3N6XA

Crystal structure of a putative glutathionylspermidine synthase (mfla_0391) from methylobacillus flagellatus kt at 2.35 a resolution
Total Genus 132
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
132
sequence length
467
structure length
451
Chain Sequence
TKPFDEMFLQDEVIRPIYAEYAAWLQDVPHQQLESKRQEAELLFRRVGITFLIPFDVVPRILSASEWARLSDGAIQRVKALNMFLHDVYHDQEIIKAGIVPSSILANAQYRPEMFGVDVPGGVYAHIAGVDLVRTGENDFYVLEDNLRTPSGVSYMLENRKMMMRLFPELFRRYPVAPVEHYPQVLLNNLRAVAQAGVHEPTVVLLTPGAYNSAYFEHAFIAQQMGIELVEGQDLFVRNNAVYMRTTEGPKRVDVIYRRIDDDFIDPLSFRPDSMLGVPGLLSVYRNGGVTLANAVGTGVADDKDTYIYVPEMIRFYLGEEPILSNVPTYQLSKADDLKYVLDNLAELVVKEVQGMLVGPAASKQELEDFRQRILANPANYIAQPTLALSTCPTLVETGIAPRHVDLRPFVLSGKTVSLVPGALCRVALREGSLVVNSSQGGGTKDTWILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a Putative glutathionylspermidine synthase (Mfla_0391) from METHYLOBACILLUS FLAGELLATUS KT at 2.35 A resolution
rcsb
source organism Methylobacillus flagellatus
molecule tags Ligase
molecule keywords Putative glutathionylspermidine synthase
total genus 132
structure length 451
sequence length 467
ec nomenclature
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14403 CP_ATPgrasp_2 Circularly permuted ATP-grasp type 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.270 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3n6xA03
3.40.50.11290 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3n6xA02
3N6XA
chains in the Genus database with same CATH superfamily
1YZUA 3L4SO 3AYHB 4JLVA 4DWWA 1LS6A 1DEOA 3DKVA 4TT3A 4DCJA 2JIPA 5KHOC 1E0AA 1OX4B 3GIJA 2JBWA 3R7NA 3V6HA 1H2XA 4GYKA 4HZGA 4Q12A 3V3TA 3PD1A 1S3FA 2C3UA 8LDHA 1W1WA 1C7QA 1X38A 1ID1A 2FFAA 4P2GA 5FI5A 3RS8A 3S4YA 5A5DA 3GIDA 4CC5A 3RAQA 1ZAYA 4BQIA 3D8HA 1KYTA 3R3XA 4K9NA 3LBNA 2BZSA 3JSAA 5IYDG 4KITB 3CY6A 3PQ6A 2EZ8A 3QX8A 1JWLA 2Z8XA 4I55F 1F8GA 1JQ3A 1YT5A 1THZA 3O8QA 4TS4A 4AXBA 4BB9A 3BC1A 1KS2A 3A7DA 2CL5A 2FPLA 1XMQH 4TSKA 3RGWS 3QX3A 2IFTA 2J67A 1E7MA 2YXNA 2O2XA 1EHYA 3C5CA 2QN1A 2YIJA 2PM8A 2J4CA 3QW4B 2AX4A 1BD4A 1XNRH 3P5BA 4QTYA 1L1FA 5JVDA 4FB4A 5F76A 3DZFA 4GGMX 3EVZA 1JYSA 1M2JA 3LXMA 4KLAA 4M1YA 4X92A 3Q9UA 4R8KA 5H3HA 3JASA 4DLTA 1XMJA 4ZHQA 3RAPR 2H7YA 5FPHA 2FRVA 4FCVA 4EI2A 5A3VA 2QRVB 4NMLA 3R75A 1DZ3A 1Z35A 2F3TA 5BWMA 3HOYG 2EDAA 3SR4A 1LDGA 1VKHA 3NI2A 1BVYF 3W2EA 2RD2A 1F4PA 3OX2A 4U63A 4C76A 2O0KA 2O1WA 3S2SA 1GGKA 4L5BA 3HJRA 1ZG3A 4Y18A 1JEYB 3A9VA 5LKRA 2RDJA 2BF7A 4DV0H 1NX9A 5KTPA 4CIXA 2I0FA 5HTKA 2CUNA 1VE9A 2A78A 2D0IA 3CGWA 1QG6A 2Z95A 1YQWA 3NAQA 4Z0TA 2HUPA 2P7HA 3H2YA 3L49A 4TXJA 5AK5A 1NVXQ 2IMWP 5BNTA 5K6RA 5DNAA 1UMDA 4H18A 1EJBA 1FP1D 3H7AA 4LXYA 3NMUF 4AZ0B 4JVOA 4HDOB 4OHPA 3TLXA 4NV0A 1T2CA 1HKUA 2E4ZA 2GEFA 1IFXA 5A02A 4G6ZA 5HQTA 4LPKA 2YBDA 1D4ZA 1D1QA 2E0IA 4YAIA 1UBGA 1ZC4A 2ZS9A 3ESQA 4JP8A 4NEQA 3UJCA 5KOHA 1N2GA 3AF1A 3NHWA 5EEHA 2ON6A 3ELUA 4XWAA 1RI2A 2YXPX 4QUDA 5TB5A 4I8DA 3RNOA 5L7TA 1DMSA 1JYEA 4HLCA 3U3MA 4D57A 2BEVB 2OB1A 4LE0A 2JA7G 1CJCA 4EY5A 4YB8B 1ZDMA 1WBJB 3BMOB 1JKFA 1H2AS 3LY7A 2XCOA 4RB3C 2XNDD 4NXNH 1L5RA 1KR2A 2J1LA 2PX8A 3GX1A 3PZRA 5G3YA 4D97A 3U9TA 2VRCA 4CCAA 3FM9A 4ZQBA 4RTNA 3NBFA 4IAJA 4IVQA 4J8PA 2JHGA 4TT3D 5KQMA 3S5JA 4P3PA 4ASUA 1P9RA 3LDAA 4I55A 1NQAO 2ISCA 2WRZA 2OM2A 1Z62A 5DTIA 3EPRA 1MJNA 2O8BA 4YDHB 2HK8A 1NFQA 4WSOA 3WGZA 1TZ2A 2B0JA 4BN5A 4JYBA 1GRNA 2EKZA 3Q2IA 5J23A 2R6GA 3CURA 3Q6MA 5ESWA 3ITNA 1X94A 1TFUA 2HH9A 5CT9A 5T7BA 4BBAA 3CZQA 3N0RA 4LIPD 1V1JA 1NVMB 5K3SA 1FPMA 4YASA 2AI2A 2I7CA 1DC4A 3RTBA 5C3UA 3H9EO 3DYIA 4FGUA 3T06B 4F8YA 1CF9A 1ZUHA 1Q1QA 3OCUA 1E1RD 3F6PA 4KDCA 3GPDG 5B1IA 4B80A 3AUJB 2Q2VA 2O2IA 2XR1A 5G3ZA 5L3RA 1GKKA 5REQB 4CEHA 1T91A 1WOMA 4R9SA 4C0XA 4ILKA 1VPDA 3WQHA 2BR0A 3N87A 4CM8A 1X70A 2DLCX 4MXDA 1ATIA 3NEAA 1KDZA 4MKIA 4KDEA 2IU4A 3NQ41 3PL5A 3GJ8A 2QLMA 1HNWH 3ESRA 2OUKA 3W6NA 4P4UA 2G71A 2QV7A 2EWMA 2WG1A 1XXHE 3LKBA 5MGNA 2BMVA 4UPVA 1DAMA 1HDIA 1C8VB 4NZOA 4FTWA 3KHSA 3NPMA 4MGKR 3VI4B 2O0LA 4L9RA 4AP5A 3FPSA 2J6SA 1UOOA 2JI6A 2WNSA 5TJHA 5J2TF 1GTG1 1VJGA 2A30A 4GQIA 4O6VA 4B3XA 3N3AC 4DUYB 2X2FA 1ZJJA 4FYYA 1EESA 2OO5A 1CETA 2GPAA 3IOEA 3KXLA 2Y9PB 1B8OA 4MPRA 3S1SA 4X84A 4ZVQA 2D54A 4R1NA 4RXMA 4B31A 3U7RA 7ADHA 4BO5A 4XWTA 2HF2A 3DSRA 4B3CA 3PQDA 1OH5A 4R1QA 1Y1VA 1RWXA 3W3ZB 1T8TA 4FOTA 4I9UA 1Y5LA 3GMIA 5BSHA 1OZGA 3HKEB 2VL7A 1NP3A 2AA3A 3UG6A 4JIGA 3H0KA 5LQCA 3QXHA 1WZIA 3HLYA 4EJSB 4N8EA 3HO1A 1OIWA 3EA0A 3O8BA 1QK3A 3SZLA 3QZ8A 1YNOA 4MUEA 4CT5A 4HAOA 1FMTA 5LJIA 1VC2A 1NUHA 3LQ4A 3IEUA 1TZJA 2PMCA 1EZ1A 2RGNC 3U48A 4E6PA 4WW0A 4ECEA 5JJLA 4ERXA 1QTNA 4E31A 2G82A 1HOXA 3EBPA 3LLMA 3S99A 3J81A 3RRNA 3C0KA 3TW6A 1WUHS 4BLTA 3UKOA 1V9PA 3LCVB 1PS8A 5GZ6A 1NPYA 4WCFC 1SQ6A 1Z7WA 3DS8A 1Q22A 2HV9A 3FCCA 4GEKA 4QM7A 2RGRA 3I1JA 1NKSA 2Q07A 1RI5A 3PA8A 3CJRA 5EXPA 1IHYA 3AGPA 1JFTA 2PH1A 1XDUA 2QJWA 3CW2A 4D9HA 2YMPA 3PN1A 4HWSA 3CNNA 3QLVC 2XRMA 1QHIA 3WL6A 4IQ4A 1BYUA 4WRRA 5AKYA 2JFYA 3FLBA 2J0QA 1NDHA 2CMHA 1ACJA 3N2EA 3LT2A 4GI3A 2EFHB 3UYLA 2WAMA 3I9V1 3JAKB 4TN5A 3RSZA 4DV5H 2LDBA 5AJYA 4KXQA 5IAOA 3DULA 1SKUA 1R0ZA 1ISMA 1ESMA 1BMTA 3IEKA 2JJ2A 4BMOB 2BVNA 2QL6A 4AU1A 1CNEA 2W93A 4F04A 5ULLA 2M6LA 1ZP6A 4MRSA 1AZTA 1P7ZA 3ZHOA 4WOJA 3HXMA 1KSGA 3W5AA 1EIWA 1LI5A 4XX1A 3ICWA 5AI8A 3GGSA 5DMXA 3RKRA 4L1KA 4CMIB 3LXXA 4U6SA 4NV3A 5C5IA 3O75A 1E1CA 3PUKA 2I9PA 1BE1A 4NNOA 4NU6A 3T3PB 4YWHA 3HV0A 1DC6A 3UJDA 4Q05A 3E4DA 4BBSG 4JI4H 2IEIA 2J07A 4IZHA 4UBIA 4ZGBA 3U3KA 4OHFA 1ZRSA 4MWBA 2DGDA 3O74A 1KI7A 3GOQA 1R3DA 2YOFA 3R40A 1JIVA 5F7XA 4KVZA 1QDLB 1S7CA 1EFKA 1DNPA 3H17A 4FNOA 4QTTB 4H3KB 3STYA 3NFYA 5ED4A 2O7QA 3CMMA 1ICIA 1IHPA 3GLKA 3AERA 4UTZA 5COBA 2BSQA 1R9JA 2GRJA 5DJ5A 5A0TA 3QVGA 4P7JA 4MI9A 3VR6H 3N41B 3CLRD 3AF2A 1C4KA 1ECJA 4DMGA 1Z26A 5ABPA 2EW2A 3L4KA 1C9DB 1OTHA 3TLAA 1NBMA 3SQLA 4ZVKA 4OV6B 2VHTA 3IDQA 1BROA 1GAJA 4G86A 3KR1A 4EEQA 2GZMA 5H4GA 2BTOA 3C0FB 1M1XB 4UU8A 1PEDA 4DWJA 2VHJA 5A9RA 4H1HA 5EQJB 2V9CA 2ZE8A 1M0WA 3NBYC 5IP9G 1U8UA 3BGWA 2UKDA 3QLJA 5BV2P 1E1QA 4KOEC 2ZYRA 4DHEA 1Z0FA 2JFOA 2OBNA 4PRYA 4IG9A 4JVMA 2C20A 2IP1A 1M7BA 3D4BA 3DDSA 1J9GA 3B78A 1U8FO 3HA3A 3V7FA 2B4RO 3BJEA 3P96A 4OB7A 3OFKA 2G4CA 2ZVDA 4G0OA 4TQUS 1K5PA 2ODEA 2VHCA 2V0CA 1XZFA 4QEZA 4ZCTA 1MABB 5ALVA 3CJTA 2VFAA 3IP9A 4UNNA 2OC4A 1GSHA 4EELA 3WNZA 1H69A 1ZVMA 3JQ8A 3RR2A 5CIWA 3CO5A 1NYQA 4DIUA 1QLWA 3KPVA 1A8PA 4HH1A 4INZA 4R9RA 5AVSA 1WXIA 1Y4ZA 5AMXA 1P9OA 3N43B 1DCMA 4AJPA 1TUEA 1W4CA 3JZDA 1RWMA 1TCUA 3I39X 3PHBE 2ORYA 3AHCA 4N6OA 1XC7A 2XQFA 3SS8A 1E2QA 4KXWA 4ZEVA 3NBUA 3TR5A 5KU7A 2VHXA 4IUCS 2HPAA 1GYRA 1Z0UA 2GPNA 3BMCA 3KQOA 4A3JG 4INOA 1E3DA 3H2HA 4JGIA 1Q92A 1B6RA 4G56A 4Z7OB 3BK7A 3FB1A 3SEFA 4G26A 2IS1A 3HCCA 4RZ2A 3ITEA 2BOVA 1TA8A 2DRIA 3GBSA 4GZ5A 2LUOA 4PU0A 1GDHA 5TY0A 4LF8B 3AIOA 3ZW7A 4F3YA 4J7AA 3W9YA 1BX1A 2D5CA 1Z63A 3LQFA 4JV0A 4D3XA 3IQWA 4Q47A 5I47A 5IAEA 1Z0JA 4BX2A 2RGGA 1IJEA 3ZVMA 1G0OA 4KN5A 3DEKA 1MHPA 3REFA 5C8YB 5MN4A 4GZLA 4D02A 2VQDA 2R93A 1QE0A 3I8SA 3LPAA 2N3ZA 2P91A 1EDBA 2CXXA 2GB4A 4EDFA 1RYYA 5HKBA 1ZHSA 4QVGA 4HB4A 1U0RA 3OO0A 4FLEA 1KZHA 2NIPA 3VPFA 3ZLJA 4D4MA 3URKA 1TO2E 5KTSA 3AK4A 3CX7A 4J7UA 4XRRA 1EK2A 4DMLA 1L4FA 3NTRA 5BV8A 1LX6A 2WWVD 1MXFA 2VDQB 4MLCA 1KVRA 3AHFA 5IYZF 1ETHA 2Z0MA 4D82A 2NG1A 4IS3A 3KZ1E 1EG2A 1X1EA 3KTAB 1G2OA 3SAJA 4YLGA 1YQTA 1Z7EA 3BD6A 3G7NA 3V7NA 5LXTF 2GK4A 4DSZA 1XKLA 2B5OA 4OXQA 1ZJWA 1AF4A 1YNSA 2ODQA 3H2BA 3ZHBA 1ZL0A 4NFSA 4W63A 3IKJA 5FULA 1OW3B 1SHJA 4PYOA 3TIXB 4D6YA 2HW8A 3FTFA 3MPOA 3MRVA 3WRVA 2VYND 4CPDA 4ZQCB 5HX7A 1WHSA 4BN0A 4L4ZA 1QONA 2GJ9A 3L7CA 4L51A 3MFIA 2FWPA 4DR3H 1S3IA 4ABTA 3VR5H 4BLSA 3R7AA 5AW3A 1WCIB 4UHEA 1CS0A 2H5IA 1GGVA 4MUNA 1GQ2A 4Q21A 1DL5A 3MS2A 4QOIA 4RIFA 4M53A 4S24A 3X3HA 2UXBB 3F6SA 4HDQB 4Z4CA 1UIRA 5KNCD 3TLGB 1CQIB 1QC5B 3ZK9A 4OBBA 1U3VA 1AUXA 1G4HA 5C0OE 2QKYA 1JLHA 4F4CA 3HBNA 2PZLA 3I2GA 4L8GA 4LX0A 2XYQA 3GLRA 4UAGA 6Q21A 4CQMD 5JXJA 3WKEA 3DP9A 2J48A 3ANMA 4X97A 4X60A 4MKZA 4YMUA 1GTRA 2P11A 5F9NA 3ZJ5A 4HKTA 5MFZA 3IVGA 5JWOA 2I76A 1QQ7A 4N0PA 2GEBA 1DIGA 1FP7A 2FN3A 2QQFA 2WD7B 2D2XA 4DMRA 3OCWA 4N3AA 5ELXA 3CLUD 2A5LA 3JTEA 3SZMA 1YL7A 3KZKA 4ZJZA 4P93A 2ZAMA 2D5LA 4P7GA 4Y0AA 5E7IA 3UQYS 4OLBA 1XMOB 5HVNA 4DMUB 1XZHA 4MTDA 1EEHA 1IEXA 1MJHA 2LCFA 1JVNA 3UATA 3VBEA 2Y0SE 1M8KA 3PXDA 4JLJA 1F20A 3WRWA 4EUKA 2P9JA 2NUPA 3DOHA 2QTWB 1UJ6A 5DBEX 1ADCA 1Y1KE 3X1ZA 5KWSA 3ZEAA 1ZVQA 5ENDA 3HWSA 3PYXA 2OZLA 1Y0BA 1JSXA 2BHNA 3H11B 2MR5A 2VSXA 1PRYA 2ZR9A 3ABQB 3QEKA 4LF6B 1XEWX 1PVDA 3C4JA 3ONFA 4TV8A 2EG9A 3ZIUA 1KJWA 3RHSA 2ONCA 4V03A 3ZWNA 2EKDA 2GOYA 1Z68A 2KS6A 2CFTA 2R1ZA 2GT1A 2VAWA 3OLCX 4G4SP 2H4JA 5LA6B 3UGKA 4OQZA 3ZDZB 1QU2A 4DYDA 3RHTA 3CCBA 1LA2A 4GI2A 4W7SA 4Q0YA 4JOQA 1Q7EA 1UT6A 3VTAA 4CEIA 1D8TA 1UK6A 1QB7A 2QAJA 3LO5A 3NJ8A 4HDNA 4LDAA 3H5VA 5E0KB 1KYWA 3VTKA 4X62B 2WAAA 2Q4OA 3UAZA 4JI0B 4HWPA 4LDJA 2G9ZA 1EG7A 2Q5OA 1E2LA 1SC9A 4QQFA 5L1JA 2ZWOA 3AUUA 2O5EA 2W2PA 2X2PA 4D4KA 3A27A 5JEEA 1CUSA 4DLAA 4WXYB 1SCKA 1HFWA 2L42A 1DTEA 3G02A 3K94A 1XPOA 3I2FA 5JE8A 1U9YA 13PKA 1MFPA 1MOQA 4CN8A 4NJMA 2MR6A 5EESA 1ONPA 1V3VA 4LZOA 1U0EA 1BYIA 4IWYA 1E7RA 3DE6X 3KUKA 3FVWA 5IDWA 1BKDR 5BMVB 3QIVA 4UE6A 4XOUA 2QX6A 3Q7RA 1I13A 2IXGA 1PNQA 4XJVA 3BXEA 1SKYB 1ZMBA 1G9SA 2W2QA 3DM5A 3DZJA 4RNMA 2G7MC 4M6WB 4P9NA 1PFQA 2WSSD 5T8KC 5FH9A 4HDCA 1H5UA 3ZHYA 2GTIA 4M3NA 2OC9A 1ADFA 1IOLA 1P8JA 1T5HX 1T0HB 1T5DX 3WIOA 1WMAA 1KEWA 2C2KA 2IPNA 4JLPA 1C30B 2ZYHA 1JEQB 4GX1A 4OTZA 3LUKA 2Y2VA 2QRLA 4AF7A 4BNTA 2WYVA 2SKDA 1OGJA 3HWWA 4RDXA 4R16A 2QD5A 3A9SA 5LLTA 2FR0A 1OLUA 3RUHA 1O0SA 1D1SA 3IE1A 4MX8A 4CZ2A 3MCZA 4JN6B 2O0MA 3F78A 4PR0A 3ZHCA 4E1VA 4RH0A 3SIWA 5LMNH 2PH3A 2KPOA 4DA0A 5IVHA 4G0WA 1O8CA 3F98A 2COKA 3QYJA 1L7MA 1SYXB 2PO5A 2X42A 1NDQA 4JI3B 3E18A 4NZNA 4ZI2A 4AS1A 4ZVTA 4OQDA 3D3WB 5ERXA 1C0PA 5KJ6A 1N6OA 2HWKA 1M74A 2HBZA 4IO0A 3OE7A 4MS4B 4LFAB 1JQKA 3U4IA 1E59A 5JH7B 3A4IA 4XSGA 1GOTA 2IDZA 1SIUA 1LTQA 2D5AA 3SF0A 1UNNC 1X3LA 2YYZA 4HHEA 3R7DA 5JSHA 4ND8B 1KMCA 4R2IA 2GJKA 1LDMA 3C7AA 2J5BA 1PX2A 1PK9A 4B74A 2OHGA 3PDIB 4EKGA 1O87A 1E9DA 1L4HA 4GWKA 4RACA 3OPYB 4RXTA 3GA5A 3VI3B 1A2QA 1LNZA 3SG0A 5IRCD 1XMOH 1E62A 2H5JA 1CVRA 1Q16A 3HYCA 3LCCA 3VNQA 2EX0A 2HK7A 1NHGA 5FTLA 3VKFA 2FQQA 1CJTC 3EE6A 2JCYA 1T8RA 1ZCAA 1GG8A 1KZ9A 2FX2A 2VDLB 3MNFA 4O2BB 4GLLA 2R8OA 3N2IA 4U6NA 1OGIA 4HQNA 5TNXA 3VJRA 1B73A 3NUZA 1NOIA 4BB5A 1P5ZB 1U3FA 4UCXA 3SXPA 1B41A 3HOWG 1YASA 5ESDA 1OV4A 3BH7A 4MRVA 4PWQA 1II8A 3N8IA 5AW5A 3TO5A 3N8KA 3A3YA 3H99A 1ONSA 2CYBA 3JYPA 1EFAA 1EFRD 1KIFA 1WNFA 4MCJA 5K3FB 1NSTA 2G8LA 1ZCJA 1HI9A 4BY1G 5DYNA 5I3CA 2X22A 2UZ0A 3DZDA 4FFLA 4M0FA 4D41A 1WB6A 4BV3A 2BFCB 3BWMA 4EFBA 4TXMA 5CX1B 3TEMA 1XA4A 5HKKD 4A2WA 1P6QA 3TQRA 2FPWA 5JXIA 5KINB 3PQFA 4DV2B 4ECRA 3FN4A 3FWKA 1BHQ1 5EFZA 3ROPA 4A7PA 2VTDA 2OORA 3ER6A 3UENA 3GN2A 1IPHA 3AR5A 4DMMA 5BN3A 3MD9A 1N6HA 1UJMA 3BJZA 3EF1A 3OEED 3EH1A 4G1VA 3EGVA 4HGZA 4JHLA 1TA0A 3D8SA 2VH2A 1V25A 1U4OA 5FTMA 4HFNA 1PS0A 1IWPB 3D7LA 1BXRA 4BVAA 3IVMA 1SUCA 1OH8A 4IILA 2JAOA 3MOGA 4L85A 2OD7A 4OMDA 4DTCA 4DLRA 3KQKA 1J00A 3RVLA 1X2EA 3AW9A 2WSSA 1DDIA 2PS9A 2RGCA 4KGXA 3JD3A 4LOHA 5EWJB 2NUTB 2F9MA 4G5XA 1O94A 3I04A 4OG2A 1CG6A 4V0MA 4N01A 5JY1A 1AT1A 3OWOA 5CB8A 4TL8A 3OUTA 4PBRA 1BEZA 4NATA 4U8GA 2GTPA 4X9XA 1QNFA 2OZKA 3FWZA 2H2AA 1LCIA 1VCNA 5H83A 1QYCA 3RLFA 1AQLA 3BSWA 3LCRA 4BKQA 2VC2B 2XOKD 3HHEA 1PNRA 4AZSA 1KEEB 4BNZA 4MR8B 5HDBB 1Y6ZA 4N54A 5AXDA 1EDDA 1YJBA 4XGIA 5SY4A 3SSOA 5DHUA 2CXQA 4O2BA 3DHEA 5FOQA 3I72A 2MHCA 2FX3A 1QRRA 4ECXA 3NS7A 4BKUA 1EX1A 3ZH2A 4WLVA 4WNAB 4DEYA 5KWVA 1AV7A 4G5FA 5KG6A 1O96B 1Q50A 3PTAA 1J5EB 4YJFB 1NXWA 3CEJA 2AG6A 2PD3A 3NYRA 3FG9A 1ULAA 4B34A 3GLHB 4G36A 1K6MA 1PR0A 1YQEA 1ZPDA 2P0AA 4UM9B 1I32A 3MCWA 4GX5A 3P9YA 4FFSA 1C5KA 1Q2UA 4EATA 1A88A 1U9CA 4QHYA 4O8ZA 3SM9A 1NBOA 4YXWD 1JKIA 1I6LA 4LN1A 2J9GA 4BC1A 1YR6A 3PK0A 5LMZA 4IMPA 2OWOA 2GFHA 1E3EA 1T9KA 4NCIA 1TEHA 5CX1A 1HGXA 1U2DC 4IOLA 4HLUA 1H5NA 4JLOA 4YMHA 5IFLA 2G77B 1T0BA 2V7PA 3IIMA 5EUCA 3TH5A 4R9VA 3VO1A 2IIQA 3MUOA 4DR7H 2Q3BA 3TTSA 4MW5A 2WUFA 4HQ6A 1E98A 3DCNA 4IR7A 3ROEA 3SJCA 3IIIA 4ECUA 4BATA 1OXXK 1XLWA 1AJEA 5DHFA 3BORA 4O4HB 2WABA 4ZYUA 5DSXA 4UQPA 2IIVA 3CUYA 5D6OA 3PGMA 2HHLA 1M83A 1NL3A 3QU5A 3U31A 3PWZA 1BQ4A 4MKFA 4CTNA 3V8VA 2KSQA 2VPQA 3NETA 3FPKA 3WLQA 1Y3DE 2J3HA 3IAM6 2OCAA 1GDDA 1RE0A 1GJRA 3I30X 3UUEA 5DNCA 3C3YA 5KFPA 4A1FA 1RRFA 3EXIA 2FVYA 3LPMA 2NV0A 4QFMA 4EF6A 3N6XA 5LM3A 1KHHA 4DA4A 2HA2A 1Q0PA 1RJ9B 3AJ8A 3GIIA 2O54A 5K09A 3LOUA 1M5TA 1DAIA 2XMQA 4LC0A 4MQ5A 2LTAA 4E5PA 2ATXA 3LYLA 4PANA 2ZT6A 5G41A 4QXQA 3RB3A 2C9CA 1A5AB 1AIPA 3LUJA 2QTRA 3O7MA 2ZAIA 4PZ0A 2HU2A 3TL3A 1MXHA 4PINA 1VFPA 3QUSA 4IH1A 4N8DA 2IKSA 4Q18A 4B85A 2WG0A 4ZKDA 1SHLA 2J6IA 3GD7A 1UPCA 4O4JB 2C2WA 1KP9A 1P4GA 4QWCA 1WJGA 1WSDA 3WJ7A 4EBCA 5KYYA 5AKIA 1TUIA 2GBGA 3TDKA 4N48A 4C0KA 4NPAA 5ECYA 2NSLA 3P9RA 3T4XA 2MINB 4LJ9A 4PSCA 2ZSJA 2QRPA 2HR1A 3NIWA 5TXGA 4C3VA 4JXXA 4NU5A 3KELA 3A2MA 3LPDA 2RHMA 2YL2A 1S10A 3BULA 3NVAA 3HKCA 3T0IA 3HCPA 8ADHA 2C99A 3MOSA 1EXVA 3AW8A 4IUYA 1Y89A 4GVLA 4O4JA 3FWHA 3UAOA 5BWLA 2YYAA 1QHYA 2PV7A 1Z0SA 4UMVA 1KQFA 3OZVA 2YJNA 2IF0A 4QZVA 3DMNA 3JU3A 2Q99A 4RABA 2DETA 2PGNA 1JX6A 3HXPA 4COOA 2PKXA 4MAMA 5BUSA 4AY6A 4ZCRA 3W90A 1KC7A 4U9UA 3I5AA 3T1QA 2VQFH 1OLXA 5L6MB 1G5PA 3G9ZA 2X19A 4ITVA 4ACAA 3VQTA 1XMPA 1WKBA 3CU5A 4L4YA 3OCCA 1FFCA 1N6RA 3EA4A 3CB4A 1FJXA 2C1ZA 3UZUA 3V55A 1GPNA 4B7CA 2AD5A 5F7JA 2HFJA 4RESA 3E9QA 1AKQA 1UPTA 4G37A 5EE3A 5P8WA 3F9RA 4NZPA 1WDKA 3VC7A 5JCZA 3D9QX 4DCGA 1D2AA 4WEQA 5D8DA 3V6JA 5G40A 3MM4A 2ZUWA 4TKMA 5KI6A 5KAPA 5L3QB 3O9VA 2UZ4A 3GRCA 1N25A 3O3NB 3MB8A 1I0IA 5JAOA 2AXQA 2WUWE 2YV1A 1W5BA 1W36B 2QBYB 2HVRA 5F51A 1NE2A 4Z1MD 2DLNA 2X0SA 4BBPA 3LUCA 2J33A 1O08A 1FSZA 3BABA 1ENYA 1Z88A 3WA7A 3THXB 1EUYA 5KT6A 2MSLA 1PO7A 1XXLA 1MDBA 1YZTA 3GT7A 4POOA 1O95C 1YE8A 4E4TA 5K8LA 3AHEA 3WYGA 1T6YA 1VHJA 4NU8X 1XZGA 4UXIA 4EHLA 3Q88A 1V8ZA 4E5UA 4QATA 2QG9A 4UCSA 5FPOA 1X1DA 2ZBPA 4QTZA 3WRXA 4TXNA 1PBTA 2P35A 4ARVA 2YNMD 3BWXA 3VR6D 3GEHA 4XARA 5HP4A 2DFNA 2ZP1A 5A6SB 4E08A 5IH7A 1SA0B 4I36A 2NPOA 4LKOA 4INAA 3LY9A 5HF5A 4MYHA 3Q3CA 2H59A 2AFHE 1WCWA 2HM7A 3ESBA 1MN6A 5SZIA 2JK0A 2UUPA 1HDGO 2P3OA 3FGZA 3E3OA 3EIUA 4YFVA 3OZUA 3KQPA 2Z5VA 1XD2B 2CVPA 3WNVA 3MLBA 1XROA 4PYIA 1DBQA 2AVNA 4LHVA 3SP1A 1X14A 1ZNZA 2D1RA 3KSZO 2IGTA 1J97A 2WA1A 2NXEA 1X7XA 3KS9A 1KH1A 1SNYA 4V24A 3UGJA 5CB4F 5KFIA 5A5EA 4W5JA 1PTJC 4CFZA 5IX8A 1I1QB 3R5XA 2W83A 1NJGA 1Z3CA 1IHUA 3OLWA 4ON9A 5E9JA 1E2NA 2XUOA 1REQA 1ZH4A 1M2GA 4IJWA 2A86A 2I4TA 3OHAA 2Q29A 4C29A 2WWXA 2MSWA 4K6HA 4I3GA 5ICMA 1Z28A 5JASA 2BEJA 3SX4A 1K8QA 3TJRA 4CLRB 1U9JA 3O82A 3U5ZB 4RD4A 3RRFA 2UZ3A 4XDGA 2O8FA 1LDYA 1Y1PA 2P68A 4R1LA 2C8VA 2XMRA 5K0NA 3UKJA 3IHLA 5KVVA 1AOXA 2AN9A 1FFSA 1F6BA 4MUMA 3DR3A 3KDSE 2ORVA 3LYAA 1W75A 4NENA 3RB6A 2GVNA 3RIHA 4B0OA 5KNDA 2UXDB 1FSSA 3OJ0A 1FSFA 4MS4A 3PUYA 5BT8A 3AR7A 3MHPA 1NN1A 1Z2DA 3KKEA 4DABA 5IARA 3IYLW 4ZT6A 2XMZA 2GARA 3B1ZA 3DE4X 5KFAA 3P9IA 4RF4A 3WYCA 5A4FS 3ONDA 2QU8A 1PFGA 1RHQA 3SU8A 1EE2A 3RRBA 2NZUG 4LI3X 5GONA 4AZ3A 2GCOB 1E3QA 1DXQA 1AGYA 3F1KA 3MTQA 1G2PA 3JRNA 4PZYA 3L7JA 1KSHA 1T9CA 1WZNA 3KEOA 4OLAA 2Q3JA 2YZNA 1JVSA 3OPYA 1IEWA 1JHRA 1J6UA 3DNPA 3I9NA 1F8XA 2QRQA 4YJGB 4DCOA 4MS1B 3D4PA 5EE0A 3KHUA 4AJIA 2IRWA 3ZS9A 3H05A 1PJ8A 1OTYA 1ZGHA 4I6JA 1URPA 3B82A 1I2MA 1ONNA 2HJ9A 3T3EA 1VB3A 2VA8A 4OYYA 2IWHA 5FV4A 3AM5A 1DAFA 3GRAA 2EKLA 1NMXA 1P33A 4ALIA 5CXSA 4R1PA 3WWEA 1U11A 4ZXPA 5FTJA 1YUNA 3M4XA 5C5JA 3WHIA 1WXXA 4LHEA 1QYVA 3SHWA 3AVUA 3HLTA 3WISA 3WQBA 4BCDA 4YHBA 4DUPA 3COJA 1SM4A 2VDUE 5F5XA 2QVLA 3AY7A 4Y3UA 2GFIA 3GTQA 3PFGA 4BJ3A 2DPJA 5GZ3A 2FPKA 2CFOA 3UOGA 3DQPA 2ZM6B 1NFFA 4JI2H 1ZH6A 3CKYA 1FTNA 5KYVA 3PIIA 1KQNA 1F17A 1YQGA 2FOIA 3L1UA 4RHEA 2IOYA 3TAUA 2UVQA 3HM2A 4ZVRA 1C0EA 1F06A 3LZCA 3P0HA 5CB6A 3BDAA 1ZOPA 1XLTC 4K87A 1WMSA 3WWCA 2AE2A 5ENZA 3DL7A 1E9EA 1P31A 3DOUA 3M33A 2P2YA 3Q8WA 1P81A 1MENA 5C8VA 4ZZ2A 3QE3A 3DFMA 5T4BA 4C08A 1I14A 5JWRA 2AC7A 3SKXA 2Q1XA 1IZ9A 3HGTA 4NL4H 2B1RA 4EYEA 4A3FG 2ZPTX 5JAIA 1QRTA 3PW7A 3CA8A 4QDUA 3FUUA 3J7AC 3L04A 4QBTA 3L18A 4OLJA 2B5VA 5IKOA 3C8DA 3HVHA 1U2PA 1L4LA 2Z08A 2CFSA 5AVUA 1CDDA 1E2FA 1W46A 3T0GA 3C6MA 3DHWC 2YVLA 2DSNA 3ETGA 3IMKA 5GONB 1XRRA 5EERA 4P4LA 1C2YA 1M67A 4D9FA 1DWQA 3CFYA 5BWBA 5LOVB 2FZ4A 3IODA 4MLPA 1L1QA 2CYCA 3L02A 4TPKA 4OX9H 4JBXA 4Z9BA 3IILA 4J4BA 4NNJA 1K68A 4IV8A 1VCOA 3SQXA 1NVVQ 2QI9C 1ADJA 5BSTA 3TSWA 2WKSA 2QD2A 5DM70 2I4OA 5FPTA 2OOSA 1FKAH 4L4RA 4JL5A 2K87A 1JB1A 2CW7A 2ET6A 3ZW8A 2Q0QA 4UTXA 4V0LA 3ZHUA 1DQSA 3EZ6A 1X9NA 3QUQA 1BS9A 4CMEC 3OICA 3QE4A 3ZI7A 2ZRMA 4UCOA 2Q46A 3R6LA 5LIRA 3EOZA 2G6BA 2VWHA 3ZDCA 4GH5A 1MO3A 1MC8A 5K51A 2KLBA 2RHOA 4FMDF 4F46A 4ALLA 4YALA 3EJWA 3TW4A 2VQ3A 1CIJA 3C3DA 4QXAA 4E2YA 4QOFA 1N5DA 5NLLA 3R3ZA 4R2HA 4XIIA 3OQPA 2H9AA 5SZHB 4QLOA 5AP9A 3JSNA 2K2WA 3DDZX 2YS6A 3FSEA 3ILVA 2OPBA 1H8EA 3QU2A 1LBIA 3GR6A 1Z45A 3JYLA 1KOFA 4IXDA 4OKNA 4JC8A 4QGHA 4XE5A 1EK5A 4MVJP 1ETUA 1W4ZA 1XP8A 3H8JA 1A9XA 2NU7A 3D4LA 3HQ4O 3WY9A 1PNTA 1VRWA 2EBHX 3DUFA 3H40A 2QTMA 4WKBA 2IVFA 1OQAA 4J90A 4DXHA 4PLCA 3MT8A 4JITA 4JKIA 5MN6A 4R8LA 3FPLA 1P74A 3GLVA 4YYZA 2KBEA 4X1YB 2CLSA 1B1CA 3C8ZA 1S8AA 4ESEA 3TM5A 3DP7A 1DKNA 1XMQB 1G4UR 1OZAA 3RNLA 3WQSB 3BA6A 4FFMA 1KA9H 1YHYA 4P2BA 2WMDA 2H1FA 4G0NA 3B2EA 2I2CA 4TVBA 4DLZA 4JJAA 1RJWA 1BMDA 1I6MA 4G1FA 2D62A 1KK1A 3OHBA 221PA 2WHRA 3FKSD 3H5WA 5CAEA 2JGKA 3N70A 4QE3A 3FNGA 2EVWX 2RMKA 4GZ3A 3B9RA 3H2GA 1LPSA 1ZWLA 1RPNA 2CY0A 3KUUA 2Y76A 2W2TA 4PSUA 4KIWA 4ZEXA 2B7BA 2NYAA 5E6UB 1DWOA 1NF3A 4H3SA 4D81A 1S5PA 3HA7A 4DIEA 3ZD6A 3FWPA 3G7SA 3GO4A 2RF4A 5KU1A 5ALDA 2YZKA 4XQ9A 3T9CA 2JA1A 4ECAA 2CW8A 2J3MA 3HOZG 4FJ2A 3IESA 4UD6A 4ZC8A 3B9QA 1ZINA 4E3ZA 1ZNYA 2W22A 1RAEA 2REBA 3EFOA 2HCTA 3OT1A 3G1UA 1YMVA 5CCBA 4RMIA 3WV4A 2J87A 2O2CA 5H82A 2ZCJA 4AJHA 1USWA 2CUTA 2QJTA 3LX5A 1OASA 4RPHA 2ZUBA 1VYUA 4NCHA 4BN4A 1IEVA 5F7ZA 1LLQA 1NMSA 2YJ6A 1SU6A 1XVLA 2ETXA 1UFRA 4RPLA 1JR3E 1MC1A 4AT1A 1QS0A 3U4HA 3HKZE 3IOCA 5JAZA 3O8RA 3GUCA 3SKVA 2R8PA 2XHEA 4HBZA 2YXEA 4QRIA 3A6PC 2V58A 1QHFA 1JHPA 1IHDA 3Q6NA 4QL3A 1NBEA 2REOA 4RD3A 4YP5A 2Z5LA 3PNSA 4MQEB 1CFZA 4JROA 3MELA 1EQ2A 1HRDA 2E2WA 3FDFA 3OIDA 5LL6b 1MRSA 2NO1A 1OYVA 2WFAA 5C3MA 2WFMA 4KDRA 4TS1A 4W5OA 2CHUA 4U39A 2PSEA 4DWOA 4UTPA 5IT9A 3QY0A 4N5LA 3DVAA 1V37A 3MJEA 1ZO8A 1XJ5A 3EDMA 4MWOA 4YRTA 3ZCVA 1AKWA 3HS3A 1ULZA 2AU0A 2A7XA 2JVIA 3NIFB 5D3MB 2F8SA 3DYBA 3KYCB 4L3OA 2XUJA 4MO2A 1HZZA 4NRDA 4C7BA 3OMXA 2ZRQA 3F3YA 5DGTA 3UVEA 1VCMA 3E9YA 1U0TA 3EUWA 1YUBA 2FRXA 4LGCA 4YS6A 4ZJPA 4TKZA 4WERA 3UV7A 1UDAA 1OV6A 2J0VA 4IGKA 4O5AA 1JHUA 4HSGA 3VM6A 2FPMA 1BIFA 2NMVA 1QZZA 4Q8EA 1WLSA 2PWAA 1NBME 2QJOA 3CF4G 4Q9DA 2XT6A 4OXYA 5EOYA 4WXPA 1NYRA 4R3NA 1L6IA 1Z2NX 4UCRA 4U7HA 5TQ2A 4FCCA 2DU8A 1N4AA 2J6TA 4HX9A 5C18A 5JXHA 1Z4KA 1MGOA 3CEPB 4ZRDA 5THXA 3SEAA 4M1MA 2Q4TA 5TQVA 3WLTA 1V1RA 5BNWA 5ADHA 1E20A 1UJ5A 1M8FA 1G38A 1U5BB 1GQOA 4DR3B 2QYSA 2JF0A 4OFWA 1E92A 2DOKA 1Z2OX 3KAJA 1QFYA 2GZ1A 2JGLA 3A26A 3DHYA 3PJRA 3K4QA 2XB2A 4GSKA 4F72A 5BMOA 2MMGA 1DADA 1AD2A 2W42A 3ZHXA 1UBMS 1JE0A 2OCXA 1QDUA 4REQA 3BGOS 2ZBVA 5KFUA 1ZU4A 5TPWA 2HLDD 1TTTA 2A14A 5JZSA 4AECA 4DQLA 4I5FA 3DZCA 5HBRB 1HE4A 1E9AA 1FNMA 1D03A 3I5MA 2IYFA 5DGHA 1USVA 1XRSB 2A9OA 3Q10A 3ZHTA 3U7EB 2FOXA 2HN9A 4IS2A 1F5NA 5JBNA 4AICA 3IP5A 4EPTA 3DVLA 3QKUA 4MVJF 4EYOA 5I7WA 3PRHA 1XDZA 2WM3A 4KPGA 4U7JA 3K6SB 3K0CC 2FP4A 3E58A 1MKYA 3H9GA 3P4UA 4JJIA 4PGMA 1G60A 5EJAA 1S2MA 3ZN2A 1P1KA 1C1YA 1XD8A 3HWRA 3TSOA 1LBSA 4O4JF 3HZRA 3PW0A 5KFJA 2R86A 3C24A 3NANA 4MMYB 5LZ7A 3RVDA 2AI1A 4GOJA 4QREA 3UT6A 4RCYA 3PWTA 3REQA 2ZJOA 2GTHA 3NHSA 5CM2Z 4Z1OA 1L6RA 4QBHA 4QUIA 3W5CA 3D6HA 3ZXXA 4B2PA 4MV6A 1QF9A 4K8RB 2V9WA 1T1EA 1XE3A 4GFDA 2HIGA 1Y8QA 6ABPA 3UMVA 4N6NA 5BWOA 2J0SA 2R00C 2XX3A 2P8SA 4YI3A 1CUAA 4CCYB 2JIZD 5C46F 2UVPB 3WAGA 3EEOA 1GDTA 1R6BX 3P4XA 4LGMA 4OL0A 4ZT7A 4MGHA 1BXGA 4ZAWA 1JXLA 1SMKA 2QDKA 5K3BA 3QTTA 1LDEA 3GEDA 4MCAA 2HKIA 4Y6LA 3V9PA 4PAMA 4DARA 1X80A 2ONYA 2EX4A 1DG1G 3GUYA 3E22B 3RQIA 5IVIA 1VB5A 3ZHVA 1Z6PA 1KJQA 1SFRA 3Q8LA 4GKAA 2AMYA 4OJYA 4L9SA 3EZXA 1TCVA 3N2GA 4RXUA 4HO1X 3MAAC 2EFEB 3GHHA 4KN8A 2WF9A 3U4DA 5JUWA 2W6JD 1AQIA 4LF5H 1P2UA 3TSYA 2JIBA 5SYNA 4RC9A 3KQSA 1NRIA 3Q7SA 3T5DA 1XTQA 1Q19A 3ZTWA 1NAHA 5IM4F 1T35A 1RI3A 2P1RA 2JGEA 4KFTA 3RWOA 4FHFA 1BO6A 1IQUA 4OCZA 3VV2A 1AM4D 4CW7A 4DN6A 4JOBA 2GZDA 3QUCA 3WFZA 3FNBA 1IZZA 1DLJA 3NT5A 2YFYA 3KFXA 1XLTA 4LKRA 1W8IA 4BMPB 3R7BA 1ZIDA 3OTWA 1PCXA 1NM5A 4AJEA 1LBTA 1JXOA 3G0OA 1R8SA 3HSYA 1LK0A 4C5CA 2IHYA 2ORED 5KFOA 2PYIA 2H2GA 3PVZA 3QF4A 4PFSA 3RVSA 1PG5A 2J5XA 3QBDA 2QQ0A 4FHCA 3TL2A 1UMCB 3NM5A 2QDXA 3CCCA 3LVBA 2VPTA 3LAWA 2CQYA 4RZQA 1UJ2A 2Q49A 5I7HA 1XZKA 1DKPA 1E2GA 1XNQB 1PJZA 1MTOA 2IYTA 4YGYA 4DGSA 4BZWA 3COSA 5ERYA 4RA6B 4BVBA 2FJPA 4L2IA 1L4KA 4C2MA 1YKGA 1JEAA 3GFQA 3BD9A 5FI0B 3UMGA 1BE6A 3OF2A 4EHHA 4DJFC 1PJ2A 1JN0A 5ALOA 2C7BA 3K92A 1DIRA 2HO5A 2WZCA 1LWOA 4LZWA 5J3JA 4TTQA 5M3BA 4C2BA 3SMQA 3UQZA 1RLJA 3C1OA 4HUQB 3GUUA 3N8GA 1QH8B 2FGJA 1VPTA 1MEEA 1ODIA 3R74A 3MUFA 4O29A 1JG1A 4P1ZA 1RXEA 1X1TA 4QWAA 2C77A 3EZFA 5F33A 3VFDA 4EY4A 2FPSA 2ZE5A 4HGYA 2Q7OE 2YXBA 4DKXA 3PPWA 2CJFA 1IXYA 4YQEA 5KFEA 1ZHHA 2I6TA 4IHJB 1DQPA 1W19A 3RIXA 4U3JA 3IELA 3UV3A 1X7YB 4IF6A 4B7XA 1NRXA 4X1KA 2XRYA 3VA7A 3KEGA 2TS1A 3NNSA 1F7UA 1U6KA 1AN7A 1WXQA 3TEJA 4F6CA 1A8SA 1JJFA 4ZQFA 4IIBA 4KWIA 4F85A 3T5LA 2YOGA 4RLFA 2QQEA 4ES6A 4RO0A 4RPKA 3BG5A 2PMWB 2ZUCA 4C07A 1EB8A 1C1XB 4H1UA 1AGRA 4XX0B 3LF1A 1QR2A 1N48A 3I64A 1IBKH 4FHEA 1PQUA 2BCEA 3QFRA 1YKSA 2BL4A 2WG2A 1PD1A 1K1EA 2V7VA 5E6SB 1QQBA 1SRRA 2C7OA 5CNIA 3QVMA 1JB9A 3WYNA 1EJ2A 1W35A 1I3CA 2YUIA 3CF4A 4TL9A 4J0GA 2PNFA 2VJMA 4QELA 1DWPA 1M33A 4KQ9A 3GRVA 1AQNA 1RXIA 3GUZA 3FOEC 2HU5A 3PHGA 2EERA 1EFLA 3VC1A 5EJ9A 4J9KA 5K0CA 3O0TA 4YRPA 3Q9NA 5E6RB 3CW8X 2AIRA 4S0ZA 3SC6A 3WNBA 1SBYA 3WLKX 1M34A 5AHRA 3AETB 3HFJA 4AVYA 3CBGA 4BKPA 2IHJA 3M8KA 4CTOA 4F9FA 3S8YA 1G9TA 1W47A 1N2OA 1ND5A 3WK4A 5DBFA 1AS2A 5LCXA 5BP7A 4RK7A 1F7VA 2IHZA 1LNQA 1JHQA 1FUEA 4FGWA 3VNVA 2J7PD 4KSYA 3PVCA 5B55A 3RC8A 4RFSA 3EGWA 3NB0A 2XJ9A 3HKBA 3R1IA 4W6ZA 1PJTA 1VSQA 4E13A 3O8NA 3VRHA 1XQ9A 3SD7A 3PIDA 3U61B 2C0CA 4CKBB 3O9MA 4LE2A 3FUXA 1IOWA 3KR9A 4YAFA 1GXSB 3WAKA 3TDNA 2OZPA 2ZRBA 2X7JA 4NYIQ 2RHCA 1IH8A 3U9LA 3L7OA 2HMTA 2F4VH 2ZT8A 3R76A 1G3MA 1N2ZA 1ZN8A 2JLSA 2N42A 1HDZA 1B0AA 2PJZA 4KX5A 5E7JA 4ESOA 5KS2A 4IHJA 4MGZR 4B6SA 1CUZA 4ED7A 1RWWA 3NJ4A 4TYYA 4GUDA 5GV7A 3UAGA 1V39A 4Z2AA 3QVXA 3C3BA 1AQYA 4TGLA 1SXPA 2PWPA 5A7GA 3AR9A 2DKFA 3A25A 1IB6A 2I4IA 5HJ7A 2EP7A 2JIOA 3AF5A 1RRVA 3NU1A 4J3JA 2A9QA 5KNLA 2BGGA 1I2BA 3KXYT 4AQYB 1KBZA 2Y1LA 3L9WA 5EL0A 1HPLA 5KO2A 4YAKB 1WW2A 2NU9A 2OD9A 2XIJA 2IF2A 2NV6A 3P0JA 4WN9B 1ECCA 1HTTA 3ORRA 2J6BA 2V45A 3LA6A 5IP7G 3IBFA 4FI3C 1CPYA 4I1OA 4L8WB 4ARSA 1I7LA 4KN6A 3T3OA 4B6FA 4BMXA 1IVNA 3DPUA 4QM6A 2IHUA 2JNWA 4MW6A 1XFAA 2WVGA 2ZDQA 4MMXB 5EWLA 1TUBB 3S2UA 3VH4A 2VJLA 3VU3A 1ZUIA 1A2BA 3KXKA 4MGEA 4XCQA 4BO1A 4FIDA 4E09A 2ZJTA 1RQ7A 1V9LA 1Z37A 3GLHA 2C2BA 1KU0A 3GF4A 3GC6A 4D9BA 2RGAA 5HF6A 3H3VH 1M6YA 1TYZA 1X7ZA 4LG1A 4V1CA 4AMZA 3NC0C 2HPHA 3UMSA 1IM2A 1EBFA 1V26A 2YV2A 3ESDA 2O03A 4MWCA 3BFVA 4PZCA 1GZ3A 3OIGA 4NDNE 1AKRA 3DBLA 1P2BA 2Y71A 2X13A 1RBMA 1UMKA 1O94C 2JA2A 3L0OA 2P69A 3TRJA 1MTZA 1E2DA 1DRVA 1Q0ZA 3FNHA 3E8SA 3E0XA 5JAQA 3PJGA 1KAMA 1IBCA 2Q5CA 3B6IA 2AR9A 4HRAA 4U5QA 4X3OA 3DOEA 3G2KA 2QM3A 2K4MA 2PUJA 3B3FA 4O0LA 2J0EA 3M70A 4UVHA 3LCJA 4JENA 3W8EA 3GTMA 3BH0A 2FF5A 5D3QA 2O05A 1IK6A 3V32A 3VHRA 2XGJA 4LDNA 1MX5A 1ULUA 4E5MA 1L5QA 2DVMA 4HNHA 2PLNA 5ELLA 2W6ID 4DIFA 5ARBA 5KT2A 3K96A 3HCAA 1ZJZA 1VMAA 4JR0A 2ZRKA 3LWZA 2W8KA 1C1DB 4TMWA 3RJTA 3OOSA 3P2IA 5GJWC 4ICIA 1TKBA 1FTWA 4GBED 4D43A 4N03A 3K2BA 7GPBA 1B23P 1OD6A 2FZ5A 4L78A 2OFPA 4CKEA 5FWXB 2OKCA 2YWBA 3I9JA 5EJMA 5DLQC 4OSEA 1V51A 2AG0A 4B4OA 2L18A 2E5LH 4BUJA 1IM5A 3KT6A 2YOHA 2A6PA 4I66A 1WVGA 2H29A 2UUOA 1TMYA 1INLA 1X7WB 1U2SA 2PL9A 4IRCA 1YSCA 4BJHB 1X1BA 1V5GA 4HNGA 4TV8F 3NP9A 2JGJA 3N2KA 5DDIP 2CHVA 1KI6A 4Q1FA 4EP1A 2ZZNA 2Q0HA 2WF8A 3L8HA 3TD2A 1N5KA 3A6DA 4GX0A 3HXLA 3M9XA 4MJLA 2R96A 3MMPA 4DE5A 1M7GA 1K8ZB 1U2DA 3OCYA 3QTBA 5KX5F 5LQRA 1JHVA 1MD9A 2FU5C 2QAGA 3FAZA 3MTDA 4H4CA 1W9HA 421PA 3EZ2A 2ANCA 4HCJA 4HVLA 1T2UA 4M8LA 1ACLA 1PJRA 4AROA 3PF9A 1HDXA 1QGOA 4ND6A 2NGRA 2OZVA 2X4DA 4HD8A 3MLAA 2LE0A 4A3IG 4K9PA 4MVJE 4PAOA 4E21A 1MR3F 1OFTA 1U4NA 1SU7A 1A4RA 3ZWVA 5HM6A 2CKZB 4ZCMA 4M37A 4LOAA 3OSZA 4RHUA 1WPRA 3QELB 2DBZA 2GYVA 3PC7A 1JI3A 1LLCA 4UCVA 1T2EA 1UUFA 1YOBA 2G83A 3N39C 4PNHA 5J47A 4Z51A 2VDOB 2D13A 1S96A 3D64A 1S89A 3F2IA 4KR7A 2OBXA 4PYNA 4JOSA 1TD9A 3BWDD 3PFNA 3RS3A 1PU2A 1FQWA 2QUHA 2OV8A 4OQXA 4ZDWA 4J9MA 1VHQA 3VKUA 1T4MA 1JALA 4FW8A 1YI8A 4XD2A 2IE8A 5JNUA 2EU8A 4HN2A 3GZNA 4NBNA 1D0VA 3F8WA 4O4HA 1EM8B 1K75A 1DE0A 3ZLTA 4BRSA 2QX7A 3PZBA 3IAXA 1QR6A 2H7XA 2VUSA 4YMIA 3ZCXA 5FUMA 3FPGA 3HCNA 2YYYA 2CZGA 1LLDA 1I3MA 1MIOA 4BXXG 4DR7B 2JEOA 2ZSBA 3IN5A 1K98A 1T24A 1FNNA 2FHPA 4LJLA 5DGCA 2AKAB 4BO2A 1YRWA 5F9FA 4BPRA 4DJEC 3V8RA 1JU4A 4F2HA 2JBHA 4IIJA 4JA2A 4XRGA 1SCJA 1VP9A 1BCSB 3BXHA 1A5BB 3IAM1 3QQPA 4DLSA 5LXTA 1RJFA 4EVSA 4U1RA 3ACBA 1BMQA 3E1GA 1DG9A 3AB7A 4CKXA 3RHFA 4M0DA 3L3BA 1U3DA 1MEJA 1GPJA 3GAMA 5D1OA 3ZGVA 4PX9A 1QGDA 1R4AA 4TS3A 3CLSC 3LUAA 1J2JA 3FSGA 3I8XA 4ZMSA 5FWYA 3JAMW 1IDOA 3F5QA 1HE2A 2O2SA 2JLYA 3ZU3A 2X9VA 4MQUA 1LQUA 1VG8A 1Q20A 2BGKA 2DC1A 3P26A 3T1VA 3ZQJA 4Q4CA 5CLFA 4CIBA 4II2A 2O5VA 4TTJA 4F5YA 2VH1A 1XD2A 4JI3H 5CT4A 4KACA 2O3UA 3EOBI 4QUAA 3HB9A 3EXHA 2WI8A 1B6SA 2ZLBA 3QWIA 2C1XA 3PNKA 4AY5A 1RWKA 1JDTA 2Q41A 2X58A 1H6DA 1E0DA 2HJVA 3QNMA 1HE3A 2NU8B 4NBUA 3U7IA 4B7AA 3ZOKA 4TYQA 3L6UA 2XGOA 4DOMA 2XB8A 1WUKS 3E9ZA 1JDNA 4WLOA 1WUYA 2AEFA 3AJDA 1SELA 1CK4A 2H4HA 2PX3A 2QM8A 1D3AA 3A9WA 4QAQA 1YZKA 3A0UA 3QVOA 1E79D 3KHLA 4ZN6A 5CFMA 1EUCA 5CMLA 1UKZA 3VJLA 4PG8A 2HVQA 2RH4A 1BHSA 1J24A 4AM8A 3A2KA 3LTNC 3PWSA 2P5UA 2Y92A 3DKPA 3GIKA 5HKAA 4C01A 1BA3A 1IWOA 1C8LA 3ETJA 5E9QA 4LF9B 1ECGA 2WYOA 3E9DA 3P4YA 1Z7BA 3A0RB 5AKHA 2YC4C 3KAPA 5DISB 3FZQA 5EIAA 3UAXA 1SRQA 3WGHA 3ESYA 3IAS6 4G09A 3KSRA 1VKNA 2BR5A 3W2HA 3ZWYA 4DAEA 2DERA 2JZOA 1FJ2A 1P7PA 3LX4A 3A7EA 3M5WA 5AM1A 4ZU1X 4CIVA 3ELDA 4EVQA 1XTVA 2XBUA 2XZOA 2CLIB 5DTEA 2FSPA 2XCUA 1UJCA 1YRLA 3G2OA 4G4JA 4GMGA 4Q7EA 5FQNA 3UWOA 2QPOA 2C4UA 2OQ2A 4TKLA 1KPGA 5FBZA 1ZOOA 1W0KA 5FAXA 3ME5A 2D2FA 3EQ7A 2ANBA 4GVXA 3FGPA 2W6QA 1TK2A 3FRHA 4RNOA 4PN7A 4TYPA 4UHKA 4IVRA 2VJPA 4UEKA 2A4KA 3L0ZA 1RR6A 2XNDA 4GZ6A 4E2FA 4H0CA 2J41A 4NAHA 5KB3A 3EXFA 4FJ1A 2L19A 2W8ZA 3BQ0A 2OESA 4RQUA 4FFDA 4B3DA 5JXWA 1R0WA 5KVCA 1JAHA 1JBQA 1KAGA 4OKSA 4YT4A 3KJIA 4LY9A 1OSNA 4KB5A 3SJ7A 1V9SA 4Z9XA 3GFTA 3ELYA 4J1NA 4F71A 1G3RA 1KORA 4CM1A 3PV0A 3UJBA 7YASA 1BC5A 1FS5A 2ETVA 1FU7A 1OFHA 1ST3A 1N0HA 2P2NA 2P3LA 3AFOA 1K4YA 3FDZB 4FUQA 4K9QA 3HZZA 2XOKA 4S1PA 2EGUA 3NWPA 4WBNB 4DB4A 5FBQB 3RJ5A 1PE0A 4NS4A 4C0QC 2WFLA 4W9NA 5K3DA 2QLJA 3K1JA 5C8YF 1N8SA 2X8WA 2YX1A 1M3SA 3F8TA 4KWEA 1JKJA 2R8BA 1A9TA 2F3RA 5JS6A 3W5DA 2MSCB 5HQ3B 1NTOA 4UHCA 2CXSA 4LZJA 5IWCA 4F60A 4H3HB 2NP6A 4BNVA 1A7AA 4G41A 1Z5PA 4OU5A 5FHRA 2Z8YM 5PGMA 4X1OA 1N4DA 5C1OA 5A4IS 4MIEA 1XEAA 1JQLB 3HEBA 3Q4GA 2RI6A 1MO5A 1YDWA 3BHIA 4HTFA 3W7AA 5JQGF 3IJPA 2JAUA 2H2DA 4A16A 4CKCB 2D3WA 1UQTA 3J7AK 1OROA 2E6UX 3E84A 3KCNA 2W70A 1WQ3A 1KF0A 3JYQA 3PFWO 3L93A 2IZZA 4MQMA 4N9QA 3WB0A 4KSBA 4ZANA 3JARA 3M2TA 4HPXB 3K35A 4M9QA 4YUYA 2ZJ3A 3M9LA 3NTXA 1ZGJA 1MJ5A 5J43A 1KAOA 3P9KA 1RJGA 5G1NA 2PPVA 2O8VA 3RAXA 1V16A 3UA3A 3G2JA 1LDNA 1FUYB 1KO4A 3QYAA 4F8JA 3ORSA 4Q7JB 4RETA 4FDTA 2YWRA 3JQ7B 3RAJA 3UWSA 3VGJA 4NMHA 1QFJA 3IUMA 5EXSA 4EA9A 2VDJA 1VAJA 4J6EA 4Q4DA 1SKAA 3RGXA 1SCNE 1W0JA 1G21E 2H85A 1YACA 2JDIA 3AJRA 3L82B 4GDMA 1N3BA 4XWGA 5DHQA 3X0DA 3ZHSA 1H05A 4PNEA 4YJHA 4KREA 4EA7A 5L3VA 2BFDA 3V97A 4A91A 1LRKA 4RADA 5L45A 1T2VA 3PDWA 3NHZA 4P83A 2RDMA 4H2DA 2B25A 1G63A 4AUKA 3TVTA 1E1DA 3Q0TA 1N7GA 2VRBA 2W7TA 3LLSA 4FYHA 4J0HA 3I23A 5KIAA 1X9HA 1XU4A 1ZH2A 2QYOA 3IHWA 2V97A 4QARA 3WK8A 2V65A 2D7DA 2UVVA 2PTHA 3SMVA 2C2XA 3CUWA 4Q39A 1U5CA 2P5TB 4FPXA 1THMA 2Q1WA 5BO5A 5PNTA 3MHTA 3BRQA 2BGRA 2JEFA 3SOZA 2WOOA 1TM4E 1E5QA 2AG8A 2RIRA 3NDPA 3QWBA 4B43A 5B6PA 3NEJA 4KBYA 1D2GA 3C87A 1Z4PX 3ZQ4A 3OZSA 4JI6H 1JI0A 3BMXA 1CY1A 3N05A 4P3OA 4QEKA 3ZZ1A 1PR1A 4D9EA 5CB0A 4OUDB 2NAPA 4ZVOA 3THYB 2Q5FA 3MF4A 2AHOA 4WFJA 1JDJA 1Z0KA 3RJ0A 2I6GA 4JL6A 4YP9A 4E30A 2NU6A 3GJYA 4P22A 2VJMB 2IU3A 5AK3A 4HYYA 4I6EA 1CHNA 1HFKA 2XWSA 2Q4DA 3MMSA 4RPIA 5HCNA 1FDTA 3DTVB 4BMYA 1MAAA 1SG0A 2NYRA 4CI0B 1E5TA 5CIYA 5FI3A 1D6NA 3OPYI 3E9CA 4WY2A 1AKTA 1AN0A 2G1AA 3PPXA 2G63A 4P4SA 3T5BA 4JLMA 4PO3X 5ESXA 1I94B 1MORA 3TS1A 4JYAH 2F1KA 3R2JA 2P6MA 3RRMA 3ZXSA 3GEEA 2FPXA 2AVDA 1CRQA 4K86A 1GNSA 2X9QA 4KXUA 1QG2A 2B1GA 3I6ZA 3OP1A 5DHAA 7MDHA 1BE8A 1TZCA 1SXJA 3OE4A 3PYMA 4DC1A 4RYDA 4KXVA 1O77A 1RPTA 5FO1A 4N47A 1A8QA 2ZTHA 2V7TA 5JG7A 3V8QA 3AEZA 5LUAA 4PR3A 2QENA 1NOKA 2AKYA 3ZY2A 2VYFA 4XB1A 1XUOA 4YMTA 3IUQA 2BEWA 3E2IA 1N2CB 1JEEA 4MKGA 1CP2A 1LK7A 1QIEA 5FJ8G 5E8RA 4LQDA 1PNOA 4HAWA 2WLSA 2O9JA 4M1TA 1M2OB 4QTXA 2M6RA 3CH5A 4KODA 3HTXA 1U7XA 4F92B 2H48A 4UUNA 4WINA 4EHAA 3E53A 4BNUA 1KKLA 4IOMA 5EMNA 2YV3A 4ZFNA 5A7FA 1XB2A 1JAXA 5LB4A 2R7MA 4A93G 1TZMA 5K8VA 3D02A 4KH1A 3C3CA 1U0SY 2DH5A 4BFVA 1EFVB 4IL5A 1PWEA 3BMNB 1SOAA 1I7NA 4J4TA 3I3SR 5DTMA 2ERYA 3EVGA 2Y66A 4FQ8A 1OXUA 3VC2A 1KYIA 1SEPA 1WPXA 2QAGB 1MAUA 2BIFA 1DEXA 2R00A 3UA4A 4R51A 1Y6RA 3O38A 1UKYA 3ZE7A 3P71T 3ZGLA 4MR9A 5EINA 4D44A 4HLNA 5AQ1A 5CX4A 3ZJ4A 4DLUA 4XR4A 2XMGA 5JS1A 4CDMA 1TT7A 4AJ2A 4RORA 5FLEX 3VO9A 1HL7A 3F73A 2O2YA 3AU8A 3T1HH 3V46A 3ZE8A 3LWNA 3KIPA 3MRXA 4LJRA 7AT1A 3GLQA 2BFNA 4NE9A 2J5KA 4R98A 4V2IA 5FKJA 4BUCA 1HNXB 4NESA 4H1WA 4ZCQA 1DTWB 1FDSA 5TMEA 2B83A 2OV3A 3JW8A 5FA6A 1T6NA 3QRWA 4DZRA 5JMPA 5HIKA 1GZSA 2RGYA 3CPJB 3LP6A 2R1VB 3OPXA 4QJ5A 5AJZA 3DFFA 1RPJA 4ETSA 5J59A 1VSBA 1E2HA 1ZWKA 2ZDGA 3H1GA 3V7UA 3W06A 5AW9A 1AKNA 1V71A 4FDMA 5FUQA 1TWCA 4YRRA 5BW5A 1WM1A 4BEVA 1QO7A 2NO7A 3E1KA 3F49S 1W85A 3PUXA 4MR7A 4ED8A 4B32A 4G9BA 5K0FA 5LDGA 1PL0A 4KVFA 3L0BA 1R4ZA 3G9UA 1XCOA 4Q4AB 2DUWA 2QUIA 4FR2A 3PX7A 1DKLA 2R25B 1E8MA 2QHXA 2RHHA 4PX2A 8GPBA 1QLJA 2F1JA 1DELA 1Y8QB 3LQYA 5DTQA 4EDHA 4F38A 3T3GA 2B37A 2W9BB 1CV2A 3KOMA 4M9ZA 4R9NA 3W2GA 1ZH8A 4JU8A 1OR8A 1BGVA 3H86A 3IUPA 4JUAA 5LXTB 1PDWA 3EGDA 2R82A 1PL7A 3W5HA 5FPKA 1UL1X 1IXSB 1YK1A 2IPLA 1WP4A 2BTQA 4XSHA 1EFPA 5ALQA 4L8LA 4DBLC 5IT0A 3RKUA 2FAXA 2MCFA 1UF9A 3RFTA 3S1AA 1C1DA 1X7HA 3DB1A 3K0EA 4ZMRA 1KIAA 3VZPA 4KRFA 2DPMA 5IJWA 2MYUA 3ZWAA 2VDRB 3JQAD 2WHYA 1GPMA 1GT6A 3SIXA 3W5SA 1MPXA 4E12A 2ZYAA 2CL0X 3JR7A 1HNWB 4KUHA 4ECQA 2P79A 3JQ9C 1CVIA 2YWEA 2GPYA 2GSDA 4HWOA 1WSAA 2CGEA 5IT4A 5DH9A 4DB2A 2RGVA 3RTXA 2NZ2A 4CLOB 1JHXA 1P45A 1UDCA 2QN8A 3R0ZA 5LLSA 3BEDA 4PONA 4RX1A 4XFKA 3U3RA 3VYVA 1ZD3A 2R97A 1EP9A 1GUYA 3QLTA 4PZEA 4RJJA 5H1YA 1E8NA 5DYYA 1XRJA 1VTKA 1L4BA 1R8QA 2XMSA 3PPIA 4Z86A 5IK2A 1V11A 3BIWA 2X0DA 3T7TA 3U4AA 1I1NA 2SICE 5F7OA 5JV5A 1GG5A 2YJZA 4V3BA 3S5UA 4ARCA 3CWZA 4H27A 4E7PA 3QEAZ 4XQCA 4JVNA 1RHRA 3W8RA 4JGGA 1RK5A 3QA3E 1W96A 2GETA 3L8DA 2VTEA 5EJ8A 2BGNA 4YECA 1Q1NA 4Z54A 2OVFA 2GZ2A 5EJ6A 2C9DA 5ICEA 5TLSA 4EHBA 2AMVA 3T4EA 1L7OA 2OGZA 3HB5X 4EY7A 4LRYA 4GM0A 2JKYA 4NLLA 4Q8FA 1R8YA 1Z25A 2A3NA 2DJIA 1AO3A 2FWBA 3IIEA 3KV1A 1W5TA 2C5SA 3L41A 4HNUA 4IR1A 4RUCA 1JECA 1KP3A 2BV3A 1XCJA 2OQIA 3N28A 2KE5A 3NHPA 4G2NA 4HFRA 4P33A 5JCJA 3X1MA 4M6WA 1H9CA 1UBLS 2WVHA 1YQXA 4O63O 4MHSA 2VAVA 4P3XA 2XWQA 4QYWA 2O8EB 3RIZA 3TRKA 2OHXA 4HEA6 1FBTA 1TM7E 1GWNA 1K1SA 2IHVA 5KWJA 2I54A 3EBLA 3UXMA 2OL4A 3V8EA 1D2EA 2I9KA 3EIEA 1VL1A 2BMFA 4EW1A 1J21A 3IXLA 3L4BC 4IJUA 1K8RA 1XEXA 4ZKEA 3WWZA 1YRYE 4AMGA 3H04A 1JR6A 3QLVA 5DG8A 1UEIA 3RUCA 1MZBA 3T1YH 3JZAA 3FJ1A 4BJ6A 3JTMA 1E60A 8MHTA 2YMQA 2ZYVX 3PLNA 1NNLA 1DEKA 1EVEA 1HDOA 1JPJA 3D5QA 2Z2ZA 3EGIA 3KSUA 2JH8A 4WHMA 1VGRA 1BMFA 4RJLA 1E6CA 2WJPA 5LBTA 2ZM5A 4ZOAA 1KL7A 1M6NA 1NJ1A 2CZCA 3CR3C 3F3MA 4XUDA 2ZXEA 1A4IA 1SVMA 2E87A 2ZS8A 2JKVA 2W2MA 5AKZA 1GAEO 2BR4A 4JYPA 4O2AB 2X5KO 4REMA 5K0SA 3D7RA 3WP1B 4EF5A 4FFBA 3RI3A 3LP8A 1BN7A 2PVSA 2GERA 3G49A 4GLJA 1GHTA 2VHZA 3I92A 2VP4A 5KDOA 2TMYA 1C3OA 2V74B 4IKPA 4DV0B 3ISVA 2ZKLA 4C2TA 3NIBA 3E9NA 3K20A 2GK6A 2NTJA 1RHMA 3PXCX 3QNWA 3AR2A 2XQGA 5KFHA 5EMHA 4WK4B 1T3GA 2LCIA 1VPVA 1YL6A 3A1UA 4CG1A 1OXTA 1M73E 2QTHA 3R0XA 3VZSA 3G8DA 1A9QA 1X9GA 1JEJA 1QHHB 1WXEA 4PLYA 5HRCA 2IYLD 3O8CA 1MDFA 5IAKA 4OAPA 4NTZA 2VCYA 1YBHA 1G5IA 2CMFA 2DY0A 4X6LA 3OT4A 1A7KA 3FAKA 4FC7A 2H1IA 3FA2A 5A3SA 2Q9CA 4C3UA 3PEVA 3VPGA 1D4OA 2IXTA 2XUQA 1E1RA 2QSJA 3D4IA 1CZOA 2WD7A 2G72A 3DE0X 3NTQA 2OXCA 4A8JC 4C04A 3DLAA 2AF3C 2B7CA 2ECQA 1Z5WA 1P7CA 3EB9A 2GPJA 2VPPA 3RWMB 5H81A 5KOIA 2G1PA 3OIFA 1ND6A 4AZVA 5AT1A 4A8JB 4LISA 4ZI5A 4KR2A 3LH5A 2D2IA 3UYKA 5A0VA 1EXNA 1X80B 4LW8A 1LXCA 1IZ0A 2WSYB 3REOA 1Z36A 4RANA 3C3XA 1K4KA 2ODPA 4UEOA 3L2PA 2PX0A 4UUMA 2GAOA 4KUEA 5ERGB 3QYPA 2IXFA 4HK4A 1EVIA 3NIGB 4H0FA 1HTWA 4WCVA 1MB0A 5GV8A 2QMEA 4FE3A 2ZT5A 5T4HA 3CZAA 3JALA 3P7MA 4O08A 4X7RA 5ICFA 2ECPA 3R3JA 1BFKA 1SQFA 3WYEA 3KJEA 3H0GG 4FOLA 4HPJB 3GQVA 2C2RA 1SGWA 2CD9A 4DNQA 4O2AA 2XMPA 3EXFB 4FOPA 3EEQA 2XI4A 1R5JA 1O5TA 1ORRA 1NDUA 1BCRB 3D3KA 3JYOA 4LF6H 5FRDA 2G0AA 4JCOA 4TX1A 1QZXA 3W04A 1EVLA 5HDQA 4Q1AA 3BD8A 3KXDA 3H5TA 3QE0A 4RQBA 1LTKA 3G3EA 5KBYA 4MUGA 3RYHB 1Z6ZA 4X64B 4NECA 3WQQA 1MGPA 4FMBB 2YRFA 5EHIA 1F12A 1R37A 3JVUA 3AC0A 8ATCA 4B76A 5K01A 3O26A 1UBFA 2W2OA 2PYZA 4ROTA 3VHLB 5AJUA 5LYJF 1J09A 4MR8A 4L15A 5K9ZA 3GLGE 2AYYA 1LRLA 4LTMA 4N0MA 1E2BA 2OBYA 2HYDA 2GK3A 4B2LA 4YUWA 4UTOA 3T6KA 3T7SA 3VDQA 1N2JA 1MC5A 4R0NA 5EKUA 2EEZA 2V7GA 4I4TF 5M29A 3DV0B 3VMMA 1JUDA 3OHMA 1XTZA 4Y2HA 1PR4A 5GJBA 3UPUA 5LSAA 1ARZA 2XSZA 3T1HB 3GVCA 2AQHA 4NBLA 4NK4A 2N75A 4EM6A 3B3QA 1W49A 4WN3A 2HHCA 3M9OB 2I7VA 1QFXA 1HEUA 1EMDA 1EUDA 3I4MG 2IUSA 2PUTA 3MWKA 5EAIA 3K09A 5LC1A 4CXMA 5AUQA 2IPOA 3B12A 1PLKA 3GCWA 4E5DA 4JB3A 4YAGA 3TUJC 4LSWA 2I6XA 1BN6A 3TW0A 4GLXA 4CEJA 3B85A 5HPYB 2VWGA 2Q45A 1PIWA 4Y6QA 4DZZA 1CUDA 1E3WB 2VP5A 3TM4A 1A95A 4CM6A 2WIGA 2I4LA 1Y8RB 3O4RA 4N3CA 1IY2A 3NHJA 4AKEA 1HBJA 4UM9D 2XUIA 1EDEA 3CZ9A 1VRCA 2PRYA 3UIEA 1P0IA 5JH7A 3PUZA 5JUMA 2FZWA 1DV2A 1E69A 1CRZA 3F6YA 1XX6A 3PWKA 4FE7A 5IC5A 4GPD1 1CCWA 4GBJA 3UTDA 6REQA 2OKGA 3GDGA 3F5SA 3M4JA 4P84A 2FXVA 3AP2A 5K6AC 4ZU6X 3IKLA 1E1LA 5ARDA 3ZI4A 1RWPA 3BPSA 3UJAA 5JPCA 3GLIB 2CBGA 2F64A 3GAAA 1KEKA 5HGXA 3BVPA 1KERA 2WM9B 2II6A 2YV4A 3WMEA 1RAGA 2YFHA 3VBCA 2BI4A 1KE2A 4D92A 2GILA 3KSAC 5ELMA 3EPGA 2OK8A 1LLUA 2PSFA 5F78A 2OPHA 1FDWA 4PLPA 2IH2A 2VNSA 3RF7A 4QVKA 4IWXA 3V9AA 4AYWA 2XUDA 5LQJA 1U7ZA 2W98A 1IQPA 4KQFA 3CNEA 3H65A 3DMYA 3U16A 4QWMA 4KWCA 4ZT3A 2P40A 1WHTB 2R8JA 1RACA 2P9CA 4N39A 3STHA 4DLPA 4KQCA 5TPZA 4WZ6A 1BU8A 3GCXA 1Z2PX 1IMJA 4QLAA 2Q2QA 3CIOA 5F77A 1CULC 3ND7A 4ZO7A 4OLFA 5E3IA 5TARA 4NCXA 2VTBA 4L22A 4YRKA 3E3NA 4S2UA 3AL0C 1U04A 2WQ6A 2CKMA 5KFDA 4C4YA 2H92A 2ZXFA 1VIAA 1VXOA 4X8HA 3ZDBA 1YH3A 1E2MA 4FR0A 3PGXA 3IV7A 5CVEA 3VU9A 3AHHA 1E6EA 4GOXA 3PUJA 4R3WA 4MWZA 4DDKA 4Q7MB 1A77A 3C3EA 3SM3A 3ONNA 4CKYA 1BGWA 3IH5A 4LJ8A 2W9BA 4FDVA 4E1BA 4CF7A 4TSRA 3DMPA 3K6RA 4W5HA 2PKEA 5IJ0B 3ICOA 2O8CA 2HLHA 2PPLA 3F97A 2VRCD 4QPDA 4QYIA 1OJLA 5CCEA 1H85A 5WRFA 1NU8A 3KQQA 5HE9A 3V3KA 1OAKA 4FS2A 2DX7A 4HGRA 1P9LA 2HQSA 5D5HA 2IV3A 5C5EA 1X7WA 1UCFA 1Z5OA 3WADA 3EVAA 1E3MA 2BEWB 3GRRA 1NATA 3F74A 3IPCA 2CVQA 4M7OA 3CB2A 4DSTA 4BV9A 2RB5A 2JA7A 3EDQA 1VS0A 2V9ZA 3UEOA 1Z0ZA 4DG9A 1BNCA 2WU1A 5HZHA 1P4JA 2GAAA 3LVQE 3LOQA 2O7SA 2RKWA 3QVLA 2WZDA 3ESAA 3NONA 1NONA 1K8XB 4ZO8A 5AW8A 3M4YA 4KRGA 3N44B 4CMIA 1RU3A 3N5CA 1XTIA 4G9EA 4BKOA 4KFRA 4PQEA 1BFDA 2V1XA 3KK0A 1KQPA 3MSXA 1TVKB 4GPAA 4XIGS 4URVR 4KFSA 1KI2A 1K0UA 5I6DA 3MWDA 1CR0A 2H08A 2J3KA 4UNSA 1D5CA 4CODB 1KH2A 3FYTA 3DC2A 4PLZA 3ZYZA 3HKCB 3KFLA 4TLCA 4KYIB 2QXUA 3FTQA 4F3CA 2DJ5A 3OFND 4UXHA 1IU9A 1KAEA 1USIA 5FHQA 5I5GA 3BTSA 3NC1C 1YVEI 4E2ZA 3OZRA 5T67A 3EYYA 1HLFA 4A26A 1XZDA 2FLWA 1ZSVA 2PS1A 1LU9A 2X40A 3A6FA 1L7RA 3B89A 2Y0CA 3ND8A 2BTEA 3W6PA 2Q2UA 2FE3A 1QHXA 3IP7A 3L7IA 2M05A 1U3UA 3ND6A 2EZUA 3PRKE 4KXXA 3WVNA 5KG0A 4GF5A 4W1PA 5K2MA 2C2EA 3WZ2A 5INTA 2WLTA 1ADGA 2B63G 5FBWB 2XZLA 1NXTA 1SBTA 2FMKA 4YR7A 2QTNA 1W44A 2B78A 2YDXA 4P34A 5JJBA 3OKPA 4CMCA 2A8YA 3C16C 1OAOC 4HQOA 1E4OA 1E99A 4DAOA 5BQFA 5M5BA 2NNWB 4PHCA 3EC7A 2I87A 4TQSA 2P3QA 2QMYA 3OI7A 3U3ZA 4KZKA 5KNDD 1QYIA 2FTKE 4LYGA 1QIMA 1NPDA 2VK1A 1G5RA 4TVOA 3L8EA 3WGIA 5JYCA 3HYSA 2FPPA 3ROXA 3X44A 3V4LA 2Z30A 4J1QA 3UK1A 5JECA 4B45A 4LVUA 4L72A 3TLZA 4CE6A 4CF4A 1H2WA 4BNJA 1P5HA 1U1DA 2BUCA 5DOZA 4DMHA 3KOZA 1HWYA 3BK2A 1WMEA 2VHUA 3WMGA 1ZGBA 5CFNA 1VI5A 3NPAA 2W7PA 1ZISA 3V4PB 3SOPA 3L6BA 4EITA 3GEPA 4U0KA 4ZRNA 5E4TA 3TLBA 4Y6SA 4WWHA 2Q5EA 3ED5A 1XAIA 1Y34E 3NDJA 1RTTA 1ID8A 3S2YA 3FH0A 5DBIA 3V2GA 1XL1A 3QPAA 4XM0A 2WIFA 1SIWA 3FI9A 2BGMA 1CYDA 1JLLA 2DF8A 3Q3JB 4LBZA 4B2YA 2EAUA 2WSIA 1QH1A 4DUGA 4S0XA 5BY2A 1YQQA 2R5WA 1P7YA 5B37A 3JQRA 4IPTA 1WW3A 3NORA 2X4IA 3DD1A 3JWEA 3PKJA 3USES 1HR0H 2FPGB 4BGUA 2F48A 3P1JA 2IEZA 1TTHA 5CXXA 1GFWA 2VXBA 2ZSUA 4GSYA 1MMFB 2ZW9A 3ZU4A 3PE3A 2MINA 1TAHA 1UFOA 1G2QA 3FCYA 2AT1A 3FOZA 2QUBA 2BGWA 2YH2A 5AJVB 4BVJA 4NMMA 4ZCLA 3QVTA 1XV5A 3BE4A 4LF4H 3I34X 1VBGA 1AB5A 4Z3OA 3OKAA 4F5DA 1I2ZA 1LBQA 2H16A 2Z9CA 4A0GA 2O2DA 5AVZA 2I7DA 3SX2A 4KQKA 1DU4A 1GQRA 1ABFA 1KS9A 1MH9A 3QHPA 3F7NA 1LVGA 1K9SA 2QL5A 3EWIA 3BERA 4J0IA 2EIXA 4AB1A 1BXKA 2FFBA 2PUDA 5D3ZA 3RFFA 5LZ4A 1RD4A 3ZWDA 4K2AA 2MMCA 3BWEA 4M1EA 3FOCA 1C0KA 3PT5A 5BYJA 4PC6A 4TQGA 2UUAB 2F55A 2D0DA 1M6VA 1G6Q1 3Q3VA 3RC9A 1WIWA 3DGEC 3N6VA 1NZJA 1UWLA 3V34A 1JH8A 2A1TS 2CN1A 2FMXA 2ZWPA 2IYXA 2CF5A 2V7BA 3L6DA 1OFVA 2HMUA 1T25A 2RK6A 2WE6A 1ML4A 3NOOA 5FFFA 3VR4H 3TIGA 1QO0D 2AG1A 4OP1A 1DO8A 1Q0QA 2W2KB 5C80A 4QWBA 1BCSA 4QC2A 2O5CA 2FH5B 4UREA 4BQPA 4LJKA 2DYKA 2IXDA 2W5UA 4M8SA 3BE6A 4JUZA 1Z6TA 2OFXA 4Y9SA 3H97A 1C9NA 3K2IA 4LWZA 2O8BB 2PD6A 1HYQA 2X7XA 1PHPA 2IYRA 4JELA 3WLAA 2C04A 4JLUA 1V5IA 2FZLA 3C15C 3UBTA 3BREA 5ALHA 1QIKA 2YHIA 5DHTA 3CC8A 3CKLA 3MRTA 2C4VA 4FDAA 1GCOA 2J3QA 4JQZA 4D5GA 2WPDA 3DEIA 4MUFA 1SIBE 1WNTA 2HREA 3PR4A 2ZXUA 2B4TO 2RAPA 5A5VA 5JD5A 2XCQA 3QUTA 4GM1A 2E6KA 4MJ7A 1WMDA 1AA6A 2OXFA 1P4RA 1A50B 2D1TA 4XEHA 1GGOA 1IAQA 1VI2A 1U2GC 3G8AA 1CZKA 2Y1DA 1KMMA 2UZAA 5ECWA 2IYZA 2BBOA 2EZTA 3PD7A 5LDHA 3ZZMA 4DKJA 2GCIA 1UK7A 1FSPA 3CRMA 5F3DA 5HJEA 3LRTA 4WEOA 3WK7A 5LQAA 621PA 1U1CA 1S3GA 1LC3A 1JMYA 2VDNB 1K89A 3C5EA 1Y3CE 2IZ7A 3DXFA 3O8LA 1V96A 5ALZA 3HU1A 3AXTA 3CISA 1CE8A 3GRYA 1IB0A 1YDHA 4E15A 5C8DA 4V39A 4JUBA 3QZ7A 3VTFA 4W6QA 1KQ3A 4C2AA 4D56A 1XMIA 1H1DA 1JDEA 1ANKA 4ZODA 5F4BA 2CT8A 3X1JA 4NCNA 2PBRA 3GNTA 5B3LA 2BQ3A 1MNQA 2QUJA 3PTLA 1PSWA 2H1VA 3D0RA 1PSDA 3BBPA 1P5FA 2ORIA 2VQSA 2YQ5A 4TWZA 4EG6A 1KY4A 2ZJFA 4ZV9A 3FOFC 4ALNA 4P58A 1K5DA 1TX4B 2C4TA 2IYAA 3VYRB 3ZBQA 4DJAA 2O5RA 5FLKA 3VR2A 3VR3A 1LJLA 5I7OA 1Q95A 3B2QA 3FPJA 3IAUA 2XDYA 1NT2A 4ID9A 1NVVR 5FTNA 3PS9A 4LF9H 1GCAA 1XRMA 3C3KA 1VHWA 3IKVA 1E3WA 2CUKA 3UWPA 4OGFA 3KJGA 5DX1A 3A1WA 3T95A 4DQ0A 2Q8QA 1IN7A 3QPBA 3CRZA 1RLOA 1YJ8A 4KQJA 4N0DA 1SVUA 3M89A 1P44A 5C44G 2HGSA 1X1RA 2H65A 3G5MA 5CVCA 2OCBA 1KARA 2A67A 3AHJA 1NJSA 3L2OB 1C2TA 4BVEA 3GJSA 1JA1A 1J06A 1HRKA 3PR3A 5IBRA 1P18A 2W8BA 3DOFA 1ZS9A 3U4QB 1G8PA 1TYAE 1DUIA 1DT3A 3E3LA 4YAWA 2C3MA 4X7PA 2B3DA 2X4LA 3JVIA 1J25A 4IQFA 5CTAA 3N1UA 3QVJA 2V7WA 2GZAA 1UAAA 4DV3H 1NMEA 5EQTA 4M7WA 1D4FA 1FRFS 1SEIA 4JMLA 1U65A 3STUA 3PNPA 3QKRA 3K0AB 4DY6A 4QNRA 4HR7A 2XE7A 4P35A 2ASLA 4HATA 3GUVA 2MSEB 2HL6A 3PHLA 2ZPAA 1JFLA 1YONA 2EKPA 4AF6A 3LHFA 5DM60 1RWVA 2SHKA 3ENZA 2J45A 2H1SA 3MG9A 4N76A 4P4SB 5H9VA 3L6CA 1FCJA 2DM6A 4RLSA 2JFXA 3EASA 4BE4A 1SC3A 3Q8SB 4UW9A 5KNCH 5LIPA 1R88A 3LGAA 2OLJA 3K0CA 1R18A 3ENWA 1WUTA 3ACCA 4GNRA 1WETA 1NVDA 2VBCA 1M76A 3C6KA 4K8OA 2NZXA 4PLGA 2VTBB 1ENOA 4C7OA 5LP6B 4GNKA 4TM7A 3V1LA 3GDWA 3IP6A 4UAJA 3E3AA 2E5WA 2FQ1A 2ZRFA 3L92A 4A73A 4LWQA 1OI3A 3UFBA 1XZQA 3OSPA 1E5VA 1N6NA 4YAOA 5IDYA 5L1IA 1MT0A 2BKEA 2PR2A 3BYZA 1WLYA 5CA0F 3DV0A 3ND9A 3R3YA 3SYRA 1Z9BA 4BNDA 1QGZA 5KG7A 3DO6A 3FMPB 1GSAA 2JH9A 2VDMB 5JRJA 1PYOA 3QG5A 4MUAA 1A27A 2ARKA 2VXCA 4ABYA 3FF1A 4R71A 2CJYA 5A05A 2HF8A 4C87A 1CKEA 2CVHA 3AT1A 3BB1A 5L4NA 5KG2A 1NY6A 1S2DA 2HXGA 5FFMA 2AH5A 3AVYA 4B3BA 1CIPA 2W11A 4DMFA 4K88A 4JUCA 2R87A 4HAVA 4XQEA 5K3CA 4EO4A 4C2UA 3KX2A 4DT1A 5TS3A 4RM3A 4AO6A 2ALZA 1LBHA 2HI0A 2WMOB 4JC4A 4KBFA 4DTIA 5LMCA 5FA8A 1B26A 1NC3A 4P54A 4RF3A 3BE8A 4MRRA 1RYFA 2IDKA 2R3SA 1NF8A 4PBTA 3R5SA 2I2AA 5E8JA 2BISA 4CMHA 1GZDA 5HW0A 4WESB 3FOBA 1OC4A 1HMPA 4KP7A 4OGKA 5F2KA 1D2RA 2H63A 5DXFA 1YUMA 1Q1EA 1VJCA 1X1SA 1DBSA 2H0AA 3ZHRA 2P9FA 1LPPA 2PV0A 4GX2A 4I5GA 2BM1A 3OOYA 3RK4A 3S2GA 1RLMA 3C4VA 4DJJA 3W5JA 1DEHA 1HZZC 1D04A 3DONA 5FTWA 2VXYA 3U7QB 5TMPA 2VXOA 2GD0A 3L4BA 4G8JA 4R2JA 4R69A 4Y9TA 5CK5A 4GKVA 2AJDA 5J9FA 3RBAA 3RG8A 1A82A 2J6HA 3F7TA 3UN1A 4EZIA 3T1TA 4ZTUB 2NTEA 3LPNA 1KETA 1S1MA 3AKDA 3DBRA 4OSPA 4XASA 5CDSA 1XVAA 3P20A 3S81A 3EGEA 1TB4A 1EQAA 3HYRA 1JHDA 2IEBA 5C4MA 4PYMA 2GO1A 4IICA 5ISMA 3U7HB 1RZRA 1WP9A 2CV1A 1CDEA 1UM9B 4PIMA 2VDWA 1SVNA 3DEHA 3I9MA 4JBIA 4XYBA 4H4DA 1CJKC 2ASVA 2K5UA 5BT9A 3ZHZA 4DRXA 1GUAA 1SKQA 2KMLA 3TSZA 3VOSA 5LQMA 2I91A 3G2IA 2GD2A 4F8EA 4EGAA 4Z0H