4Q3OA 4I7EA 1UPXA 1SGWA 5AI6A 2FP4B 3VR2A 1AU9A 4MAAA 3IV7A 3E35A 1RKBA 1DQPA 2DIKA 3AIKA 3OQJA 2J32A 2HBYA 4D0RA 2PH1A 2O2IA 3MTJA 3S2SA 5LOVA 1JKXA 2NV0A 1H0HA 4JSYA 4TTSA 2QGZA 3R0IA 4KQIA 4Q3CA 4DTCA 2PUAA 2GRJA 3MJFA 4GXRA 3A9RA 2O2XA 3ETLA 3ICWA 2A8YA 1HQKA 5KNBA 5SYNA 2R751 5ALLA 3H6GA 4ZAVA 2NV2B 2VK2A 3LUDA 5LYJF 2WE8A 1HBJA 2XGMA 3KHLA 1D2EA 4XVQA 4ML3A 3W5DA 3WSWA 4J9QA 3KLMX 2Y93A 2YIVX 3K3PA 2IPNA 3GAAA 1DPFA 2VHUA 3INNA 1O5TA 1G38A 1J7KA 1WZNA 4Q9IA 3D8RA 4UAVA 1E3DA 2GSWA 2DOKA 3JQDA 1N57A 4C5AA 3OLZA 1Z38A 2XKAA 4TM7A 3L4BA 1G2IA 3U19A 2AOWA 1S2LA 1V5EA 2FPIB 1LW7A 1SXJD 1T3ZA 4DMLA 1YOVA 4CLEA 1SQSA 4Q6BA 5BOSB 4EG0A 4RTMA 2H2FA 2AUNA 5C5EA 3CONA 1L4UA 3DS8A 5J4VA 1MV8A 1O08A 1EX1A 3PC8C 3JWEA 3OT5A 4XEUA 3U0BA 4J07A 2IYEA 2QUBA 5EIHA 4HDKB 2DPMA 4XWTA 4JELA 3KWMA 3QPDA 4JT9A 1IM5A 1OPXA 3GD5A 2FZLA 1V6CA 1NVKA 1RXWA 5C5IA 2EJCA 1I6WA 3NYQA 5EOVA 1J5PA 1S2IA 1GZDA 1U4SA 1ILEA 1K6EA 3GPCA 1TZMA 5L7YA 4GBGA 4Q05A 3WLIA 4XR9A 5EVCA 2CBGA 1XJ0A 3PGLA 3WIBA 1C3OB 4HVAA 1LS1A 1OH8A 5T8KA 1UBEA 1W4BA 3WYDA 1R4ZA 1Y4SA 1DXYA 4AJKA 1Z2EA 2NVWA 3YASA 5LC1A 3UJDA 1ID8A 3NFRA 3DTVD 4A6EA 4MKGA 4X3CA 2QTHA 3CX4A 4KAAA 4JB2A 4PFKA 3OHMA 4IICA 2H8KA 3OUTA 4YP7A 5EFZA 2FMXA 2ZJ1A 3EOAI 1GGNA 4DA4A 2NP7A 1KI3A 1WPRA 1Y81A 3GQVA 5F64A 4X61A 2RH8A 4BVEA 2OO3A 4J0IA 1GN9A 3OCUA 1GQSA 1R4MB 2D2VA 2GD0A 2ZCJA 1H8ED 4WZBB 4EKNB 1SCQA 1CF9A 4WL0A 3M6WA 4HUTA 1J22A 2ES4A 2PS3A 4XLZA 4C43A 3CC8A 2GZSA 5CLLA 2F3QA 2UYQA 2YJ6A 1H23A 4C7JA 5HZMA 3JTMA 4LC1A 2XDYA 2KQUA 2YS7A 3CA8A 1FRZA 4QEDA 2EF1A 2A9VA 2JCBA 5EIAA 3OG9A 1G8GA 1JMKC 4AWAA 1XLTA 1P80A 4Z1MD 3HKEB 1U3WA 3TAXA 1RVDA 3CG4A 4IVNA 2CNWD 1WHTA 1J5EH 2CHFA 3CZMA 2IXAA 3DV2A 1U6IA 3PN1A 3OSPA 3SSNA 2OORA 4CEJB 3T5DA 5FDFA 1UMCA 2WM9B 1SKAA 5HJ5A 5JDIA 1N2CA 1HGXA 1UBNA 5L9XA 5AI5A 2OAEA 4G9EA 2FWRA 1MZBA 4JJAA 4HAOA 3PTLA 4WLNA 1JSCA 3WMRA 4DCCA 1NYTA 3RV3A 3LLSA 5BR8B 2HA6A 3E9ZA 4DNXA 2NPFA 4DMKA 1J2RA 2C3YA 1KO8A 3HJTA 5BR1A 3GHHA 3VKUA 4WBNA 4EFMA 3EGIA 3FB1A 4F45A 5AJWA 4X9XA 4DE5A 2PFSA 3V6MA 5L7TA 2HHHH 3IMEA 3LG2A 4W9RA 4YIHA 2QD3A 3PCTA 1LPPA 2QRJA 4MLDA 1DBPA 5HUHA 3ZEIA 5B3JC 2R97A 3VPSA 2W9AA 2P67A 2VHYA 3D0RA 4I50F 1R4NB 3M5WA 5KB3A 3CRNA 3BSWA 4C21A 1E59A 3EVDA 1DKOA 2JNWA 3U7IA 4I1IA 3NJ4A 3FPLA 1ORVA 4EENA 3FNHA 1TTPB 4X1IA 4RJLA 3FI9A 5HDBB 1N3YA 4KN8A 4QQNA 1DGSA 3ZE8A 1Z82A 2QD4A 3SLKA 2CDAA 2X13A 1XA4A 2CHEA 2WIFA 4ER3A 5HJ7A 3MJ4A 2A3RA 1ZQ1A 1WDMA 2D5AA 2JGKA 5I4CA 2HBQA 2HQRA 3SIWA 1O96A 1TM4E 1KGSA 1E7WA 2FMTA 2PTGA 1E8MA 1E0KA 2BC9A 1EESA 4JT8A 1NXVA 5ENZA 3SVZA 1D6MA 1TAQA 3NZEA 1REQA 1K2WA 3Q3EA 4A3LG 1PS8A 4JI0B 1KYXA 3DOFA 5H80A 3M6VA 4W5NA 2QR2A 4ARZB 3LLMA 4RK1A 2GJ9A 1N9GA 4KR9A 1TU4A 5D6NA 4HJRA 2QUJA 1XJCA 3FTDA 4OKSA 2XXAB 4V3CA 3FOFC 1HNZH 1I1NA 3OLXA 1ZR4A 1QDEA 1F4LA 3VUEA 3JXEA 1NC1A 3UWOA 3AF3A 4D4KA 2IUTA 3ONVA 5C31A 1V41E 1E89A 3B38A 1XCPA 4QHSA 1UFVA 5EHNA 4DXHA 4TLBA 3RUIA 4RKWA 2R5WA 5JC1A 3NOOA 1NW4A 3F78A 3V7WA 4E11A 2J7KA 1UAAA 4I46A 1JJFA 3HUDA 3OFJA 2XYPA 4DREA 4MMZB 1DIHA 3S2EA 3PRHA 3PPYA 1SVNA 4ZO8A 5AKLA 1M6YA 3MTDA 3FMGA 5C37A 2YN4A 5CBPB 2VAMA 1WP4A 2N1BA 4ZV4A 2UKDA 3QU4A 2ODAA 4WTOA 2KLBA 1Z2NX 3MFHA 2REOA 1EVEA 3N7UA 4RVGA 2RGDA 3QYFA 1K3TA 3BULA 5JALA 1VDMA 3ZNPA 3OT1B 4RDXA 1T6ZA 1Q0QA 5EKUA 2VTDA 4GQAA 3QJYA 4Q3KA 4L8YA 4KDRA 3TDMA 4OFWA 4U7GA 3AEKA 3TIFA 5MN4A 3OZGA 1AGNA 2P6PA 4WNAB 1YJCA 3AEUB 1JG2A 2HA3A 2YV2A 4PHHA 1CUUA 2R92A 3P45A 1L5OA 1GL6A 2TMKA 4WCFA 1YRLA 3BYZA 3NVDA 4F60A 4ZJPA 2HMVA 2WD9A 4LZZA 5GOTA 4BZQA 4RX1A 3MGKA 4KLAA 4Y1RA 1UJNA 1RAAA 3NHRA 1DKRA 2P2NA 2PKRA 1MV5A 3UJ6A 1I6KA 2P69A 2I62A 3VJRA 4WCDA 3THXA 4FPXA 4IRMA 4MI6A 2VUTA 4B44A 2DX7A 1OXTA 3W2TA 3GLHE 3B1XA 2XKBA 4CMEA 2L2QA 4GR9A 2O5EA 1R0WA 3ZCTA 2MU1A 1AJEA 1USUA 3PPWA 2VT7A 4U7PB 3QITA 1V47A 1XHEA 1E8DA 5GJVC 1OI3A 1VG1A 1GZ7A 1O94D 1EX6A 5K0NA 5LA6A 1ZRMA 2ZIAA 2JJMA 4CDGA 1WSCA 2R00C 4NAUA 5EZ5A 2ZRGA 3TRIA 4MK4A 1UXIA 1EXDA 1C7RA 5F7XA 1P9LA 5F5LA 4Q6WA 3COJA 4NYJQ 3EPHA 5I9LA 2G08A 3U09A 3O0TA 1HKUA 4V0SA 3SF0A 1YE8A 2EGUA 1PDWA 2IOFA 4OXXA 2FX3A 4JH0A 1UMDA 4RCZA 1Y5LA 4R3UC 3KM0A 2Z1NA 5IJAA 3QU2A 1G8KA 1M6EX 3BJIC 2PUHA 1T5BA 3OIWA 3W5UA 5FBKA 5KC9A 4FFNA 5DNYB 2G9ZA 1DEAA 4ZP1A 1DKMA 1P1JA 1OBOA 2QJOA 2YXLA 4F9GA 1XTJA 4WFJA 4P3OA 2VKTA 3L4JA 3TIXB 1ZCJA 3THWB 2C3MA 3DQZA 4G97A 1ISRA 1HDEA 4RK5A 1CUEA 4Z3OA 4BN0A 1NFQA 4UNRA 1H9AA 1KO4A 4QLBA 4GI5A 5KKNB 5TQ0A 3BA8A 5I7UA 2X8JA 4YV1A 2AQ4A 3RWBA 3LDUA 1G6HA 1EFRA 2AZ4A 5LR6A 2A5FA 4DL4A 3AV3A 4N18A 3RU7A 4URYR 3UUGA 2WRZA 3BWXA 4EHLA 3U4GA 3UMRA 4F4JA 4ASUD 3M4XA 5F78A 4F9TA 4MUIA 4FHEA 3ETNA 5SZHB 1VP9A 3BRWA 5T4BA 2PGOA 2O0LA 4NAVA 1DIGA 2QTNA 2Z57A 1DEOA 3OURA 3AO0B 1YS2X 1V7QA 5KNDA 3KRTA 3RU3A 3ZHSA 2WYIA 1H3EA 4L3WA 3BJYA 1T5IA 3FXAA 1RYSA 3I42A 1DX6A 3ZPXA 3ZX4A 5EWLB 3SHFA 1L3IA 2G6BA 4KXMA 4ZU1X 3PF8A 1D09A 2DQ4A 1GRNA 2E7ZA 4AUMA 1X1EA 2W5UA 5E4TA 1G0OA 3EEQA 3FPAA 3AR5A 3EXAA 3D3QA 2IHBA 1LC0A 2FWAA 5EGNA 1JMVA 3RSGA 3OEWA 2IU6A 3TUZC 4G1VA 5BVGB 5G02A 2CSUA 4N7BA 4QUAA 4Q9DA 1GTZA 3OCYA 3QBTA 3AFHA 1SC6A 4TT3D 3QEMB 4OB8A 1FJXA 2D1FA 3DLCA 1IOLA 3R8FA 1PG2A 3E3NA 4KWHA 4BIIA 4CJXA 1J5EB 1MAHA 1S0UA 2EL7A 4N8DA 4F6RB 5BN3B 1CBUA 3HU1A 4FGLA 4HC4A 3H5OA 3ZE9A 4DLLA 1E5LA 1H6AA 1JUDA 4KQXA 1ZISA 5J2TA 2Q9BA 5AM1A 4GR5A 1BFDA 4OHKA 5CVEA 2BI7A 5FUXA 4U8HA 3TZBA 2AGQA 1SXHA 1A4IA 3H3VH 2XNDA 2E48A 3SKXA 1KZ7B 1TM2A 1XPUA 4NBRA 3TSZA 1L1FA 3N2ZB 4A2AA 4I36A 1E3JA 3QYAA 5CX4A 4WJKB 1WDTA 2YV5A 1E96A 2I2WA 1ISPA 3CF6R 2HHHB 3WS7A 1LEHA 5KYXB 3IAM1 3C6XA 2XQGA 1LLUA 4PG7A 4PXSA 1PJZA 4I2NA 4FOLA 3C1TA 5L3SB 4EJSB 2IUFA 3LY8A 5EZ6B 1IEVA 1SCJA 4YRRA 3KOXA 1S0MA 3W5CA 2EFJA 1W4CA 3ZLVA 4J9VA 3HKDB 5HRCA 5DOVA 2G36A 2O57A 1VXRA 3LP6A 3ESDA 4ATNA 1KEPA 1EB8A 3OZDA 4QPNA 1TF5A 2QAGB 1EEHA 3WWCA 1R9MA 2VSOA 5KHLB 5IHPA 1K63A 5CXSA 4PO8A 5IN5A 2PJDA 4MUEA 5D84A 2FPGA 4KPGA 1ZD9A 3BQ0A 2DUUA 3MWYW 3P9YA 2V6MA 5DTMA 1OHHA 4Z3DA 4DIDA 2DB3A 2WPNA 4NCKA 5HUQA 1GZVA 3B20A 4YRPA 1L7MA 5AW3A 1PR4A 2ZRMA 1TEXA 2GPJA 2B35A 4PEVA 4IIBA 4ZI2A 3GLHA 5THKA 1E6KA 3NYWA 3GA5A 2FPLA 4PLTA 1X9HA 4R51A 5CCBA 3OJOA 3M5DA 1N6RA 1M67A 2IU4A 2C2DA 1EFPB 1B8UA 2XITA 3ZWKA 4ZQHA 1VKZA 4LYYA 3RBEA 1FMTA 4TMYA 4A3DG 2EGGA 5K8CA 4EBFA 3D0KA 2ZBUA 3L6CA 1E0JA 1HNZB 3QI2A 1TC2A 4M1WA 3B89A 1WB9A 2PZGA 3B53X 3DZIA 1NDHA 4LTNA 3AW9A 3CX7A 3IJPA 1NN1A 3P9XA 4HRXA 4BXOB 4GPTA 3AWIA 4IWNA 4W82A 4JBGA 1NHWA 3IXMA 5KTTA 1T2FA 3M9MB 3ZQKA 3TCKA 1E2GA 1VZ2A 2LKCA 3NOXA 1J24A 1WDKA 2XZTA 2GPTA 2ATVA 5DNWA 3U4IA 2V96A 4Q12A 4EW1A 4MUKA 2GKSA 3N0TA 4MR7B 5F2EA 2R6R1 1FLDA 4M6WB 1IATA 3PD1A 1C50A 3ICCA 3PRJA 4CMIA 1Y1VG 3I61A 1E4GT 4DJEC 1D1TA 1NXOA 2FETA 3ECSA 1N92A 2NTNA 1QHEA 1NRIA 2R44A 4P2BA 3EF1A 4ZQBA 4D6PA 1HE1C 2QW0X 5LL6b 1NM5A 1NY5A 1ZY2A 4CKCA 3EEYA 1ULSA 1GGJA 4GPEA 2AVDA 2B37A 3SN6A 4Z0NA 4HQFA 4UMVA 3TQ1A 5F5NA 2V0GA 3DHVA 3GJZA 4BB6A 3I58A 1O54A 3FM9A 3ZBTA 1WE2A 1A7AA 1RQ7A 4KDFA 2YHIA 4WBSA 2FW9A 1Z47A 2YYYA 3F4LA 3VJMA 1KAOA 2RGWA 2DETA 3GU3A 1GUAA 1SIBE 1LK5A 1VGVA 2VNAA 4Z1OA 5JECA 1JYFA 4URXR 3T54A 2CC2A 5C80A 5KFKA 2RHWA 3IQIX 1U11A 1XTSA 4OK3A 4X91A 3T1TA 3G2KA 5EE9A 2ZT5A 4HAIA 3AB8A 2DH6A 1M0TA 1X1SA 1E66A 4PLYA 1PW7A 1GY8A 3KQNA 3G82C 2V55B 3ZU3A 1OGIA 3QG1A 4NFHA 1UXOA 1NVAA 3RK0A 2DECA 2I6SA 4ENRA 4M60A 5F1KA 1DRJA 3W79A 1U3FA 1SUAA 4KSYA 5JXIA 4BJ5A 2ACKA 2QRNA 1TZCA 4IIVA 4ETSA 4K05A 1IMJA 4UTRA 1O75A 1BJRE 1ZNQO 4F4XA 4CI0B 3C3MA 3DVSX 4X7PA 4CL3A 3D8BA 2QX6A 1R50A 4A8JA 5JWRA 3ROGA 2IITA 3IVCA 1N4AA 3ZQUA 5A9SB 2NUPB 4X85A 1IUPA 4LJSA 2XR1A 1MABA 2BBSA 1P4RA 3VU9A 3TIVA 3TPCA 5IPFA 2VHTA 1P7VA 2H8GA 1ECGA 4M7WA 3LUJA 4XW2A 1SPXA 3VDMA 1R15A 1G98A 3HCRA 3TSYA 1BHQ1 1P77A 3NONA 3N8DA 1P1FA 4EF5A 1EFLA 2GB4A 2D3TA 3L0BA 5E3IA 4M98A 4NU8X 2I22A 3SC4A 3EARA 3OTHA 1GCOA 3AVVA 3TMYA 2H63A 5FWAA 2VXBA 1XALA 4LXTA 3G0OA 2G1PA 3DDCA 3D31A 3HXQA 4Q47A 1UC8A 4MUGA 1T6BY 2QX9A 3L5KA 3ESXA 2Q2VA 1C7JA 5IAEA 2YMQA 1X2EA 2DPXA 3ZWOA 3LZDA 3MJRA 1WXXA 4UJ5A 4DNQA 7YASA 2TMDA 5AXCA 4D8TA 4ZYYA 2JJ8A 4IM7A 1LDBA 1ZVMA 4NBNA 2EZ4A 4X24A 2QLNA 4TWBA 3KXKA 4XJTA 1E7MA 4J03A 1C4OA 1TF7A 3FLBA 3ROFA 3BQMB 3DQPA 5GMOA 1GZ4A 1YZTA 5A71A 4N5IX 2W7PA 5KWVA 1PBTA 3TLKA 1UDCA 5TQ2A 4U2DA 5T41A 4EVIA 4ALIA 1QFMA 1AN7A 4GO1A 2X1HA 4E31A 3KSMA 4UCRA 4B2LA 1AO0A 1Z3IX 4Z53A 2O19A 1W5TA 5IFLA 1DWQA 2H0QA 2F1JA 3JVIA 1B0UA 5BNWA 4O5OA 4URZR 1NU8A 3RYCA 4NNOA 4CETA 1MAWA 2OK7A 3E05A 3KKEA 2FUG1 2J7PD 4XUEA 4AS3A 1KKUA 3VSCA 1RI1A 3E7FA 1UKCA 4S1OA 2PLNA 3SI8A 4MV6A 3RUCA 3H6HA 1W5AA 3LIIA 5JO0A 3TZLA 3T5GA 4FWBA 2JAHA 3R1IA 2X7XA 3RAXA 1AUXA 1QVWA 3UAYA 2HREA 5FHQA 3Q8MA 1KAEA 3D7SA 1G55A 5EJAA 4MUMA 4FU0A 3ZI7A 4PNEA 4IHJA 4FX5A 1AHHA 2GHQA 5B1SA 1X3SA 3E7PA 5IW8A 2ZG6A 4PYMA 5IULC 3H05A 2ZKIA 2C83A 4GX5A 4CM8B 1C3XA 3KKMA 1QAOA 3KG2A 1WSWA 3KZNA 3EZLA 4HRYA 1IAQA 3CKLA 3T4EA 4GICA 4GL4A 1OY1A 4MEJA 4BVFA 2JS7A 4GNKA 3DUFB 1P0IA 2B8WA 1QP4A 4BBAA 7ADHA 4IUDS 2EDAA 3DOEA 3A6KA 4KXQA 3O3OB 1LY1A 3M83A 3QXXA 1SVSA 4ZYWA 4D43A 1S0OA 4DC9A 2QXUA 4ZOCA 2QX4A 3AVUA 1QTNA 5AESA 5CPFA 2V65A 2VF4X 3CPSA 1K89A 4F2PA 1RJDA 3OPNA 4UJ3A 4RENA 2EP8A 4Y8VB 4ID3A 1BH2A 3LUCA 1EDDA 1PHPA 4HX9A 2ZXFA 3KE8A 4NWIA 2V7VA 4KCGA 3M9NB 2GNAA 4EWLA 1QHYA 3N8NA 1Q7BA 1O8CA 1MC5A 2J87A 3MTGA 4GMKA 2IYQA 4L4RA 2ZRNA 5MF6A 2PVCA 3SPXA 1XDNA 1KORA 4IAOA 5DN9A 3DOJA 4WLVA 1W36B 3HDVA 2PV0A 2W2QA 5ALQA 1KFKB 2GNPA 3HNPA 4M9SA 3M1YA 4RVFA 2VHZA 3ZN2A 3HHEA 1TU3A 3O8QB 1RJRA 1ZM4A 4RNMA 2PWYA 4PYIA 1RK6A 1NVWQ 5I8WA 1TU0A 4XIGS 3O91A 2CDNA 5GZ3A 2YMPA 5DNDA 3C2QA 4QGSA 4KTTE 2B34A 4MUJA 4TUYA 3B82A 1ZPDA 4MO9A 2Q07A 521PA 4UBIA 2H85A 1OH6A 3JQRA 4Z3KA 2PD3A 5BN4A 1DFHA 3ELDA 4HNGA 1KMHA 2VDKB 3H87A 4WH0A 5JVLA 3JALB 4CKXA 4DPMA 2PLFA 4R8VA 1CUWA 1QBGA 1VKOA 4IHAA 1HYQA 1OLOA 3VYVA 4DNFA 4V0OA 4UTOA 2I7CA 4KMSA 3F97A 1Z0ZA 4OA8A 4C3UA 1DJLA 1Z4IA 2W0SA 1BMDA 1SBZA 2IS6A 3IBYA 5H1YA 4IV8A 1GVNB 5T64A 3EBLA 5F9HA 4HAVA 1WXIA 3OZUA 3WAGA 1K7YA 3F74A 1F3LA 1D07A 2ZK7A 4I5GA 2I4OA 2B0CA 2GAOA 3PO2G 3VR5A 4EEKA 2CLEB 4LJ7A 2QW1A 1TYAE 1O9GA 2W2TA 5KYTA 8ADHA 2JARA 3P2KA 1E9RA 2OO5A 3ABIA 3BFXA 1Z68A 5LZ7A 1TW2A 5KG1A 3A3NA 4K0KH 4ZI7B 4FVTA 1RJWA 4INZA 3C4JA 1K1EA 3Q0IA 2WAQA 4NPHA 4TX1A 4U7DA 4MS1B 1UT5A 5FNVF 1DMSA 2X23A 5E38A 2EP5A 1TQDA 4TXHA 3VNBA 4HJXA 5G0UA 3AYZB 3L82B 1E1CB 1T9GR 1KK0A 3U1VA 4M9UA 1RQGA 5H16A 4MA4A 4AZ3A 5AJZA 4PTYA 4GI7A 4A23A 3G6WA 4BO0A 4B32A 4J0KA 1VPDA 2COUA 4Y6OA 3GZJA 4KI7A 2P5TB 1HRKA 2O06A 1ETUA 3V1YA 4FGUA 1GL7A 1Y4UA 2ODPA 5KT2A 3M34A 2W8KA 1H2FA 3PFKA 3L7OA 3V97A 1KYWA 2VN8A 4P4TA 2HLDA 4P22A 2B5OA 4A03A 3CLUC 2BTQA 2E6KA 2AFHB 1VDZA 5A2QA 3ZS9A 4HVTA 4CIDA 3B6JA 4GPBA 4NBSA 5CA1A 3VA7A 1TRKA 2XOKD 4EG3A 4BB0A 4N3NA 1PFUA 3SIRA 3GJ7A 5BQXA 3FVTA 1IN7A 3T5JA 3R5FA 1QR2A 1YE3A 4HB0A 2P9GA 1CB0A 1ORTA 4L8WB 2UVPB 5LQUA 2SCUA 1OVGA 1PT7A 2AR0A 5F7OA 1SN7A 2O3JA 4PYRA 4D26A 4I50B 1Z34A 1NVXQ 1JVBA 4D44A 1HTTA 1VLVA 3SYTA 1ODIA 5DM70 1H4TA 2BGIA 3UMBA 5K09A 3SC3A 2J0SA 2SHKA 1PWHA 1MA0A 3S27A 5KFWA 3RYIB 2ZUWA 3K6SB 3HR4A 1M34E 4CKWA 2ZREA 3AJRA 4F2DA 1S2GA 3ECAA 2ODQA 1BHO1 4KV9A 2IWHA 4DCJA 4MR8B 5EJ9A 1FNDA 2LNDA 1AK1A 2ONZA 3LP8A 1KIMA 4FBGA 3BMXA 4M3NA 2ZWPA 1JE0A 1HZJA 3T7IA 2I87A 3FD8A 2NSLA 1L5MA 1OXUA 2IUUA 2FZGA 3WMXA 1MO5A 2VFAA 3T0IA 4MDHA 3GZ4A 1DBIA 1TQ8A 4BCCA 4LA4A 1NSFA 1C0KA 2Q0XA 3H5RA 4AI6A 1AV6A 1Q3KA 1EFUA 4RLFA 1P74A 5ISMA 4Q01A 3B2EA 3PIRA 5ESXA 4XCVA 1Y0BA 5KFYA 4IZOA 3T5CA 1QGYA 1NOJA 2AHOA 5DTRA 1VHLA 4G5FA 1ZC4A 4CKEA 2BH2A 1UC4B 5KJFA 3VR6H 2W8LA 2PMZE 3PUHA 3TVTA 3W5SA 1ZUNA 4MW4A 2GK6A 3JWGA 2NZYA 2YNMC 4L0DA 3N0WA 1YR6A 1ODTC 2I7VA 1G7SA 3CLVA 2BR4A 1YRQA 1KSFX 4QKQA 5CUQA 1L7NA 3N44B 4N65A 4TV8F 4JC5A 4CFSA 4IBOA 1E2NA 4JC4A 5EHZA 1ORIA 4FDMA 2PNFA 3BGWA 3P0EA 1XU9A 9LDBA 1YVRA 1V4NA 2GPBA 4INAA 3R3HA 1D1SA 4DLVA 2YFQA 3FSGD 2ZIUB 4LWPA 4CT0A 2AN4A 2Y4OA 5F9FA 5FD8A 4OHMA 4JKYA 1BWPA 3NOVA 4KXWA 4WOCA 5AI8A 4WSOA 4M1KA 3I5YA 3ZDQA 3JQ9A 4HPWA 1UWVA 3R5SA 2Q5JA 5LP6F 1EA5A 4Z4GA 3OC6A 2VAVA 5SY4A 2FPOA 3MXOA 2P2DA 5HVNA 1IZZA 3ETEA 3IX7A 4U3JA 4BBZA 1JBKA 4TWAA 5LQAA 2QZZA 2ISCA 4DLNA 4G07A 4LQDA 3TOCA 4XM0A 2OOKA 2NZ8A 1QHFA 2X9NA 1P1CA 4YROA 3EA0A 2A57A 3EXEA 1PWYE 4W5RA 4Q1BA 5J2UA 3IAM6 1RC0A 2WYUA 5IM5A 1QU2A 3RC2A 3T9CA 5IASA 3LQRA 3P4UA 4GGPA 4RXUA 9LDTA 3GRAA 4HAWA 3KYJB 3MVEA 2PD4A 2C9CA 4FWIB 4QO7A 2PGNA 3A11A 1A7UA 4JASB 2N47A 2GEDA 4ZARA 1C1HA 1SG6A 4R5MA 2RCNA 2RHLA 4B3HA 3MTQA 3F2IA 4IJMA 2B2XA 3DEIA 1MJGA 5DHRA 4RU9A 2DMRA 2PGIA 3IEKA 1ETHA 1N0IA 3NAMA 2QTFA 4WY5A 4V1CI 1FF9A 5HEKA 1D3AA 5F2OA 3AH8A 1XLUA 1M0EA 4MCJA 3ZDEA 1GPUA 1ZGZA 3OZFA 4FC6A 1GQOA 3OQVA 1BVYF 4LV8B 4G86A 4AF6A 4TVBA 3GRZA 1JMYA 4W5TA 1L4KA 3JQBC 5DM4A 2MOKA 2JBAB 4D8UA 3L8DA 3ROZA 2BT4A 2HLHA 4PLGA 1E18A 4B40A 1PJLA 1NASA 4F97A 3BWMA 4J7AA 1ZJ4A 1KWGA 2DFKB 1M76A 4EDHA 1GO2A 2OFWA 3AZPA 2AXNA 4D3SA 4A6PA 1OBCA 4AURA 2NU8A 2AJDA 4FSHA 4BNIA 3R77A 2QPOA 4IG9A 1BSVA 3GG9A 3ZDBA 1TLTA 2WLTA 4I4TA 1SUDA 4QICA 2WZQA 2QTBA 1JHYA 4RPLA 4FE3A 1DO8A 1PQUA 2QDXA 2R86A 2AOXA 4PU0A 3KT6A 2R2AA 3G8YA 3GT7A 5L4LA 1DX9A 1OZAA 2X5JO 1YKGA 3TQHA 1JECA 4NQRA 4K9QA 3RRXA 3T3PB 4MRPA 4YK7A 5J4YA 4UDXX 5AM5A 1HT3A 1B42A 4UFNA 1HG1A 4N03A 3CSDA 4BO2A 2ZUBA 3VR4A 3WE7A 3V1MA 1Y98A 1H8HA 1G6OA 2Y71A 2II6A 4GKVA 1P4AA 3LCCA 4W9NA 4RFLA 3HGMA 4N39A 3UJBA 3PQDA 1CDDA 4FOOA 2VKQA 1JEDA 2HK8A 4CXMA 3H2KA 2BMWA 5K7SA 4KBYA 1F5NA 1X7YB 3DXFA 1Z2OX 3RTAA 4PZ9A 1A9XB 2HGZA 3FFWA 3ZHZA 3NNNA 1E4OA 2CNLA 2PLAA 2B21A 1IJFA 1W2GA 3GV5B 5G4LA 2BGMA 3R3YA 3FVWA 1GU1A 3AFNA 2G4CA 4RIEA 5KNCA 4MLZA 5DHSA 3GJ0A 3TLGB 2X2PA 3JYHA 1E3TA 2ORVA 1D5CA 2MINB 5FXMA 3DWFA 1AC5A 2V7QD 4BTLA 2QE6A 1YIDA 1KNQA 1AM4D 2GFQA 5ALOA 4EQZA 2ZSDA 4NLLA 5ELMA 1O9HA 5F4ZA 5BO5A 3BWBA 1BD3A 2DLDA 3DGFC 3WHIA 2X77A 121PA 1J90A 2QM3A 2Y1KA 1QHSA 4B7UA 2RGXA 2VYNA 4Q48A 5IWAH 1EYZA 3VSAA 1IJBA 4OI2A 2IS4A 1P75A 2AFIE 1RLIA 3OETA 2G8LA 4LHSA 4K0KB 3O47A 4OUDB 5KJEA 1ORRA 3TRHA 3ID6C 1XRNA 2OQ2A 3OE1A 3PUWA 2PMZA 2J3MA 2Y99A 3V6LA 4RH3A 3T7CA 2AOUB 4QSMA 3ICOA 3D6MA 1QCZA 2O8CB 1QTRA 2WB4A 2EZUA 1EVJA 2YRXA 4EI2A 4TVOA 2WAYA 3QNUA 1MN6A 2KI5A 1U0LA 1QORA 4QNMA 1Y4AE 5BN1A 4O4LF 2C5FA 5IWCA 2VF7A 1Y9JA 2ZJ6A 4BJ1A 1ESMA 5BXYA 3L79A 3I04M 3WB9A 4BGEA 2XRFA 2BM8A 1RJ9B 1J0BA 5AIAA 4Q1CA 2QJRA 4RB2C 3QE9Y 3L4KA 1RQ2A 2C2RA 4B6JA 1GILA 4HDNA 3GPLA 2FSIA 5CA0A 4ZO6A 3N2GA 2VP6A 3DVAA 4U7CA 3PE6A 2H4XA 3MR2A 1M1YE 2QM8A 3K7EA 2HWXA 1H5QA 3NPMA 3EAQA 2Z4RA 4X8OA 3EQ6A 4GP6A 1U9IA 5F2KA 5EHQA 3MYRA 1EPUA 5MHTA 1JTVA 4UNIA 5E3HA 3UJCA 3OTOH 4NBKA 1ADYA 1IWPB 1C3JA 4X95A 2CKZB 3HOXG 3BMOA 5B6JA 1HDCA 1PUIA 3KUXA 2VJLA 1MO6A 4Q3LA 4ZA2A 1QHIA 2LDBA 1OC4A 3NW9A 3OZWA 1BX1A 4A0RA 1SUCA 4OHXA 5EE5B 1KJ9A 3BTOA 3DONA 4UBOA 2DPHA 2BF4A 5A5DA 4PV7A 3NJRA 1DC8A 3C41J 1PV2A 4WLOA 4AC9A 5KJCA 2H1HA 5A05A 3SYKA 1KMCA 4UXJA 2XODA 1F6WA 5CIWA 1FOEB 2O4CA 1KVRA 4HCJA 4R98A 3ZZNA 4JIGA 4U00A 4ZPJA 5B55A 1EGMB 2G80A 1W88A 2QEQA 5KFEA 4ZMSA 1P2DA 1RJFA 2BKLA 4Z2AA 2GM3A 3GY0A 3ENQA 1YU6A 4B80A 4NF2A 1M5TA 2Q62A 4GLBA 1ESDA 3C7KA 5HKAA 2PVSA 3GQCA 1YDGA 3QH4A 3VO1A 1NG1A 4B3SH 5JCZA 2FMIA 2HSGA 4V0KA 2FUG6 2R48A 4MKIA 3S2YA 1MDBA 1V8PA 1Z56C 4OPMA 3U9TA 3SZGA 4XCXA 2YTZA 4KN6A 2YXBA 3CB4A 3SNHA 4C30A 3KFVA 4Y9TA 2WOJA 2CFOA 2FWJA 5EPEA 1G41A 3SCZA 4CQMA 3U7QA 3N40P 4JLUA 1C9JA 2H2AA 4H7KA 4YBZA 4K6HA 5JDCA 3G0CA 4M8KA 2CDBA 3AHHA 3LKVA 2ZI4A 2WLSA 4MPTA 3ND9A 1NBHA 5IKOA 4NU6A 1O6FA 2N42A 2YRFA 1OZHA 3RFCA 2EOAA 4O3FA 1VPWA 3MQ2A 4DNPA 1HDGO 3EFOA 4HH3C 4BYMA 2IU0A 5HMLA 2YDXA 4DR3H 4L0CA 1Z22A 4Y67A 1DAMA 3F5MA 4F21A 4GWKA 1PGNA 3GMIA 2BE7A 4YDHB 4QOIA 4BE9A 1JDSA 5U4XA 1HPLA 5KJ1A 3HR7A 2GAFA 2GJ4A 1X7HA 1OOEA 4M8IA 4BC1A 2H2HA 1FDRA 1XP8A 2WUWE 1GPH1 2C5HA 3MUOA 1KZ4A 1BQ3A 3FVQA 2JEOA 3U4DA 4N6GA 3EXIA 1L7RA 1X9IA 1ULUA 4X00A 4R7TA 2ZEJA 4AFNA 3SF8A 2RKOA 3NGMA 1GV1A 1HOTA 4EL0A 5BYAA 3AUJB 4RF4A 3WYBA 1U63A 1HE3A 2P9JA 1MB2A 1XL1A 3T7SA 3HL4A 4PS0A 2XCIA 3R3SA 5JR3A 4JLWA 2HK6A 1MX1A 3O2SB 5JYCA 1SUFA 3QXGA 2HCJB 2XBLA 1O9BA 1A4RA 2DP4E 4MDFA 2AFIA 1JQDA 2JGDA 4DJ5X 4FX2A 2FNAA 2WWFA 5CH3A 3EZFA 2ORIA 1WOYA 1FLVA 3T9DA 1TM3E 1OT3A 1S10A 3WRYA 1KJQA 3GJ8A 4IILA 4JT4A 3VDNB 3HKBA 4JOBA 3EVFA 5SZIA 2QL7A 1DIBA 1HLPA 4DDKA 3Q72A 2ZRKA 1PG5A 2LP4Y 3OSZA 4RY2A 1B0ZA 4YAKB 4MGIR 2QORA 4J4TA 5CFRA 2Q6VA 1NG9A 3KFLA 2ID9A 1KU6A 1L4HA 4CLXA 4LFAH 3PFCA 3A32A 3LQKA 4HFMA 5EESA 1W94A 2ETVA 3EGXA 1CUYA 3AFMA 5C34B 3V8BA 2DFNA 2ZUVA 2R6JA 1WO8A 3E15A 3MCWA 5ER9A 2FWIA 3KSZO 1PYOA 1Y3HA 2OC9A 2Q4DA 1GEEA 4RZ3A 4GOOD 1HFEL 3P5SA 2G25A 4ZDJA 1M1YA 4A2BA 1XQWA 4QPDA 1H42A 4DCGA 4AMUA 2OBFA 1UXHA 4LRYA 1E1RD 3AKDA 5FPKA 1I4DD 4RVHA 5AVYA 4JGGA 2IX3A 2Q4RA 3R0VA 3PGMA 4QC2A 3AY6A 1RXEA 1HDXA 4EB0A 3IPLA 1RM5A 1GIAA 4HDSB 3VNAA 2FF5A 2W4MA 2G5GX 3EISA 5IVHA 1JLRA 1A04A 1EGVB 4OU5A 5CB4F 1FRNA 4GM4A 1ZAYA 4V02A 3ZU6A 5E7MA 5I4IA 2WT4A 2Y77A 3O95A 1O1YA 1S2OA 2BFCA 1Q22A 4ZCPA 1Z26A 4B3MH 4J0HA 4JMLA 1SKQA 1RYFA 3BSSA 2CL6X 3DLHA 1EAMA 8MHTA 4LJ9A 3ZU2A 4BNZA 3QVWA 4IXDA 2LE0A 4I7HA 1B4DA 3LBAA 1JWBB 1AZWA 4RM3A 4OIMA 4NBVA 4LRTB 2JANA 5BR7A 4AUEA 2YUTA 5M04A 4FC7A 4H3SA 3LNTA 5TGTA 16PKA 4HYYA 4RZ2A 3OPYB 1JSRA 2ZB8A 1V4YA 3RQIA 1J1IA 2E82A 2NT3A 5ITZA 1GNRA 1W4RA 5IWAB 3HB5X 2C9MA 1JHRA 4TKMA 3VJKA 1PV1A 5EJ4A 3BXPA 2NG1A 3T61A 1RYMA 2GEBA 5IBQA 1X15A 4X8HA 2CE2X 2QE7A 4JLDA 1DRKA 3DLTA 2VF2A 1RWKA 4YJHB 3U4QA 1DHTA 4TSFA 2QTVA 3QIVA 4PFQA 3ORRA 4UZFA 4QGHA 4A0HA 2VSNA 4YREA 4FSDA 3A2KA 3WV5A 4Q1DA 4D8WA 2NXCA 1ZJZA 3NU1A 5K3SA 1F2UA 5J43A 3NXKA 4NYMR 4PW0A 1JJVA 2R7LA 3IUYA 2CW5A 2IH5A 2VTVA 2L42A 1BGVA 3I6IA 4WJLA 5AFSA 5HUJA 3FNRA 3PENA 1DTWB 3OOYA 4LHZA 3VZQA 4KE8A 1YCDA 4R2JA 2YL2A 1Z0IA 4NESA 3BD9A 2RHMA 1Q3TA 1OBFO 3I6MA 1SUBA 3M6XA 4EZBA 5C7LO 1JLLA 4RETA 3W3ZB 5CFLA 3PNVA 5FLEX 4RDIA 4MW2A 5BQOA 2AV6A 1THZA 2XA9A 2XB8A 4GEKA 4UUOA 3ZYCA 2EFEB 4TMVA 4B73A 1KFEB 3BXEA 3O5AA 1QB8A 4W6QA 2A9JA 3QXHA 3NTUA 3TI7A 3V4ZA 3OTOB 3OJ0A 1G60A 3WLEA 4JUAA 4RA9A 1E2MA 3LU1A 1WTAA 4MV5A 4IJUA 1P1RA 1CQJB 4ECZA 1R6XA 2ZR9A 5BMVF 5FOXA 1KO7A 1A5AB 1II8B 2NO0A 5K0SA 2CWDA 1VIVA 2NTYC 4MAFA 2JI8A 2OFFA 4M7PA 1ESZA 3A4MA 1X80B 4HNUA 5K6AA 2GZRA 2RGAA 3KLPX 1P5JA 4OB7A 1FFGA 1BVHA 2Q5FA 4M36A 2EBUA 3IVXA 2HI0A 1VMEA 4XUDA 2C35B 1P8LA 3DZDA 3QOWA 4YDRA 1FX0A 1I2DA 2QRGA 1ODCA 3I6QA 1J00A 3B52X 2YZ7A 3WLLA 3PNOA 3PPVA 3GTKA 2RC6A 3EC7A 4B3SB 4TRJA 4B0OA 3P2OA 3RVSA 1YHZA 4QDXA 4D3DA 1HM5A 1KHHA 2BCJQ 3DLBA 2BEVB 3WB2A 2AL7A 4GC7A 3JQ7B 1KEEB 2QX7A 3NQ41 2VPYA 4OX9Y 1U0BB 4YRGA 5JCOA 3W2HA 3WLNA 3V4PB 1NBOA 1JAIA 1C9NA 2C9BA 3MS7A 4DTIA 4WESA 3UMMA 2A9QA 5B5SA 1I50A 3MINB 1R1DA 2HU5A 4HI0E 3F73A 1Y7HA 4IJ5A 1U9CA 3VU1A 3NHPA 3G5AA 2P78A 3DAPA 2WKRA 3IRVA 5IZCC 2DHDA 5LB4A 1URPA 4YP3A 3RS9A 3WHPA 3E9NA 3SS7X 3GEIA 4L7VA 4ECEA 3WQQA 1L3BA 3VOSA 3CLRD 4B33A 1LSSA 2EFDB 3N74A 1NVGA 3CMCO 4J0GA 1QQBA 4BX0A 4OP3A 3OE5A 4DR3B 1I0ZA 3Q7RA 2R65A 1Z29A 4YACA 4INPA 4M0DA 4HZGA 4B8WA 5K0GA 2JZCA 2XT0A 1SPBS 2GERA 3KHGA 4NBWA 1LDGA 2QG6A 1GD1O 5CYFA 4DY4A 1FMCA 4Q4HA 3UJ3X 3QK7A 1QIDA 3EFHA 2W9BB 2UXBH 1GQQA 1VL6A 5HW0A 2RDIA 2BHLA 4KR6A 1C30B 1YMUA 3BIWA 1XRPA 4AW9A 3W3AA 2WY2D 2YCHA 1U2EA 4TTJA 1S2DA 4TWZA 4JZYA 1EFVB 1NMYA 4OREX 3QVSA 5AVRA 3HDQA 3IP8A 3ZCSA 1PHRA 4F5EA 1JIVA 3RS3A 3KKNA 2KWIA 2OCYC 3N87A 3P2IA 3B5JA 3H9CA 2YYAA 1MQAA 3QUCA 3RKUA 5EYPB 3PDJA 1Z2CA 4INOA 1XV5A 4CG3A 3GLFB 5FFNA 2CKDA 2ZITA 1N8SA 3KWJA 1C1XA 1CKEA 2H1VA 4RF5A 1B76A 5JWOA 3UENA 5LP6C 4EG1A 2FK3A 4O6VA 1SOMA 3DB2A 3FMVA 4J9UE 1SO8A 4XX0B 1A82A 3PXAA 3QVJA 2I4LA 1SWWA 4PQFA 3AF2A 4ZYTA 4X6LA 3W8NA 1NNUA 2GT1A 3KYCB 1XDWA 2EGHA 2BFFB 1GA6A 2XADA 1VJTA 3ZK8A 1UH5A 5MN6A 1KY3A 2EKQA 3BH6A 3OTQA 4YHHH 2WIKA 1Z4JA 3G3EA 3N3BC 2WSIA 3UGJA 4LFAB 3NKLA 1MQSA 1LPBB 1VHWA 2OENG 2Z8YA 3GZTB 1PD1A 4F4HA 2PMCA 2YINC 2LDXA 2C2GA 1PEYA 1OLSA 1AXEA 1NI4B 5DISB 5M2QA 4OKNA 5GAJA 3OQIB 4LCEA 4C1NA 1MENA 3C3JA 4FNOA 3C8ZA 5G1PA 3BOSA 3WL3A 1C8LA 3OQMA 2NU6A 4L95C 4M38A 1GVHA 1INLA 1XMJA 1FVOA 4RIIA 5AVOA 3PKZA 5A2QW 1S9DA 1RMQA 3OVMA 4MO2A 3HXPA 1C9DB 4L51A 1FFHA 2G5PA 5LN1A 2IGBA 4UHDA 1NI5A 2XLBA 1XEXA 2QUZA 3VM6A 2RHJA 1EG2A 4GNRA 3KJEA 3H3FA 2Z6UA 3PXEA 1S9FA 3GR6A 1UZMA 2Y1EA 4B48A 4P9NA 4TV8B 4B3MB 2WIDA 3GMSA 5JATA 1DIKA 4F56A 1XHFA 1Z5VA 1HZZA 4H17A 1Z6TA 3HBNA 2JIZD 3OKCA 4GLJA 3FWKA 1JHPA 4HXYA 2GM9A 4LPKA 4IWXA 3GJXC 2QJTA 2DR0A 2GBFA 4EP1A 2CJWA 4WBXC 4JYPA 1G3IA 4Y6PA 5FP0A 4P53A 3UAZA 2Z2IA 3GLGB 2D4HA 2H08A 2DBYA 4W7SA 5KBYA 1RYDA 4JP3A 2WD7B 1EGHA 2C4HA 4A1OA 5E2AA 3LQ2A 3HY3A 4MB2A 3DBLA 1AKUA 5F1PA 3VZBA 1G5HA 1O97C 4DPKA 3J80A 5KFLA 1VLHA 1P72A 1NV9A 2B20A 2YWEA 1Z37A 1ZI6A 4KYTA 1XAJA 1WCYA 1IJKA 4G6ZA 1QHNA 1EK5A 3I9MA 2Q49A 1GYPA 1XF1A 3KJGA 1F1JA 2KBEA 1WM1A 2L19A 3BJRA 4INJA 1A1SA 4P32A 5A7FA 2Z3ZA 4DV6H 1VL8A 1PJ8A 2VUUA 2HIMA 1QS0A 4DMHA 4BY9E 3HRIA 4A73A 3K1AA 2XMPA 1W49A 4OMFG 2I3ZA 4UCWA 4C22A 3P1JA 2OD9A 4A36A 4X3OA 1PTJA 2A1UB 4U9UA 4MYSA 2ZJFA 1S96A 1T8WA 2R1VB 4YGYA 1XCJA 2LBPA 1UK7A 1NVBA 4EBDA 4E3WA 3K8QA 2GK4A 1WPQA 1LU9A 1VGRA 4BUJA 2JJYA 1E5QA 2EZTA 1SIOA 1Y7PA 3RU2A 3TAUA 2RGRA 4MV7A 3GJSA 4NMMA 3DMTA 4P92A 1RXVA 4H4CA 3N6VA 1Z6GA 1GAJA 3EF0A 5HM8A 3GLIB 1EWYA 3M0EA 1TPYA 2R25B 4RV4A 5AVJA 3LY5A 1DSSG 3QU9A 4BQRA 3RDPA 5FD6A 2FYTA 2A30A 1KC7A 5LZ9A 5DGAA 4ZHQF 1A7KA 5CFOA 4JEHA 3P0JA 4QTYA 1U4NA 3K94A 3OC0A 3QTTA 4WVLA 4Q24A 2C7OA 4HEA1 3DAHA 1G66A 1JXAA 4DLWA 3JARB 3TLEA 3V8PA 5JT1A 4ANFA 4MEBA 1A5ZA 4MVJI 5FUVA 3R6GA 3SJAA 3OEHA 2IL1A 4L75A 1YI8A 2HVQA 3OM0A 3KT3A 3UK6A 5HP4A 5LYJB 2EAUA 3CNEA 4D9BA 2FLPA 1PSDA 2GAIA 1E4EA 3CHYA 4RY9A 5ENVA 5FAKA 3HWRA 4PCLA 1PFWA 4XWOA 5EMHA 4TV9F 3NTLA 5JAIA 4MWBA 2ZU0C 1DUVG 4OGLA 2FRVA 2HQ1A 1LRKA 1C2TA 3QELA 1XZ8A 3LP5A 1K08A 2P7HA 2GRUA 5H02A 3KL4A 4M1YA 4U7WA 2R8BA 2AG8A 3KAKA 4QBIA 3NUGA 3FDZB 5T4EA 4TZTA 3Q3JB 4I1YA 4FB5A 2C4NA 1JG6A 1KKLA 3VZDA 4WJZA 2HB6A 1TLLA 1ZD5A 2J67A 4ZD6A 4BLSA 3RYFB 4MGEA 4MWEA 5K3DA 5DV9A 4MRMB 3G1TA 4BX8A 3M2TA 3ELYA 3KELA 1IQ0A 3UXEA 3NDRA 4QUGA 4IF4A 1AKQA 4JBHA 4TWJA 2SNIE 1Z4QA 4ZZ1A 3KSRA 4LSGA 5EL0A 2D5BA 4B3FX 2JIMA 3RK4A 3CR3C 3V2UA 4WXRA 3C7CB 3WGVA 1UPUA 4GE0A 3HB4X 2ZUUA 3E84A 2P6MA 2Q2NA 3VHQA 2VTBA 2A92A 4DQXA 2CXUA 1ZHFA 3ABOB 3PPXA 4OQQA 3D3EA 1M6NA 1XZJA 1X8JA 4WA8A 4NARA 1XZKA 3LUAA 4XSGA 4UARA 2UXBB 1RZUA 3W1EA 2WB1E 5LMUH 3MWEB 1F06A 3HJBA 3SDBA 1SHKA 3B2QA 4YRQA 1G17A 4A5OA 4YCBA 3I09A 3WQRA 3CQ9A 2DBZA 5E1OA 4GZLA 5AW1A 4BN5A 2LXNA 1V1MB 2AK2A 1YR9A 4ZVQA 4RESA 5G3ZA 1W36D 1P9OA 4ED9A 1A3CA 4KN9S 3H86A 1CDEA 1CRWG 4LI3X 3CPEA 2H1RA 2W6IA 3NRBA 4ALNA 3BWYA 3IIKA 2BQUA 3H84A 4EYQA 3ONEA 3ESBA 5AW6A 1CY4A 4DNOA 4D4LA 3MGGA 4Y2RA 5C1DA 1Y3DE 3GGJA 5JJCA 2A4MA 1DTEA 1FYWA 3MMNA 4UZSA 2XUOA 4EYHB 3N0XA 4M54A 3U61B 1TWGA 1C1DA 3SKYA 2XRMA 1FNCA 3ON5A 1Y7TA 4Q9AA 3HXMA 4YR0A 3NG1A 4RPIA 5AW7A 2FFBA 3OZ7A 4OHWA 2FH5B 1UBLS 3RTCA 3U4AA 5A0TA 1EIZA 3VHRA 4QO8A 1UKAA 1ZO8A 3L6DA 2DQSA 1XQ9A 3TF5A 3IPXA 5T6BA 4BMYA 1H6DA 1MD9A 2J9ZB 3QOFA 1ORDA 2HQBA 4KIWA 3RYHB 3H42B 5DM0A 2HM7A 2HBRA 3SJCA 4QVGA 1G19A 3I0ZA 1A9TA 1Z4LA 3EYAA 5KG2A 4YHHB 3ZXIA 2VYCA 4ETWA 2WJ4A 2CUTA 1HI9A 2GX6A 2D1RA 3HGQA 2QTRA 3RVPA 1YZUA 2M6KA 2BGWA 4LQLA 4B3CA 1DC6A 5JQGA 1MB0A 2H1WA 3IUJA 1PJRA 5FBHA 1P17A 3HYNA 5LQNA 1QLJA 4BKMA 3RC1A 5EPOA 5D51S 4E2YA 3HCAA 4MTEA 1THTA 4A15A 1UXJA 1XKTA 2J09A 3KEOA 5BV1A 1E3WA 5IEJA 3D8NA 1AUPA 5JSZA 2A33A 4UBKA 1KDTA 5BUQA 3T7JA 1BVUA 3S8EA 3KXIA 4RFVA 1E7YA 4HB3A 3QV1A 3L1UA 3RFXA 4CUKA 2IYWA 1EFDN 4MGHA 4HWTA 2GF9A 3ZWBA 3ZW8A 3G0IA 2R9VA 1UKZA 4UTVA 3AHFA 2GCEA 1U2DA 1Y5RA 3AERB 3DEZA 3OIVA 1RYYA 2GBPA 2O1XA 3TG2A 3M81A 2I71A 1WMEA 1G20B 4NNPA 3BZWA 4IXMA 2E2HA 2ZSHA 5L3QA 4MINA 4A8HA 5CRIA 4UHCA 4RS4A 4PC7A 1XTKA 1LQTA 4N76A 4OLFA 1RI4A 3WNQA 4TXJA 4LVUA 4TWIA 1FSZA 3CVZA 1IPEA 3MLAA 1Y1VA 3ESYA 3SXUB 1KAQA 5KHAA 3NALA 2Y1OA 3CH4B 1B8NA 4ZDWA 1X74A 3F8NA 1IQUA 1AXGA 4JI1H 4O63O 1ZUIA 3ZDRA 4ZVUA 4QPCA 5G41A 1L5HB 2W00A 2E4WA 2VH5R 4PIMA 3W1WA 1EXNA 1M7JA 1EKXA 4F4YA 1OYVA 3R41A 5JH7F 2E87A 3IVMA 3QBVA 2VYVD 4FXPA 1YRWA 1OLUB 3DMGA 1Z0JA 1G42A 3V7YA 3AUTA 1X3LA 4UXHA 4Q3AA 5GQSA 1KAHA 1FFAA 3KKLA 3P27A 5JMTA 1W8DA 2O5RA 2KW5A 2IUYA 4QRDA 4BQPA 2IZZA 2D0DA 1G2QA 1FZTA 5BV0A 2FPUA 4A92A 1G291 1T6XA 2CFIA 4L27A 2H52A 4L74A 2RK4A 3TTXA 4TMXA 2YXDA 1P29A 4DV6B 3HJCA 2J4DA 1L5SA 1H5UA 4J6FA 3PQ8A 2WHPB 2I29A 2PSHA 3FGPA 4DBLE 3VRHA 3BF7A 4P4SB 4B4VA 2REQA 5FA8A 2C0QA 4IDOA 3F3MA 5C44G 1HSZA 3WL8A 1VJ1A 2XA2A 1ZIXA 1PZMA 1J6UA 5EWJB 1ND5A 4JL5A 5EMNA 3BHJA 4LYJA 3IBSA 1FFXA 3K9HA 1QYVA 2HLPA 1MIOA 4YAOA 4QSHA 3AKCA 1CUJA 3LUHA 1G3RA 3MILA 2P41A 1KXJA 3DC7A 5C3UA 2QLBA 2PY6A 2IYUA 2WT8A 4LE1A 4IDAA 5L45A 3MC1A 5HV6A 2JIPA 3GUHA 4G5HA 3T3NA 2AC4A 5EQJB 4B2PA 4DMMA 2DR2A 1BDMA 1IZ9A 1GAWA 4ZEOA 2VA2A 3EWIA 4ZCLA 2VDWA 3CUUA 3BFJA 2HA4A 2ATEA 3L1HA 2R1ZA 1QAMA 1Q74A 4L72A 4BNVA 4I1PA 5EPUA 4LJRA 4FINA 4UCQA 1NYRA 3QFSA 2QMUA 2R6ZA 1LQ2A 1YONA 1PNRA 1N5LA 2IOFK 3IH5A 1ZFNA 1T0UA 3GTGA 1J99A 3LFTA 2JFHA 3GDGA 3IKVA 2FEKA 3X3HA 2MHCA 4E51A 5JNUA 4OHPA 5B2ZA 4W1RA 4HBGA 2VNKA 4O1HA 1ZOIA 3HB9A 1IQPA 2BF7A 4O5AA 4H15A 2WWGA 1NWCA 2E5LH 4F8JA 3RS5A 2PIDA 4EJ6A 4KMRA 4EHNA 3IHTA 1HFKA 3L8GA 4BE4A 2EKZA 3U3OA 4R01A 2IKQA 3STYA 1JGTA 1M8KA 1PL0A 1Q7EA 3C8MA 1XRMA 1CUCA 2P79A 5CB4B 2XUZA 1D6SA 3S44A 3FIJA 3ZDXB 5KG5A 1N5OX 4KYUA 4F1WA 5BSMA 1YBAA 4FOPA 1ESCA 2Y9PB 1XCLA 1PZHA 2ZVPX 4P3NA 1UP4A 2C22A 4X71A 2FN3A 2H4HA 4JI2H 3BB4A 4Z99A 1KJWA 1KRWA 1NJ1A 3ANTA 1KPGA 1W0KA 1OGJA 1XCGB 1AQIA 1KJZA 3AV0B 5F98A 1JQ3A 1TO2E 1S7GA 4YB8B 2BFAA 1LX7A 4KHZA 3VC3A 5HE9A 5CDYA 1U3VA 3PL1A 3TNYA 3NIWA 2AW3A 1UFKA 3QGMA 1J7JA 3I5AA 1VMKA 2G5CA 3P20A 3UMGA 3RIGA 1H3NA 3LQ1A 3JAMA 3E4CA 1YVPA 1ULHA 4L73A 4NYIR 2MTBA 1IRIA 1CR0A 4MYDA 1GRQA 1AXRA 3RD5A 1EHIA 3DOIA 2FKLA 3N2LA 1Y37A 3MJEA 1MLDA 3I12A 1M34A 3PUIA 5KEIA 1CRZA 1HMPA 5LMUB 2F1OA 4RGQA 3LLCA 3WO1A 3UAOA 4RHCA 3PFIA 2H3HA 4GWLA 5FL7D 1I6UA 1CJUC 2JIDA 1BRMA 3FYSA 1AKTA 3WGYA 2W6NA 3G0GA 2ZUTA 3SQWA 2QMYA 2AUTA 4H1VA 2Q3MA 1T91A 1TL7C 3EBOA 4U9HS 5KFTA 3L4SO 2GWHA 2VAWA 4EYOA 3HJGA 5LD2C 2X86A 4RHYA 1UJCA 3TD9A 3COPA 4YMSA 3HYSA 1DG3A 5C1PA 2R7NA 2ILTA 4NDAA 5GZ1A 3AJDA 4MUHA 4A2PA 3PI6A 3KSBC 2RI0A 2ZJBA 4IRUB 4BKRA 2JFXA 3NS7A 4RAOA 4A9AA 4DF3A 3SSOA 2B5VA 4IDEA 3PL5A 2PM8A 4O2BF 2HUNA 5CAEA 1X92A 2ZT7A 2FN4A 4YJFA 4C0SA 1F2TB 1B33N 2R96A 4OBBA 1EM6A 3CEJA 4KLCA 1YE5A 1RHQA 1MAAA 5KQPA 4YV0A 1PR2A 2O2HA 2A1IA 1ODSA 3A1CA 3SZRA 3T9AA 3LWZA 4GH5A 4QXAA 1QQAA 1CLUA 2QY9A 1BCSA 4YO8A 1J56A 4WN9A 3X2SA 1VQ1A 3R3XA 2XCRB 2IZ6A 5BMVB 1ZA1A 2P9BA 1K06A 4GPIB 1QIJA 3UHPA 3CV3A 2R5FA 5A06A 4H08A 4B9EA 2AWNA 1YI1A 2GA8A 3WYEA 3ZLBA 2K7ZA 4CF3A 3I39X 4FDTA 3DL2A 4LNUB 5M5BA 1XO1A 3FCUB 1GUBA 3VH1A 3WLOA 3R7BA 3KQKA 1WDWB 3LL7A 4QBFA 2NVXA 1W35A 4B2YA 5E9WA 4W5JA 3ML1A 5EMLA 1U8EA 4PONA 5DBHX 4QA9A 4GW3A 2RAFA 1XZCA 2Y0BA 1KYTA 4Z0PA 4RANA 5EJEA 1UBMS 1CHNA 2WA2A 4W63A 3L7YA 3DMDA 5L7WA 4J9RA 1L6IA 1WXFA 2XQKA 2RJOA 2WMNB 4MMYB 1T24A 2X5OA 4XWYA 5AHRA 2FQ1A 3BWDD 4P83A 3QWBA 5G4KB 2JLZA 1WUTA 4E08A 3VC2A 3C3AA 1QG6A 1Q7GA 5B37A 2VDRB 2HIAA 1YZLA 4NJEA 1DT5A 4C06A 4ZFNA 4ZAYA 5E4FA 4P93A 1ZIPA 4BAZA 4RA6B 2XJ9A 3GT4A 5K8IA 5KYUB 2VRCD 3M2PA 3C1AA 2DPYA 5K3OA 4BFVA 3NGLA 4GR4A 2HWUA 3L8HA 1A8SA 4Z9YA 4ECUA 3GN2A 4M37A 4C05A 1WCXA 2AJCA 2ZAIA 1R9JA 4E2ZA 4QAQA 2V59A 2OBXA 1QIKA 2HH9A 5BVHB 1BG6A 2E4AA 2QP3A 3DCNA 1YDHA 4JI1B 4UUAA 4FQ7A 1YQUA 2WSSA 2GR9A 4QLOA 1ZINA 1P0FA 1OAOA 1TJPB 1RDFA 5CX1A 1NT4A 3W04A 3HACA 1G4HA 4EYSA 1VLQA 4BWGA 2VPXA 1NLUA 3BMCB 2A5JA 4NEHB 2FAXA 4AZ0B 2FJUA 3HFSA 3EQ9A 1JBQA 3MELA 4CQJA 2CQYA 2YJNA 3EGCA 5HZHA 3FHJA 4UVGA 4MHSA 3AIMA 2C61A 3HXOA 2GZ3A 3CSUA 4OTZA 1U2GC 3L05A 2WUDA 3CH6A 2JAPA 2EW8A 1A9YA 4Z54A 3CVXA 3TDKA 4GRDA 3F46A 4E5KA 5EA2A 4G5XA 5EWGA 5AQ1A 2ZJ8A 1GL9B 5KFGA 1XEWX 3D3WA 3BEDA 4PC2A 3A0UA 4DCMA 3FBGA 3P2YA 1WZEA 4EG6A 4MV9A 2CUZA 2FVYA 3GEPA 4ENSA 4UHJA 4X5OA 2PGJA 2VT3A 2ZYDA 4F91B 1XN1A 4HEA6 4XD7D 4C6TB 2CBZA 4LBZA 4Q4DA 4UOZA 5KVAA 2W8BB 4HNTA 4MLPA 4N9WA 1Y1QA 4IRDA 5P21A 1D6NA 3EUWA 3VTFA