3N77A

Crystal structure of idp01880, putative ntp pyrophosphohydrolase of salmonella typhimurium lt2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
141
structure length
141
Chain Sequence
b'MRQRTIVCPLIQNDGCYLLCKMADNRGVFPGQWALSGGGVEPGERIEEALRREIREELGEQLILSDITPWTFRDDIRIKTYADGRQEEIYMIYLIFDCVSANRDICINDEFQDYAWVAPAALALYDLNVATRHTLALKGLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside triphosphatase nudI
publication title Crystal structure of Idp01880, putative NTP pyrophosphohydrolase of Salmonella typhimurium LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Hydrolase
total genus 41
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3n77A00
5DPKA 1MP2A 1MUTA 5FSIA 2FMLA 3MGMA 3I9XA 2I6KA 4ILQA 4MPOA 4JZUA 3N9UA 1RRSA 1JRKA 5ANWA 3Q2TA 2DSDA 1XSAA 2GT2A 4ZG0A 1PVFA 1V8UA 2GT4A 1VHZA 4YPRA 2B06A 3X0KA 1X84A 1NQZA 1MQEA 3BAPA 1HZTA 1K2EA 3P6YA 1JKNA 2O5WA 1PPXA 5ANSA 3X0PA 3MDGA 3X0IA 2W4EA 1V8NA 1VCDA 4K6EA 5HZXA 3Q1PA 5GHIA 2YVPA 3O6ZA 5FSKA 1V8WA 4ICKA 2J8QA 3EF5A 5BONA 2I8UA 1RYAA 3SHDA 2DSBA 1G0SA 1V8LA 1V8RA 1MK1A 3CNGA 1SU2A 1V8TA 5FSNA 5LPGA 4N1TA 3J7Ye 1I9AA 3I7VA 3QSJA 2FVVA 1PPWA 3A6TA 3U53A 2G73A 1U20A 3GG6A 2QKMB 4KG4A 4KTBA 2AZWA 4IJXA 4JZSA 5DDGA 3SONA 3GZ8A 5C7TA 3GZ5A 4S2YA 4S2WA 5I8UA 4YPHA 5C7QA 3MDIA 3FCMA 3GWYA 3EXQA 1MR2A 2A8RA 1KTGA 3DKUA 3E57A 4KG3A 1V8IA 1Q54A 2A8PA 1RRQA 5GHJA 3X0JA 3EESA 2Q9PA 3ID9A 3MCFA 4JZTA 3EEUA 5C8LA 1V8MA 3N77A 1Q27A 3A6UA 3GRNA 3ZR0A 3X0RA 5FSMA 4S2XA 2DSCA 3Q91A 3HHJA 2I8TA 3R03A 4KYXA 3X0SA 3FSPA 5ANUA 1SJYA 2KDWA 2DHOA 3X0NA 2QJTA 3FK9A 3Q2SA 2G74A 3O61A 3WHWA 2XSQA 2A8QA 1Q33A 3ZR1A 2ICJA 2A6TA 1PUSA 2RRKA 3BHOA 1MQWA 5FSOA 3SMDA 3GZ6A 1VC9A 1VIUA 2VNQA 1F3YA 1X83A 3HYQA 2QJOA 5GHQA 2GB5A 1QVJA 1V8SA 3F6AA 2FKBA 3O52A 4S2VA 5GHNA 1SZ3A 5IW4A 3Q4IA 3BM4A 3X0MA 1XSCA 4NFXA 5GHPA 2PQVA 2CL3A 3P5TA 1IRYA 2B0VA 1PPVA 1NFZA 1X51A 3H95A 1PUQA 2YVOA 1VC8A 5CFIA 3X0LA 1V8VA 3RH7A 3Q93A 4JZVA 1VHGA 5BS6A 2R5WA 3G0QA 5ANTA 4YOQA 1VIQA 2ICKA 3O69A 2YVNA 2KDVA 3ACAA 4C9WA 4HVYA 4C9XA 1V8YA 3FFUA 5CFJA 1K26A 3A6SA 2A8TA 3F13A 3OGAA 2B2KA 1KHZA 1NQYA 1KT9A 5ISYA 4HFQA 3X0QA 5ANVA 3O8SA 3X0OA 3AC9A 2YVMA 1OW2A 1GA7A 1TUMA 1SOIA 1HX3A 1VK6A 2JVBA 2PNYA 5IW5A 3DUPA 1G9QA 5DD4A 2YYHA 2O5FA 1R67A 3I7UA 5GHOA 5DEQA 3FJYA 2VNPA 1VRLA 5GHMA 4V14A 1NFSA 3KVHA 4NFWA 1XSBA 2DUKA 4DYWA 4N1UA 5FSLA 3A6VA 3L85A 2O1CA 2A8SA 1PUNA 3COUA
chains in the Genus database with same CATH superfamily
5DPKA 1MP2A 1MUTA 5FSIA 2FMLA 3MGMA 3I9XA 2I6KA 4ILQA 4MPOA 4JZUA 3N9UA 1RRSA 1JRKA 5ANWA 3Q2TA 2DSDA 1XSAA 2GT2A 4ZG0A 1PVFA 1V8UA 2GT4A 1VHZA 4YPRA 2B06A 3X0KA 1X84A 1NQZA 1MQEA 3BAPA 1HZTA 1K2EA 3P6YA 1JKNA 2O5WA 1PPXA 5ANSA 3X0PA 3MDGA 3X0IA 2W4EA 1V8NA 1VCDA 4K6EA 5HZXA 3Q1PA 5GHIA 2YVPA 3O6ZA 5FSKA 1V8WA 4ICKA 4J7HA 2J8QA 3EF5A 5BONA 2I8UA 1RYAA 3SHDA 2DSBA 1G0SA 1V8LA 1V8RA 1MK1A 3CNGA 1SU2A 1V8TA 5FSNA 5LPGA 4N1TA 3J7Ye 1I9AA 3I7VA 3QSJA 2FVVA 1PPWA 3A6TA 3U53A 2G73A 1U20A 3GG6A 2QKMB 4KG4A 4KTBA 2AZWA 4IJXA 4JZSA 5DDGA 3SONA 3GZ8A 5C7TA 3GZ5A 4S2YA 4S2WA 5I8UA 4YPHA 5C7QA 3MDIA 3FCMA 3GWYA 3EXQA 1MR2A 2A8RA 1KTGA 3DKUA 3E57A 4KG3A 1V8IA 1Q54A 2A8PA 1RRQA 5GHJA 3X0JA 3EESA 2Q9PA 3ID9A 3MCFA 4JZTA 3EEUA 5C8LA 1V8MA 3N77A 1Q27A 3A6UA 3GRNA 3ZR0A 3X0RA 5FSMA 4S2XA 2DSCA 3Q91A 3HHJA 2I8TA 3R03A 4KYXA 3X0SA 3FSPA 5ANUA 1SJYA 2KDWA 2DHOA 3X0NA 2QJTA 3FK9A 3Q2SA 2G74A 3O61A 3WHWA 2XSQA 2A8QA 1Q33A 3ZR1A 2ICJA 2A6TA 1PUSA 2RRKA 3BHOA 1MQWA 5FSOA 3SMDA 3GZ6A 1VC9A 1VIUA 2VNQA 1F3YA 1X83A 3HYQA 2QJOA 5GHQA 2GB5A 1QVJA 1V8SA 3F6AA 2FKBA 3O52A 4S2VA 5GHNA 4J7GA 1SZ3A 5IW4A 3Q4IA 3BM4A 2CZRA 3X0MA 1XSCA 4NFXA 5GHPA 2PQVA 2CL3A 3P5TA 1IRYA 2B0VA 1PPVA 1NFZA 1X51A 3H95A 1PUQA 2YVOA 1VC8A 5CFIA 3X0LA 1V8VA 3RH7A 3Q93A 4JZVA 1VHGA 5BS6A 2R5WA 3G0QA 5ANTA 4YOQA 1VIQA 2ICKA 3O69A 2YVNA 2KDVA 3ACAA 4C9WA 4HVYA 4C9XA 1V8YA 3FFUA 5CFJA 1K26A 3A6SA 2A8TA 3F13A 3OGAA 2B2KA 1KHZA 1NQYA 1KT9A 5ISYA 4HFQA 3X0QA 5ANVA 3O8SA 3X0OA 3AC9A 2YVMA 1OW2A 1GA7A 1TUMA 1SOIA 1HX3A 1VK6A 2JVBA 2PNYA 5IW5A 3DUPA 1G9QA 5DD4A 2YYHA 2O5FA 1R67A 3I7UA 5GHOA 5DEQA 3FJYA 2VNPA 1VRLA 5GHMA 4V14A 1NFSA 3KVHA 4NFWA 1XSBA 2DUKA 4DYWA 4N1UA 5FSLA 3A6VA 3L85A 2O1CA 2A8SA 1PUNA 3COUA
chains in the Genus database with same CATH topology
5DPKA 1MP2A 1MUTA 5FSIA 2FMLA 3MGMA 3I9XA 2I6KA 4ILQA 4MPOA 4JZUA 3N9UA 1RRSA 1JRKA 5ANWA 3Q2TA 2DSDA 1XSAA 2GT2A 4ZG0A 1PVFA 1V8UA 2GT4A 1VHZA 4YPRA 2B06A 3X0KA 1X84A 1NQZA 1MQEA 3BAPA 1HZTA 1K2EA 3P6YA 1JKNA 2O5WA 1PPXA 5ANSA 3X0PA 3MDGA 3X0IA 2W4EA 1V8NA 1VCDA 4K6EA 5HZXA 3Q1PA 5GHIA 2YVPA 3O6ZA 5FSKA 1V8WA 4ICKA 4J7HA 2J8QA 3EF5A 5BONA 2I8UA 1RYAA 3SHDA 2DSBA 1G0SA 1V8LA 1V8RA 1MK1A 3CNGA 1SU2A 1V8TA 5FSNA 5LPGA 4N1TA 3J7Ye 1I9AA 3I7VA 3QSJA 2FVVA 1PPWA 3A6TA 3U53A 2G73A 1U20A 3GG6A 2QKMB 4KG4A 4KTBA 2AZWA 4IJXA 4JZSA 5DDGA 3SONA 3GZ8A 5C7TA 3GZ5A 4S2YA 4S2WA 5I8UA 4YPHA 5C7QA 3MDIA 3FCMA 3GWYA 3EXQA 1MR2A 2A8RA 1KTGA 3DKUA 3E57A 4KG3A 1V8IA 1Q54A 2A8PA 1RRQA 5GHJA 3X0JA 3EESA 2Q9PA 3ID9A 3MCFA 4JZTA 3EEUA 5C8LA 1V8MA 3N77A 1Q27A 3A6UA 3GRNA 3ZR0A 3X0RA 5FSMA 4S2XA 2DSCA 3Q91A 3HHJA 2I8TA 3R03A 4KYXA 3X0SA 3FSPA 5ANUA 1SJYA 2KDWA 2DHOA 3X0NA 2QJTA 3FK9A 3Q2SA 2G74A 3O61A 3WHWA 2XSQA 2A8QA 1Q33A 3ZR1A 2ICJA 2A6TA 1PUSA 2RRKA 3BHOA 1MQWA 5FSOA 3SMDA 3GZ6A 1VC9A 1VIUA 2VNQA 1F3YA 1X83A 3HYQA 2QJOA 5GHQA 2GB5A 1QVJA 1V8SA 3F6AA 2FKBA 3O52A 4S2VA 5GHNA 4J7GA 1SZ3A 5IW4A 3Q4IA 3BM4A 2CZRA 3X0MA 1XSCA 4NFXA 5GHPA 2PQVA 2CL3A 3P5TA 1IRYA 2B0VA 1PPVA 1NFZA 1X51A 3H95A 1PUQA 2YVOA 1VC8A 5CFIA 3X0LA 1V8VA 3RH7A 3Q93A 4JZVA 1VHGA 5BS6A 2R5WA 3G0QA 5ANTA 4YOQA 1VIQA 2ICKA 3O69A 2YVNA 2KDVA 3ACAA 4C9WA 4HVYA 4C9XA 1V8YA 3FFUA 5CFJA 1K26A 3A6SA 2A8TA 3F13A 3OGAA 2B2KA 1KHZA 1NQYA 1KT9A 5ISYA 4HFQA 3X0QA 5ANVA 3O8SA 3X0OA 3AC9A 2YVMA 1OW2A 1GA7A 1TUMA 1SOIA 1HX3A 1VK6A 2JVBA 2PNYA 5IW5A 3DUPA 1G9QA 5DD4A 2YYHA 2O5FA 1R67A 3I7UA 5GHOA 5DEQA 3FJYA 2VNPA 1VRLA 5GHMA 4V14A 1NFSA 3KVHA 4NFWA 1XSBA 2DUKA 4DYWA 4N1UA 5FSLA 3A6VA 3L85A 2O1CA 2A8SA 1PUNA 3COUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DPK A;  1MP2 A;  1MUT A;  5FSI A;  2FML A;  3MGM A;  3I9X A;  2I6K A;  4ILQ A;  4MPO A;  4JZU A;  3N9U A;  1RRS A;  1JRK A;  5ANW A;  3Q2T A;  2DSD A;  1XSA A;  2GT2 A;  4ZG0 A;  1PVF A;  1V8U A;  2GT4 A;  1VHZ A;  4YPR A;  2B06 A;  3X0K A;  1X84 A;  1NQZ A;  1MQE A;  3BAP A;  1HZT A;  1K2E A;  3P6Y A;  1JKN A;  2O5W A;  1PPX A;  5ANS A;  3X0P A;  3MDG A;  3X0I A;  2W4E A;  1V8N A;  1VCD A;  4K6E A;  5HZX A;  3Q1P A;  5GHI A;  2YVP A;  3O6Z A;  5FSK A;  1V8W A;  4ICK A;  2J8Q A;  3EF5 A;  5BON A;  2I8U A;  1RYA A;  3SHD A;  2DSB A;  1G0S A;  1V8L A;  1V8R A;  1MK1 A;  3CNG A;  1SU2 A;  1V8T A;  5FSN A;  5LPG A;  4N1T A;  3J7Y e;  1I9A A;  3I7V A;  3QSJ A;  2FVV A;  1PPW A;  3A6T A;  3U53 A;  2G73 A;  1U20 A;  3GG6 A;  2QKM B;  4KG4 A;  4KTB A;  2AZW A;  4IJX A;  4JZS A;  5DDG A;  3SON A;  3GZ8 A;  5C7T A;  3GZ5 A;  4S2Y A;  4S2W A;  5I8U A;  4YPH A;  5C7Q A;  3MDI A;  3FCM A;  3GWY A;  3EXQ A;  1MR2 A;  2A8R A;  1KTG A;  3DKU A;  3E57 A;  4KG3 A;  1V8I A;  1Q54 A;  2A8P A;  1RRQ A;  5GHJ A;  3X0J A;  3EES A;  2Q9P A;  3ID9 A;  3MCF A;  4JZT A;  3EEU A;  5C8L A;  1V8M A;  3N77 A;  1Q27 A;  3A6U A;  3GRN A;  3ZR0 A;  3X0R A;  5FSM A;  4S2X A;  2DSC A;  3Q91 A;  3HHJ A;  2I8T A;  3R03 A;  4KYX A;  3X0S A;  3FSP A;  5ANU A;  1SJY A;  2KDW A;  2DHO A;  3X0N A;  2QJT A;  3FK9 A;  3Q2S A;  2G74 A;  3O61 A;  3WHW A;  2XSQ A;  2A8Q A;  1Q33 A;  3ZR1 A;  2ICJ A;  2A6T A;  1PUS A;  2RRK A;  3BHO A;  1MQW A;  5FSO A;  3SMD A;  3GZ6 A;  1VC9 A;  1VIU A;  2VNQ A;  1F3Y A;  1X83 A;  3HYQ A;  2QJO A;  5GHQ A;  2GB5 A;  1QVJ A;  1V8S A;  3F6A A;  2FKB A;  3O52 A;  4S2V A;  5GHN A;  1SZ3 A;  5IW4 A;  3Q4I A;  3BM4 A;  3X0M A;  1XSC A;  4NFX A;  5GHP A;  2PQV A;  2CL3 A;  3P5T A;  1IRY A;  2B0V A;  1PPV A;  1NFZ A;  1X51 A;  3H95 A;  1PUQ A;  2YVO A;  1VC8 A;  5CFI A;  3X0L A;  1V8V A;  3RH7 A;  3Q93 A;  4JZV A;  1VHG A;  5BS6 A;  2R5W A;  3G0Q A;  5ANT A;  4YOQ A;  1VIQ A;  2ICK A;  3O69 A;  2YVN A;  2KDV A;  3ACA A;  4C9W A;  4HVY A;  4C9X A;  1V8Y A;  3FFU A;  5CFJ A;  1K26 A;  3A6S A;  2A8T A;  3F13 A;  3OGA A;  2B2K A;  1KHZ A;  1NQY A;  1KT9 A;  5ISY A;  4HFQ A;  3X0Q A;  5ANV A;  3O8S A;  3X0O A;  3AC9 A;  2YVM A;  1OW2 A;  1GA7 A;  1TUM A;  1SOI A;  1HX3 A;  1VK6 A;  2JVB A;  2PNY A;  5IW5 A;  3DUP A;  1G9Q A;  5DD4 A;  2YYH A;  2O5F A;  1R67 A;  3I7U A;  5GHO A;  5DEQ A;  3FJY A;  2VNP A;  1VRL A;  5GHM A;  4V14 A;  1NFS A;  3KVH A;  4NFW A;  1XSB A;  2DUK A;  4DYW A;  4N1U A;  5FSL A;  3A6V A;  3L85 A;  2O1C A;  2A8S A;  1PUN A;  3COU A; 
#chains in the Genus database with same CATH topology
 5DPK A;  1MP2 A;  1MUT A;  5FSI A;  2FML A;  3MGM A;  3I9X A;  2I6K A;  4ILQ A;  4MPO A;  4JZU A;  3N9U A;  1RRS A;  1JRK A;  5ANW A;  3Q2T A;  2DSD A;  1XSA A;  2GT2 A;  4ZG0 A;  1PVF A;  1V8U A;  2GT4 A;  1VHZ A;  4YPR A;  2B06 A;  3X0K A;  1X84 A;  1NQZ A;  1MQE A;  3BAP A;  1HZT A;  1K2E A;  3P6Y A;  1JKN A;  2O5W A;  1PPX A;  5ANS A;  3X0P A;  3MDG A;  3X0I A;  2W4E A;  1V8N A;  1VCD A;  4K6E A;  5HZX A;  3Q1P A;  5GHI A;  2YVP A;  3O6Z A;  5FSK A;  1V8W A;  4ICK A;  4J7H A;  2J8Q A;  3EF5 A;  5BON A;  2I8U A;  1RYA A;  3SHD A;  2DSB A;  1G0S A;  1V8L A;  1V8R A;  1MK1 A;  3CNG A;  1SU2 A;  1V8T A;  5FSN A;  5LPG A;  4N1T A;  3J7Y e;  1I9A A;  3I7V A;  3QSJ A;  2FVV A;  1PPW A;  3A6T A;  3U53 A;  2G73 A;  1U20 A;  3GG6 A;  2QKM B;  4KG4 A;  4KTB A;  2AZW A;  4IJX A;  4JZS A;  5DDG A;  3SON A;  3GZ8 A;  5C7T A;  3GZ5 A;  4S2Y A;  4S2W A;  5I8U A;  4YPH A;  5C7Q A;  3MDI A;  3FCM A;  3GWY A;  3EXQ A;  1MR2 A;  2A8R A;  1KTG A;  3DKU A;  3E57 A;  4KG3 A;  1V8I A;  1Q54 A;  2A8P A;  1RRQ A;  5GHJ A;  3X0J A;  3EES A;  2Q9P A;  3ID9 A;  3MCF A;  4JZT A;  3EEU A;  5C8L A;  1V8M A;  3N77 A;  1Q27 A;  3A6U A;  3GRN A;  3ZR0 A;  3X0R A;  5FSM A;  4S2X A;  2DSC A;  3Q91 A;  3HHJ A;  2I8T A;  3R03 A;  4KYX A;  3X0S A;  3FSP A;  5ANU A;  1SJY A;  2KDW A;  2DHO A;  3X0N A;  2QJT A;  3FK9 A;  3Q2S A;  2G74 A;  3O61 A;  3WHW A;  2XSQ A;  2A8Q A;  1Q33 A;  3ZR1 A;  2ICJ A;  2A6T A;  1PUS A;  2RRK A;  3BHO A;  1MQW A;  5FSO A;  3SMD A;  3GZ6 A;  1VC9 A;  1VIU A;  2VNQ A;  1F3Y A;  1X83 A;  3HYQ A;  2QJO A;  5GHQ A;  2GB5 A;  1QVJ A;  1V8S A;  3F6A A;  2FKB A;  3O52 A;  4S2V A;  5GHN A;  4J7G A;  1SZ3 A;  5IW4 A;  3Q4I A;  3BM4 A;  2CZR A;  3X0M A;  1XSC A;  4NFX A;  5GHP A;  2PQV A;  2CL3 A;  3P5T A;  1IRY A;  2B0V A;  1PPV A;  1NFZ A;  1X51 A;  3H95 A;  1PUQ A;  2YVO A;  1VC8 A;  5CFI A;  3X0L A;  1V8V A;  3RH7 A;  3Q93 A;  4JZV A;  1VHG A;  5BS6 A;  2R5W A;  3G0Q A;  5ANT A;  4YOQ A;  1VIQ A;  2ICK A;  3O69 A;  2YVN A;  2KDV A;  3ACA A;  4C9W A;  4HVY A;  4C9X A;  1V8Y A;  3FFU A;  5CFJ A;  1K26 A;  3A6S A;  2A8T A;  3F13 A;  3OGA A;  2B2K A;  1KHZ A;  1NQY A;  1KT9 A;  5ISY A;  4HFQ A;  3X0Q A;  5ANV A;  3O8S A;  3X0O A;  3AC9 A;  2YVM A;  1OW2 A;  1GA7 A;  1TUM A;  1SOI A;  1HX3 A;  1VK6 A;  2JVB A;  2PNY A;  5IW5 A;  3DUP A;  1G9Q A;  5DD4 A;  2YYH A;  2O5F A;  1R67 A;  3I7U A;  5GHO A;  5DEQ A;  3FJY A;  2VNP A;  1VRL A;  5GHM A;  4V14 A;  1NFS A;  3KVH A;  4NFW A;  1XSB A;  2DUK A;  4DYW A;  4N1U A;  5FSL A;  3A6V A;  3L85 A;  2O1C A;  2A8S A;  1PUN A;  3COU A; 
#chains in the Genus database with same CATH homology
 5DPK A;  1MP2 A;  1MUT A;  5FSI A;  2FML A;  3MGM A;  3I9X A;  2I6K A;  4ILQ A;  4MPO A;  4JZU A;  3N9U A;  1RRS A;  1JRK A;  5ANW A;  3Q2T A;  2DSD A;  1XSA A;  2GT2 A;  4ZG0 A;  1PVF A;  1V8U A;  2GT4 A;  1VHZ A;  4YPR A;  2B06 A;  3X0K A;  1X84 A;  1NQZ A;  1MQE A;  3BAP A;  1HZT A;  1K2E A;  3P6Y A;  1JKN A;  2O5W A;  1PPX A;  5ANS A;  3X0P A;  3MDG A;  3X0I A;  2W4E A;  1V8N A;  1VCD A;  4K6E A;  5HZX A;  3Q1P A;  5GHI A;  2YVP A;  3O6Z A;  5FSK A;  1V8W A;  4ICK A;  4J7H A;  2J8Q A;  3EF5 A;  5BON A;  2I8U A;  1RYA A;  3SHD A;  2DSB A;  1G0S A;  1V8L A;  1V8R A;  1MK1 A;  3CNG A;  1SU2 A;  1V8T A;  5FSN A;  5LPG A;  4N1T A;  3J7Y e;  1I9A A;  3I7V A;  3QSJ A;  2FVV A;  1PPW A;  3A6T A;  3U53 A;  2G73 A;  1U20 A;  3GG6 A;  2QKM B;  4KG4 A;  4KTB A;  2AZW A;  4IJX A;  4JZS A;  5DDG A;  3SON A;  3GZ8 A;  5C7T A;  3GZ5 A;  4S2Y A;  4S2W A;  5I8U A;  4YPH A;  5C7Q A;  3MDI A;  3FCM A;  3GWY A;  3EXQ A;  1MR2 A;  2A8R A;  1KTG A;  3DKU A;  3E57 A;  4KG3 A;  1V8I A;  1Q54 A;  2A8P A;  1RRQ A;  5GHJ A;  3X0J A;  3EES A;  2Q9P A;  3ID9 A;  3MCF A;  4JZT A;  3EEU A;  5C8L A;  1V8M A;  3N77 A;  1Q27 A;  3A6U A;  3GRN A;  3ZR0 A;  3X0R A;  5FSM A;  4S2X A;  2DSC A;  3Q91 A;  3HHJ A;  2I8T A;  3R03 A;  4KYX A;  3X0S A;  3FSP A;  5ANU A;  1SJY A;  2KDW A;  2DHO A;  3X0N A;  2QJT A;  3FK9 A;  3Q2S A;  2G74 A;  3O61 A;  3WHW A;  2XSQ A;  2A8Q A;  1Q33 A;  3ZR1 A;  2ICJ A;  2A6T A;  1PUS A;  2RRK A;  3BHO A;  1MQW A;  5FSO A;  3SMD A;  3GZ6 A;  1VC9 A;  1VIU A;  2VNQ A;  1F3Y A;  1X83 A;  3HYQ A;  2QJO A;  5GHQ A;  2GB5 A;  1QVJ A;  1V8S A;  3F6A A;  2FKB A;  3O52 A;  4S2V A;  5GHN A;  4J7G A;  1SZ3 A;  5IW4 A;  3Q4I A;  3BM4 A;  2CZR A;  3X0M A;  1XSC A;  4NFX A;  5GHP A;  2PQV A;  2CL3 A;  3P5T A;  1IRY A;  2B0V A;  1PPV A;  1NFZ A;  1X51 A;  3H95 A;  1PUQ A;  2YVO A;  1VC8 A;  5CFI A;  3X0L A;  1V8V A;  3RH7 A;  3Q93 A;  4JZV A;  1VHG A;  5BS6 A;  2R5W A;  3G0Q A;  5ANT A;  4YOQ A;  1VIQ A;  2ICK A;  3O69 A;  2YVN A;  2KDV A;  3ACA A;  4C9W A;  4HVY A;  4C9X A;  1V8Y A;  3FFU A;  5CFJ A;  1K26 A;  3A6S A;  2A8T A;  3F13 A;  3OGA A;  2B2K A;  1KHZ A;  1NQY A;  1KT9 A;  5ISY A;  4HFQ A;  3X0Q A;  5ANV A;  3O8S A;  3X0O A;  3AC9 A;  2YVM A;  1OW2 A;  1GA7 A;  1TUM A;  1SOI A;  1HX3 A;  1VK6 A;  2JVB A;  2PNY A;  5IW5 A;  3DUP A;  1G9Q A;  5DD4 A;  2YYH A;  2O5F A;  1R67 A;  3I7U A;  5GHO A;  5DEQ A;  3FJY A;  2VNP A;  1VRL A;  5GHM A;  4V14 A;  1NFS A;  3KVH A;  4NFW A;  1XSB A;  2DUK A;  4DYW A;  4N1U A;  5FSL A;  3A6V A;  3L85 A;  2O1C A;  2A8S A;  1PUN A;  3COU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...