3N6XA

Crystal structure of a putative glutathionylspermidine synthase (mfla_0391) from methylobacillus flagellatus kt at 2.35 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
467
structure length
451
Chain Sequence
TKPFDEMFLQDEVIRPIYAEYAAWLQDVPHQQLESKRQEAELLFRRVGITFLIPFDVVPRILSASEWARLSDGAIQRVKALNMFLHDVYHDQEIIKAGIVPSSILANAQYRPEMFGVDVPGGVYAHIAGVDLVRTGENDFYVLEDNLRTPSGVSYMLENRKMMMRLFPELFRRYPVAPVEHYPQVLLNNLRAVAQAGVHEPTVVLLTPGAYNSAYFEHAFIAQQMGIELVEGQDLFVRNNAVYMRTTEGPKRVDVIYRRIDDDFIDPLSFRPDSMLGVPGLLSVYRNGGVTLANAVGTGVADDKDTYIYVPEMIRFYLGEEPILSNVPTYQLSKADDLKYVLDNLAELVVKEVQGMLVGPAASKQELEDFRQRILANPANYIAQPTLALSTCPTLVETGIAPRHVDLRPFVLSGKTVSLVPGALCRVALREGSLVVNSSQGGGTKDTWILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative glutathionylspermidine synthase
publication title Crystal structure of a Putative glutathionylspermidine synthase (Mfla_0391) from METHYLOBACILLUS FLAGELLATUS KT at 2.35 A resolution
rcsb
source organism Methylobacillus flagellatus
molecule tags Ligase
total genus 132
structure length 451
sequence length 467
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14403 CP_ATPgrasp_2 Circularly permuted ATP-grasp type 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.270 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3n6xA03
3.40.50.11290 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3n6xA02
3N6XA
chains in the Genus database with same CATH superfamily
4LJRA 3B1YA 2JIRA 2PD4A 5B2ZA 4LF8B 3PFIA 5D3KA 1P4RA 1JR3D 2O9JA 4I3HA 3ZDDA 2ZBDA 4WXMA 3U2QA 4KLNA 1Y8RB 3E9QA 4CMCA 2AOVA 2ODBA 3KXDA 1Q7CA 3R7AA 2O06A 2RDJA 2CF5A 5HGJA 2FWMX 3VVMA 2VHVA 4P0PB 1N6RA 4C08A 2C8VA 1QZ3A 3AGPA 1CRQA 3EASA 4FMCB 3VFDA 3BKWA 2IYAA 4ONEA 4QOSA 3P4UA 4ND4A 4S0XA 3THWB 1BWSA 3L4KA 3JVUA 1OWOA 3P9PA 3ZD7A 1UMDA 2GSWA 4M2LA 4RK5A 4BRUA 2C42A 4R0VA 3RWMB 4IRKA 1XZEA 3QIAA 4R2WA 2GFIA 1DX6A 5D1NA 2Q3FA 2ODNA 3UF0A 3VU9B 3HU2A 3DT6A 4Y2SA 5K3FA 1K6XA 3D8RA 4IXTA 4ZDIA 3GA7A 4HZGA 2WVJA 2WD7A 4EHKA 1HLPA 3RWBA 3WIBA 4TMTA 3U7RA 4AKSA 4IGKA 4QBFA 1KKUA 1QJ4A 3U1TA 4TWAA 4HATA 1AG9A 2Y76A 1EFHA 2JFGA 5JAUA 3K1YA 4EECA 3LE8A 3UCFA 4EY6A 2B0JA 2VPYA 2Q6KA 3B9PA 1JG2A 2G9QA 4R1NA 1XLTA 4MV3A 3OCXA 4LF8H 1UBUS 2FP3A 2XMRA 5KHAA 2O05A 5ECDA 3KOXA 2EW1A 1GUYA 3CNNA 4R4JA 5JS8A 1YIAA 4JI6B 3EPLA 5FUQA 2FJPA 2EBWA 3V5NA 4OMCA 3G0BA 3FI0A 3BRSA 1UZAA 1ZIXA 3AM4A 1M66A 4P7KA 2X3FA 2RJNA 4MUXA 1P9RA 3I52A 3I1IA 4F97A 4ZREA 1NJSA 2HNBA 4D8UA 4E5SA 1F5NA 1W73A 3F2IA 1JEQA 4DLWA 2ZLBA 4AC9A 2QMOA 4V2UA 1KYYA 2PGDA 3BMNA 3BMQB 4HGPA 2IOFK 4YRQA 3CNQS 4ZCRA 5TDHA 1FFBA 3L8FA 4NCNA 2CHQA 4LJ5A 2Q7DA 3HXKA 5CX1B 4OHCA 2BGRA 5KTSA 3DG9A 3IUJA 1F7UA 4D82A 2Q2NA 2ZSKA 1X9HA 421PA 1K6IA 5JSZA 2F64A 4QBHA 5C5JA 5BNWA 1DLJA 2Z1NA 2GZ3A 4F7DA 1KMMA 3M6AA 3EIXA 3Q0IA 4BNYA 2D7JA 2GCIA 4REQB 1BH6A 4A3DG 5HQJA 4KOEC 3WGVA 2R8KA 1E0JA 4QATA 2XOKD 2Z5FA 3I72A 1A69A 5LQCA 1JX4A 3UH1A 4BZQA 3IBCA 4DJTA 1F4PA 4IDAA 1ZBDA 1T13A 5HTKA 4PONA 2JEIA 1ZN7A 1JDBC 1LWOA 2P9GA 4NENA 3L7NA 2K6GA 5AUOB 1L5RA 3P2EA 4IDCA 4R71A 4OXIA 2O50A 3B13B 1E1RD 4R8MA 4DGSA 3NC0C 3RRMA 4K9SA 4PNZA 3CQZA 4RHYA 3RV3A 3ZZNA 4ZZ1A 3G2IA 1X14A 4OXXA 4D3DA 4CIBA 3HWWA 2XXAB 4UW9A 2G67A 2YN4A 2V4UA 2W9AA 3C0KA 3O2JA 5FEUA 3GVIA 2OK7A 2O3TA 3BORA 3ZCTA 1OH6A 4BGUA 2HY7A 2XMCA 2J85A 3C45A 3UT0A 5C37A 2F9MA 2B36A 3DL7A 2WM3A 5KNDD 1QCDA 1O89A 2WD8A 3N8DA 2JJ8A 1HE2A 3HSSA 5KAPA 1PWXA 4ENTA 4D99A 3A4MA 2WT8A 3IJ5A 4KSCA 3ZGYA 2AN3A 4US1R 3CRNA 1RLIA 1TGYA 3KFVA 5ICGA 3ZIAA 2F17A 1G3IA 1ESMA 3GZNB 3O93A 5D2CA 3F1LA 4UBKA 4KKXB 3PGJA 4EBFA 3OIFA 1IBLH 4BN5A 5I7OA 1TAEA 1FFDA 2W5UA 3MCTA 1H2YA 3ROMA 2CVZA 4AYBA 1VL8A 5TPWB 4PZ0A 2YHIB 4JFAA 2YFQA 2OILA 1JPJA 4UU0A 4UUBA 1EFPA 4E4TA 4KN5A 2V6FA 1NZDA 4TMZA 3IJRA 3ROTA 1TWGA 5IC6A 4BVEA 4DLBA 2XZTA 2D06A 3OPXA 5K0GA 1JPUA 2VF4X 5FPPA 1Y7TA 4X85A 4ETNA 4RPJA 4C0JA 3B8EA 3L7AA 4IQ0A 1AURA 3BFKA 1PI3A 4H9GA 2ZYDA 2DPYA 5IKPA 4MVJI 1CUJA 2OCPA 4PW0A 4FMCF 1PW7A 1QFMA 1P4HA 3NM5A 4I9UA 1Y98A 1Q1NA 1XPJA 5JAIA 3N59A 1P17A 3PJRA 5EHZA 3FI9A 1U98A 3ZHOA 3FF1A 4RVNA 5K0LA 3A58B 1GEGA 2XB6A 4A2AA 1AVTA 3EARA 3WIVA 1XSEA 2IH4A 4FGJA 4RK7A 2RHMA 2R66A 1J2UA 4P31A 2AZXA 4M3NA 2BE9A 1VMDA 4WQMA 1FUYB 1R8SA 1Y7IA 1JTVA 2FQQA 3ADPA 5JSFA 3MWGA 3ZLUA 1YCGA 4DV0B 1P31A 4CQLB 3TUZC 2JS7A 3JQ6A 2GD1O 1XMVA 4C7VA 1X9GA 3VAYA 2X4DA 3OF3A 2XSZA 5ECYA 2P69A 3E03A 3H2HA 3ONDA 1WH2A 5BW4A 1FFAA 1CRZA 2OYRA 1PYOA 4Z9XA 3KD3A 4TN5A 4CUJA 1KWKA 3ZXSA 1SKBA 1SXGA 1SN7A 4EJSA 4PC7A 1Z4PX 3UOAB 1V43A 2ZIWB 5B1HA 3DFUA 4DLVA 1TCUA 4B7ZA 1FP4B 3KT8A 4IRUB 5A03A 4V1CB 1QZUA 3W5DA 3JASA 3U7FB 2EU8A 4BATA 1XKXA 1WD5A 2C4NA 3V42A 2R00A 2C77A 2YIJA 8LDHA 3DBIA 3IB3A 1UBNA 3GVHA 4MMXB 4OQZA 2NXNA 3TIXB 1RVDA 1EIWA 3ECAA 2J6HA 5L4LA 5LN1A 2F00A 1SCKA 4AU1A 1MAAA 5T7BA 1JYFA 2BFMA 4WD3A 3ZWQA 2J07A 3TZHA 4OAQA 5IHPA 5JHHB 1VIYA 3OT5A 2WWVD 1P7WA 4RENA 4TSFA 1E89A 3DCYA 4OTZA 5FNVA 3VR4D 1W1UA 3C4JA 1OMOA 4RJIA 1JLKA 4DV0H 4V3BA 4HEA1 3ZCPA 5A5VA 1JR6A 1XCGB 3JVVA 5G1NA 5H80A 2ASDA 2XKJE 4J6FA 5JNRA 3W1WA 4ZI2A 3GLFB 2WBLC 3N58A 1YUMA 3H0EA 4RUKA 3CWCA 2IDMA 1XKTA 4TTSA 1PGOA 1T4CA 3TCNA 2V7WA 2A1UB 4I5EA 4ZTZB 5DWQA 4MHSA 2C7BA 2IYRA 5BP7A 5A3JA 3OQJA 1Z62A 1L7QA 3SBEA 1I2CA 3R23A 3ZIAD 3H2GA 4EHAA 1R0SA 1Z6TA 1NVBA 1AXGA 1PUXA 4PV7A 2GNOA 2GMWA 3COSA 5BQ3A 3ID6C 2NAFA 1Y1PA 4L22A 5ALFA 2PBZA 4CQNA 2YINC 2JFXA 2XMZA 4PN3A 1BXKA 1NDHA 1EB9A 1I50A 4R54A 4Q9KA 2PX2A 2TECE 1AGRA 4DV4B 4EELA 3CVUA 2LV8A 3JY6A 5DX1A 1ZU4A 1G3MA 1QJCA 3DHNA 4QIWE 5BSKA 1YNOA 4DMUB 1ZD2P 1L9XA 3H9JA 3IP8A 1VIAA 4YVFA 5K4AA 3MUEA 3E7WA 1KSFX 3I64A 4YAIA 2GBFA 3E35A 2FEPA 1W2WB 1GYRA 1PLKA 1SUFA 4F8EA 4BX9A 8OHMA 3Q8XB 5C35A 4MVJF 1B73A 3VR1A 3EVFA 2V6GA 1UDRA 6AT1A 2VK2A 1PS8A 2J9RA 4OUKX 2UZAA 5C31A 2VPXA 3N05A 1J7KA 4ZAVA 3NHYA 1QRRA 2PQ6A 2NIPA 1YU6A 3MS4A 3QYFA 2DMRA 4PXAA 4D9NA 3CSUA 1KY4A 1ZVMA 5L3VA 3G5MA 4JDPA 1VRWA 5DHPA 1GWNA 3TNJA 2BTQB 4I55A 5FWYA 2O48X 1WZ2A 2G63A 2QYZA 2IYQA 4DBZA 2XSZD 1O97D 3D6AA 1XRPA 1U2QA 5CCXA 5KTKA 1AF7A 4F4WA 4DV4H 4XWGA 2VZEA 3VPCA 1VJCA 1D0IA 1O6BA 2CXHA 5IRCD 1SXQA 4FYKA 2WEKA 4BJ3A 4IW3B 2FPPB 2KMLA 5B2FA 5IARA 5KFHA 5FWDA 4BOYA 3V8RA 1EYZA 1VJGA 3IPAA 1DC6A 5K2OA 2H51A 2A30A 1YUNA 4RWEA 3G1WA 2RD2A 3IBFA 2X6QA 1H65A 4AKIA 1VB5A 2O4CA 3P2MA 3AU9A 4Y2GA 4YACA 4MV6A 2HD4A 4XD7A 3WLAA 4J91A 3FRIA 2QRZA 4JP5A 4V0OA 5CH3A 2ZB8A 2FG6C 1O96B 3WRVA 5E9QA 3A8TA 3GJ8A 1E6UA 1KK3A 3M83A 2BEUB 2YV5A 3N0WA 3RC1A 4DE5A 1WCMA 1J56A 3V9PA 1V8ZA 1VZ2A 3UMCA 3BGSA 4BZPA 2J09A 3MJSA 1IY9A 4K1XA 3QBVA 4ROSA 2VRNA 4HJXA 4O3PA 1P9NA 3QPBA 1ZD3A 4ZALA 3Q41A 2WU8A 3GDGA 1JLMA 3K4HA 1WA5A 4WNAA 2GUGA 1BCRB 1WABA 3WYNA 2GZMA 2IXEA 4GMDA 2IYTA 1G20E 4X44A 2EP5A 4AUMA 4UDYX 1QC5A 1LNQA 1V95A 2O2GA 5ALOA 4FNGA 2H1FA 3EXEB 3E84A 5CA1B 2ORED 4A2PA 3WSVA 1L5LA 2ISCA 2NM0A 1M8PA 1QMPA 4F4CA 2OMKA 3ZXXA 2XUQA 4X1KB 4XB2A 3ZWNA 2GK7A 4QRDA 3H4DA 1T9ZA 1A0OA 4I4TB 5H7XA 2J9YB 3OUZA 3AP1A 2WJHA 3MTAA 1LPAB 2OO5A 1T0JB 1TIPA 3U80A 3OZIA 2RGAA 3BMCB 1V5IA 4R05A 3KE8A 4B9AA 5CDHA 1LK5A 3FLAA 3I30X 5ITZA 2PANA 5IBQA 4E3WA 1J0AA 4HWRA 2C2MA 3RHFA 2XBLA 4FYJA 4JYMA 1K97A 1NXXA 2H3HA 3K6KA 3OFKA 1OAOC 3LT2A 4YQEA 3U0VA 3HOWG 3PPIA 1NBIA 1OTHA 4ZOEA 3GIKA 3K2BA 2IUSA 1Q84A 4ZVLA 5HNKA 4LX0A 3MB8A 2QX9A 3FIUA 4ZPXA 1DRVA 3C3JA 4H2DA 4FYHA 1G60A 1YJCA 2G82A 3CLSC 3HO1A 2BFNA 4KGZA 3T7SA 5I9TA 3H04A 5E0OA 2J0QA 4BCBA 1K0UA 1HDEA 3EXFB 3U7QA 1FK8A 2Q5CA 1SBZA 5DGAA 4JZKA 2CV0A 1G6OA 5B7NA 3KWLA 4Q9NA 3F8TA 5B6JA 1OIVA 2NT4A 1FLDA 3TLZA 1GPDG 2UDPA 2YZ2A 3DNPA 4N4AA 4JAVC 1XDNA 2EFHB 4YJFB 3R3SA 2MT9A 1E5TA 3H75A 1XZHA 1Z0DA 4LOKA 2OD7A 4QNNA 5D3ZA 5CYPA 4HGOA 1PJQA 3GJ0A 2HWUA 5AVSA 2OCAA 2PG3A 2X0SA 3GMTA 3GEBA 9MHTA 4QREA 3HB7A 4B82A 2OCBA 3KHGA 4MB6A 4RD3A 5I7WA 1VRCA 3I34X 4NV1A 3IP7A 4G84A 3GLHB 2XRFA 1I8TA 1CUHA 5BR4A 3HCAA 1MOZA 1VGRA 3HA7A 4FMBB 1JZSA 3WMRA 5CNJA 2BUAA 3UGQA 2BUBA 4WZZA 1XDGA 1VE5A 5J2UB 1V51A 2CNWA 3LXMA 3G5UA 3EE6A 4DV3B 2QSYA 1EGMB 2HOQA 2Y05A 4WT7A 4C3OB 4R98A 1E2MA 1EWRA 2LIPA 4JC5A 4LNHA 1XELA 2QTVA 3L5KA 4YYEA 3IP6A 3GILA 3N76A 3O1IC 3NDJA 2JIZD 4LF4B 2FW6A 4R83A 2DSTA 5CAEB 3JAWB 4UFPA 5ES3A 4XD7D 1UAAA 1EJ0A 4YUZA 1MH9A 1PFYA 3A2MA 2E2IA 3BE4A 1S7GA 2DT5A 5KEIA 2YIDA 2E4AA 5FEMA 5TQ0A 5FOUA 4Q9DA 1PNTA 3C7DB 3HJBA 1FIUA 2QW8A 2AS0A 3ZI4A 4IR1A 3LWDA 4D44A 2E5WA 2JAWA 1GITA 5JG7A 4DCPA 1FBTA 4TXMA 5JD5A 4UFNA 1MVNA 1SXJA 3L7IA 4DCMA 2Z3WA 5CB6A 1YI0A 4UXHA 1F0NA 2H54A 5JQGB 5B7GA 3GA0A 3BIWA 3OZSA 3ILSA 3RIEA 3JQBC 3KQOA 1CY4A 4ESOA 3WJ1A 1N2HA 4P9NA 1DARA 1Q21A 1U0LA 1TU4A 4KPUB 1A77A 2BP7A 5EKTA 2FP4A 1JHUA 3TIVA 3WLLA 2E21A 5CK5A 2UZIR 3QXJA 3DAYA 1QB8A 2RSLA 3DJFA 4TUYA 4GP6A 1P0FA 4BPBA 2VDWA 4N6GA 3RJ9A 3AF5A 4C87A 1OIXA 4BLPA 4IFBA 2HVSA 4X20B 4BV2A 1VRVA 5AKYA 4QVKA 5K05A 4L1KA 3V8BA 2D7CA 2X77A 1PS9A 2JD2A 3GIPA 4LF4H 2AFVA 4IKPA 1LZLA 1CPYA 1L3BA 1EBBA 1W8IA 1FJGB 2QLMA 5JWOA 1NNEA 4GXTA 5TR9A 4YROA 1QLJA 1QP4A 3TZBA 2QMQA 1EUCB 5T4EA 3PENA 4OK3A 4P4UA 1DCKA 1WPRA 3NJ4A 1QH9A 4BFYA 5CA1F 1H0HA 3TX6A 3GLIB 5IBCA 2PLFA 3IJEB 2P6RA 3NHUA 4QYIB 4Q45A 4FD2A 1NYRA 4HMOA 3G49A 4QYMA 2AWNA 2YNMD 4AJ9A 1NUHA 2Y0SE 2O4UX 3C70A 2EG5A 5IJ9B 5ALDA 1XE3A 2OMEA 5LVAA 2P1ZA 2QG9A 1XU7A 2OOKA 4CV0A 4RV4A 5FT9A 4W8GA 2XWJI 2ZUSA 3IR5A 5HDQA 2GBIA 1EQAA 4QPDA 3KYBA 3E70C 4K5QA 2VHEA 1QGUA 4FEYA 1NR1A 4TSRA 3KWMA 3W4JA 4PR3A 2PS0A 2Q5OA 1WXEA 3IMKA 3GK3A 5JSYA 3T0GA 3GWGA 2XLBA 4RCYA 1L8QA 4LNAA 2UYGA 4GVPA 5TVKA 1Y3DE 1GVHA 4I1PA 1C81A 3W3AH 1T4BA 1UUFA 1J07A 5ILQA 3P20A 3FWPA 3A9UA 4U7DA 2GHRA 1KP2A 3RYFB 4HUQA 4G41A 2A33A 1C5KA 3FUWA 5IJZA 1WXQA 2B20A 3X2FA 3SEFA 5KFTA 1FLNA 4C43A 3N2LA 4JP1A 1TEVA 4TTTS 1YR7A 2D2VA 4F3TA 3KOMA 5IZCA 1ZPDA 4IF4A 4QELA 3DKIA 3A7DA 4W1PA 4BFZA 1T3SA 3V7WA 1C7QA 1FVFA 3BL8A 2WUFA 4UM5A 2PU5A 3TDMA 3QUQA 4DRXB 5I9IA 2A0FA 4FYIA 1V9LA 1LSUA 4KE7A 4DR5H 1V3VA 1MENA 3O3CA 1NF9A 2V3VA 3RS9A 4OSPA 4PGMA 2BQ3A 4EA8A 5JLAA 1MAVA 3RG2A 4XDZA 5EC8A 2DP4E 1XD9A 4YPVA 4Q4AA 1DUVG 1WV1A 2DTDA 1WW2A 1K1SA 3HCFA 4C20A 1CJBA 2Q29A 1Y1SA 3QQPA 1RYMA 5HFJA 3LMLA 2F4VB 4KNVA 4GO1A 3EQ6A 4DWVA 2QM8A 2QS9A 5J2UF 3NKVA 4ZV9A 1QHFA 4IMRA 5C53B 1SXJD 3TW6A 4X94A 1EEHA 1XZJA 2Q8NA 3K9FC 4DVJA 3WX0A 3GIWA 2W9CA 2NG1A 1BXRA 1NQUA 5HKAA 1Z5ZA 2EGHA 4HH3C 3E23A 1EHYA 2R97A 1DJNA 4PY2A 4W4TA 1N2XA 2PQMA 4IVRA 3PO2G 1AKUA 2L18A 4YCAA 1Y9ZA 4QDJA 5SYNA 2NV0A 3QY0A 4TT8A 3G6KA 2N9UA 2PNFA 2F43B 3JZMA 3SC4A 5JY6A 3W2HA 3UJHA 1UPAA 3VX4A 4HTFB 1C7FA 3USES 2VSOA 3CRQA 3ENNA 3KETA 4Z9BA 1SA0B 1TF2A 4EUFA 4G1EB 2OBYA 3KSUA 2OV6A 2AJBA 3RS2A 3ZV4A 4L16A 5JQGF 3ZDYB 2VAXA 2ZG6A 3KS9A 1OLXA 3CUUA 4MULA 2VEOA 1I9GA 4OJTA 3I61A 2JJ2D 2HCRA 3T5CA 2QF7A 4C6HA 2WSBA 2H2DA 1G5FA 3MXTA 2P67A 1T6NA 3MS2A 3LIPA 4MUJA 4IL5A 4QBTA 1VL0A 2PX5A 1Q1BA 4GEGA 3PYXA 4BE9A 4DA8A 5J2TB 4H0CA 1JEYA 5EEGA 5D51S 4KQFA 4PSDA 3GXBA 4NV3A 3LKDA 1N92A 3HKBB 3Q85A 1ESCA 5JI2E 1OYYA 1WR8A 3KZOA 2AC4A 2C57A 1JB9A 1V1RB 4TYNA 3TLGB 3CEJA 4GBJA 4LWPA 3R6DA 5LQJA 4RKQA 3NXSA 5KSOA 2NTJA 4E32A 3PW5A 4N8SA 4RAZA 2JK0A 4KQGA 4CL3A 3P9SA 1AA6A 1SG6A 1TDJA 2FV8A 2ZI9A 1G21A 3R5FA 1K88A 3KB6A 4FEGA 1YC2A 4M1YA 1JN0A 3VBEA 1IXYA 4NPAA 3H4VA 4JI2H 4N8DA 4UTZA 4NS4A 4GC6A 2NVYA 1Z73A 1RU3A 2VLBA 4GDMA 4R9UC 2EZ8A 4M1EA 1XA0A 2YV2A 3DYBA 3PQEA 2QK4A 2WP8J 3ZY6A 1WSAA 4Q19A 3GIMA 2ONZA 1T5BA 3T5MA 5BSTA 2O20A 3ZN2A 2DPXA 2NSYA 1WMEA 3BK7A 3Q88A 5FADA 3FFWA 2C2ZA 1UXOA 3E6AA 3FZEA 4BRWA 4EB3A 2OZKA 1VLLA 2JRCA 4MH0R 2R7ZG 2D00A 3F5MA 3EDRA 4EYHB 1H5QA 2PSSA 4OHOA 1UKEA 1WDKA 2P90A 1LRLA 3OZWA 3BFVA 3UT6A 2YWJA 1WLYA 5EXSA 1RJEA 1E9BA 2ZTHA 2H1OA 4FFNA 1A9OA 1GPJA 3WL3A 4F4YA 2CL0X 3FWNA 5CBPB 3NVMB 4DIMA 2J9GA 3EULA 1EVZA 2LIVA 2R93A 1GV0A 1YBFA 1C0KA 3E5MA 4IEIA 4UATA 3OJOA 5JRJA 2AI3A 2B30A 4M76B 2JH8A 2WYOA 1O6CA 4GPZA 3N8KA 4LJ9A 4J29A 5BMVB 5HM6A 4X6UA 1S2DA 3QHPA 2ZBQA 2OP1A 4W8OA 3C1TA 3SAJA 5EXEA 4XH9B 3KSBC 4P7BA 2QWXA 1E94E 1KEZA 3KEQA 5K4GA 4GOMD 3PHBE 4LEIA 3P26A 3UTCA 5J4YA 3NVKI 1A8SA 2AW5A 3RVKA 5KAMA 4OLFA 4EJ6A 1J5XA 2R6ZA 3S81A 4IBOA 5HA5A 3J7AC 4ARCA 2QD5A 5T64A 3U44B 1OH8A 3ETEA 4CUZA 1QIDA 4B0PA 4JR0A 3S7TA 1SVNA 2DVMA 4UARA 2VK4A 1S2NA 4YT5A 4LSWA 2QT0A 4B2LA 2B98A 2ZBPA 3CH5A 4B76A 4IKOA 5AUNB 4FEEA 2QYOA 3K1AA 4O4LB 4V38A 1DFIA 3ZNPA 4YH1A 2V7BA 3OPYB 4D57A 1QU2A 3E82A 1MW9X 4YJ3A 3PCTA 1AMUA 1I80A 1GSIA 3SVTA 3AFNA 4EWLA 5FUWA 4NIMA 2D7DA 3T06B 4JU8A 3W8NA 1OX4B 1VBGA 3ZDAA 3VR3A 1N0VC 1R1DA 5KYYA 4O1HA 4HI0E 2IK8A 2CNOA 2WU3A 4EUEA 1SBQA 1TJ5A 3EWNA 1EGAA 2VDQB 5HK8A 1CB7A 2EIXA 3KKKA 3BBPA 3TD9A 1I10A 4F9FA 3Q6MA 3C39A 1W96A 4GLLA 3FLMA 4JC0A 4RVCA 1FX0A 1V41E 9ATCA 4UU7A 3DZ8A 2IIVA 4O4HA 3SD7A 1K7FB 1SM4A 5J23A 5EZ6B 2PLAA 4DKXA 2HFJA 1TECE 3ESBA 1R7RA 4MW0A 1QCYA 5ALSA 2Y99A 1W8DA 2YVKA 4ZANA 4LV6A 1WMFA 5FI1B 5CNMA 4MZXA 3VSEA 1KQ3A 2ZITA 4IZHA 2QMYA 2YYYA 1CF9A 1GUAA 3BD6A 3USCS 1I9CA 4H31A 4M9CA 2JGDB 3WQQA 3QJ5A 1LQUA 4JYAB 4WCFB 4DN6A 3GTPA 3GTMA 3FSGA 1VSUA 1IPHA 1S2LA 5I7SA 2BPOA 2DKOA 3U4MA 1SEIA 5J2TF 2FQXA 4FN5A 4LX8A 1MOPA 3I04A 4QYXA 2BYTA 1KZ6A 1WS6A 4GUAA 4CTOA 4ZMSA 2HSEA 2WA1A 4PRZA 1YC5A 2PR2A 2AR0A 4RKFA 4C4XA 3O4VA 3AY0A 4JBGA 4L9SA 5JAQA 4EEKA 2IH2A 3INTA 4LV5B 1V6AA 2V7VA 4FYXA 4RY0A 2ZVQX 3SXUA 3SE7A 3GT0A 4X7MA 5KX5B 3QLEA 1MUUA 1P0MA 4ZVNA 4J76A 4WVLA 4IDNA 1Q7GA 4OFWA 1Y3FE 1NVFA 1ATZA 4IIYA 1LGYA 4ZT2A 2AXEA 2PY6A 2FZLA 4UVDA 4B5KA 1ZXBA 2GF9A 4XB1A 4WLVA 2J8ZA 7ADHA 4KL8S 2X0RA 3AKCA 4KLRA 2HA2A 2O8FB 2J0UB 4FD3A 5BXYA 2WE6A 4DHEA 3TAHA 3RTCA 1SCIA 3VDNB 1FC0A 1S9DA 3F67A 2JHCA 2BR4A 3SKYA 2GH1A 4BNZA 1TPYA 4QEKA 4PYKA 4UM9D 3MTGA 1G5HA 2O8CB 4S35A 1PSZA 2FHSA 4X1IA 4C4TA 3AV3A 3MBIA 3T12A 1YRQA 1SQFA 4WKBA 2B37A 2QLFA 5AJXA 3LVQE 3DFFA 3ISTA 3N28A 4BLRA 2WABA 1L5YA 3EIOA 5CVTA 5CUQA 4OREX 4TT3A 1NSYA 2AVNA 3RIZA 2NO1A 1F48A 3K09A 3COVA 1O03A 4QO8A 2ATXA 2PTHA 4W7IA 4KXQA 1ZRNA 2IUYA 4CDMA 1UPUA 4Z0NA 4JV1A 4UUQA 5FPSA 4BJ6A 2XT0A 5EE5B 5CDYA 2QBYB 1DHTA 1TA8A 1KO4A 1RAIA 3QNMA 3G02A 1D2MA 1GPH1 1GU1A 2O8NA 3TYXA 1ECBA 4LC1A 1C2YA 3L1JA 1EH5A 4RUCA 2BHTA 2RK4A 1TZCA 3P9CA 3SLKA 4QDXA 3V7FA 3VR3D 2XBMA 1ISMA 5A6VA 3I39X 3BX1A 1U0TA 1JHRA 5HSGA 3UYKA 4RB2C 2FWRA 5C8YB 1JDNA 1IXSB 1DADA 3NGLA 1UFRA 3G1UA 3RVLA 1QQ5A 3MEQA 3EGDB 3ND8A 3INGA 3IOYA 1YA8A 4H15A 1YOVA 2KQUA 3JU3A 4HN9A 3I8XA 1NVVR 3BCSA 2QU7A 5MN5A 2IBKA 4HC4A 2UVPB 2Y2UA 4G0WA 4O4LF 5KDOA 4XYLB 3TSWA 4AF6A 4FE3A 3O4FA 3CLRD 3KJNA 4NESA 2COUA 3F2VA 1I5EA 4RDXA 3WLEA 3HSYA 4OH1A 2VDVE 1I3QA 4INZA 4O3OA 4YRBA 2QZSA 3NWBA 2AQHA 4FPXA 4JASB 3NGMA 2P9CA 3C6KA 4WBSA 4DL6A 4AMBA 4ZGBA 2PWAA 1U2DA 4I7EA 4ZO6A 1DZIA 4OYRA 3OURA 5ILOA 4JOSA 5KNDA 1XTZA 4J94A 5KTOA 5F9FA 4PIMA 1RAHA 1GQFA 2RH8A 5GOZA 2JGJA 3HB1A 5E3IA 1DDGA 3PGVA 3FSGD 4BBPA 3UKOA 2R65A 2XH8A 2F3UA 4C4PA 3GH3A 2BI7A 3SXPA 2AFHA 4BFVA 1OFVA 3T9DA 2R7MA 3EGIA 4ENVA 2YW9A 1JNXX 5KJ1A 4OPMA 4UMVA 3BXOA 2COKA 7REQA 4GKBA 4HMPA 1SOVA 2N1MA 5JCJD 2HO5A 2O1XA 2R25B 3FPHA 2V1XA 2DH6A 4M9UA 1KDPA 3MHTA 2Y67A 2FR0A 2OPHA 2HQRA 4RTJA 4HWSA 1NQVA 2VXCA 5M2QA 2IU3A 2XVXA 4NYIR 2CFOA 3OEWA 5YASA 3LA8A 2IXTA 3H5RA 1IY1A 1B42A 2WUVA 2QXUA 1XD2A 4RH0A 3HK2A 5L7TA 3JWJA 4JSTA 4O33A 2X22A 1K0FA 1EUDB 1R6BX 4ZU3A 1GSOA 3BWCA 1ZP6A 5KYUA 1GDDA 5F1YA 1XCJA 3VU8A 4BJHB 3EEQA 2E4YA 1D1TA 2QJFA 3A6ZA 4KYUA 1H2BA 3U3OA 4DC1A 4F4JA 1NJ8A 2P62A 3HXMA 4DM4A 3R0IA 2D8AA 3PK0A 4PCUA 2AG8A 1KFBB 3C3KA 4BEBA 5E1OA 1RJGA 3BILA 4OG2A 2XITA 3TTWA 5K8IA 3QOXA 4O3MA 4XA8A 3QXGA 5A4IS 5KX5F 3DFKA 4B2YA 4BB6A 4D3XA 3AG6A 1US8B 1TI7A 2XA2A 3IBYA 1OWTA 4LAFA 4EUNA 3K0CA 2BZ1A 3DD1A 1A2KC 2J6TA 2UVUA 3EPIA 2V9ZA 2YMQA 3AF1A 3ZVKA 1IEXA 1OH5A 3W05A 4IIVA 3H9GA 4OHMA 4IJ6A 3L40A 3K94A 4FCTA 4TT3D 2BM8A 4JI7B 5IT5A 4N0DA 2Q5HA 4JGBA 4M1ZA 2X13A 4JCCA 1KC3A 1SKYE 1ZH4A 3ZHYA 1FYFA 2XUHA 4EYSA 3GFGA 2AGVA 3UJBA 4KBGA 4ZCSA 2AH5A 5JNSA 2YFKA 5CG1A 4WGFA 2DHEA 2XGSA 3ZGXA 4O4JA 4WXHA 3DEYX 4J7UA 1U8TA 5CIWA 3RKSA 4YDRA 3I2FA 2IYEA 4PCLA 3FYUC 4ZGWA 2M9MA 2H7XA 1TC1A 4LQCA 3L1KA 4ZZ3A 2GAIA 4Q7LA 1RLTA 2QRUA 3PUHA 4BVHA 3HPQA 1E2EA 2GWHA 1Q7EA 3EXIB 2QNRA 1IBLB 1EU1A 1GFZA 2C9ZA 4URFA 4J0HA 1QRDA 2B8EA 3VO2A 1UKYA 2OGZA 4DA6A 2EVWX 2JFYA 4Q03A 2ZJ8A 3H16A 3ESAA 4XTRA 1AN7A 2JA7A 1SHZA 1W0CA 3JARA 3UMVA 4UKDA 3VHXA 2GJSA 3D1LA 3CBGA 5A7GA 2GDJA 3JD3A 1FDVA 1C9KA 4O0MA 2WTAA 3KAJA 3VR4A 1IBRA 2ZBRA 2VHCA 2J3IA 2O0LA 1Y6JA 4N1AA 4Q9HA 5HTOA 1P60A 1NQWA 3NXKA 2VDOB 1H1TA 4JI7H 3AZQA 3FCSB 2PMDA 4MWCA 3V00A 5MFZA 1HRKA 5C8YF 1C1HA 1NLUA 1VJ1A 4YAKB 2FW1A 4S2EA 3A06A 3OQVA 5EJGA 4WDRA 5F5NA 2CEKA 1C8KA 2W6ZA 1FYDA 4DGQA 2VBCA 2Z2ZA 2XMPA 1YZNA 1ZLXA 3PC4A 4NDZA 3AB7A 5KFXA 2PL3A 4IZIA 2XTNA 2WUGA 5L8VA 3AX6A 4F3RA 1GNSA 1II0A 5KSPA 1XG5A 3WRWA 3EA5A 5IVIA 3O9ZA 4AG3A 2JLXA 1C3EA 4B0OA 2FWNA 4QE3A 1NPDA 3DONA 4B8ZA 3B1WA 2P7HA 5DCYA 2HWWA 1JZQA 1YULA 2HI0A 3UMJA 5IKXA 2W6MA 3M6VA 4UTPA 1XQVA 1NT2A 4EW2A 1NOIA 4BLUA 2AMJA 5LL6P 4YHHB 2F55A 4BKRA 3UMYA 2HBRA 4ZJZA 5BQXA 1B0AA 1RHJA 4QOGA 1CEQA 1IWPB 1I6MA 4BFTA 5LWQA 1AK9A 2B99A 3RSOA 3HOYG 2PXAA 3LSTA 3NDPA 1K6MA 3LXXA 4R69A 4DTCA 2BF7A 4B47A 3EAFA 5CT5A 4DAOA 2FE1A 3HZHA 1CZHA 3P32A 4EG3A 3EPHA 4EVRA 5A5DA 3WSTA 3KDPA 5H3HA 3RW9A 1AZSC 3ADCA 1G41A 1YDHA 4OI0A 3UBMA 2FSHA 1KVUA 3Q87B 3TSYA 4MDYA 1YVPA 4NZ9A 3A0UA 3FMGA 3KB8A 3NALA 2Q9AA 3OZUA 1EBUA 4I08A 4G3IA 4L4UA 1DUSA 2GBLC 4BKUA 4UCQA 3KQYA 4WLFA 1XJQA 1F06A 5MDHA 3V55A 2QRNA 2PBFA 1V8FA 3ZK8A 3NMUF 3TCXB 4FDTA 3S4YA 2VJOA 1Z8FA 1ZBQA 2P9TA 1K5PA 1GL3A 2H1VA 4D7AA 3KJXA 4UZFA 1P1JA 4PCAA 3AI7A 5IP5A 3OTQA 3CLTC 1RKBA 1SEVA 1MT0A 4PNHA 4XCVA 1IM2A 4YHHH 4XUCA 1XRJA 3U4GA 2R7AA 1WDLA 2GO1A 5EPOA 3TKAA 5AT1A 1WBBA 5C4IA 4X6YA 5EUBA 1WIWA 1IL0A 2D4HA 8ABPA 1ACJA 2GHQA 1FDWA 2VXOA 1BCSB 3AR4A 2B4YA 4D9JA 3W2GA 4D8TA 1VE7A 4K9QA 3SU8A 1QONA 1MJNA 2P5SA 5J3JA 2R1VB 4C21A 2ZWOA 1BXGA 5KBYA 1RR6A 2YMLA 3GTQA 3VPXA 4BQSA 4ARZA 4MVJD 3U61B 2IEGA 1U99A 2HXSA 3CZPA 2WWHA 5ADWA 1HYGA 4U3JA 1Y1KE 5C0OE 5LP6B 5I3ZA 1QHHB 2IHZA 3MC1A 2PT5A 1N78A 3N43B 4H3KB 2O8DB 2NZ8A 5K3DA 4ZDJA 5AW0A 1T1RA 1DIGA 5LQSA 1ODCA 1VMAA 1QVZA 3OQIA 5FV4A 4QFDA 4E03A 4K9LA 2MSLA 3LFHA 4EPWA 1DTEA 4V1CI 3SF8B 4PQGA 3GFSA 4FJ2A 3ZEIA 1W5AA 1Q57A 3RUEA 5JZOA 5KO2A 2D2XA 4JSRA 2HJWA 1YR1A 4MS1B 2YWDA 1IEWA 1TF5A 2I29A 4ZZ0A 1KYTA 3IKMB 3BHJA 5TE9A 2WG1A 4ZYVA 2GS9A 3M5CA 4UD2A 4NJEA 2GPYA 2OBNA 3WGNA 1ZZEA 4A10A 4B17A 4ZXPA 4PS1A 3VBCA 5ALTA 4J0DA 5HIMA 2VEDA 1FDIA 3ZWVA 4H1WA 3SFVA 1EGHA 3A1DA 1NI4B 2RE8A 2O8VA 2B8WA 5J9FA 1HDZA 4L02A 3RVSA 3JXEA 4XWAA 1GGOA 1YZHA 3I4LA 3M6IA 1OZFA 1T6BY 5EZ5A 4DDUA 4CV1A 5IYZB 3S40A 2ASVA 1UMKA 3DB2A 4HYEA 1ZINA 3STUA 1SEPA 1PR1A 2I7DA 1OJLA 1ZRSA 4BHTA 3GCWA 1U0OC 2P79A 5T67A 1TYAE 3NYIA 3SR0A 4JSYA 1F8XA 3EPJA 3NV7A 1Y1TA 2NGRA 5BYBA 4V03A 3TRJA 1IUOA 3NHSA 1I2BA 2OORC 3ZGOA 2G36A 1QHYA 2UYCA 4RK4A 5AW1A 4M46A 2MHCA 4EGCB 2QN8A 4D4HA 1EVQA 2ZYRA 4PYOA 3QPWA 3HOXG 4MWSA 3WGMA 4BBZA 1S10A 1QB7A 1DGSA 3HDHA 3DAOA 5A4AA 3LAWA 4J16A 2LZ0A 1Q1AA 3JYNA 2HF2A 3GLKA 2XOEA 3K1TA 2CJFA 1CHDA 1C9EA 4BNVA 3HJUA 2EKBA 3RQSA 1FDOA 4C0XA 3O92A 3TRHA 3OOWA 5HQ3A 3AFOA 1K9SA 3VKWA 2IELA 4L3VA 4WEOA 4KV9A 1RRCA 5F64A 2IS4A 2AFIA 4J1SA 1WF3A 4JT9A 1JLLB 5IVPA 4IOMA 4MUKA 1P2TA 4H3VA 1YFLA 3ZD6A 1GNRA 3U6BA 4FFOA 2XLCA 1CQXA 4ERXA 4WWHA 3PW7A 4PNPA 4MSUA 1E4YA 3SHTA 3KQMA 1ECFA 3N39C 4WRRA 2PZGA 3A4IA 3CGGA 2VDUE 1KFEB 2PYZA 4BP3A 4HAZA 3C5WP 4YRRA 1HOXA 4DQVA 4MNTA 2AC2A 3KVYA 5T4HA 5SY6A 2FRDA 1XXLA 4BNHA 4ZU1X 3GCDA 3FDIA 3VTAA 3BTVA 4B7AA 2M32A 4JIMA 1KEUA 2H08A 1PDVA 1YO6A 1ARZA 1WSBA 2BEWB 4C0QC 2C7VA 2ZXUA 1ZONA 4OXKA 3C8HA 2JIZA 2VF2A 4NONA 3EZ7A 3OTGA 2BFPA 4UTNA 3TGLA 2C99A 2QGZA 3VXKA 3N2KB 3N5KA 4XVUA 3J80A 2R47A 4M60A 1MHTA 3DCJA 3ZR4B 5JD3A 3LP8A 4EYEA 4JJ7A 2JEJA 1Z5WA 1R2QA 4N01A 1J1UA 3QEBZ 4QQNA 3KWJA 2PXCA 4JWKA 5ICMA 1I4EB 2GPNA 1JFRA 4LMYA 1OZGA 4X8HA 1FSGA 3DEZA 4L07A 1RKXA 1DP4A 3O82A 5A05A 1IXZA 1XZ8A 1G63A 2DYKA 3NTRA 1OPXA 2CLEB 4CMJA 5KYXB 1S8NA 4A2CA 2Q5QA 2W00A 5AVRA 4G0ZA 1GCAA 1QPGA 4I4IA 4G9BA 3IVGA 1ONNA 5JCZA 4PBRA 4I6EA 3VX3A 1ZCBA 2NSHA 2VP5A 3QE2A 4PFQA 2BZGA 3HZZA 4Y30A 1VYVA 2PAAA 2I6SA 3VQTA 5LP6F 4KOAA 2PO5A 3ZE1B 4L6CA 2V74B 2VQ3A 2X40A 3EPKA 3WL6A 5EWLB 3RSCA 3UWOA 5IAJA 2PUTA 2J5BA 1W49A 3IHTA 4X65B 1ENPA 2EWWA 5K1ZA 3GZJA 3HXOA 3FYDA 1P8AA 3V8MA 1R4AA 1RSZA 3RVJA 1TXGA 2LNDA 2D1TA 5FBWB 1J9EA 2I8AA 3LT0A 3S44A 5LQMA 3W04A 2HLDA 1U5BB 2C97A 4DCVA 4P7JA 2O8EA 3TSCA 4G0XA 1C3LA 2CYCA 3N8HA 3F3KA 4KHPB 4RELA 1RAFA 4EGJA 1F0KA 2GXAA 1I0LA 4EOGA 1UZMA 4C5BA 2WF5A 4US2R 1GILA 2PUAA 5DK6A 5E1DA 2YOGA 4BNDA 1NZJA 1ITZA 1RYSA 3UMGA 2IYUA 1KDOA 1N2CB 1W5EA 1ESEA 1YE8A 1RPNA 2YNMA 3P2JA 2OG1A 3CKKA 1O94C 1ZN2A 3QEAZ 2W8ZA 2W2KA 4LF6H 3VNSA 2R7KA 2ZDQA 4BBJA 2V97A 4NATA 2F1OA 2VVTA 1C30A 4NFHA 4FZ5A 4OHFA 5AM1A 5KZMB 5IYZF 4UMFA 1KKMA 5DNUA 4DQKA 2AKAB 2GB4A 5LU8A 3LD9A 4RW0A 1C4OA 1IHDA 1U7UA 3NG1A 5EUCA 3FDZA 2IU4A 3PF8A 2DQ4A 2Y1EA 4W9RA 4D97A 4LVNA 4EI2A 2FETA 4RX1A 2GM3A 4X65H 1GR1A 3VVLA 4GLFA 4ZVUA 2CY0A 4N0EA 4MWOA 4EPVA 3GRUA 4PPYA 5C44G 1FMLA 1Y37A 3A4NA 2JLWA 1NW8A 4LOHA 2QMZA 4MLPA 2QTLA 4F91B 3V6JA 1QHXA 3DGEC 1WMAA 2A0UA 3ILXA 2WSIA 1M0SA 3RTEA 1JDTA 1JDUA 4K86A 4FBTA 2GZSA 4CF4A 4HDMA 4LWQA 4KHPH 1I1HA 5KDLA 3CB4A 4EYIB 4HADA 2YZNA 4LTMA 5BT8A 1A71A 4BFCA 1FYXA 3HBNA 3R5TA 4J1TC 2XE8A 3PLAE 5J59A 1XTTA 1NIJA 3IDAA 2CWDA 1HI9A 2AZ4A 3KKEA 3TQSA 4HLCA 1DPGA 1JKFA 2DKFA 1N0UA 3CWQA 3CNEA 3ZU6A 2J3JA 4LW8A 4U6PA 1WE2A 4ZOQI 2MCFA 2E4ZA 1LF5A 5K0FA 1AKEA 3A4YA 1G8KA 2XYQA 3NAMA 5T3YA 1SH7A 4MP6A 5ICSA 4Y2JA 5E38A 4H1TA 3E9NA 4Z4EA 4C2TA 2YHAA 3VU1A 1H2EA 2D5AA 1H0SA 4KO8A 1PJSA 5AVYA 5A2QA 5K45A 1CR1A 4GLOA 3W2TA 5GTDA 2HHHB 2B8JA 3LK7A 5JUMA 2WIFA 4GVLA 1DIHA 5H02A 1D7OA 1E1CA 2XBUA 5AI9A 4UE2A 1KDYA 4YDQA 1B0UA 3ZHCA 2AT1A 1LRKA 2CCGA 5IKOA 3GRPA 4DC0A 3MJCA 2O5RA 3T1NA 3GEDA 1WB4A 4ZVMA 3S68A 1LKZA 3L7OA 1E7YA 2G28A 2IS6A 2EHJA 3CNOA 4PICA 2G4CA 4AN4A 4EG4A 3SCZA 1O0BA 3QLUA 1BQ3A 2QRKA 3FB1A 1RAGA 2ZCUA 3BVPA 1VBFA 1Z29A 1F2TA 3G9XA 4R2LA 4Q18A 3FVTA 1IG0A 5KFCA 4OGGA 4GM0A 4NL4H 1UC5B 2FK7A 4XM1A 1OT5A 5CEJA 1GM5A 3LBAA 2AVDA 2AWOA 2BSXA 3DVAA 1VECA 4IUDS 2EGGA 5F76A 2HLDD 4YHBA 5LP1A 3HCCA 3A6PC 5CA0B 4OSOA 2VRBA 1QHIA 2W70A 5CURA 2WLSA 5L3SB 1DDOA 4L4ZA 2HHHH 2W8KA 5HJEA 4YYZA 2JJ2A 4EY8A 3SQWA 4C7JA 2RC6A 4II3A 4JV2A 4FSHA 4BO1A 5K03A 5EJIA 3Q3IA 4ECEA 3BDIA 2WJIA 4A36A 5CPFA 1NPYA 1T91A 4DR5B 3C7KA 3AHHA 1OXXK 4I4TF 1FCJA 3VNQA 2R1TB 4D26A 3HPRA 1G3QA 3TVDA 3HVIA 4U02A 5G2OA 2MDTA 1UZLA 3HFGA 3T7CA 2J45A 2EX4A 1S9HA 2DFLA 3FPLA 2XA9A 2ZBUA 3W4KA 4P4LA 2WDZA 2A84A 1OWMA 1GSAA 3AM5A 3THXA 5KIAA 2GJ9A 1WCIA 2H06A 2J41A 1QHEA 4C07A 2GZDA 1UWLA 3V3TA 4JQZA 2BRUA 2Z6QA 4XIYA 3WOVA 2CMKA 3F8NA 4Q8FA 4HO1X 2XIGA 2ZIFA 2VO1A 4YASA 3K9GA 3EAGA 3MB5A 3CCFA 2NZ2A 2DULA 1VKHA 2PJRA 3A05A 1VHWA 4IJMA 2CKDA 2PRYA 4UREA 3KVRA 3HKCB 1OU0A 5I8ZA 4RTPA 4CEHA 5AI6A 1J5EB 1N5RA 4MW2A 5KOJA 4KMMA 2DAPA 3DE2X 4PC2A 3WJ2A 2EYQA 1Q1GA 3M6MD 3E9CA 4X8OA 4URUR 5AMXA 3WHIA 3T5AA 5TC4A 4YMIA 4TTIA 4Q43A 1YHZA 3NVDA 3L41A 1E2JA 1TQ6A 2H2AA 3BH0A 5CT4A 2CMGA 3MLAA 2NP7A 3LCJA 4I2VA 3SYKA 1XB2A 1AU9A 4CM7A 4PS0A 2PGNA 4KK4A 4E46A 3TNYA 4AJLA 4C0LA 1ZHFA 4LNUB 4BKMA 1ESZA 3GAMA 2E3JA 3D43A 2X2OA 4HNGA 4D81A 4B3JA 1M7JA 2VSFA 4DR7H 1B16A 3COJA 4N5NA 2CBGA 4L2IA 1SQ0A 5F23A 3D1VA 2VFAA 1LLCA 3UT5B 5C34B 4C7KA 1RLMA 4IDPA 1KFCB 1BEEA 5FULA 4FQ7A 3BOSA 5AK3A 3L0BA 3S28A 2JHAA 2G7MC 3F47A 3DDHA 2QAGC 1JHOA 2ZUFA 4MLZA 3OOHA 2O1WA 4MWTA 3ENZA 2DECA 3M6FA 4TXNA 1YE3A 2V1UA 4HHEA 3OM0A 5B58C 4IUYA 3TOCA 4Q4HA 1P80A 4IH4A 2V0GA 3PC6A 1UBJS 2CUNA 4QUKA 3V2GA 1QO0A 2C9MA 5KI6A 4KODA 1J5EH 4MV5A 5E9AA 4QWEA 3LY9A 4ITVA 5ESRA 3SHOA 1DJMA 4IF6A 3OH8A 1H2XA 1GZHB 4CI9A 3KVVA 1LQTA 3GQVA 4OMFG 1ZU5A 3VDRA 1XU9A 4WKPA 1EFVA 3VU3A 1M8FA 1GRNA 1C3JA 1Z5UA 2ZPAA 1DTWA 4JI2B 3FKIA 2ETVA 1OW3B 4IWNA 3S1AA 1ID1A 3ILHA 3N2EA 4QULA 3QJYA 5IN5A 1N9GA 3RC8A 1MO5A 5KC8A 3H5VA 4HNAA 3ROZA 4CEJA 5L4NA 4GBED 5KHLB 2BOVA 2N47A 3U4AA 1QRTA 1Y1LA 1JPNA 1VJDA 3SOPA 1BA3A 4KXMA 4MYUA 1MX5A 4KQWA 4UVGA 5HOEA 5JI3E 4YQYA 4AJ1A 2NNWB 4HFNA 5DH9A 1HA3A 3DUFB 3CIOA 5GJBA 2C22A 3HI4A 4ICIA 3OMLA 5CFNA 3WKBA 1BMQA 2JFQA 1HFKA 4WLOA 3DZCA 2P41A 4ZKDA 3JZDA 2DG2A 4IQGA 3DM9B 3KWFA 3O0DA 2GN1A 5E7IA 4UCXA 5BW8A 1K8QA 4Y7DA 3PKIA 5TMBA 4IIJB 1E2GA 2EYUA 4JKIA 3DQPA 2BI8A 5KQGA 5CA0F 3S2ZA 3TJMA 2W6QA 1GKIA 3EFOA 3V3KA 3LQFA 4U2DA 4LJ8A 1THMA 3SFTA 1MB9A 1CJUC 1FUIA 1NHWA 2DUUA 5CJJA 2FFJA 1E77A 1ZD8A 3CF0A 2QRPA 4W1QA 3RFTA 5G4KB 3EIUA 2DTEA 1QO9A 1V16A 2HWXA 3PZPA 1OBVA 1U94A 1T2NA 4QXQA 3UJ9A 1EWYA 1BGXT 2O2IA 2HHCA 2NO0A 4G0QA 3E9MA 4Z9AA 1MZBA 4HXGA 4YR3A 3PUVA 2OR3A 3G7SA 4NCBA 2C1EA 2PJZA 3DMRA 1Z6YA 1RCTE 2ZB7A 1Z4QA 3L0PA 2Y6VA 3U4IA 3EBPA 3GEIA 4OHZA 3B89A 1NF8A 2ZSHA 5KG1A 1P5RA 2HCBA 3PNOA 2ZJYA 3IE2A 3IQWA 2C28A 3KQVA 1GNLA 1WNFA 3PJEA 4P36A 3FHCB 1Z06A 4YAOA 1YMQA 2GA9A 1L7XA 3MW8A 4EARA 2AR7A 1GLGA 5AVZA 4YQWA 1K7EB 2ZUWA 4QUHA 1UPXA 5KFUA 1SHLA 4DEXA 3JRXA 3HWSA 4AZWA 4E0BA 4JUZA 4ZVRA 2HRQA 1JEAA 2WDTA 3KQNA 3ASYA 2QG4A 3O8QA 4NS1A 4HH1A 3AOGA 3O4JA 3WLTA 2FAXA 4BB9A 2RIPA 3PDCA 1WP4A 1WZNA 3DOFA 2YWBA 4FI3F 5C3MA 2PKRA 1UIMA 4ZAFA 2EQAA 3TAUA 4U4AA 1QO0D 1WVGA 5BRJA 2ODPA 4B3HA 5ITVA 3D5TA 1ABEA 2YJ5A 4QSMA 3JQ9A 3O8RA 1NR7A 3K8QA 2ET6A 1U4NA 1NA5A 1MB3A 1MGPA 2EAUA 2PKWA 3CA8A 3GZTB 3F4LA 1MDBA 1N3BA 2VPPA 1IMOA 5CVCA 5DB4A 1TTQB 3PQ4A 1K7CA 3GJ3A 1B04A 3ABQB 1GPNA 4BGIA 1FNBA 4KVFA 4WBXC 2JIMA 4MVCA 4IPTA 2CV2A 1X80A 4MPDA 2PIAA 4WERA 1JHXA 4MDEA 3H5NA 1SC3A 4YV2A 1E7RA 1DI0A 5AM2A 1H85A 1DAKA 2A5FA 1M72A 1X7YB 1MJHA 3V46A 1H3NA 2R6R1 2C4VA 5E8RA 3GV8B 2PWBA 1MAHA 1OZHA 1PS0A 6Q21A 3UVEA 3VM6A 4TM7A 3W9SA 4JI3H 3OPYI 3UJAA 4JL8A 1R5BA 3PDUA 3QKWA 4OB6A 4MROA 4FMDB 1CQZA 2BCGY 3TB4A 3T9AA 1XCPA 1UDWA 3CX8A 2W2OA 3UJNA 1ILWA 4C4AA 2OXEA 3PX7A 3EZGA 4Z2YA 3M6WA 2HTFA 3VNAA 1IRIA 1AZTA 1E60A 4Y7CA 1J2JA 1NASA 1RM0A 3KQPA 1E92A 1KAHA 2GN2A 1GGKA 1P5JA 5D1OA 3DDCA 5AFSA 5TEVA 5EESA 3DB1A 2XDQB 1ZL0A 5E4YA 3ROPA 3L4BC 5F2OA 1Y4ZA 2ECOA 2OZEA 4JVLA 1DC7A 3HH8A 2YOHA 5FOXA 4LPKA 1DIBA 2YJZA 3BGIA 2B6HA 4TWIA 4CLDA 3ANYB 3W7VA 1Z5PA 4AWAA 3K0BA 1ZK0A 4RJJA 2VT3A 3R3JA 2ALJA 4RZXA 4HDRA 4F4HA 3AY3A 5JCJA 3SZMA 2H4FA 5IFLA 3QLVC 2DBZA 1T9DA 1CQIB 3LWZA 3WLJA 3IQGX 3LDGA 4HWOA 4X1YB 3ADDA 2FJUA 1UADA 4RCZA 1M2FA 4QHSA 2EF0A 4DY4A 2VDLB 4FHEA 2OLKA 2O5VA 4WPGA 2XNSA 1Q74A 3F7OA 4YPFA 2Z4RA 2I5PO 3DOIA 1FL9A 1MPXA 4TKUB 3DF9A 4B6FA 4KN8A 1XMOB 1U8EA 5DHTA 1BIFA 1MVOA 2AA3A 4L7QA 4X95A 3ZG6A 2N1BA 3N2GB 2CFCA 1IUPA 1JFVA 3DFIA 5JNWA 4CLRB 2FPGA 2H31A 2KE5A 4KYIB 3ZU2A 2ZAOA 1XEFA 3F8SA 5LKRA 2C1ZA 4DS3A 1UPFA 3F5FA 3AEKB 2JLZA 3KHKA 3Q0EA 3IMGA 2PL1A 1OLOA 4MAAA 2BMDA 2IS1A 4DWOA 1KSGA 2PXXA 3M1LA 1UXGA 3AWIA 4LCBA 3C85A 3DKRA 1H6DA 3OKPA 5L1IA 1IY8A 1R3DA 4QYWA 4DR1H 3OPMA 3W90A 3WTCA 1NONA 3X1DA 1QKJA 3ND5A 4CTKA 1KO7A 5JS7A 1R50A 3CGWA 5CLLA 4KACA 1GQ2A 3BCUA 3TQQA 1ISPA 2SBTA 4FGLA 4Q16A 1DT3A 2GPBA 5AOBA 4B80A 4OHWA 4HDNB 4FDUA 1IRXA 1Y8RA 3KXKA 4U1RA 5FV7A 4BYGA 5TQJA 4GX1A 2Q1XA 5BMVF 1G55A 5TX7A 2FVYA 1MO6A 3SMQA 3A4TA 3DKVA 4YJGB 2D0PB 4RC9A 1YAHA 4GC9A 2WIGA 2H7YA 3TQTA 5E4FA 5B57C 1WLSA 1RRMA 1M0EA 2BR3A 1XMOH 3W5AA 4QM6A 2FN3A 2PVCA 2WE7A 3KL2A 1Q3KA 1JHQA 1OXSC 1PYGA 3ENKA 3P0RA 4ZVTA 3PNBA 3THWA 5K8JB 4JP2A 1NKSA 4O1MA 1A7UA 3C8ZA 1EG2A 4DIDA 3C8UA 2EL9A 3I9NA 1FTQA 3ZD9A 2C1XA 1EZ1A 2VTKA 3A3NA 3JQAD 2UZ4A 1BOOA 3K9QO 3LQ4A 4NQRA 5BNTA 2DR0A 2G0NA 4MJ3A 4APMA 4W9NC 3D64A 2XGQA 2C3UA 1UXKA 1U9IA 1Z34A 3DHEA 3LOPA 3VO1A 1GDTA 1BD4A 4EW3A 2ZTLA 3LLMA 4TTAA 5K20A 2PUFA 1BZYA 2HH9A 1CUSA 4N40A 1OJ7A 5KINB 4FKBA 1FLVA 5DEOA 4HDSB 1G8JA 1DV2A 3AUKA 1Y1QA 3STXA 3HGTA 4GKAA 9LDBA 3Q1KA 4IX9A 2RGDA 4Z5XA 1RNLA 4JBWA 3CJQA 1IZ0A 1JIHA 1PJ3A 1RT9A 4GSKA 1DCMA 4HRYA 2AW3A 2UVDA 1JSCA 4D9CA 4JLWA 3SQNA 4JJKA 3L8CA 3GTLA 1ZSVA 4TLAA 3F97A 2BBWA 3EUFA 4JELA 1KZ9A 5AI5A 2WZDA 5DNAA 3BMQA 5KJFA 1TNDA 3EMDA 5HZMA 4FLMA 4RPLA 5AD1A 2OT3B 3DR3A 4W5WA 3A6HA 5CX1A 3R5KA 2IF2A 2Q2OA 1NFRA 3PCXA 2ZPUA 4KYVA 3MGAA 1M54A 1HYBA 5EWJB 621PA 2NTEA 4WA8A 5EMKA 3BXZA 3BTUA 4L08A 1X1TA 1BEZA 5CB4A 4REQA 4NV0A 1MX3A 3GLVA 3LNCA 4LJSA 4UM7A 3OA0A 3W77A 4LRYA 1PWYE 1EWTA 1GUDA 4MICA 1WMDA 5I7UA 1YS7A 5FBRB 4DMMA 1QRUA 1QQTA 1G7TA 3VOSA 4R84A 4M0UA 3B36A 3PXDA 3KSAC 1WG8A 4FFRA 4R8SA 4MUIA 3UJ7A 3PW0A 4PYQA 1T9KA 5HJ5A 4M9XA 1Z6ZA 1NV9A 5HE8A 3BQ9A 5AO9A 4EY3A 1I4DD 2VHJA 1Y3IA 5AVUA 3TOZA 5HKOA 3QYAA 2ZK7A 3CX6A 3L4EA 4QOEA 4BP1A 4F1KA 1TMYA 5EIBC 1R8QA 4JK3A 4MW6A 1XZKA 1SVWA 3WQBA 2QLJA 2VZ8A 4LYFA 1UP4A 4NLLA 3ZCVA 1Q7BA 1BDIA 5I6DA 3KB1A 3FRHA 3LDAA 3L0OA 2JFUA 4PGAA 4I5GA 2QOEA 4UBJA 1XL1A 3SSNA 2NACA 5K7SA 2EV9A 4W6ZA 3BWYA 1KFJB 3H2YA 3T7EA 3MWJA 1VKRA 1OFHA 3DPIA 4CLHA 2GPAA 4B34A 5KFFA 1LC0A 3K0HA 1JKXA 3SLRA 3BH7A 1M34B 3TK1A 1UAGA 1QSGA 4E11A 3MPOA 2GRJA 4I0WB 3R8FA 4IIHA 5CVUA 4ECYA 4IFEA 3EW7A 2FCAA 5FNZA 1E7WA 4TYYA 3GZNA 1CUFA 4F04A 2DB3A 5DBHX 5CM9C 5EKUA 1ECPA 2J31A 4RABA 1W48A 4X8MA 3C6ZA 1BG6A 3G2JA 1L8LA 4H1HA 4AIRA 4ECSA 4CTJA 1H2RS 1NPTO 1Q3TA 5TPWA 4MVJA 2YHIA 2XB9A 4B33A 1JZTA 5DSTA 1U7XA 1SVMA 3WS7A 3ZVMA 4KPGA 5KU7A 2WUEA 4ZQEA 1W52X 4L0CA 1QKKA 1RBMA 3KEOA 1O1YA 3RIHA 1IMJA 2R2AA 2Z2JA 1J8FA 4RHCA 4S1TA 4C2BA 2FPXA 4EFBA 3VAZA 1B93A 1RYNA 4D9KA 4G4SP 2CC2A 3EISA 2MYUA 2HPAA 4LDQA 1P6QA 5KNBA 2FPRA 4R2KA 4QLOA 2RHTA 1S3SA 2C5GA 3TLYA 4HRXA 1XEWY 5EUQB 3S1LA 1HLDA 4OKIA 3RODA 5KFSA 1IQPA 3PJFA 2VHXA 1WZEA 1HGXA 4YRSA 1GAJA 4Q3LA 4V0LA 3RRZA 5CLJA 3RO7A 4YAWA 2AE2A 1J21A 2QZ9A 4CQLA 4ND2A 3RJMA 4ZCTA 5FR2A 1XN1A 3NTXA 1E4GT 4CEIB 2WIKA 3GG2A 3GFVA 4KQEA 1L5FA 2C03A 3TX2A 3HY6A 3G6XA 7AT1A 3C6XA 2FDRA 3NIGB 3AFGA 1JXAA 1JYEA 2RHDA 4I8DA 4RZ3A 1U7DA 1Y4AE 4RJLA 4OXNA 2GFQA 5C5IA 1P45A 1PV2A 3PE3A 2ERCA 3QOYA 4QOIA 1WU7A 2EDAA 1UC4B 3L0ZA 5DFAA 3Q2OA 2E6KA 2O19A 3EC2A 2X23A 3FTFA 3AVYA 3I6YA 1FP4A 4G2NA 4W99A 4OQ4A 1M5RA 2JVKA 3R0XA 4FGUA 4FYVA 1A7JA 4IIFA 1OI4A 3MTDA 3VH3A 2IQIA 2CUTA 2B5WA 2JCSA 1BHO1 3T4PA 2HSZA 2Z3ZA 5HKBA 2ZWPA 2OV1A 4ENUA 4RF4A 4NAVA 5AWFC 4PG4A 3L1HA 4IYRA 4KE8A 4R1MA 4IG4A 2HMUA 3V6HA 2CLMB 4D4KA 1UT6A 1NNLA 2G06A 4QFMA 5JYEA 2IOYA 4BQEA 3QQ5A 3UXHA 3W3ZB 2OWEA 4TTJA 1E2IA 3EAQA 4NHOA 3FOFC 4PHTA 4A1OA 1U9ZA 3GJXC 2RHBA 2W6NA 3TNDA 2Y1WA 1KEEB 2OK8A 4F71A 1B26A 2ZRMA 4R6WA 4EBBA 2GM9A 3WKEA 2V54A 2VUGA 4QGFA 1T5LA 3HQ4O 3ZYZA 5AR1A 3PU6A 3L8DA 4PQRA 3MGKA 1P77A 1Q1EA 1ABFA 5EP3A 3FM9A 1B15A 5EIOA 2W2PA 4HL6A 2A1UA 3S55A 5I9LA 4JYCA 3H65A 3UWDA 3D6UA 5BQFA 1RJWA 3HCBA 3LSYA 4MJLA 5DNDA 1WXWA 4CU2A 2VUTA 3UXMA 4A3CG 3GUVA 1P2DA 5BOVA 3P2YA 1OPRA 5JPDA 2YHSA 4IOJA 2GARA 4QUAA 4YECA 5AKJA 2B21A 2QV7A 2ZVJA 2AG1A 2JVJA 2BCJQ 3ZHVA 2CLCX 2LP4Y 4OK6A 5AK4A 1H05A 2IYLD 2WU4A 1LVHA 4YK7A 3WRXC 2CUZA 4BVLA 1LLDA 3EDOA 4M86A 4R2XA 1KIFA 5AIAA 2I54A 1NRXA 4P3YA 4EHIA 4QKQA 1NC1A 1OASA 3WZMA 2A5YB 2X5KO 3J81A 1NVAA 2O1EA 5FOTA 5KNLA 1RABA 5KNBD 1A4IA 1BMFD 2LW7A 1D5CA 1KI9A 3CCBA 3SI7A 2FSVA 5JADA 1VL5A 4WHMA 2FZ5A 1U2EA 3TL2A 5KMGB 3Q3JB 5ALIA 2AN9A 3UIEA 1GIAA 3Q6IA 2E4UA 2BAGA 2X1LA 1MTOA 3N8NA 4BMNA 4DREA 1ZJ6A 3LW7A 3N5CA 1LBIA 2VA9A 4PLTA 2ZRHA 1HORA 4LY6A 4D4JA 3A1SA 1PTKA 4GQAA 1KBZA 4CCAA 1ZA2A 4QQKA 2IWHA 1QS0B 3KC2A 4B4UA 1OLSA 3WGZA 4B1FA 3GFQA 3KP1A 4Q24A 2J3DA 2BKXA 2BTQA 1ZGBA 3ZDFA 4MWBA 5EJ6A 4WFJA 1YFJA 5IYBG 1G5TA 3TRIA 1XTSA 1FFWA 1X86B 1ESDA 4QGAA 1Z2DA 2AG6A 1N6HA 2P6MA 1CD5A 4W6QA 1D04A 2AOUB 3S99A 3N6VA 3P9NA 2FPPA 4IWYA 2VJPA 3NBYC 4A8JB 4EM6A 1BWRA 2D8MA 4RL4A 5CNKA 4YN3A 3ED1A 4QJBA 4IQ4A 4V3CA 1H6CA 1OC2A 1WU8A 4I81A 1TJNA 3COZA 3SQLA 1L7AA 3HU1A 2R4TA 3A1VA 4J49A 1GZ3A 2Z2YA 3D8HA 1ZVJA 3N2ZB 1K98A 3D9QX 1N7JA 2BGWA 5LDGA 2AXQA 4RCVA 3FWKA 2WAMA 4TZ6A 1O96A 3PPYA 3QMMA 3HGQA 1LNSA 3T3IA 1M7HA 1VI6A 4HQFA 3IQFA 2BEUA 4DBVO 1XXHB 5ER9A 1IB6A 3S7ZA 1IIBA 4NZOA 1KL7A 3MAJA 1YB5A 2A6PA 2EOAA 4FYWA 2P9QA 2VP9A 3H9BA 3HO8A 4KREA 3EZLA 1MA0A 3PCRB 2JARA 1NATA 2CLSA 1NRWA 3B48A 2JG3A 3L06A 2JJQA 2GR9A 1BCRA 1RYRA 2Q9BA 1PBTA 1YBAA 3IXQA 3BWDD 1NW7A 3H0KA 1ST2A 5LMCA 4M0MA 2NTYC 2PNJA 3B38A 5EOVA 3TEMA 5CA1A 2ZPTX 3F78A 4FMPA 2GUWA 2B5VA 4Q4JB 3WP0A 2HU2A 1Q95A 4AMYA 1UINA 3JQFC 3KVOA 3OC6A 4ED2A 3GCZA 1VAJA 3QU4A 3T1VA 5HRCA 1DOZA 4JLAA 2EARA 2B1IA 3KEMA 4E2YA 4DANA 1N56A 1WQ4A 4RYLA 2B1GA 1L5QA 1W581 4L0MA 1C0EA 5AYVA 4WY8A 2HGZA 1K63A 4Q1DA 4EYKA 4CKEB 5ERXA 4KVGA 3BMCA 3L01A 1XGKA 3OF5A 5AW2A 3R5XA 3GEGA 2QTBA 4QGGA 5J1TB 1J2YA 3CE9A 4PLFA 4FINA 3ABZA 2HZBA 4KV7A 3AL0C 3M49A 3IQZA 4RSMA 1CR4A 4OLAA 3D8NA 4YR0A 2FJZA 1Z2PX 3HG7A 3FZYA 4GU5A 2M6SA 3P9RA 1V4VA 4ER6A 4XX1A 1PTJA 5AJUA 3ET4A 4M8SA 2IDZA 3H5AA 1BMTA 4ARSA 2WKQA 4LDZA 4WESB 1EKXA 3PZBA 1RADA 1CRLA 3R1IA 3WNZA 1PN3A 3NEAA 2V59A 2P9BA 4ABTA 4LF6B 3OJXA 3QVGB 3N07A 3ETJA 1W5FA 1M6WA 1ISSA 3SS8A 3ZKWB 1QUFA 2J48A 4A3IG 4CMAA 3A6LA 4LMRA 1FU7A 4YJFA 5KG5A 3CC8A 4BMZA 1JDVA 3KKZA 1SUIA 3AW9A 3OPQA 1VJ5A 1IJKA 3RC9A 4JX9A 1X7XB 4G8JA 4ISBA 5CU7A 5KFAA 3K6RA 1NUPA 2J3HA 2EP7A 1CZOA 4IIEA 3BIFA 1IN5A 1ZM4A 5HUQA 4P33A 4M7OA 2XGMA 1DLIA 4P2GA 3BMOB 2A4KA 2BGTA 3GLHA 4FFBB 5K3AA 2AX3A 3MLEA 1UBLS 4QUBA 2XTMA 3AIOA 2H65A 4KDRA 5FJ8G 4MTCA 1TT5B 1KPIA 5J2UA 3AVTA 4MRVA 3QBTA 3PGMA 1C9MA 4M22A 3KQHA 4AECA 1VI5A 1S1CA 5DTJA 1KH3A 4PBSA 1X7ZB 1NW5A 5LDHA 1V5GA 2A4MA 2AHRA 3T3HA 3HZOA 5GP1A 4G85A 4UMDA 2OHJA 3MWDB 3QSYA 1ODKA 1JQAA 2FEWB 4LY0A 2E7ZA 3H8SA 1Q6YA 4C6TB 2ZIXA 1KEVA 3QKRB 4PPNA 4JYBA 4OLJA 3GMSA 5IBRA 4YCCA 3DL4A 4FDMA 1QGZA 3CFYA 1UBFA 2PSDA 3SJAA 1Y5RA 2DCUA 5AW7A 1PT8A 5JV5A 2M6LA 2P11A 8ADHA 1L5NA 4I8IA 4W9MC 4EB6B 2H4HA 2K4MA 5C51B 1OXTA 3WISA 5D86A 3YASA 2FKAA 3JVEA 3DL2A 1J6UA 2XADA 3V7NA 3MRTA 4R1LA 4MV9A 2YXEA 3RASA 3DEIA 2OSVA 3NH6A 5EJ8A 5HGXA 5FL3A 4IS3A 1Z6PA 4N5MA 1K1EA 5JQGA 1GAWA 3E18A 2QJRA 2FLNA 3RUFA 3KT0A 2XHZA 1D2GA 4CMEA 1DKMA 3MG9A 5DX0A 3RFXA 1ZXXA 1KO1A 2WSLA 1P1CA 3O3NB 1KK1A 2BFEB 4M0DA 4LHXA 1ZIPA 4KPUA 5FBVB 2Q62A 2GAFA 1MJ5A 1K8XB 1QZXA 3M4ZA 4Q3OA 2NW6A 1E59A 1E2FA 3NTLA 2NXEA 3ZZ0A 5IF3A 3KTAB 2JLCA 4TTRA 4MMYB 4FCCA 1GNTA 4HAWA 5A4MS 4EX7A 1GA6A 4BVGA 3G7UA 1M2NA 4X20A 4EFLA 4RQTA 1KIAA 1PFWA 1TEHA 5DOZA 2F9LA 4U7FA 1XUOA 4NOJA 2II6A 4MLDA 1UFVA 4NAUA 2ZTUA 5JAMA 2OV2A 2YXPX 3PUWA 5JJBA 1A88A 4JB2A 4WIAA 2FF7A 3IXMA 3B1ZA 2X8JA 3PHJA 5EJ2A 4UUOA 2FKNA 3IKTA 1U0NA 3W8EA 2RJ3A 4CRWB 1S2GA 4A3JG 2RG7A 1O6ZA 2ZB2A 4A0QA 4DMRA 3OIWA 2F7SA 3TEJA 3AFIA 4QYIA 2VPSA 1P6UA 2FW0A 1UFKA 4KLAA 4UCWA 3ZCUA 3B2QA 4WW0A 2A3NA 2P9JA 4W82A 3GGDA 1PKXA 5TF0A 2P3SA 2C4HA 4ZJPA 3KK0A 4PO1A 5KFNA 3OE1A 3NBXX 4J0IA 3ZDXB 2YW2A 4BFWA 3QVJA 1LDYA 3A28A 1Y1RA 3LPDA 4MQLA 3GTOA 1N6KA 4XSHA 3EGXB 4NK5A 2OV4A 3UMMA 5BQOA 3HY4A 2YC4C 1JAIA 4C04A 1NXPA 4Q1VA 4MS4B 2HW8A 5BYKA 5A2GA 3I01M 5ANRB 4GPEA 3PWKA 1IOVA 4DUGA 4EGAA 3ML1A 4J0QA 4B6SA 4F1WA 3BQNB 1J99A 4TRJA 1CKEA 2YCBA 1CETA 1E5DA 2QQGA 3OZAA 5GVSA 1NM5C 1MRSA 1Q83A 3RYFA 1PWEA 3KLPX 4TVSA 2Z8YM 4HVTA 3T7IA 3GU3A 3BAZA 1ZK2A 4C0SA 2XVMA 5C9ZA 1U8XX 3M4IA 1WZCA 3IT0A 3EMKA 1ZVKA 2Q0XA 3EH1A 1PR6A 1R66A 5EZQA 3X44A 3G88A 4BQRA 1NF2A 4TQ9A 1CQJB 1HDXA 1XYGA 1O0SA 3MR6A 3MD0A 2IZ0A 3PX3A 2X0KA 1PD1A 1VA5A 3MTBA 1Z4KA 3WL8A 2NVWA 3S2UA 4DRXA 2FMTA 3X2EA 3MJ4A 1G8MA 2EDCA 1RWQA 1ORDA 4HFRA 4MI3A 2XVAA 1V7PC 2FFHA 3NHZA 2WB1A 2CF6A 5IVDA 1KR2A 3EIEA 3LWBA 1HLGA 4MA5A 3HKEB 1OTXA 3G7NA 3JQ8B 1YJ8A 5EWGA 1TJ4A 4O3FA 4UDNA 2OZPA 2ZYSA 3USZA 5DT9A 3Q5EA 5F77A 1EAYA 3QV1A 4ZCQA 1SC4A 3GWZA 2Q7XA 2MWMA 2CE2X 1CG6A 5PNTA 1PFUA 1W5TA 4DR7B 3MWKA 3S8EA 3MT9A 4U00A 2L17A 4B3MH 2BMAA 5AM4A 4OX9H 4RVOA 3GP5A 3OWXA 1PL0A 5HMMA 2A0YA 2ZVPX 2EBUA 1XQ9A 2JFWA 4Q15A 1J9ZA 3WB0A 1HE8B 3SM3A 1FTWA 4CXMA 2RMKA 2FZ4A 1CJCA 1DQYA 3H6HA 2ZAMA 1TKRA 4HGQA 4PYLA 1U7HA 2JIOA 3EFHA 1WEHA 4U2GA 4WCVA 1WUHS 2QGFA 5LJIA 4BWVA 1L9KA 4NXMB 5AVJA 4Y8VB 3IP1A 2BJWA 4ZI3A 1Z4IA 4A4DA 5CDSA 5BSHA 2HX1A 4QJ5A 4CMIB 3E15A 1JQBA 2IKSA 3NYRA 1JR2A 3GGGA 1E9EA 1APBA 2JPDA 2F43A 3GARA 1H4SA 1CYEA 4EI7A 1KQOA 2HQSA 4U7PB 5DE3A 3VR6A 4X71A 5FO0A 3GNQA 3W3AD 1T9HA 4HTFA 3HB0A 3ACDA 4WTOA 3K16A 1SA0A 2CMFA 5FQNA 1XPUA 2F62A 3NO4A 4X9XA 2EFJA 4DY6A 3IH5A 4JBHA 4RAQA 5JNVA 3E7DA 3NIDB 4E3ZA 5KC9A 2PRIA 5JBNA 3LCVB 2IX3A 1M2KA 1BA2A 1NOKA 5G0TA 4EJ2A 2OO3A 3DDUA 2PKQP 4YPOA 2A9FA 3D3WB 3LCUA 1PSWA 1HDGO 4E22A 1VIVA 1YRWA 2L82A 3LVRE 3ZUGA 1XZQA 2FX2A 2XUPA 5J2TA 1KI7A 2NZWA 1TZMA 4JHXA 3SSAA 1FBNA 4JB8A 2ACKA 4WV3A 2Q3CA 3UWKA 4DADA 3HKBA 4Z0TA 3D31A 2OYSA 1ZHHA 4LDNA 3G2HA 5FD6A 2R6FA 1M73E 1V1RA 3I2KA 4RDHA 3PEUA 1RI5A 1E0DA 4KUGA 3TLGA 5K0ZA 2XOXA 1PD0A 4L51A 1BHJA 4NXMH 1YZQA 1NBMA 5FLYA 2RH9B 2XYVA 2IEZA 4D9FA 2ZS7A 4ZEWA 2WAQA 4C5AA 2F1RA 3P0HA 3GL9A 4OQQA 3CLUC 3BPSA 4DUGD 4BO3A 3D6JA 3F8WA 4UVEA 2F8TA 3GRCA 3QY9A 5A5FA 5JPCA 2QSJA 3ZJUA 5KJEA 4FFDA 1O9GA 1AK2A 4TLDA 2G6BA 4GZ6A 1UFOA 1X74A 3KPWA 3KR1A 2FEOA 3E4CA 2QR2A 4F21A 4HNRA 4IJQA 1ZUNB 3AR9A 3IQDB 3ZWKA 1PQUA 3SJUA 1H22A 3FZGA 4BCDA 1SCNE 1P1IA 1M1ZA 1TFUA 2X8WA 3NAZA 4UVHA 1UJ6A 3WIUA 4QXRA 4LGCA 3C5CA 4PLGA 1ZGJA 4K81B 1LV7A 5BT9A 3CR8A 3RVNA 4HXFB 2E0IA 5L1LA 2W2VA 2JFNA 2EJCA 2KBEA 4JNCA 1PJRA 3IS3A 3OJEA 3G2NA 3G8CA 1YQDA 1U31A 4N54A 2YZ7A 2ZYVX 2BFDB 3C3BA 5CBPA 1PT7A 4GI7A 5TRTA 1A9RA 2OFOA 2YVQA 3O1LA 1G5IA 4JV5H 3COYA 2IE8A 3V8NA 1GCIA 4Q37A 2NNLD 3GRKA 1OFUX 3BQ1A 4JIGA 3VDMA 1KYQA 3W5UA 1KVQA 2CJWA 4Z8YA 3DV0B 4F6LA 3KUDA 3KKNA 3G82C 3X1ZA 4GQIA 5LIPA 3R9IA 4X5OA 4LOIA 1PNQA 4M7EA 1OAAA 5KWEA 4IM7A 4QFCA 1LB1B 3PNYA 3PICA 1B1AA 4IO1A 2WTNA 3FNQA 2C2EA 2IVZA 3U44A 1QGYA 2OBFA 3CN9A 2C83A 3OI7A 1SG9A 4IICA 4JJAA 3B5JA 3UY4A 1A7KA 2A59A 2GDZA 3REOA 3DBRB 5K8VA 4ZIRB 3BD9A 5KKAA 3K1ZA 3UCXA 3SYTA 4KFRA 3ZH2A 3OVMA 2XWQA 3LIIA 1A8HA 3GRRA 2DEUA 4O4LA 3ICQB 3OPYA 3EXHB 2MYNA 4PZEA 3VR6D 2D6FA 5LXTB 5IP7G 1IULA 2ZULA 4CNBA 1OX4A 2XA1A 3L6RA 2KM1A 3OIGA 2IEIA 2D62A 3H1PA 2X0EA 4EL0A 3UC5A 3OESA 1G6HA 5EA2A 3R7WB 1JG7A 1E1QA 2OCGA 5DN6A 2XZPA 1V4NA 4RMHA 4HCJA 5JAZA 2GLTA 2CHEA 2GZHA 3ZEAA 1J0BA 3EWAA 1G64A 2QE6A 2XCAA 4ZT4A 3UB3A 4AZ0A 2D5CA 4OB8A 3CEAA 5ABPA 3ETGA 1Y1WA 5EZSA 2RHCA 4PSUA 1JXOA 2C35B 3MT8A 3SIPA 1YJXA 2G1PA 3I9V6 3PXCX 1BDBA 4GHWA 4URXR 2VUMG 2JBWA 1ADCA 1EK2A 1Z7EA 4JI3B 2DC1A 4EL5A 2BM0A 3F5QA 1QDEA 3WDMA 1WXHA 4EA9A 2WYHA 1FP2A 1WAMA 4H3HB 1C41A 2RGRA 2OQ2A 4HRAA 4C3ZA 4CF5A 4HAYA 4Q1EA 1NX9A 2VKTA 4KNWA 3GLGE 4CBVA 1AY0A 2JLVA 2WKPA 3WAJA 1M6HA 1Y1VA 13PKA 2QA5A 1FSSA 3F6SA 1BVYF 2RONA 3DBLB 4LG1A 5EKXA 3PC8C 1JA1A 1NBMD 4MVJP 1XMPA 2PAFA 4WCFA 4PYMA 2FWAA 4P93A 4B85A 5ES4B 5LDDC 1YBVA 5C18A 1H0RA 2HNAA 4FDLA 1TCVA 4XLZA 1RWWA 2C5LA 4QL3A 3RK0A 3MRXA 2CLFB 3C7CB 3OAAA 2I7XA 3BXPA 3S8YA 4Q39A 4B81A 3K72B 1C7JA 5EHQA 5FAKA 3SY8A 4NOLA 2XRYA 5E7QA 3SR3A 1X2EA 1YAJA 4KNYA 5AKGA 3K70C 4ENPA 2O8BB 5KX5A 3DDZX 5CCDA 1ZN9A 2XQVA 3QSGA 5C2JB 4DIBA 2AEJA 2VR1A 1Y9AA 1LLQA 4LSMA 1QUEA 1Z82A 2I2XB 5SYMA 5B4UA 1B2RA 3DE1X 1Z39A 3JQAA 1YNSA 3LGSA 3ABSB 1SC9A 4BASA 6REQB 1TD9A 4OHUA 5LKAA 3QXCA 3DLHA 3I45A 4JUBA 1E3TA 5EJ5A 2IBSA 1QDLB 2EQ5A 2J0UA 1YQGA 3WKCA 1QFYA 1LTKA 1OA1A 2CL6X 3CG0A 2PUJA 1R0WA 4URHA 2I8CA 1KAQA 1VKZA 4K28A 1KPHA 1TQDA 5LFAA 1BYIA 3FWHA 4IQ8A 4JKYA 3RFUA 2REXB 3WLPA 4KR9A 3TLAA 3M6LA 3NHKA 2O8CA 2CGEA 3X1JA 2QN6A 3HV2A 3VZBA 3K05A 1DINA 1WUKS 1ZISA 4HAUA 2HU7A 4AP6A 4FFWA 3IX7A 3GOQA 2O2HA 4G26A 1AKTA 4MPPA 5BSWA 3PGKA 4ZEMA 1Z8DA 1CZRA 2V3WA 2VAPA 1BMDA 4CKBB 4DLRA 4BTVA 1SELA 4DR1B 1COZA 3N0VA 1PT6A 1UKZA 4B83A 2ZCVA 4ECQA 3DWEX 2QBYA 5DGDA 5F78A 4IIJF 4PFKA 3Q8QB 1E2KA 4JBNA 4B7UA 4IAJA 4ASUD 1YVRA 1JVNA 2ZJ4A 1AK1A 1REQB 5JSQA 1M1XB 2Q21A 1EA5A 5JAOA 5A3SA 3HJNA 4BL5A 2XNKA 4R0NA 5FHRA 2QTWB 4FOSA 3SDZA 3A9WA 4KX5A 5B4VA 3PPXA 1E1QD 5DN6D 5C8YA 3DPSA 4LRSB 2TMKA 3OMWA 4NE7A 1ZXLA 5IDQA 2BN4A 1QMGA 1RI3A 3I9V1 3DFMA 1B3RA 3HRHA 4EMTA 3D4OA 3NPAA 3SDBA 3NGXA 3EGDA 5DLPA 2YFHA 1AS0A 2D1RA 2ESRA 2AD5A 2ZT7A 3WIDA 1DXHA 3IERA 1CJVC 1J9GA 2UVPA 1GGNA 2HRCA 1JAZA 3I32A 3PI7A 2QSZA 3O8DA 4XYLA 2Z9CA 3OBBA 4WJLA 3OO1A 4N5HX 2HR1A 1W88A 4GH5A 1KSJA 5LXTF 1U9CA 2PCJA 1V2HE 3EOAI 2QPOA 4H7DA 4QUGA 1NJ5A 2PIDA 1E62A 2ZANA 3L8EA 1XFDA 4AS2A 1T4DA 5AQ1A 1Z22A 4RJ2A 3MIZA 2C2BA 2C2RA 5CCEA 2PS1A 5F51A 2ZTVA 2ZRAA 4DNQA 5DI3B 5U4XA 1E66A 3T5LA 4GKVA 4Q93A 2W9BB 5B3JC 3PYLA 5K99A 5CTJA 2CYBA 2GD0A 1D8TA 3GDOA 4CM8B 2NUBA 2Z3VA 2LUOA 4QBKA 4RPKA 5GJCA 5EP2A 4W5TA 3OAAD 2PLRA 4QRIA 4ZO8A 4UC0A 1RKUA 4JDUA 5LLTA 5I5EA 3ER6A 4U6QA 4BU1A 1JJAA 4E5KA 1ZCAA 3IN5A 3EZNA 3QNWA 1SU8A 2AK3A 1EVIA 4BV8A 2QUZA 1I33A 5I7HA 1FUUA 3R7DA 5AVXA 2X76A 5A62A 3HFRA 5LD2C 3VU9A 4LIPD 2GEBA 1AUPA 3LF1A 1KYWA 1EUDA 4RV5A 4C6SA 1VOTA 2DT8A 1W0JD 2WIAA 4DA7A 1NXTA 3AY6A 2XMQA 4HUJA 4WOCA 4UULA 4AF7A 2JLSA 3OHPA 4X63A 5FJJA 3FNIA 2CLHB 3RC3A 3AG5A 1V25A 1FVHA 3TFQA 2GCNA 1W94A 3PWSA 3CH6A 3C98A 1NBWB 5I7AA 2Z58A 3QYJA 5FPTA 1NGSA 3HDGA 1RC0A 4BLVA 3FWZA 1QNLA 1US8A 2G83A 2X14A 1L5KA 2GETA 2C2WA 5DVZA 5HS4A 3V1KA 3KU4A 1OBOA 3PR2B 1ZAKA 1CZUA 2H9IA 1Z3IX 2ZB4A 4P4TA 5LQKA 821PA 1P7YA 4QICA 3JTMA 4NWIA 1NVEA 3LCRA 1R00A 4FMDF 4B4OA 2WTUA 3IIEA 5KFQA 4LBZA 5DG9A 3A1UA 4YNBA 5JZBA 4KN9S 3PA8A 3Q3GE 4N3CA 4RNOA 3PYMA 1UH5A 1TM1E 2BHSA 5HF8A 3N3BC 4TLCA 4AY6A 4OHKA 5JDCC 3VMFA 5KFYA 4IVQA 2QN2A 3IHWA 1J25A 4L3OA 1YIDA 4XDYA 4LC0A 5DT2A 1PZGA 3QF4B 4PEVA 4NDNE 1ZIOA 1CLEA 2YU9A 1FRFS 2YMMA 1BE0A 1LDNA 1AGPA 3GFPA 4EW1A 5FYQA 1RWVA 4J9RA 3LKZA 4ALJA 4GSYA 4C2UA 3EXIA 4FN4A 2C7RA 4XEHA 2WIDA 1VHQA 3V2IA 5KNCH 5KDDA 3L0CA 5AVWA 3CWZA 1BW9B 3EDYA 2ID8A 1SUPA 1M8GA 4AKHA 3VI3B 5EQFA 1P5ZB 4MHTA 3HCEA 2WP0A 1QP7A 3E61A 1WWKA 4N5DA 3V6LA 3V48A 1Z0KA 3ZH9B 3CN7A 2PA3A 2XXAA 2YYZA 4YFVA 2MR5A 1C7ZA 1LPPA 1L7OA 2UYOA 3C7TA 2JFFA 1EQUA 2BBTA 3KD2A 4MRSA 1G6Q1 1T35A 2V7GA 4DSTA