3N6XA

Crystal structure of a putative glutathionylspermidine synthase (mfla_0391) from methylobacillus flagellatus kt at 2.35 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
467
structure length
451
Chain Sequence
b'TKPFDEMFLQDEVIRPIYAEYAAWLQDVPHQQLESKRQEAELLFRRVGITFLIPFDVVPRILSASEWARLSDGAIQRVKALNMFLHDVYHDQEIIKAGIVPSSILANAQYRPEMFGVDVPGGVYAHIAGVDLVRTGENDFYVLEDNLRTPSGVSYMLENRKMMMRLFPELFRRYPVAPVEHYPQVLLNNLRAVAQAGVHEPTVVLLTPGAYNSAYFEHAFIAQQMGIELVEGQDLFVRNNAVYMRTTEGPKRVDVIYRRIDDDFIDPLSFRPDSMLGVPGLLSVYRNGGVTLANAVGTGVADDKDTYIYVPEMIRFYLGEEPILSNVPTYQLSKADDLKYVLDNLAELVVKEVQGMLVGPAASKQELEDFRQRILANPANYIAQPTLALSTCPTLVETGIAPRHVDLRPFVLSGKTVSLVPGALCRVALREGSLVVNSSQGGGTKDTWILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Putative glutathionylspermidine synthase
publication title Crystal structure of a Putative glutathionylspermidine synthase (Mfla_0391) from METHYLOBACILLUS FLAGELLATUS KT at 2.35 A resolution
rcsb
source organism Methylobacillus flagellatus
molecule tags Ligase
total genus 132
structure length 451
sequence length 467
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14403 CP_ATPgrasp_2 Circularly permuted ATP-grasp type 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.270 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3n6xA03
3.40.50.11290 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3n6xA02
3N6XA
chains in the Genus database with same CATH superfamily
2P4UA 1YZFA 3UMYA 4CPDA 3VA7A 5KHOC 4F21A 1D7OA 1ICEA 4EYQA 1RKVA 4BNFA 3AUFA 4X60A 4ZVRA 4LK2A 1QSGA 3RGZA 2WJJA 1EI9A 5EJEA 1AQJA 5SZHB 4JLWA 1L4MA 4H0FA 1XGKA 4AMBA 1S3SA 3KPJA 5WRFA 2C82A 2ZYIA 1OKKD 4WJKB 2IMWP 4R83A 4I55B 4MKFA 3IOMA 4QXPA 3A37A 5LDHA 1HXHA 1NW7A 5AHRA 4II2A 2OD7A 1VSUA 2HAEA 2MJLA 1OIVA 1Q1AA 4Q03A 3HCFA 2A4KA 4ZPJA 3H84A 3EBPA 3KTDA 1RMYA 1X19A 5KG5A 1H2YA 3AVOA 3H1AA 5KTNA 1Z29A 4R7TA 1OR8A 1PHRA 1VDZA 4DV7H 3I8SA 3DNPA 4Q19A 1E3SA 1YV9A 4KUHA 4D5EA 1XRJA 1YONA 3OIWA 1TB4A 4DZTA 1R9TA 3ETDA 1BX0A 3AI3A 2FMKA 1CXZA 3A36A 3BOSA 2I8CA 4TMYA 5D00A 2Q0HA 1E9CA 1V8ZA 4I3GA 1O95C 4LY6A 3PZBA 2ORED 2YYAA 1Z37A 3LQ1A 1X1BA 2DTDA 2KE5A 1C9NA 2P11A 1YDWA 2QYSA 3WA7A 1QP0A 3ZHZA 4P83A 1H4QA 3FE2A 4KRXA 4F11A 4BBRG 5JI3E 4OU4A 4PHCA 5I7WA 1R66A 4EGAA 1WY5A 5E9JA 2PMWB 3AM3A 2OGZA 2GD2A 1TMGE 3FDIA 3NR2A 3ZX5A 2PT9A 4OBEA 3RIYA 1NVWQ 3IAM6 3KD2A 1ESDA 4WZBE 1TZBA 4D0LB 1AS3A 4NJMB 2E21A 4YRNA 1LSSA 1Z6ZA 2CCKA 4UZFA 2A9VA 2MSKA 4IQ0A 3IT2A 1IH8A 4JJ6A 4G8CA 4YCBA 4YN3A 3IOEA 3KL4A 1JFSA 4UD2A 2G80A 1WKCA 4NV1A 4TV8F 3TL2A 2I7DA 4WBXC 2A8YA 2VPTA 2P9TA 2Y6VA 1WG8A 5LXTB 3TOXA 4NKRA 1U0NA 1RYMA 1I30A 4PBRA 4E5KA 4CC6A 1QRAA 3D8RA 4HAYA 2UKDA 1ZGBA 4LMYA 2VSXA 2C8VA 5KREA 4GRAA 3U7EB 4KYIB 4A8PA 4PHGA 3IVRA 4DL3A 5EZSA 4YV1A 5A4AA 1QH0A 1DC5A 4G85A 5A3QA 1F4LA 4QIWA 1JAZA 1W8DA 1V9PA 1L5RA 4TXJA 4WFIA 2O8BA 5HKKD 3GIQA 1S2DA 3PCRB 4KWEA 1HH4A 1V3UA 2AW5A 3KHSA 5K0LA 4GMXA 1KMIY 2I80A 5B3KA 3WHLA 5IWAH 3ZVNA 4RF3A 3H2SA 2ZTLA 4LJAA 2ACWA 5HJEA 1OYOA 4FSXA 2OKGA 4ZC1A 4DLXA 1GADO 1GG8A 2G04A 4J76A 1CR1A 4XFDA 3L0CA 3L1VA 3IUQA 3F9CA 4DV2B 3ZD6A 1A50B 4KH1A 3HDGA 3ROGA 4BGDA 2FWIA 4GC7A 1N5JA 1FFHA 1KEKA 3KTAA 5HG0A 4WEQA 5B3JC 3C8UA 4O2RA 4A03A 1TYZA 4MGEA 3I9MA 5C9ZA 4DL7A 4ZZ2A 3E22B 1U3VA 2HL6A 3I2HA 3MM4A 1UQUA 1ELOA 2FZKA 3CX6A 4F8YA 3RSCA 4N49A 3OO1A 1BCRA 1U0HC 2QTFA 4S1PA 3C6XA 2GPSA 3Q0IA 4ER0A 4W1SA 1U99A 3GLVA 3CM0A 4OX9B 1D8TA 3BVPA 2GM3A 1P6UA 4IHJB 4X62H 4TQ9A 2EQBA 4KVFA 4DSUA 1W6RA 2AI1A 3AJ8A 4QBTA 3DBVO 4N6GA 3VDMA 1T8UA 5ENDA 3ZHQA 5CH3A 2ZQ5A 1Z0KA 2QMOA 4ED2A 4LJLA 4PSVA 2GCIA 3LYHA 3QHQA 4M0MA 5MHTA 5FYDA 1E3WB 3ADCA 1XTVA 4ZVVA 3PHHA 4FW9A 4Z0NA 3LP6A 1GRCA 3VI4B 4B4UA 2B1IA 3WBFA 5A4JA 3LVFO 1WCMG 3AR4A 4B73A 5JALA 4Y1RA 3W7VA 4LF5H 1NF8A 1NDUA 1VJTA 1JTVA 2BI7A 2X40A 3I52A 2O6LA 2ZSIA 1UFKA 3BBLA 3I72A 4FGZA 2OCDA 1O57A 3GNSA 1FP7A 4ZI7A 1VHTA 3WQHA 4U9IS 2DHRA 3IE1A 4HI0E 3PA8A 4MITA 2PYIA 4BJHB 3FYTA 3K35A 3LVBA 3BSYA 1YT5A 1BG6A 4J0MA 1VXOA 1LB1B 3NM5A 3E9MA 4UNIA 3A6JA 3EXAA 4RU9A 5SICE 3CTMA 3V2GA 3KZOA 4M9SA 3UMMA 4WACA 4RCYA 4AN1A 1FTYA 1NJSA 1Z8DA 4YHHB 1HNZH 3RSGA 1VCOA 1NWHA 4WZBA 5A5GA 4Q1BA 4I1YA 3UZUA 3SOPA 3KHUA 4XIGS 3G1UA 4KPUB 3KTMA 5F2OA 1WE2A 4IS3A 1WXDA 3OSNA 1NXXA 2ZIFA 2AUMA 3K1AA 3QBVA 4LSWA 3LUCA 2XKAA 4OSPA 1PFQA 2PRSA 1J2UA 3RFCA 1MW8X 1E7RA 2W6QA 3F90A 2XDQB 4W6QA 4DR7B 1H0SA 4NYMR 3QLJA 5KHLB 3EGWA 3OZUA 2BGLA 4I1UA 4I9GA 1M0SA 4V24A 3JWJA 5CIQA 1VE3A 2YHAA 3LP8A 1WEHA 3TZBA 3LXUX 2R47A 4OCZA 2O7QA 4GGPA 3AUYA 3MERA 2AGOA 2I22A 5K4HA 2EKLA 2W6ZA 1MEEA 3WQSB 1SIWA 4EBFA 1V71A 5HIJA 3IT1A 4QJ3A 1Z0AA 4QUDA 2E2WA 2QT9A 2QRZA 3QENA 3AY0A 3MRSA 4FLMA 3G8YA 4G5OA 1P61B 4JI2B 3NALA 2PH5A 2ISQA 1TKAA 2HHLA 4S05A 3L4BA 4RTMA 3AERA 5AO9A 3U3OA 1KFJB 2GM4A 5TT1A 2FPRA 1W46A 4OHCA 2WJGA 4GLLA 2QDXA 3QVXA 3WJ7A 4UULA 4AI6A 4X7MA 1Z2NX 2WJZB 3ZX4A 3G7UA 3HJUA 2BSQA 2YJTD 1DIBA 2H54A 1MRNA 3KELA 4BFVA 1XXHE 3JQAD 4FHFA 1IIRA 3GB9A 5A2GA 3BFJA 5KDDA 5AFSA 1BWQA 1NT2A 1SG9A 1E98A 1Y1LA 1VRVA 2C4WA 2B3DA 5JY1A 4MKHA 2ZS8A 2NUAB 3U48A 1LA2A 2EFCB 3N2IA 3UT0A 2H4ZA 3E5MA 1L4GA 1HT1E 2DUUA 4K3UA 2YJZA 2QTNA 3SE7A 4UVGA 4AJKA 2VP9A 4WD3A 2ZREA 4R8KA 2OV6A 1YS4A 1NUSA 2V59A 3UMRA 4R0VA 3ZV5A 2IE0A 2G40A 5L4NA 3VZQA 2PR2A 1P1KA 3A1TA 4BMXA 4A5SA 2GPNA 1DXQA 2JHFA 2PVCA 1Q0RA 4UXIA 2AH5A 3SHOA 4WFQA 2OBLA 4BZQA 1HYBA 5JARA 2ZROA 1VKJA 2VBGA 2HIHA 1MJ5A 3P9QA 2NP7A 1W5EA 4WT7A 2AJBA 2GZRA 4OB6A 4EGSA 5IT0A 3L92A 3ICOA 1TVEA 1NYQA 2YW2A 1XVVA 2HDHA 2WICA 4Q4CA 1K6MA 1RQGA 1JILA 4IEFB 3K6RA 3W3AA 3T3EA 3E5RA 2VXCA 1V11A 1ZN2A 1OREA 1G9SA 2PWYA 2HUPA 1XKTA 2GNOA 4TN5A 2W57A 2W5UA 2P9CA 2JA2A 3DEHA 4MI3A 4LYGA 5AK0A 3JSXA 4PGAA 1X1SA 5JCZA 1ZWLA 2W4MA 4NZOA 2MTBA 3VTAA 5TV2A 2O05A 1JDPA 2DPYA 2D8MA 5A6SA 1ODIA 4R9VA 3CSDA 4AT1A 1T26A 1VM6A 1DMRA 1ZSVA 4LGYA 2O3QA 4YAJA 3QELA 3T7IA 1L7BA 2HMSA 1S4QA 1QHXA 4RK6A 3RWMB 3P20A 4FS3A 2TMDA 1WR2A 1V16B 3BK7A 3H2JA 3BCHA 2QPOA 3L43A 2GN0A 4NBVA 2IPMA 2ZJ4A 3BK1A 4KRGA 5CLQA 1T0IA 2F3RA 3MYRA 3LLUA 4U7DA 2RDMA 2WFLB 4DABA 2CMDA 1QKJA 2BBTA 1L7NA 4UNQA 1W30A 5EQDA 4DLRA 3AF2A 1VRCA 2AF3C 1ZRNA 1IBMH 3TIXB 4RUCA 3JAKA 1KS2A 3BN3A 3TJZA 4HQOA 2B1JA 1ZUWA 3SPXA 4PSDA 5AVOA 3MUFA 3KQYA 4DUGA 2B4YA 1Y5NA 3HCBA 1UM9B 2R6R1 4N65A 3I9NA 2IEBA 2ZR0A 4OHZA 4EB6A 2EJVA 2BFAA 5JNRA 5BSRA 4OI1A 4ODIA 4AWAA 4Y30A 3LYLA 4EPVA 1X8KA 5ALXA 4OB8A 1PQUA 3GRUA 3KETA 3A25A 4CM7A 4CKZA 1TD1A 1DGSA 1D1PA 2HLDD 3QV1A 3OX1A 2CXPA 3CLTD 5AOAA 2P6NA 4ZOAA 4A8TA 3M5CA 4CCYB 3DTVD 3TZKA 3WL8A 2IZ5A 1JRLA 1J6UA 5FWXA 4WGGA 4YTEA 1D2GA 1DDGA 5TVGA 2XWBF 4EEQA 2GF0A 3LVQE 4OUKX 1SZJG 4NZNA 1E2NA 2AZTA 2FA9A 3RRBA 1MVNA 1GYFA 4OAOA 5AHOA 3N5KA 4BP1A 2HKIA 3K8ZA 5JNVA 4YYEA 1A9OA 2GFQA 1TT5A 3ORFA 4BC0A 2H1OA 1XXHA 2G63A 2AJ8A 1D6MA 5K4AA 1NXWA 2I4OA 1V2GA 3IQDB 1Y7HA 2V6JA 1RRKA 1RYFA 5K51A 2Y67A 1WDKA 3ELUA 2O0JA 4JI7B 1ESEA 1JU3A 3UWKA 3K0AB 5LA6F 1EVYA 1KO5A 4AM8A 4W7SA 1Q3TA 4J0JA 4WQMA 2Q62A 3PPVA 4CLDA 3FVRA 4YDSA 5BV2P 1NT4A 5MFZA 3NGLA 1Y7PA 4RPGA 3LKBA 3EFOB 1OIXA 3QU7A 1D4ZA 5BVGB 3OPXA 4MB0A 3ZDCA 5D1HA 3T0IA 5BW6B 2IVFA 3GT0A 2CGEA 4FE4A 3IMFA 2ZVQX 4M7EA 2A9FA 3GRKA 5LZ2A 2RDIA 1WCXA 2W8KA 3MT0A 1GKYA 4R3WA 1RJ9B 4TSFA 2PXCA 3OZBA 4DCCA 3C3YA 5JSZA 4IINA 1BKSB 4D9HA 2VSQA 3TR6A 2C7OA 1E8DA 1SFRA 5DSZA 1B23P 5K3EA 3HB4X 3FHOA 2PVSA 1DZIA 4ZJYA 5DI9A 2C2HA 5BXYA 4CT4B 1X42A 4EDFA 3KU4A 4R1MA 3ANYB 3GN2A 5BN4A 5IDQA 2ORYA 2WJIA 4MLPA 4J2TA 3ZGYA 2JJMA 1OXBB 5K8IA 1QGDA 3D7KA 3PGLA 3AF5A 3ROEA 2VLBA 3MSCA 5KB3A 2VC2B 1JMVA 3W3AH 3WHPA 3JZMA 3M49A 3IAUA 2XC9A 3H1EA 3ND6A 5KYWB 4CDNA 3HOWG 1NXOA 4EY5A 2EWMA 1REQA 2C9OA 2ZIXB 2FPGA 2QV7A 4LBZA 2EWVA 2Z1MA 4WLFA 5LIRA 4C0QC 3W5JA 2FPXA 3LBNA 4E2FA 3AL0C 1QK5A 4LAFA 3FAZA 3AFGA 2YZKA 2WU1A 1TYAE 5IXJA 4DE5A 3AESB 3QPVA 5HHTA 1ZN8A 4M8IA 4LPSA 4JI0H 3IMEA 5JROA 1SIBE 1N56A 2AN3A 2WJPA 2ZTVA 1RP1A 5K09A 2L17A 1KQFA 2PKWA 3UPTA 1FFBA 1THMA 2RGUA 3LZCA 5IT5A 1FFEA 2YVKA 3CT6A 4INOA 4TRJA 2WMNB 2X8AA 5BNIA 3ZNPA 3DXZA 3S27A 1KQNA 1X7ZB 3GLIB 3HUDA 3NNDA 3IHTA 5K0JA 1U0LA 2A57A 1EVJA 2QSJA 5H80A 4C4XA 2NZWA 3AV0B 3HCAA 4OP1A 4ZDJA 2WINI 3D6MA 4GBED 5AXCA 4B6QA 1DTSA 1KSHA 2QMQA 3IPCA 5REQB 3WYCA 2VDNB 1UDCA 4UVIA 1EAYA 3IDZA 3IUEA 2WHRA 2OBFA 3B1YA 2QYZA 2GJAA 2JCGA 2VH2A 3K9FC 1LPNA 2GSWA 4J1TC 4RNDB 5FI0B 1JAYA 4ATNA 3T41A 4LTDA 5LOVB 3A9WA 2GMWA 4YRZA 2Z5FA 1D2NA 2DWUA 4XUCA 4UREA 3LXXA 3F8SA 3GJZA 1OFIA 3T7JA 5IM4F 2DERA 1VPWA 4ZC8A 4MHTA 2QLFA 2WHQA 2IZZA 1TQDA 4JBHA 3DL2A 3QU2A 4H4EA 2X14A 3AZPA 3OQBA 2O5RA 1NRXA 1XRLA 1N2BA 1VFPA 2K2WA 2OZEA 1KYZA 4G0YA 1KC3A 1Y4UA 5B7GA 1I5RA 1J90A 2RHHA 1T5TA 3GA7A 1L6RA 2QJOA 1AN9A 4M1OA 3TPCA 1LS1A 4K0KH 3EMDA 3I2FA 3CS3A 3LT0A 2Q2TA 3P9CA 1P6XA 1E64A 3K0FB 3BJIC 1U6JA 2GYVA 1SVOA 1WNFA 3G17A 1FNSA 4AVYA 3NORA 2QN3A 3VOBA 3KPYA 5FCDA 4KHZA 3G0HA 4ALJA 3N1UA 4OH1A 3S81A 3ZCPA 2V6GA 1U2ZA 2GN2A 3WGIA 4HLCA 3II6X 4UJ3A 2VUHB 1MQ8B 3DONA 4NBLA 1M54A 3SM9A 5AESA 1PJ4A 3C7KA 1SC9A 1T2VA 1NY5A 5CBPB 4G4GA 1QC5A 1DKOA 3RSZA 3MR6A 3HHEA 5BVHB 4G2NA 5DNYB 2PGJA 4HL6A 2GQ0A 2ZVJA 1D03A 5CLGA 3EJWA 1G2IA 5LBUA 3FCAA 2VAXA 3DVSX 3KVOA 3MGAA 5JZSA 1YCDA 4C5CA 2C2RA 3DDOA 3NJ4A 4KN5A 3ML1A 1HTTA 1J8FA 1H8HA 4EIWA 4KR2A 5ALOA 1L5SA 5JU6A 3P19A 1E7YA 2BFFB 3QFHA 4J6FA 3G6KA 1RAGA 1W4RA 1Y33E 1FDTA 5E6SA 1NR1A 1QHNA 5ALDA 3VU0A 5T8KA 5JANA 3MUOA 1X13A 2B35A 2AR9A 5AK4A 3DM5A 1OLOA 1XCPA 3H3FA 5ILQA 4QU5A 2WHXA 4QA9A 4BVAA 1BQ4A 3C7DB 2QVYX 4C7JA 3G2QA 3AEKB 1BD4A 4AF8A 5E3HA 5JOQA 2PRZA 3MT7A 4I4TB 5IKOA 1R15A 3JCZA 3UXYA 4FZ3A 4MW0A 5IW8A 3U31A 1C0PA 3L6BA 1WEKA 1X9GA 1ZMXA 4QDKA 1SD1A 4RS3A 1FRFS 3HR4A 4QXOA 4I08A 2J41A 2I4RA 1IBLH 3W1EA 1U8TA 5AOCA 5CXUA 5FULA 3N2LA 2ZFUA 4DM7A 4X65H 2Z2YA 3E2PA 3NPAA 3ZWBA 3OECA 1C4XA 4NI5A 4B43A 5L4SA 5E0KB 1T15A 2D7JA 3VJMA 5FPRA 3IBTA 1ZC3A 4B33A 3L9WA 4D0RA 1BIFA 5ERXA 3X1YA 4NCXA 3F78A 4YRPA 4ZVQA 3A6FA 3UJNA 1NYLA 1ZGCA 1RFGE 5A0FA 3VFDA 1JR3E 3GG2A 1M2NA 2C1EA 4MW5A 2JAUA 4Y2TA 4L78A 3ZEIA 2SNIE 3SWWA 4BAGA 3KYCB 1LPSA 4BRWA 1MO4A 2RK6A 1CUFA 1EFKA 4WZZA 3M4JA 1QTQA 3CLSD 1KFBB 2Q3LA 1II9A 4D3DA 2Y0DA 5IRCD 1UXIA 3DL0A 4ISBA 4Y1EA 2D54A 2W2NA 4KNWA 2O3JA 4UBMA 4ZCRA 4A0QA 3H16A 4HWGA 4PGGA 3OLCX 2QN2A 3KBOA 3N43B 1LD3A 4MX8A 2FEAA 4JI5B 3EPJA 2FCRA 2QLNA 1Z4LA 5AICA 4BKUA 1SVWA 3K70C 2HVRA 5TGTA 4R41A 4FXOA 1JBEA 3VYUB 3U4HA 2J48A 2AOTB 5PNTA 1P2FA 3TBKA 3Q5DA 1YS2X 4BGIA 2CYAA 1N1GA 4E5VA 4XM2A 3EAQA 3QJYA 1CUUA 4RAOA 3IBGA 4ZT4A 4HNGA 3N58A 4PBSA 1GTVA 3ROFA 3JWPA 1EWTA 3KYDB 5EG5A 2FP3A 1OTHA 1EK1A 1JHYA 4HDKB 1HC7A 4O8ZA 8OHMA 4LA4A 4EYIB 3RK1A 2WF5A 5CBKA 5AVZA 1NC3A 4CKXA 5C53B 4DR1B 2IP2A 3OCXA 3PE3A 1Z7EA 1B6TA 1Q14A 1OYVA 1W85A 2HT1A 1L2TA 4RK7A 5DWDA 3S55A 1SUCA 4N03A 3L46A 1O9GA 1ZHSA 1C30B 1GFSA 1G16A 3K4PA 2HSJA 1OX4A 1P74A 3B36A 3AKZA 3IEIA 1YOBA 5CJJA 4CM9D 2VT2A 3WAKA 1TJNA 3WGLA 2BFBA 1RI1A 2PX5A 2J09A 3T3MB 3QFSA 2QT1A 1VSTA 2PX6A 3DNMA 1D4FA 3QJGA 3T1VA 2QZJA 4OXRA 2CKDA 2FEPA 1RRMA 4NONA 3D4BA 5CK4A 2FUCA 4UTNA 2CFSA 5ELXA 2VWQA 5DCYA 1DEOA 3FOWA 3VKWA 1VA5A 1W2HA 1D4OA 3OIDA 3D3NA 3P2KA 4XIYA 1BTOA 2FFJA 1K4YA 3GEBA 5J59A 4MULA 3UC5A 1P7VA 2WR8A 4JBYA 4JLVA 1QK3A 5AI8A 4J9RA 1MQSA 3PS9A 4FOOA 1SC6A 4DXHA 5JD4A 1ZOIA 5JS8A 1Y9AA 4M86A 4O4LF 4K9LA 1DAKA 4YRDA 4PC1A 1F8YA 5KOIA 4ZJZA 2GCGA 1Z8NA 1GUBA 1TAHA 2XPCA 4LYYA 4Y2QA 2ZPUA 2C98A 3NBUA 1OI2A 1MO3A 5FEUA 4NXNH 1XTZA 4W1RA 1PR4A 4H3KB 2GN8A 2JFVA 1JV2B 3H6GA 2C5SA 4EF5A 2IHUA 3ONDA 3F8NA 3HKBA 4KDFA 1M76A 1ZMRA 4IRCA 1CERA 3OEHA 4LF8H 4PIVA 1Y3AA 2ZRFA 5NULA 2WA1A 3IP9A 2HXYA 1JR3A 3PLNA 3OIVA 4WADA 1PZNA 2CCJA 1L5OA 2V74B 4H1UA 3PC4A 2AOWA 4FNMA 1RHRA 1NP3A 1RM5A 2HJGA 3V80A 2C35B 4HZGA 2ZIVB 2PANA 3H42B 3WSVA 2AG1A 1W9MA 1XYVA 3LS2A 3T6KA 1R6BX 5ER9A 1ORIA 5EZYA 1GPLA 1MCZA 5KG3A 2OEPA 3S0JA 4GI3A 4R8RA 3DMRA 4MWSA 1XDSA 3E3NA 2GZHA 2Z95A 1FXSA 1RMTA 3BZBA 2BRUC 1GSOA 5GM1A 5IP5A 1FKAH 4CMJA 3PO2G 2Q0XA 1AQLA 1KY2A 4TRRA 3EXFB 2ZSKA 1KXJA 3BXHA 1IB6A 2JIBA 4WA8A 5JWHA 1NQUA 1B0ZA 2LPMA 5DTEA 1OTXA 4EZIA 1RJGA 1RTKA 4BC1A 3VR4D 2WHPB 1EU1A 4A9AA 3T4EA 2V3CC 2O4UX 3GCXA 4D9BA 3KUXA 1EKXA 1SRQA 1RJFA 3JQBA 1Z5UA 1M67A 2L2QA 4WKGA 3HNPA 4Q4HB 5COBA 2NWQA 1P9RA 4IZ6A 3DD5A 1LSOA 1OT3A 3D3JA 4MQBA 1H1TA 3RB0A 1CULC 3ZUPA 4INAA 5AVUA 2PNFA 5H1YA 3QUAA 1XAIA 3PWSA 1EX1A 5EXSA 5JC8A 2R65A 2JGNA 4JVMA 2DFPA 2IUYA 1CUIA 2BONA 5KU7A 3JVVA 2O5EA 4R2KA 3N0XA 1AGRA 2HHCA 3KJHA 4K2HA 4KQFA 3R44A 4CIWA 4ZWNA 2MSEB 3EGEA 4V02A 3L7JA 4E03A 2ZVPX 3LW7A 4PLGA 2G5PA 3TW8A 1ODFA 2PX0A 2VPZA 4F4XA 3WLTA 4CTJA 3GVXA 3PW0A 2QS9A 1VP9A 3EPKA 1VMDA 3PC6A 2CWDA 2JFYA 2V7GA 3T1QA 4RUAA 2X9NA 1PX2A 1UWLA 3HJGA 3DZ8A 4HNVA 3IBFA 5SZKB 5KOJB 4V3CA 2GBLA 3BF7A 5JPCA 8AT1A 1Z38A 4LJKA 4DIBA 2OQVA 4X97A 4DPMA 4PX5A 4YI5A 2MR6A 3TFOA 1OWNA 3CISA 4K9KA 2GXAA 4A3SA 4F6RB 3NBMA 2JEYA 1RJDA 5DM4A 3I6MA 3EQZA 4AIIA 1CNFA 2BMAA 1YQDA 2PO7A 1YZVA 5DG8A 1DC8A 2H2WA 3KOYA 3RS9A 3VGJA 2R6DA 5C8ZA 5JVDB 1ZUIA 3O9ZA 1A8UA 1UK7A 1F2TA 3JAWA 2NUPA 2HWWA 3AHJA 5K3FB 1WHTA 1C1YA 1IUOA 3PSHA 5BQXA 4W9NA 3T4XA 3EIXA 4DLYA 1ISHA 2NVXA 3Q3GE 3PJDA 5AUQA 3MFQA 4EYOA 3IJPA 4JYAB 2IUUA 2VJBA 3TZQA 4NDAA 1LI4A 1CJUC 1BDBA 5JXJA 5L95A 3FNHA 1HEUA 2IDJA 2ZW9A 1TLTA 3TQSA 3HADA 2I5PO 3KT0A 1EBBA 3PBKA 2Q3MA 4QGAA 3R5JA 3DFZA 4L51A 1TL7C 4GR5A 2YBEA 2V0CA 2ZTHA 4FKZA 4KSCA 4E1VA 3ETLA 3GJQA 2AFIB 3EG9A 3V7FA 2XB8A 3IURA 2RC6A 4BCCA 4ETWA 1PO7A 2I87A 1C4OA 1AKUA 5G40A 3GHHA 1V4VA 1C7RA 4NYJQ 1A98A 4A3EG 3MWLA 4US1R 2B8JA 1TO2E 1OB5A 4MINA 3AEXA 3KZXA 4BJ6A 4IIBA 2CDRA 2HA5A 4G1EB 3LC2O 4F1WA 1XZJA 4RYLA 4OEHA 4OLJA 4QULA 1N9GB 3T5MA 4PS0A 3V1MA 2QTRA 3UG7A 1X3SA 1G3UA 2JIZD 2X7JA 4OOFA 3BS4A 2MCFA 4Q3KA 1RHUA 4TL6A 3M5WA 4BNDA 4V0ME 3EZ2A 3G9XA 1KFKB 2XXJA 1BYIA 3A06A 2NPFA 3ZHTA 4XSVA 1GGEA 2VWGA 3W8DA 4OIMA 2PZBA 3O4GA 3A26A 2BEWA 1F6WA 4UCTA 4LF9H 5J4KA 3MS2A 5IMBA 2W2XA 2YIVX 1X1DA 2O19A 3LL7A 1DUIA 3LL4A 1D0IA 2Q5OA 5IJ0B 1XLTA 1M8KA 1SBTA 1DCKA 3PNOA 1DX6A 1HNXB 2BKLA 3KE8A 4PAMA 3WQRA 1Y8QB 2EL7A 2MIIA 1Z6PA 3NLLA 4NLLA 4BEVA 5B2FA 2BFEA 3FJ1A 4GI5A 4OHVA 4RK4A 4LMBA 2W93A 3NHJA 4A6DA 2GLTA 4HQ6A 1R12A 2IXAA 4Y6LA 3EGVA 5HJ2A 1M2OB 1NBOA 4WNAA 4CC5A 2E18A 3HRIA 3U4QB 1TEVA 4G4JA 1YB1A 5A5VA 1RU3A 1IHUA 3FBTA 2H07A 4GX2A 1DJLA 3BZUA 2OLSA 1LCIA 3MXTA 4EEXA 3ITEA 4C6HA 3CLKA 4QNNA 1ZR4A 2JI7A 5EEGA 3OA2A 5B55A 1TWHA 1DKQA 1HOXA 1I0IA 2C96A 1U90A 3O7WA 1YQEA 4BQOA 1KEEB 4QE3A 5KSWB 2XHZA 2ZUTA 5F3WB 3S8EA 5FLXA 1UPUA 1WMAA 1NWCA 2JGIA 3KJEA 4OHBA 1OAKA 3HSSA 4JJFA 1N92A 2SHKA 3FCSB 1FUYB 3HZRA 4DCTA 4FHCA 3CNLA 4W5NA 3VVCA 1AXRA 1O97D 3F5DA 3HKCA 1P9WA 4WN3A 1RKQA 3VRHA 2JLRA 3GFSA 3W6OA 4J29A 1JB9A 3GA0A 3CGGA 5FUWA 2JI9A 5ALNA 1HG1A 1FDVA 5B2ZA 3LT5A 2DQ4A 4J8PA 4I81A 2BTQB 4W99A 1YGYA 5C52B 2PJDA 4I50A 4KE9A 4BRSA 4CMEA 3WRYC 1DAEA 2IXDA 1SK9A 3NI2A 4LSZA 1YB6A 2CUNA 5DLGA 2G1UA 1U7OA 1WQ3A 2ZIAA 3ESXA 1TWAA 1BE8A 4C6TB 3ZS9A 3ZV7A 1KY4A 4KV9A 2XUHA 3WRXC 4J9KA 5D1OB 2WYOA 3AY7A 2HIMA 1G8JA 1TW3A 4KBYA 2J5BA 4OG2A 2EFEB 1XEAA 1Z5NA 3N6XA 3B3AA 4MWDA 4TL8A 2Y0PA 3GAMA 1O0CA 3DOEA 5EPUA 1IC6A 4GO1A 3V8EA 1ONNA 4C0HA 2VZEA 3T9BA 1J07A 5BQ5A 1CEYA 2QR5A 4BB0A 1LZLA 2WNHA 4KE7A 5KFGA 1E9BA 3KHHA 4DIKA 4DLWA 1CLEA 1RPTA 1UT8A 2AYYA 1DE0A 3B1XA 1UQTA 3RFVA 4BY7G 1DJMA 2R4TA 5FI5A 4GEKA 2PE5A 3KXKA 4RABA 4V0MA 3VH3A 3IE0A 4RDIA 3OHSX 1G9TA 4R1TA 1YRLA 3HC7A 4AUMA 1CK4A 2H9YA 1I3QA 1OX6A 2LBPA 3VR3D 3HL0A 5KPJA 2QPAA 3FUXA 4TLAA 4GDFA 1KDTA 3MWYW 1P1RA 1A7JA 1XJCA 2PRYA 1SOVA 2OV4A 2R7NA 2HU7A 4C87A 3NTQA 3KQQA 4G1BA 1HSOA 3AIKA 3WS7A 1IBRA 4FHZA 2UAGA 4URFA 4DRYA 4EHLA 4HDNA 4AJNA 2P3OA 5C4MA 2RHJA 2HU8A 4FR0A 2ODEA 1JEOA 2JD0A 1RKUA 2O03A 4TYYA 1SKBA 2XKKA 3KZMA 2FZLA 3WAJA 4KXLA 5CFMA 2ODNA 2ZSAA 2G70A 3ZY4A 4JL6A 1D2AA 1QG4A 1LU9A 1QOQB 3TMKA 4I9HA 1OV4A 1XRRA 4JQYA 5TPZD 5FBVB 2FUG6 4ENSA 2UYQA 1W8IA 4COOA 2AZXA 2W70A 1BQEA 3VV2A 3D4LA 4OF4A 1O96B 2DPXA 5J4YA 1Y37A 2WPDD 2Q27A 3M70A 4YO8A 2Z2XA 3U80A 4KXNA 2QRUA 2PBZA 3OJ0A 4IDAA 3N44B 3SBOA 2AZ4A 4X8LA 4E6EA 1P29A 3I2GA 3V1NA 1PGJA 2W6IA 3S29A 2QQGA 2BFNA 4FCCA 1NAIA 5DTRA 1RJEA 1XKXA 2WE8A 1WZCA 5F9HA 4GOXA 2H7VA 4AYXA 4MA4A 3OQOA 4YPFA 1T5HX 3VISA 3CA8A 4RD4A 1TADA 4YRMA 5LMZA 1P1HA 1Z7YA 1WQ4A 4YLGA 2A92A 4IEIA 4L27A 3NAZA 2XVAA 3INTA 2GPTA 3C3CA 2Z5LA 2PGLA 2Z4SA 3SFVA 3FSEA 2IGTA 4AQDA 4N5DA 1SVIA 1K0FA 1WV1A 4IIUA 1ML4A 4ND5A 2QAGB 4N0QA 3OJXA 2R7MA 2YZGA 1W52X 2QW0X 3K9QO 2QD2A 5HK8A 1FXWA 4BLOA 1ONOA 1XVIA 1GL3A 4P4TA 1DAOA 3RU7A 3VSEA 2EZTA 2J4CA 2Q99A 2JK1A 4A2BA 3O03A 4PVCA 4UTOA 4O63O 4AY4A 3V8VA 3RK4A 3J7AC 3RBEA 3KAPA 4RACA 4BWFB 3RD5A 5JRDS 2R66A 3I8XA 4YJ3A 5AM5A 5DH9A 3T7KA 4GKKB 2JH8A 1SPBS 5C2JB 3O38A 4KQHA 1Y98A 1GQYA 1HRDA 4TQAA 1A5SB 3MGBA 2PL9A 4L85A 1B2LA 2FSUA 3V8RA 4EQ6B 4UM9D 3ENQA 2H8GA 2VDWA 1KL7A 3PIRA 1M6VA 2FCAA 3FTDA 3NM6B 3UKJA 2IY7A 2ODQA 5LNK1 2GTHA 4OSOA 1JKFA 1N0WA 5B3AA 1YQGA 3X3HA 2OGUA 1RWNA 3AONB 3OIGA 3CPJB 3ZV3A 5U4QA 1OBOA 1BOOA 5DI3B 2I03A 2H5EA 5F9LA 3JQQA 3GRVA 4F2PA 2QQFA 3EGDB 5DX0A 4CIAA 5YASA 3PHIA 3UXHA 5ENZA 2ECOA 4D99A 1XZEA 2PS9A 3BEOA 4XQCA 1H94A 3GEEA 4HADA 3LQRA 1QFMA 2BGIA 1DDIA 4EUFA 5LZ4A 3OZTA 3UPDA 4PYRA 2HK8A 2A1IA 2PAFA 3GLKA 1T9KA 2AKYA 1Z28A 7MHTA 3HO1A 4CKBA 4B6GA 3GGJA 2ORWA 2JFFA 4E33A 5A02A 1WCYA 1U2DC 2WF8A 2FP4A 1CSEE 3EZFA 4XPIA 1E0JA 2F64A 5F2NA 3QBEA 1O5TA 1JIHA 3BE5A 1XMSA 2W0SA 4DIFA 4MTEA 1NVBA 2CCGA 4Q37A 4GC5A 1K27A 5FJIA 3ITNA 2G36A 1GGHA 1V6CA 2X8LA 4WBNB 1XWWA 2D1RA 2HHHH 4BX8A 3HE3A 3RC8A 1DLIA 3E82A 5KFPA 1T3TA 3W8RA 3AUXA 3ONWA 3I4FA 3TLXA 2GEVA 1Y9ZA 3JY6A 1NA5A 4J94A 1PFGA 3E0XA 1SU6A 5AYVA 3CZ9A 4Y2UA 5JAZA 2AMVA 2XA2A 1FXUA 1AJEA 1WSBA 3GMIA 4W4TA 1N25A 3BGIA 1DBIA 4BMCA 3FHLA 1K6JA 2B0CA 2LGJA 2WEKA 4YB8B 2Z1DA 3WICA 2QRMA 4MPDA 2D2XA 5ALLA 1OH7A 1EWYA 3AM1A 1JB1A 4JC4A 3N59A 2H1SA 1RJPA 1JYFA 4JB2A 1J09A 1JT2A 4E4TA 2W2OA 2LZ0A 4BO5A 2WKPA 5EIHA 3D2AA 1SCJA 4B8YA 1S8FA 4PYKA 1HMYA 1FRZA 2R85A 1AK2A 2F1JA 1GTZA 1PFKA 3RJTA 2JVIA 2Z2JA 5ALGA 2WPNA 3DPUA 2XSZD 4MS1A 5DSXA 1MF7A 2OCAA 2FLVA 1NI4B 4Z4IA 2ERXA 3AVPA 3OT5A 5DT2A 1ACMA 4J16C 2PKXA 4TVKA 1S2OA 3SR3A 1BVRA 4B7AA 3CF2A 2EIXA 3MCUA 3VM6A 4EAAA 4Q12A 4JP1A 1UJ6A 4DDWA 4Q02A 4E15A 3L1IA 3HA3A 1II8B 4EO4A 3GJ0A 2GVDC 3UBTA 2ECFA 2FNAA 2Q6TA 2OLEA 1K68A 3A9RA 2J3QA 5KSZA 1P0QA 2I3AA 2BJWA 2NGRA 7REQB 3ZXXA 3VU3A 3K9WA 3N8HA 1ZFNA 2ZYRA 3TW0A 2F3UA 4YJDA 4TL7A 3SXUA 1YZKA 1GPNA 3VR6D 4JD5A 3ER6A 4HVLA 1PFYA 1JMKC 1NLMA 4FFBB 2PRIA 3RB6A 1NW9B 1ZMTA 4MUXA 3L3BA 4L8GA 5HDBB 3J80A 3DZBA 4V39A 1ISIA 3ZJTA 4UHEA 2CK3D 4PR0A 5E7JA 3SQWA 3EIOA 3RSOA 4XSHA 1P2BA 5T7BA 2Q2WA 1N32H 1SQGA 5TARA 1Z12A 5AVKA 2XF2A 4HDMA 2AX4A 6YASA 4DUPA 2RDJA 3FOAA 3KL2A 2IGBA 3H87A 3V00A 4O3FA 3MCWA 1GD1O 4CL8A 2PUVA 4XD7A 4HNUA 4G63A 1EZZA 2YH2A 2ZZKA 3PCXA 4WZ6A 4F9EA 3PIIA 2BGJA 2FVYA 4RVSA 5CX1B 2DTEA 2CBXA 3JR3A 4NCIA 1EM8A 2R1VB 2HTEA 1ZEJA 5ALYA 1L8XA 2XB4A 2JVJA 5EHQA 1UODA 3B9BA 4RB3C 1LVHA 3EWAA 2YJGA 2HHAA 3U1TA 2AFHE 4ZDWA 4LFBB 4OXQA 2XGPA 4MROA 1NRIA 2EX4A 3ZS8A 5BT9A 4RKEA 2R6HA 4ZJPA 4H35A 4OGLA 3T54A 2E82A 4UXJA 1KRWA 2G9UA 4JLUA 5KFSA 3NYIA 5CHEA 4DNFA 4FGWA 2R8BA 4TQSA 1W75A 1TUIA 2YY6A 4TOIA 3MBOA 2PA3A 3NX4A 4MWEA 4EJ2A 1C29B 3L06A 1E1CA 1CFJA 3SZLA 2RKWA 4X1YA 3FH0A 4B5LA 1D3AA 5C4GB 3MN1A 2Q5HA 4YXFA 4RVNA 1Y1WA 5HBRA 5C35A 3FI9A 3VJKA 4ALNA 1EAMA 1IIBA 2FJPA 2QEQA 1HRKA 4DF3A 1OJ7A 2GGSA 2IEDA 3RT7A 3Q8MA 3I9V6 5EWFA 3ISJA 4CWAA 3H4TA 1DWOA 4L8FA 3V97A 5F1OA 3OX3A 1I3CA 1Z62A 1XFAA 4B2LA 5G4KA 4PYQA 2ADFA 2IELA 2IKSA 1M1ZA 3CCCA 1ESCA 1EFAA 2UVPA 2JAOA 5DHSA 5D3ZA 2FSPA 4ZAVA 2BFCA 3S3TA 2UXDH 2PBLA 5DEOA 2Q4TA 4B84A 4OHFA 5TPWA 2DT8A 2ZUUA 3DZGA 3H0EA 3PEYA 1Z5GA 3EXEA 2LRHA 4RORA 4JBNA 2ZSBA 2QLMA 2W6JD 4F2WA 4IGAA 1C3VA 2WQZA 2X2FA 1HE3A 4K40A 5T64A 1A5TA 1MX3A 1G20B 1M10A 4MLZA 4DDHA 4PNEA 2ZPAA 4JXKA 4KXQA 4AS1A 3DBRA 4LMPA 2Y2UA 2AVNA 2XYHA 1YACA 4JXJA 2CWWA 2BFDB 4AL4A 5EXPA 2ZYHA 1KJQA 3HJFA 2ZB3A 4MI6A 3PFIA 4ZHQA 4LI3X 4O08A 1E6KA 2WD7B 5A4IS 5BO5A 3W2GA 3GLGE 2F1KA 4UHKA 2GCPA 4KIWA 3N8GA 4RZ3A 1OTYA 5LYJA 4JKYA 1XQVA 3MELA 4LMRA 1LY1A 4BAZA 3RT9A 4D4MA 3V6LA 5JZMA 5CNJA 3KHLA 2G6BA 1PNVA 4X5OA 1UMBB 2B9VA 3FNRA 4KO8A 5C81A 3SKYA 1VOTA 4QG7A 1HDXA 5EIAA 1R0BA 3DLAA 4QEZA 3W77A 2C7BA 1MJNA 4F4UA 1C0EA 1X74A 2WJVA 3B53X 3V4RA 3B6KA 3JALA 4UHDA 4MUYA 4JJKA 4MO2A 2IV2X 1J49A 4OP2A 2AUNA 4IWXA 3CXRA 1U28C 5DX8A 2A6PA 3LU1A 2JH9A 4XVHA 1XTBA 4LZZA 3DCNA 5C7YA 2OOKA 2VK8A 5C8YB 2H2FA 3UN1A 5BOSA 1H9AA 3M6IA 4MHSA 1MX1A 5AJWA 2GCNA 2X7HA 3QA3E 4ME6A 3UGQA 4XASA 1FF9A 4ZANA 4U7GA 4K0RA 2YV1A 4F3NA 3I6IA 3R7BA 1XJ0A 2VNIA 3KOXA 1U9CA 2CL6X 1U7WA 2CFIA 1IYZA 5BN1A 3F73A 1SULA 2VAWA 4O3QA 1PYOA 3VC3A 4B6FA 5BQOA 4UEOA 2R1UA 3ZJVA 1GNTA 4HGOA 4DLTA 5T57A 4KMRA 2JS7A 3VR0A 2Z4TA 1XV5A 5AJTA 2AFHA 5DLEA 5KDLA 1SKYB 2GJSA 4GVPA 5GM2A 1WKVA 2AHRA 1CUYA 2HB6A 5C32A 5DNUA 1ESNA 5ADVA 5BUZA 2A67A 1PHPA 1Z4PX 4MIKA 1OX5A 3CRVA 4KN6A 1G3QA 3ZW7A 1T3HA 4PSAA 1U9JA 1I36A 1VLQA 3A2NA 5H70A 1O95D 3ILSA 4OMDA 3UAVA 1NQTA 1JIIA 5CVTA 5LIPA 2A9QA 2CL7X 3CJRA 3U1BA 2YKGA 5KFHA 4HTFB 4B3RB 3QFTA 1H85A 3H8SA 3ZJ4A 5ARDA 3B5JA 1LJLA 3ILXA 2NU8A 4KAAA 1QR2A 4LXGA 2WE7A 1NY6A 4WASA 2YV2A 1LH0A 1YRBA 4YRCA 5FD6A 1XKQA 3ZWMA 1DAPA 3MR2A 1XHEA 1E66A 2CZGA 1ZLYA 3AHEA 3MAAC 3SK0A 2DPJA 2FN4A 4YCSA 1Y1KE 1CR6A 5DNWA 5EXEA 1JR6A 3L4SO 4CDRA 4ED7A 1R0RE 2GILA 4I99A 2CHVA 4BB5A 1BZYA 3S2EA 1TYEB 4PDBA 1QGUB 1N34B 4TMZA 1F8UA 1QNFA 4LPKA 3DD1A 4OSEA 3ZW8A 3C8DA 3U4MA 4Z4EA 1ZNXA 3WLNA 1GKUB 4OMFG 5FOUA 1INLA 1Y4SA 1N5LA 2I66A 3JYLA 1GQ2A 3OM1A 1DCFA 4OQXA 4JV1A 1UKEA 2XXAA 1RRPA 2GBFA 4JI3H 2ATLA 3ZU3A 2DY1A 1IB0A 1PUXA 1OOEA 5HZKA 1J5EH 4GRIA 2GJ9A 4P4SB 1TMKA 5H59A 3GLGA 1GLGA 1V4BA 2IZ6A 1WPGA 1XTQA 2FE3A 4ROTA 5E1BA 4PG8A 3T3NA 5FTLA 4GUAA 3F0TA 2VNJA 4OQFA 5FPPA 4KI0A 4UCFA 3GIWA 3EIWA 1DQRA 1KGDA 3WLAA 5KX5B 5TIIA 3G49A 1CEEA 3UCXA 1IU9A 3IP3A 3FPSA 2I1LA 4WI1A 3MWJA 3ZVLA 2YXDA 1WX1A 1DIOB 4KHPH 5CAEA 5F33A 2HRZA 4ZHSA 2XUIA 3VNQA 3JXEA 2A9KA 1K08A 5FPTA 4D43A 3M3PA 3MOIA 1FTWA 2FDRA 1ZJ4A 2KPOA 1MO5A 1G6KA 4E1AA 1PJLA 4BO9A 4EZBA 3SDBA 1RYYA 1MMFB 5JHHB 4G5RA 4O4IA 4OQLA 1N6OA 1DRJA 2C8LA 4MMXB 2L0XA 2F1HA 1ORWA 1UJMA 3T5PA 5E3IA 3MJHA 3Q3HA 4L72A 3KEQA 3WYAA 1SVMA 5EE0A 3P45A 1QE3A 2BKUA 2I0FA 3IJEB 3QE0A 1Z68A 1E2DA 5ES4B 4US2R 3EARA 3DFIA 1OBFO 1QTIA 3I9OA 1MA3A 4JU8A 1XLUA 4M38A 4V1CA 3NHLA 1RRGA 4TS3A 1LS6A 5CR9A 4FDMA 2JRLA 1KK3A 1MAAA 4M1WA 4HWSA 2C1ZA 1TEZA 2CDAA 3WY9A 3GRFA 2WABA 3FXAA 1M1NA 1C9MA 5I4CA 1PD0A 1U9YA 5EDWA 2R62A 2UUBH 5IZCA 3RLIA 2XTNA 3AMVA 1XMVA 1B15A 3R9KA 1ZZEA 3HYLA 5KJ6A 4A0RA 1MOZA 5FTJA 1PLKA 1UUFA 2EHJA 3NWJA 5A3JA 1MRSA 4GKJH 2YWCA 4U9HS 2VYVA 4BNLA 2JRCA 4EELA 3EVEA 4NMHA 4LY9A 4AG5A 1DFGA 4M36A 2H92A 1D1SA 5EYPB 1QGED 4F7DA 1MN6A 3R3UA 1PZHA 2BCJQ 3DKVA 2GFIA 3P0HA 4N12A 4IW3B 2RH5A 3F5SA 3M6UA 4WOPA 2L42A 4K6MA 3FTCA 4ZO4A 1KYIA 1NYTA 1SB9A 1XU7A 4WOBA 1QAOA 5F5LA 1K86A 1II0A 1I6LA 1IZ0A 3FJOA 2Z6QA 4CRWB 5HQ3A 3LUPA 4KZKA 5DE3A 4EHAA 5KG0A 1ZCAA 4X93A 3RAPR 4XYBA 1PW7A 3KEMA 1E60A 3T1YH 1I94H 1OWOA 2X8BA 4C07A 1R6TA 1RQ7A 5LL6b 3LGSA 4POOA 3E9DA 1TA8A 3P2IA 2LXNA 4QTZA 3WFZA 5JAMA 4PONA 2WD9A 5H5JA 1NE7A 7YASA 4XAQA 1R00A 1DG9A 3WC4A 3DMYA 2YXNA 3I39X 1E7SA 3S99A 3UFXA 2XJ4A 2YWHA 3JZAA 3KOZA 5LQUA 2A35A 5HZHA 5AQEA 2WVHA 1U6IA 2QAIA 3RFUA 1N2CB 3TJRA 1FPMA 2AIRA 5EIBC 1F38A 4LRQA 1ES9A 1Z47A 4CTKA 1JU9A 4DR3B 4XB6B 4LF7H 2HTFA 2FQWA 1R6XA 1UBCA 1SFOA 5KYTA 3I8OA 4J0EA 4LOJA 4XYMA 3LF2A 5KYUA 3UW1A 5CEJA 2R93A 2DFLA 1OFVA 1PCXA 5KOHA 2PAAA 1G17A 1LBSA 1R0SA 1HQDA 3HV0A 1WR8A 5TF4A 5BV7A 1HDOA 2NLOA 3FOFC 3OFNA 1X8XA 4OY3A 3UJPA 4NBKA 3EMBA 4D9NA 4ZRNA 2XMQA 4DLBA 5DLFA 5CEFA 5I9NA 1TQ4A 2HSZA 5B1DA 4O2BF 2YIMA 2OORA 4UFNA 1MAVA 2TMYA 3ZBQA 2GDJA 2VWHA 3PWTA 4FW8A 3DO5A 2HJVA 2RKBA 2RCYA 1IL0A 1DG3A 1W0CA 3V8MA 1SCAA 4FB5A 4C6SA 3GTMA 3C5EA 1XYGA 3Q88A 3TKLA 1TA4A 5L3SB 4OGGA 1ONPA 2JLCA 4RIIA 3NEJA 4ENVA 4I55A 4LE2A 3EEOA 5FDFA 2X0KA 3L9XA 4OQEA 4M2LA 5DTIA 5EHGA 1K5PA 3PNMA 2OFWA 4KLCA 1BU8A 4TWJA 1AD2A 4ETSA 1YMVA 4IIXA 1ZD5A 1XBTA 4BMVA 2PZGA 1EWRA 4JBIA 1RK6A 3AGQA 3WHIA 4PLFA 4W5OA 4K6OA 4G0ZA 2X2EA 4NMXB 4Q4DA 3QW2A 1PBTA 2RSLA 3CUEF 1VKZA 6ADHA 2CW7A 3C5VA 4EL5A 4KACA 4TLBA 3FCEA 3G1WA 4YMHA 3CNNA 3ZCRA 1KJJA 1A4XA 3N2NA 4EG6A 4RE5A 3N2GA 1OT5A 4BFXA 3AHDA 1R10A 4UVEA 4EFNA 4HVCA 1QHFA 1BN6A 1RVV1 2WAQE 4DG5A 2ZJ6A 1ZQ7A 3GVPA 1IY0A 1P5ZB 5FA6A 1PSWA 3C7AA 4N82A 2R5NA 4QUJA 5IAOA 1LJUA 2M1ZA 3IILA 3SQLA 1K8YB 2UUAB 5FPKA 4YQWA 2PEZA 1NJ8A 3RW9A 1G8KA 1ZX1A 3FMFA 2J0SA 4JNKA 5GJBA 5HF5A 2G1AA 3AB3A 3K4HA 3OUUA 1LBHA 4H6XA 1MJHA 4PR3A 3LO5A 3D0OA 3G79A 4NFYA 5CT6A 5DK4A 1QWSA 3ODGA 5EGNA 3UHPA 1MRZA 3DKKA 4NJMA 2HPHA 5IJAA 1PR1A 1GA1A 3O0TA 1PJZA 1I6UA 3H5LA 4KQIA 5JSYA 3QJ5A 1B26A 3TQIA 4E22A 4QWEA 1R9JA 4Z49A 1GTSA 5KFFA 4U00A 2VWPA 5CITA 1W0JA 3PICA 3HVUA 5LXTA 2HEGA 4QAJA 4DMMA 2EFGA 4Q9JA 2OCXA 2IOFK 4M8LA 2BLNA 2ORIA 4Y2SA 1WUKS 3H17A 1W6UA 5KVAA 4KLRA 2H5IA 2DPLA 1IUKA 4V03A 3OCUA 1XR3A 4YI3A 4HNRA 1AUXA 2IX3A 1P80A 3UUFA 1ECJA 3BDVA 3GF4A 4QWAA 1A7AA 2WLTA 2WJ3A 3V1LA 3S6JA 4BIMA 2FMHA 2ASVA 2HA2A 4GXNA 4X7BA 4MLDA 3L7KA 4FM9A 1E79A 3G1TA 2HREA 4RV5A 2BH2A 1IQPA 1FJ2A 3LQKA 2B7BA 2ES4A 3EOBI 1MNAA 3HJHA 1Y6FA 3LT1A 3NZEA 4H3VA 4OFBA 5F2KA 3T3DA 3NHYA 4IVPA 4BTEA 4WNYA 5BMVB 2G83A 3Q8XB 4UUBA 4DJFC 2P1DA 2XNDA 5BRNA 3CH5A 2GBPA 1JG4A 2WU3A 3SR0A 5B1SA 1XL0A 4KWTA 4NSNA 1T9AA 5BV8A 1XP5A 3T52A 2X4LA 2C2GA 2XUGA 5TE9A 5F23A 4QQNA 4S1NA 4RPHA 3GLHB 1EK5A 3G8BA 3OPQA 3E22A 4NRDA 5ISMA 4NX2A 1IBKH 2LR0A 2Q3JA 5EPEA 3HQ4O 5TQ2B 4A2WA 4CIVA 1C3OA 2O2SA 5A7FA 1E89A 2OBBA 4B83A 5ALSA 3K5PA 2Y3IA 4OGFA 3R6TA 4RGYA 3PVSA 4V1CI 2YOGA 1PGOA 4D4KA 1B16A 3A05A 5EY5B 1E69A 4FEYA 3AHCA 2JA5A 5C34B 2A0XA 1Y1WG 4U7PB 3I2JA 1LEHA 1KOJA 1E2JA 3GEMA 3OZFA 1E3WA 4Y2GA 3IBCA 4HV4A 3KR9A 4F45A 2O8EA 4MLCA 1ADCA 3PUIA 3DXYA 2XQVA 2F2TA 3UOWA 4DN6A 1AKNA 2KLBA 3TIVA 4DW8A 1FS4A 3QLTA 4IILA 3GAZA 3I5AA 1Z4QA 2WT8A 5DN6D 4E5PA 1W19A 1R5BA 2Q7XA 4FDLA 1GL9B 4X9XA 5BN3B 1TFUA 1XTKA 2WAQA 2QYOA 2BKXA 5K03A 2CD7A 1JPNA 2QUAA 2QZ4A 3GRCA 4RZHA 1WUTA 1UBOS 4K8OA 5FBHA 4Y6GB 1HR0B 4WLOA 3RCBA 3QEOA 4L73A 1KWGA 1JHXA 2PRJA 4IIJF 3RRZA 4NZ9A 2VG8A 1X6VA 3QNUA 2IPNA 4XRGA 3P9SA 3TGLA 4KQXA 4DR5B 3BIXA 3I09A 2PMFA 3AVUA 3DAGA 1GGJA 2YFKA 1Q0SA 2FLKA 3AEUB 4O2LA 4TM7A 1IBSA 2PLFA 5IK2D 4KPUA 4A23A 1IAQA 3ZH9B 1TD9A 3O8QB 1Q7EA 2RGVA 1DAMA 1R0YA 2R6JA 3ZN2A 4E13A 1FYVA 5JDIC 4B7CA 1QWOA 2WWFA 2JDID 1TWGA 4ZOLA 3D0RA 2XDQA 3AI1A 4NYMQ 4L5YA 2RHGB 3K5IA 4I5GA 3FCCA 4F3KA 4J07A 1J2TA 1J00A 2DM6A 1RQPA 2PUTA 3LKVA 5DXFA 5KAMA 3NV7A 3T1TA 3R0XA 5JADA 2R5WA 3P0FA 3SKVA 3DMTA 2BEUA 2DFKB 4PRLA 1F4PA 5LQRA 3ZIAA 2YZ7A 1THGA 4ERXA 2NUTA 4HJXA 1ZI6A 2JBHA 2XQKA 2PYZA 4S2UA 2YQ4A 2VATA 3ICEA 1GLVA 2BVNA 2HQ1A 2WMYA 1Z56C 1W5SA 2E9SA 3ZWAA 3VPSA 4EHKA 3EGCA 4NS4A 2N46A 2XMSA 1GQFA 2WP8J 3CRZA 2A86A 1TQHA 5L9AA 3H1GA 2GK6A 2R44A 3PXAA 2A9JA 2DZDA 1G0NA 5ILOA 5I8ZA 3ANMA 3A6KA 3RIXA 2UXBB 4CQLA 2NUAA 4M54A 1U2EA 5FL7A 5I7VA 4RHCA 4DV2H 1Y9EA 4D4HA 2C4TA 2G06A 1VE6A 1RQXA 2GAIA 3RS3A 4DMFA 3EPHA 2PDAA 3RYHA 2IFTA 4ZXPA 1OXUA 2A2ZA 5KYXB 1P45A 4BS9A 1EMDA 2PLWA 3FOCA 3GCZA 3AR5A 3IEMA 1QDLB 3K0BA 5AD1A 4MVJP 3CZMA 2YMLA 2I4MA 3F1KA 2C2MA 1E0AA 3I2YX 3BIJA 3MBKA 4RGBA 3HDYA 4NU6A 4OX9H 2EU8A 5KNLA 3P9YA 3JWIA 3PUHA 3CT4A 3G0OA 1VPLA 3D6AA 4X91A 1PSZA 3T15A 4DXAA 3U7FB 1UT5A 1JJAA 4ZCLA 3PEVA 3QEJA 3INYA 5CW1A 3W2IA 1HEIA 5EP4A 2PPLA 4RA9A 2Q1SA 4PPFA 1KIAA 3TKYA 4EW3A 2Q2OA 5LL6P 1HGXA 2V5AA 2IEAA 5KTMA 4DKXA 1Y4DE 4KB5A 1NSTA 5C51B 1FZTA 5KJEA 3UKDA 2YHSA 1YH3A 1H2ZA 1M7BA 1GUZA 2BM9A 5GJVC 2QTWB 2VSOA 2AGPA 1CX9B 4OBXA 3ESAA 2JCYA 3QWHA 1V16A 1VL0A 4OAPA 4I3HA 2VBIA 4IXTA 4QTUB 5CDGA 5EHZA 5HGJA 4JJIA 1DNPA 3DDCA 1DBPA 5F51A 4O8CA 1TOAA 2WFLA 1U8ZA 5JAQA 1FA9A 2Y1EA 2V5UA 2ALJA 3IJ5A 2X6QA 3ADBA 2HQSA 4QPDA 1XD2B 4Z1OA 3MUNA 1DB3A 3RUAA 3E5NA 1LTKA 4B47A 4YHHH 3F5MA 4GMGA 3IC5A 4RTPA 2P68A 4JITA 2F62A 1Y6ZA 4EA9A 4O02B 2J5KA 1L4BA 3SZRA 5G41A 1DX9A 1VB3A 1UM9A 3ESZA 1GPUA 3IDAA 1J4AA 1RAEA 4B6JA 4HSGA 2JG3A 5A3SA 3GLIE 1RI2A 4ESHA 1IHDA 3DBHB 4EKDA 5L53A 1GLNA 3UW3A 1X9HA 3V1TC 3WWPA 3E05A 5H4HA 2CV1A 4I4IA 5EIEA 4M0UA 4A8JC 3TLKA 1KEZA 4B75A 3ZZ1A 3TB4A 4JAVC 2F8SA 1DZ3A 1IEWA 3P4UA 2C5BA 3PPXA 3T3PB 3CE9A 5SY4A 3GDFA 4CMGA 4YJKA 4R9UC 4EHDA 3PUVA 2VZ0A 2OVFA 3SZUA 3FROA 4CU5A 2RI1A 4B32A 4QVKA 4WX2B 1FMTA 2BMEA 3DCIA 3Q9UA 2PCJA 2HCFA 1RWPA 5DHFA 1XVAA 2VRNA 1RQLA 4JI2H 3HJCA 4BN4A 1Z2EA 3K70D 1ITZA 4YJ2B 2AWNA 1RCFA 1EA5A 3OCCA 2WU0A 3OBIA 1KEVA 4M8KA 3IQWA 1P4JA 2EF1A 4GP9A 3U60B 3K0AA 4M76B 2PKRA 1FOEB 1CHDA 1I13A 4IXMA 3WYNA 5JDCA 2J3HA 4NTZA 4MGKR 4MHOA 1GN9A 1R3DA 3EFOA 4QHYA 5K1ZA 1UMCB 4F3RA 3GRYA 4RSGA 1K2VN 2QROA 4E2YA 1EFDN 4FYMA 4RTQA 4HX5A 3SQXA 3M5PA 5HBGA 1FMJA 4X1KB 4EHHA 3QPUA 3PC8A 2EYQA 1KQGA 3OE7D 4EM6A 1DUSA 2YY5A 4ITVA 4F84A 5EWJB 1RJ9A 2V4MA 4RIGA 4M1TA 1O75A 1FK8A 1AIPA 3DC7A 3I73A 3AWIA 1AU9A 3B6EA 4D6PA 2WWYA 3BXGA 2V58A 3W9UA 2DPGA 3R3VA 1W96A 1S3IA 3O73A 3M9LA 3PXDA 4D44A 1TVKB 3KEGA 4D25A 1WSDA 4IR7A 1RLJA 2AZDA 1GM5A 1NN3A 2IHNA 1L8LA 2BFOA 1H0HA 2O48X 2YFHA 3IKMB 4ZMSA 1GDDA 4DCUA 3NBQA 1B8OA 4AMVA 3MJTA 3KR2A 1YVDA 4CLOA 4RLHA 4EJSB 1LFDB 1FYEA 1P31A 3OJLA 2ZIXA 4J0DA 4L8LA 4F2GA 1GFWA 4RHFA 5HCIA 3QG5A 1SXJB 5FKJA 1RJQA 1NLUA 1KQ3A 1Z08A 5JJLA 2OHXA 4BNZA 2NTJA 4EVSA 2CNWA 2A5YB 3VUFA 4IDDA 3R09A 1WSWA 3AESA 2C7RA 1Z0FA 4UCWA 4LZLA 4AKIA 4YC7A 4C3ZA 5ESXA 3O92A 1L5HB 2RHRA 2QVLA 2MYPA 4M98A 1KRHA 5CB4B 1W94A 4B8WA 3T5LA 5CLHA 1UKCA 1Z2OX 2WYIA 2A1UB 3PNLA 1COWD 3V9AA 2PD3A 3S7ZA 1YI1A 1WZIA 2CY0A 1TXGA 2ZRMA 1X7ZA 3GLIA 1GSIA 4GOOD 2BGMA 4FQ8A 4XGNA 3S1LA 2PSHA 3KLOA 3T7TA 3C3KA 4P3KA 4B3IA 3HOXG 1X1RA 2GHQA 2NT3A 5JRJA 5REQA 3FYDA 4J3JA 1GY8A 4WFJA 3HBNA 3C41J 1W0KD 2QTZA 4NE2A 3WDSA 1MC5A 4LE0A 4ER5A 3ANSA 3D4NA 1PVDA 2GFHA 1PNTA 4Q8FA 3PUKA 3NDIA 4QREA 2ZT6A 2ILTA 5FFNA 3N8IA 5EJGA 2CVHA 3SMQA 3RR2A 1XNJA 4JVNA 1DXHA 3L2PA 3SC2B 5LOVA 4IR1A 3P7MA 1OI7A 4F60A 1NVVR 1M33A 1NNI1 3R77A 2JGLA 2QI9C 3A31A 4IO1A 2X0RA 1YULA 4DGQA 1UADA 1WNTA 3RV3A 5CA0F 3MPUA 2HZ7A 1AGXA 5EJ9A 5MGNA 5D1PA 1HDYA 5KT6A 5ICEA 1J97A 3DG9A 3CRMA 4PFKA 1FU8A 3PK0A 5FLKA 4OPMA 4LKRA 2QP9X 3RKSA 1YJCA 2HD4A 5CVJA 5EP1A 4DKJA 4JI7H 4EY6A 2XEXA 2HVQA 4YP1A 3TTUA 1NJGA 4RFSB 1CVLA 1FDIA 3K0FA 4HUTA 5AKXA 1VBGA 1QP8A 1QPGA 2CDCA 3QKRB 4AJ1A 4RNNA 3EDQA 1U04A 2C04A 3RK0A 1YK1A 1O2DA 1JFVA 3DAPA 3A3YA 4GP7A 1YZHA 1F6BA 5AVVA 3QKUA 1AH2A 4Z7QB 1NXQA 3UK7A 1L3IA 4MPJA 4ENWA 2QF7A 5CBPA 1MORA 2HLHA 4PX9A 4HGZA 2BHLA 4PFSA 4PM4A 3JD2A 3L0BA 4HH4A 3C0KA 2FQQA 1VE9A 5AXDA 3I12A 3D1JA 3ETCA 4KH0A 1X14A 4F5ZA 5K8LA 4G07A 4X0EA 1KOFA 5LQJA 3OAAD 5KFNA 2XCSB 1N0VC 1ODTC 1LLDA 3LHSA 4JJ7A 4M1KA 5LCXA 1JFFB 1E5LA 4BKRA 3BB4A 2FPUA 5JAOA 4D97A 3LMKA 1D9XA 1EVKA 1Z16A 2BFFA 4D9CA 2GCEA 4IV8A 2XGSA 4BNYA 1GQRA 4RD3A 4KFRA 2O8FB 3TK1A 3C5CA 4G09A 1U1EA 2ATIA 1XROA 2FWRA 2V7WA 4ZQFA 2JB9A 4ZRDA 3KAKA 3WDKA 4O4JB 3L1KA 5HILA 2ZUBA 3BXPA 1QB8A 1M9NA 3JQFC 2GZ3A 3AEKA 3ZNOA 3U56A 1RZUA 1S03G 2BTOA 4I4TA 5EHXA 3PUZA 2P5YA 3V7YA 3SY8A 4JOBA 1MVLA 2Z9BA 5I8WA 3HCDA 3AUSA 4CEHB 1V26A 3QVWA 4FS2A 3I0NA 5GP1A 2LV8A 3Q8KA 1PYDA 3H1PA 1AUQA 2J4FA 1O6ZA 2A0UA 5ENVA 3ME5A 1ZIDA 3MLBA 3HEAA 2D5CA 4LBWA 2J7PD 4BATA 3UNXA 3G6YA 2EWWA 4U8GA 2PS3A 4UPVA 1UJ2A 3WBJA 5CXXA 2OK8A 3U7HB 4M9ZA 1RE1A 2V7QD 5F1KA 4A0HA 2P2SA 1EUYA 3K92A 4J7XA 3QIVA 4LZAA 2FR0A 2VYCA 3HU1A 2RF4A 1IM5A 5D85A 5JAIA 4URVR 5A5FA 1IOZA 1W36C 4UNRA 3PE4A 2PD6A 4WNIA 1QIEA 3KYCA 4M6WB 1A9XB 1W5FA 2FXVA 3THYB 3BWDD 1SA0B 1E9RA 1VJ0A 2CUKA 1O5IA 3T1HB 3J80W 1G7TA 4ZQEA 1UR5A 1ND6A 4DUZB 5SY6A 2OHGA 4AC9A 4JS0A 2DFDA 2WWTA 5FJJA 1KI6B 2HPAA 3TFQA 4C21A 3ZCQA 4DGSA 1XXLA 2EZ9A 1X77A 5HKLA 3HR8A 4JP8A 5BQPA 3K6SB 1JH8A 4QOIA 3K8OE 3N0TA 2HK6A 1P4SA 3H1FA 3KVVA 3FRIA 3U2QA 2Y1CA 3NUZA 3A1SA 1QTRA 2AOTA 4KIJA 2OYRA 1FTSA 1BA2A 1YXMA 4BL5A 4CM3A 3QUSA 1TIBA 4CLXA 4Q6WA 1E2GA 4KGXA 3OCJA 4V0LA 1Z0SA 1IK4A 3VU1A 4BBPA 2IF0A 4HDKA 1HZJA 3KVRA 5DWVA 3U16A 4TLEA 1C4WA 1CD5A 5THQA 1HNNA 1KSJA 1SU4A 2BZGA 4FUQA 5FI3A 2VHEA 3VNAA 2DETA 1SH7A 1T4GA 3L8EA 3CZPA 4BNNA 4OQZA 4W9MC 3FTEA 5C4IA 1WPXA 1C30A 2F48A 3TAXA 1XAGA 2REQB 4B74A 4MZDA 4LSXA 2ZZNA 4OYYA 1QGOA 3H97A 4TXLA 4IY1A 3LWDA 3N5CA 4NBSA 1DX4A 1PAUA 2AS0A 3M6WA 1HT2E 2VYND 1NQWA 5I47A 2XOKD 1WVIA 1FDOA 1TECE 3KU1A 2E3JA 4ZEWA 3FGPA 1USVA 4G1UC 4MKIA 5AW5A 1YZGA 5JMWA 4HYKA 3GIMA 5EJ5A 3VH4A 5EIXA 1U8FO 5C1OA 1D6NA 2ZUCA 2DPHA 4JH0A 2QL5A 1JDJA 5J2UB 4IMJB 3M8KA 4RC9A 4ZKEA 3P96A 1MC4A 1OROA 2WMOB 4ECZA 3ZQJA 5LB4A 1HKHA 4YV0A 3R20A 3N7AA 1MHTA 2DQYA 1IPFA 4IH1A 4QOHA 5KVVA 4YAKB 4AZWA 3PXUA 1O8CA 2QJRA 3UWPA 4KNVA 3H5NA 3BMCA 4PCLA 4F8EA 4CM4A 4G0OA 4EK9A 4U7WA 1AHPA 2R82A 3EC7A 3S2GA 2VHZA 3OZXA 1JJVA 1CHNA 4JLDA 4MVJI 2FSHA 3N2KB 1FL9A 3CXUA 1QORA 2Z9DA 2XIGA 1R4MB 3G02A 3T9EA 1PT7A 1MJFA 4G5SA 4G1MB 2A4MA 4CEJB 3U40A 5JC1A 4DDVA 2QGFA 1QONA 2GBGA 1FRQA 3HOZG 1FMLA 2EYUA 4B3MB 5BT8A 3QVSA 4WK6A 4V2UA 2C3MA 3F7OA 4H3SA 3IYLW 4Q3LA 1L7AA 4YV7A 1MFZA 4KLAA 2LCIA 1SBIA 5BQFA 2VKTA 4ZZIA 3OOJA 2ZR9A 2PXAA 1Y9JA 1K97A 5A9SB 2H31A 1YHNA 2FY8A 1Z2PX 2H4WA 1BXRB 3TO5A 1BMFA 1PX0A 4JUDX 1P4AA 1R6DA 3FNBA 4Q1CA 4O4HF 2AFIE 1CRWG 1XMXA 5IEBA 2HJWA 1WPQA 1B04A 5AKKA 1YVEI 2IU3A 3OM8A 2QWXA 1G42A 4RB1A 1P0FA 1WU7A 1PDWA 1MU0A 2DPIA 5EE5B 4D02A 3CY6A 3F8WA 4ZYZA 3MD0A 2POQX 2BDEA 4QU8A 1OH6A 3EXFA 4JI5H 3E1KA 5H0IA 3TQQA 1S96A 4BLPA 2Q2QA 4DC0A 3EXG1 3NHRA 1OH8A 2C2XA 2ECKA 2IOQA 4CF6A 4MB6A 1WMEA 1UP7A 1KPGA 3O3OB 2WHPA 2BN4A 5JBQA 3D81A 4AXBA 3QY0A 5I7OA 3WL3A 4XX1A 4O2AF 4P2BA 4LXQA 4R9NA 4G1CA 4FC7A 4BP8A 5KFDA 1VG8A 1N6KA 4HWOA 2XQIA 4Q4HA 4HP8A 2YYYA 2YXBA 1MENA 1IN6A 4Z9AA 5F4BA 5DP1A 4ZQCB 5U9CA 2JJ1D 3DQZA 3H5RA 3BFXA 3G89A 1RDFA 3Q87B 2GXQA 3VSBA 1AHIA 2YS6A 3FYUC 2AEJA 2X9LA 2AEEA 1A4UA 3LFHA 3LKDA 4IOKA 4DR1H 1U5BB 4DV3B 4UDXX 4P80A 4MKRA 3B2NA 2KBEA 2ZKLA 3TLJA 1OAOA 1I2MA 2Y1LA 2SKDA 3FKJA 1JG2A 2XTZA 4LZJA 4BP9A 3PT9A 1IY1A 4ARVA 2FVXA 1GZDA 1YQXA 2ZDQA 4HRYA 4WCFB 3DYVA 1ZNWA 3UICA 5GGXA 3BE4A 4FIDA 3ZCTA 2H1RA 3OCVA 2AL7A 4LTMA 2VCYA 2P67A 5HR5A 4DV6B 5KKAA 5L3QB 2UXCH 4Z9YA 3AOEC 1FVFA 1X1AA 2Q5QA 4FP9A 1T5SA 3G5TA 5EERA 3ONEA 5KOJA 5G0SA 2BZ0A 1C9EA 3G5UA 3ZE6A 3BQ1A 1SOAA 4UCQA 1RQ2A 4L5AA 1CRPA 3H20A 3DOCA 4EX6A 3VZBA 3PIDA 3DMGA 4YBZB 4F6RA 5JAHA 1K7EB 4INPA 1Y1RA 2FRDA 3TTYA 4BFLA 1EDDA 2XECA 2Y99A 4XWOA 2HUNA 5C18A 5E6UB 5D5QA 1AXGA 2IPOA 4C1BA 1OLXA 4KR6A 5JVDA 1MDFA 3KKLA 3TTWA 4E4YA 1N9ZA 5BURA 5K3FA 4UEKA 1SEPA 2QJWA 4WRRA 1IZYA 3NP7A 4N7BA 1TJ5A 1RI3A 1ZJWA 4CCAA 2QRJA 2LCFA 4ESVA 2QKYA 4MW4A 4UBKA 2CJFA 4KK3A 4TMTA 1AN0A 3BABA 2PA0A 3UPUA 4G84A 3IO3A 2NP6A 1B42A 3I4CA 1BH6A 1GAWA 5CTJA 3DMFA 3TZHA 3RWBA 3ZDQA 4TWBA 3EX7C 3IV7A 2PV0A 3N86A 5TS3A 2QTHA 3FJYA 4MB2A 2OYSA 3ANTA 3NOXA 3GNTA 2NM0A 2I4NA 2R8EA 1XF9A 1M2VB 2BGRA 3BPSA 3EZNA 2HLPA 4BZPA 1ABEA 1S97A 3FWNA 4LJ8A 1MQ9A 2R2GA 1XZ8A 2YU9A 2AFIA 3IBYA 2J33A 4E12A 4BEWA 3PHLA 2ZE6A 3WBBA 1UXOA 4I1OA 2P1ZA 2PTGA 1E3JA 1OXTA 4RIHA 3F6SA 1FRVA 1XZQA 2XUOA 3FDJA 2W11A 3K94A 3I30X 3URKA 1Z82A 1Z4IA 1IZ9A 5L3VA 5BORA 2ORVA 3L5KA 4HEJA 1I8TA 1E6EA 5IXYA 1AHHA 1N9GA 4Q45A 4IGFA 2ZBFA 2BW0A 1VKHA 4MUJA 1B8PA 4NZYA 1Z6TA 2P0AA 1ISSA 5CVVA 3L49A 3LKZA 3W90A 2PX4A 2J45A 4C0XA 3GJRA 4OGWA 4GW3A 4BXOB 2IX9A 2IHVA 3CF4A 5ADWA 2X19A 1PK7A 1JA0A 1XPOA 4A8HA 1POXA 2JCBA 2NTVA 4XZ3B 1C9YA 3OTQA 3AF3A 3GT3A 3O9MA 3HJBA 3FNQA 5DOVA 1V9SA 4CXMA 5CFNA 1AV6A 4UZSA 2YJ4A 4F85A 4KNYA 3PNPA 2MR5A 2I2WA 4CKYA 2BZSA 2WVAA 4C01A 9GPBA 3RWOA 4GOJA 4DRZA 5DYNA 2H00A 3CYFA 4R68A 5BR7A 1CPYA 4TUYB 5IJ0A 4GXTA 3HN7A 1GL6A 1JBQA 1RXUA 2H85A 1MG5A 9LDBA 4TVBA 2XMDA 4HGRA 4QFDA 2I67A 3KKPA 2WSSD 1W4ZA 3TZ6A 5SZJA 4V0RA 4LQ4A 1A2OA 5E4JA 1AN7A 1M2OA 3RJMA 1L5ZA 3VKHA 1V8FA 1SCDA 4P7JA 3U4QA 1DKPA 1U1DA 2JI4A 4FBTA 4PZUA 3OZWA 4LQCA 4TKMA 5TS2A 1BDIA 2IH2A 4GWKA 4HUQB 3ZWCA 3UUWA 4F4WA 2OP1A 2LKCA 3QZ8A 1Y4ZA 4UCSA 3WWYA 4V0SA 1R1DA 4JR0A 2PM8A 2RHMA 1KEEA 2W2KB 3FPGA 4RESA 3CLVA 1NURA 1IQ0A 4LFAB 2NZYA 3TX2A 1YR2A 1Z5OA 3GX1A 1QJ4A 1QG6A 3OPMA 2QP4A 2I6QA 4Y3UA 3O8NA 3F7TA 3HLYA 2ONJA 2GAAA 1Q0UA 4M1MA 2PIDA 4MVJM 4OI2A 4EEYA 4L2IA 1S10A 1EX9A 1ZU5A 1OZFA 1OHHA 3CMMA 3QPCA 3KWJA 1WW3A 2J5RA 1PJQA 2FPLA 4QOGA 5AW4A 5K0BA 1UP6A 5JH7F 1F7VA 4D9KA 1I7SB 1E2FA 1U8XX 1K1QA 2NAFA 5DJ5A 4ASUA 1B93A 3QXSA 1BKYA 2VUMA 2R6AA 1K98A 1OW3B 9ABPA 2KSQA 2ZSFA 1K06A 4JYAH 1C1HA 2BTQA 3EVGA 4NBNA 4XWTA 1TCBA 3NHSA 2I2BA 3C3XA 3KQWA 5F76A 2GA8A 4HNHA 4MQEB 1JTFA 4HBZA 1H3NA 1YUMA 3OQIB 1YUNA 4C6TA 4WGFA 3QEMB 3K8YA 1JU4A 5D1OA 4PXAA 3TOCA 2Q5JA 3KSZO 1GZUA 1PT6A 3Q11A 2CDBA 3DEKA 4P5DA 2JFXA 3D3WB 1GNLA 5EJMA 4YCNA 1T1EA 3H65A 1XRPA 4S2EA 4XD2A 4OH7A 5JS1A 4YEDA 2Q4DA 4PFQA 3L7IA 2XRYA 3GUUA 3CNOA 1T34A 3AR2A 1A5BB 3KJFA 1XQYA 4HAIA 1ZH8A 3KQHA 3L7DA 3KYIB 1Q20A 1RXCA 1X8JA 1Y1TA 3ZWWA 2OC4A 3KJNA 4BWSC 3N07A 4ZAYA 1HQYE 1ISRA 4MUKA 3JQPA 3UCEA 1C2YA 5A9RA 1ACJA 4KXMA 2DHCA 1MAHA 2VOBA 4W8GA 3HZZA 2V96A 4MQMA 4YAWA 4RDCA 3KXYT 4CQJA 3H5WA 1RYSA 4G0VA 1EWVA 4GEGA 3QI7A 2IS4A 4IQFA 1LLCA 1VPTA 2B8EA 4CUKA 2PSDA 4NP6A 2FU5C 1GEGA 1BAPA 3WIVA 4RPKA 4B2YA 1ZH4A 4GZ6A 4ND6A 2V65A 2OAEA 1V1MB 4BPBA 3B9RA 4NNOA 2NZ8A 1JPJA 5ECYA 3TTSA 5D2CA 4LZNA 3G0IA 3BT7A 2QIOA 2FHPA 4R16A 1NI5A 3UTCA 1RK5A 3AOGA 4KR7A 3LX5A 2NXWA 1HO3A 2ZAIA 2CLEB 5C1IA 4N5HX 2I9KA 1ZHOA 5GV8A 1Y8AA 4ENUA 2ZI6A 2XZDA 3CUTA 4QNRA 3ZWXA 2XE8A 2HF2A 1YK0A 1HNXH 1U1FA 5AVRA 4DLNA 4NOKA 4K5QA 3OZRA 1B00A 1NX6A 2OO7A 4ERNA 5ALJA 4PBTA 2FG7C 1XWFA 4TSRA 4NU0A 5KT7A 2MSDB 2WK1A 4MDFA 3UHJA 4N7JA 3PKJA 1O96A 3X1KA 5CT4A 3IOYA 4PG6A 3LY5A 5BWCA 2AXPA 3WZLA 4ARIA 3PHGA 1NXTA 5AW6A 3RVDA 3TMYA 5KFXA 3GTGA 1LLFA 2DR0A 4K9DA 1K3FA 4FEEA 1GGFA 4PZEA 1KJNA 3CWQA 1Q0ZA 1E59A 3T7DA 3M9XA 1M2KA 1OLSB 4AW9A 4C0LA 4JB8A 1JQDA 3DP9A 1NASA 5K2OA 3KSUA 1DQNA 1QU3A 4HRXA 2VPSA 5AVQA 1J8MF 1IN7A 2OZLB 5F78A 1NU8A 2D0IA 3PN1A 5GONB 1BHJA 3STTA 5K6TA 4FNAA 4TN1A 2JJ2D 1OYWA 5T6MA 1E4YA 1RYEA 1K5GA 1A7UA 1AQYA 1RD4A 2F43B 4TKZA 2QAGA 1V6AA 5LQDA 3R9XB 4J1NA 3G3EA 4JA2A 1V35A 3HXPA 2DVMA 4GECA 2XR1A 1NXVA 2QB5A 4TWZA 3LPDA 4R8UB 2VJQA 4HYYA 2XYRA 3NVAA 2YWXA 1CKEA 3EVBA 2Y0BA 3B6JA 3MJDA 1RNLA 4A36A 4UC0A 3M3DA 3QZUA 1X9NA 1P8AA 1EXDA 4PSKA 2JCXA 3TG8A 5ARBA 4IHJA 2Y1XA 2UZ1B 3L7CA 4QDJA 2YW9A 2FJ0A 4S1VA 1Z8FA 3PRJA 1QIFA 5HOQA 1N6PA 4YGYA 3GUZA 5LWQA 4R8VA 4X63A 4XM0A 4R9RA 2VT3A 5DRYA 3ZZMA 1ZGGA 1VL8A 3WZMA 1X7DA 1AF4A 1LGYA 3VPAA 3FB4A 1WCIB 2E4WA 5JWOA 3HFGA 3EA0A 3ZHUA 2B92A 4ZO7A 1Z34A 1XTSA 1A72A 3ZHCA 5H9WA 2L82A 1DJQA 2G9RA 1X9IA 3AP1A 3SSOA 1UBKS 2ILVA 1DJPA 3SHQA 3FZNA 4JN6B 3EGDA 1VPVA 1RE0A 4W5HA 3T7SA 2AW3A 1XMJA 3BIFA 4N3CA 4GNKA 4JI4B 4GKBA 2ZSDA 3QSYA 3WL5A 4E2WA 2GASA 1C7IA 1RYRA 2PK3A 1RXVA 3F98A 3GJYA 4NBWA 5FTNA 3SYRA 3R1IA 4AJ4A 4FOTA 2OXEA 3V3KA 3EHEA 1OASA 1W1WA 2PKCA 2B9EA 1I3KA 4J0IA 4DYHA 4C06A 1L4YA 2OSBA 1EZ4A 1PKXA 2AKEA 4GMKA 2FFHA 3KUDA 3QOYA 2I6FA 3DBLB 4D45A 5DBGA 3RIZA 3H04A 2H1IA 4B3CA 1XVTA 4TLDA 1VZ3A 2BCEA 2IBKA 2B20A 3AM4A 1I3MA 1M74A 2F59A 5DMHA 1SUFA 4Q0MA 5L40A 1R4ZA 4AZTA 4BQRA 1W49A 1KYQA 4OFZA 4G24A 1Q7BA 3DAFA 4ZCQA 4WBNA 4BHTA 2QI9F 5KHAA 2PSSA 4KMOA 1Z63A 4LDJA 5ES3A 1NUPA 2PLNA 4X61A 3V4FA 3Q15C 2I62A 2R00A 1PK8A 1T24A 4MO9A 4W9RA 1I7DA 3UUEA 3ZE8A 1RKXA 4JYBA 5CD1A 3GPIA 3GLRA 2WYHA 1VYUA 3QUBA 3COZA 1QP4A 3RFFA 1T8YA 1PLLA 3I0ZA 3G7SA 1NBME 3Q98A 3ZEAA 1Q50A 5LP6B 5LDGA 3V3TA 4YB8A 1D4AA 2WIAA 4FEAA 2RH9B 3U7GA 1Z0DA 2CFOA 2P5TB 1YNSA 1HK7A 3IEXA 3STWA 2PMBA 2PU7A 3TQOA 1ZYUA 3M33A 1RJWA 5DTJA 2EFDB 1QH8B 3TUZC 1B2RA 1M6YA 1QR6A 2WDPA 3RQSA 2APJA 1CDOA 4GZ5A 1HT0A 3PGVA 3ECCA 3G8DA 4LEIA 2OHOA 2Z8YM 1RADA 5NLLA 4Q9IA 2R97A 3IQGX 1A04A 3ETEA 4ZAXA 3S2YA 2OHVA 5KVCA 2H4XA 1TCCA 5KKNB 2VRCD 4NEQA 2XOXA 1QF7A 3RRMA 5AJHA 5JQGF 3TRIA 1Z75A 2C9CA 3DVAB 4RUKA 3JRWA 2P8JA 2P5SA 4H59A 3KE9A 3ICVA 4BX2A 5GJCA 5JBIA 2ZYWX 4N6NA 1H42A 2IS2A 4RTRA 1DWUA 1JAXA 2JL1A 4DHEA 5L9XA 1Z45A 1G20E 4EFBA 3CH4B 1F0YA 2CMFA 3E23A 1IZ8A 2IYSA 2H1VA 2ZKIA 4UHCA 3AF1A 4QC2A 5EZ5A 4EY3A 5TVKA 5IG2A 2JLXA 3O1LA 1XTUA 2C95A 2ZAYA 1YR6A 5FPQA 1XPRA 3DBOB 2F9FA 3KQLA 2P9HA 7REQA 1N9KA 5HCUA 4GKKH 2QXUA 4JBLA 3N74A 3IODA 4B7ZA 3UBMA 5FLXW 4ZDKA 5I9LA 5T3YA 3O8CA 5IUKC 1BWPA 3ZHRA 2Q3BA 2Y66A 3PDIB 2FRXA 1DAHA 1KU0A 5KUTA 1ZKDA 4FFBA 3ZGVA 4DS3A 2F55A 2NMVA 4OTZA 2EG5A 3L4BC 1CW2B 3PR4A 4L16A 1MKYA 1KC7A 4NPHA 3HBJA 4QGBA 2JARA 1BE6A 4MQ6A 2BMJA 1Y42X 1NUHA 1WHSB 3AR8A 4FOPA 2ZCJA 1SXQA 1P3Y1 4KBFA 4E2XA 1X1CA 4GPEA 4GM0A 2R7ZA 2O8VA 3PKIA 3A1FA 2UVVA 4FS1A 3S2SA 2FRVA 4K26A 3UVEA 4B6SA 2R8RA 3JD3A 1G2OA 2BWJA 4Y2PA 3W6PA 1VHQA 2P4EA 4JSYA 2XZTA 4US0R 2JATA 5ICFA 2H7CA 2VJMB 2EW8A 1J7JA 2QMZA 1YIOA 2O2DA 3W2FA 4GQBA 1NUQA 3CNBA 2D6FA 4YY3B 2O4CA 1XNGA 2DHQA 1WXEA 3CX8A 4E88A 2Q4EA 1QG0A 2XUKA 5CX1A 2HK9A 4EEZA 4F97A 4WVFA 1OYYA 4D81A 5C5DA 4ZT3A 3OFJA 2R1VA 5AUPB 2VAVA 3MS4A 3LP5A 3PFCA 1QPBA 5KQRA 2HBRA 3HCWA 2GX6A 1NOJA 4P34A 5JYBA 4ZV7A 3GT4A 4MVJE 3H3XA 5CEEA 6PFKA 4GKAA 5JR3A 2FZVA 2XHEA 2MSNA 3GLTA 1CP3A 1THTA 4Q1EA 4YRQA 4OHXA 3HI6A 4ACAA 2HYIC 2O9JA 2C5EA 4DR7H 4C7VA 2ZIZA 4X94A 2HF7A 3E18A 4YP5A 1Y81A 4OK3A 1GNVA 3M3HA 3C3EA 4CCYA 4WXMA 2GO7A 4B3DA 4GKVA 1NBMA 4M0PA 3I9FA 3S44A 3QRWA 2GSDA 3MRVA 1OGIA 2GTPA 4M87A 2W8ZA 3TI9A 2ZWMA 3MD9A 3L7AA 1HYHA 3OTIA 3PSAA 3B60A 4H7EA 1BO6A 4U7JA 4BX0A 5AW2A 1BX1A 5L51A 2WTXA 1U98A 4PRYA 3W4IA 2ZP1A 1JH9A 2O2XA 4PAGA 3T38A 2BUCA 4V0QA 1NF2A 4QGFA 1WH2A 2KM1A 2WC1A 2Z43A 4DCVA 1LC0A 2Z4RA 3VX3A 3D3QA 2ZYTX 5KTSA 3PRYA 2K7ZA 3DWFA 5PGMA 1LBTA 4W8OA 1YIDA 3VR5A 5HXAA