3N77A

Crystal structure of idp01880, putative ntp pyrophosphohydrolase of salmonella typhimurium lt2
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
141
structure length
141
Chain Sequence
MRQRTIVCPLIQNDGCYLLCKMADNRGVFPGQWALSGGGVEPGERIEEALRREIREELGEQLILSDITPWTFRDDIRIKTYADGRQEEIYMIYLIFDCVSANRDICINDEFQDYAWVAPAALALYDLNVATRHTLALKGLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoside triphosphatase nudI
publication title Crystal structure of Idp01880, putative NTP pyrophosphohydrolase of Salmonella typhimurium LT2
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Hydrolase
total genus 41
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature ec 3.6.1.12: dCTP diphosphatase.
pdb deposition date 2010-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3n77A00
2DSDA 3DKUA 5I8UA 1VHZA 1NFSA 3ACAA 3F6AA 3GZ8A 5DD4A 2FMLA 1NQZA 3X0PA 4KTBA 3DUPA 1MQEA 4C9WA 3A6TA 4JZUA 1Q33A 1V8IA 2DSCA 3MDIA 2RRKA 1MUTA 1V8MA 5FSMA 5GHQA 1V8YA 5LPGA 3Q93A 3X0MA 3CNGA 1Q54A 2PNYA 4C9XA 4ILQA 5ANVA 1MK1A 2R5WA 4KG4A 1XSCA 3GG6A 3ID9A 2DHOA 2I6KA 4K6EA 2YYHA 5FSKA 1V8VA 2O5FA 3Q4IA 5GHNA 3SHDA 5BS6A 5FSOA 2I8TA 1V8SA 1X84A 3HYQA 1MP2A 2QJTA 2KDVA 4ICKA 5DEQA 3ZR0A 4KYXA 5ISYA 2XSQA 1PPWA 5IW5A 4N1UA 3FK9A 2GT2A 3KVHA 3SONA 2YVMA 3BM4A 4NFXA 5ANWA 5C8LA 5IW4A 2JVBA 1NFZA 5C7QA 5GHPA 3Q1PA 3G0QA 1PUNA 2J8QA 3O69A 2QKMB 2YVPA 3MCFA 3FFUA 4IJXA 4NFWA 2G73A 4YPHA 3N9UA 2VNQA 5FSLA 3FCMA 2Q9PA 1NQYA 2W4EA 1VCDA 3X0IA 1V8WA 2ICKA 1KHZA 4S2VA 4KG3A 2O5WA 4S2XA 3P5TA 3QSJA 5GHMA 5DDGA 3I7UA 3GZ6A 2ICJA 5HZXA 1X83A 2A8RA 3E57A 2B06A 1GA7A 3J7Ye 3N77A 2FKBA 5FSNA 5BONA 1VRLA 1SOIA 3Q2SA 1G0SA 3X0OA 3SMDA 2I8UA 5GHOA 3X0QA 5CFJA 2DSBA 3H95A 3O52A 4YPRA 3R03A 3ZR1A 3O6ZA 4V14A 2KDWA 1R67A 2A6TA 4HVYA 1HZTA 3AC9A 1XSBA 3L85A 3OGAA 5C7TA 2B2KA 1PPVA 1U20A 1VIQA 2FVVA 2YVNA 5ANUA 1MR2A 2YVOA 3Q91A 2AZWA 1I9AA 2G74A 3Q2TA 4DYWA 1V8TA 1MQWA 3FJYA 2A8QA 2VNPA 1V8NA 3I7VA 1QVJA 1RRSA 5FSIA 2GT4A 3EESA 3FSPA 1SJYA 3MGMA 4JZSA 2A8TA 1SU2A 1KTGA 1VK6A 1F3YA 5ANTA 3X0NA 3P6YA 4S2YA 1PVFA 1VHGA 1XSAA 3I9XA 5DPKA 1OW2A 1PUQA 1RRQA 1PUSA 3X0KA 1V8RA 2GB5A 4HFQA 3X0LA 3BAPA 2A8SA 3A6SA 5ANSA 3GWYA 3O8SA 2B0VA 1SZ3A 3HHJA 1TUMA 4N1TA 4S2WA 3WHWA 3BHOA 5CFIA 3GRNA 3A6VA 1IRYA 3U53A 4ZG0A 3X0RA 3F13A 4MPOA 2PQVA 1VIUA 2QJOA 1VC9A 3GZ5A 1K26A 1PPXA 1V8UA 1Q27A 1X51A 2CL3A 3MDGA 3EEUA 3RH7A 3X0SA 1VC8A 5GHJA 3EF5A 1JKNA 3A6UA 3COUA 4JZTA 1KT9A 5GHIA 1V8LA 3O61A 1K2EA 2A8PA 4YOQA 1JRKA 2O1CA 4JZVA 2DUKA 1RYAA 1HX3A 3EXQA 3X0JA 1G9QA
chains in the Genus database with same CATH superfamily
2DSDA 3DKUA 5I8UA 1VHZA 1NFSA 3ACAA 3F6AA 3GZ8A 5DD4A 2FMLA 1NQZA 3X0PA 4KTBA 3DUPA 1MQEA 4C9WA 3A6TA 4JZUA 1Q33A 1V8IA 2DSCA 3MDIA 2RRKA 1MUTA 1V8MA 5FSMA 5GHQA 1V8YA 5LPGA 3Q93A 3X0MA 3CNGA 1Q54A 2PNYA 4C9XA 4ILQA 5ANVA 1MK1A 2R5WA 4KG4A 1XSCA 3GG6A 3ID9A 2DHOA 2I6KA 4K6EA 2YYHA 5FSKA 1V8VA 2O5FA 3Q4IA 5GHNA 3SHDA 5BS6A 5FSOA 2I8TA 1V8SA 1X84A 3HYQA 1MP2A 2QJTA 2KDVA 4ICKA 5DEQA 3ZR0A 4KYXA 5ISYA 2XSQA 1PPWA 5IW5A 4N1UA 3FK9A 2GT2A 3KVHA 3SONA 2YVMA 3BM4A 4NFXA 5ANWA 5C8LA 5IW4A 2JVBA 1NFZA 5C7QA 5GHPA 3Q1PA 3G0QA 1PUNA 2J8QA 3O69A 2QKMB 2YVPA 3MCFA 3FFUA 4IJXA 4NFWA 2G73A 4YPHA 3N9UA 2VNQA 5FSLA 3FCMA 2Q9PA 1NQYA 2W4EA 1VCDA 3X0IA 1V8WA 2ICKA 1KHZA 4S2VA 4KG3A 2O5WA 4S2XA 3P5TA 3QSJA 5GHMA 5DDGA 3I7UA 3GZ6A 2ICJA 5HZXA 1X83A 2A8RA 3E57A 2B06A 1GA7A 3J7Ye 3N77A 2FKBA 5FSNA 5BONA 1VRLA 1SOIA 3Q2SA 1G0SA 3X0OA 3SMDA 2I8UA 5GHOA 3X0QA 5CFJA 2DSBA 3H95A 3O52A 4YPRA 3R03A 3ZR1A 3O6ZA 4V14A 2KDWA 1R67A 2A6TA 4HVYA 1HZTA 3AC9A 1XSBA 3L85A 3OGAA 5C7TA 2B2KA 1PPVA 1U20A 1VIQA 2FVVA 2YVNA 5ANUA 1MR2A 2YVOA 3Q91A 2AZWA 1I9AA 2G74A 3Q2TA 4DYWA 1V8TA 1MQWA 3FJYA 2A8QA 2VNPA 1V8NA 3I7VA 1QVJA 1RRSA 5FSIA 2GT4A 3EESA 3FSPA 1SJYA 3MGMA 4J7HA 4JZSA 2A8TA 1SU2A 1KTGA 1VK6A 1F3YA 5ANTA 3X0NA 3P6YA 4S2YA 1PVFA 1VHGA 1XSAA 3I9XA 5DPKA 1OW2A 1PUQA 1RRQA 1PUSA 3X0KA 1V8RA 2GB5A 4HFQA 3X0LA 3BAPA 2A8SA 3A6SA 5ANSA 3GWYA 3O8SA 2B0VA 1SZ3A 3HHJA 1TUMA 4J7GA 4N1TA 4S2WA 3WHWA 3BHOA 5CFIA 3GRNA 3A6VA 1IRYA 3U53A 4ZG0A 3X0RA 3F13A 4MPOA 2PQVA 1VIUA 2QJOA 1VC9A 3GZ5A 1K26A 1PPXA 1V8UA 1Q27A 1X51A 2CZRA 2CL3A 3MDGA 3EEUA 3RH7A 3X0SA 1VC8A 5GHJA 3EF5A 1JKNA 3A6UA 3COUA 4JZTA 1KT9A 5GHIA 1V8LA 3O61A 1K2EA 2A8PA 4YOQA 1JRKA 2O1CA 4JZVA 2DUKA 1RYAA 1HX3A 3EXQA 3X0JA 1G9QA
chains in the Genus database with same CATH topology
2DSDA 3DKUA 5I8UA 1VHZA 1NFSA 3ACAA 3F6AA 3GZ8A 5DD4A 2FMLA 1NQZA 3X0PA 4KTBA 3DUPA 1MQEA 4C9WA 3A6TA 4JZUA 1Q33A 1V8IA 2DSCA 3MDIA 2RRKA 1MUTA 1V8MA 5FSMA 5GHQA 1V8YA 5LPGA 3Q93A 3X0MA 3CNGA 1Q54A 2PNYA 4C9XA 4ILQA 5ANVA 1MK1A 2R5WA 4KG4A 1XSCA 3GG6A 3ID9A 2DHOA 2I6KA 4K6EA 2YYHA 5FSKA 1V8VA 2O5FA 3Q4IA 5GHNA 3SHDA 5BS6A 5FSOA 2I8TA 1V8SA 1X84A 3HYQA 1MP2A 2QJTA 2KDVA 4ICKA 5DEQA 3ZR0A 4KYXA 5ISYA 2XSQA 1PPWA 5IW5A 4N1UA 3FK9A 2GT2A 3KVHA 3SONA 2YVMA 3BM4A 4NFXA 5ANWA 5C8LA 5IW4A 2JVBA 1NFZA 5C7QA 5GHPA 3Q1PA 3G0QA 1PUNA 2J8QA 3O69A 2QKMB 2YVPA 3MCFA 3FFUA 4IJXA 4NFWA 2G73A 4YPHA 3N9UA 2VNQA 5FSLA 3FCMA 2Q9PA 1NQYA 2W4EA 1VCDA 3X0IA 1V8WA 2ICKA 1KHZA 4S2VA 4KG3A 2O5WA 4S2XA 3P5TA 3QSJA 5GHMA 5DDGA 3I7UA 3GZ6A 2ICJA 5HZXA 1X83A 2A8RA 3E57A 2B06A 1GA7A 3J7Ye 3N77A 2FKBA 5FSNA 5BONA 1VRLA 1SOIA 3Q2SA 1G0SA 3X0OA 3SMDA 2I8UA 5GHOA 3X0QA 5CFJA 2DSBA 3H95A 3O52A 4YPRA 3R03A 3ZR1A 3O6ZA 4V14A 2KDWA 1R67A 2A6TA 4HVYA 1HZTA 3AC9A 1XSBA 3L85A 3OGAA 5C7TA 2B2KA 1PPVA 1U20A 1VIQA 2FVVA 2YVNA 5ANUA 1MR2A 2YVOA 3Q91A 2AZWA 1I9AA 2G74A 3Q2TA 4DYWA 1V8TA 1MQWA 3FJYA 2A8QA 2VNPA 1V8NA 3I7VA 1QVJA 1RRSA 5FSIA 2GT4A 3EESA 3FSPA 1SJYA 3MGMA 4J7HA 4JZSA 2A8TA 1SU2A 1KTGA 1VK6A 1F3YA 5ANTA 3X0NA 3P6YA 4S2YA 1PVFA 1VHGA 1XSAA 3I9XA 5DPKA 1OW2A 1PUQA 1RRQA 1PUSA 3X0KA 1V8RA 2GB5A 4HFQA 3X0LA 3BAPA 2A8SA 3A6SA 5ANSA 3GWYA 3O8SA 2B0VA 1SZ3A 3HHJA 1TUMA 4J7GA 4N1TA 4S2WA 3WHWA 3BHOA 5CFIA 3GRNA 3A6VA 1IRYA 3U53A 4ZG0A 3X0RA 3F13A 4MPOA 2PQVA 1VIUA 2QJOA 1VC9A 3GZ5A 1K26A 1PPXA 1V8UA 1Q27A 1X51A 2CZRA 2CL3A 3MDGA 3EEUA 3RH7A 3X0SA 1VC8A 5GHJA 3EF5A 1JKNA 3A6UA 3COUA 4JZTA 1KT9A 5GHIA 1V8LA 3O61A 1K2EA 2A8PA 4YOQA 1JRKA 2O1CA 4JZVA 2DUKA 1RYAA 1HX3A 3EXQA 3X0JA 1G9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DSD A;  3DKU A;  5I8U A;  1VHZ A;  1NFS A;  3ACA A;  3F6A A;  3GZ8 A;  5DD4 A;  2FML A;  1NQZ A;  3X0P A;  4KTB A;  3DUP A;  1MQE A;  4C9W A;  3A6T A;  4JZU A;  1Q33 A;  1V8I A;  2DSC A;  3MDI A;  2RRK A;  1MUT A;  1V8M A;  5FSM A;  5GHQ A;  1V8Y A;  5LPG A;  3Q93 A;  3X0M A;  3CNG A;  1Q54 A;  2PNY A;  4C9X A;  4ILQ A;  5ANV A;  1MK1 A;  2R5W A;  4KG4 A;  1XSC A;  3GG6 A;  3ID9 A;  2DHO A;  2I6K A;  4K6E A;  2YYH A;  5FSK A;  1V8V A;  2O5F A;  3Q4I A;  5GHN A;  3SHD A;  5BS6 A;  5FSO A;  2I8T A;  1V8S A;  1X84 A;  3HYQ A;  1MP2 A;  2QJT A;  2KDV A;  4ICK A;  5DEQ A;  3ZR0 A;  4KYX A;  5ISY A;  2XSQ A;  1PPW A;  5IW5 A;  4N1U A;  3FK9 A;  2GT2 A;  3KVH A;  3SON A;  2YVM A;  3BM4 A;  4NFX A;  5ANW A;  5C8L A;  5IW4 A;  2JVB A;  1NFZ A;  5C7Q A;  5GHP A;  3Q1P A;  3G0Q A;  1PUN A;  2J8Q A;  3O69 A;  2QKM B;  2YVP A;  3MCF A;  3FFU A;  4IJX A;  4NFW A;  2G73 A;  4YPH A;  3N9U A;  2VNQ A;  5FSL A;  3FCM A;  2Q9P A;  1NQY A;  2W4E A;  1VCD A;  3X0I A;  1V8W A;  2ICK A;  1KHZ A;  4S2V A;  4KG3 A;  2O5W A;  4S2X A;  3P5T A;  3QSJ A;  5GHM A;  5DDG A;  3I7U A;  3GZ6 A;  2ICJ A;  5HZX A;  1X83 A;  2A8R A;  3E57 A;  2B06 A;  1GA7 A;  3J7Y e;  3N77 A;  2FKB A;  5FSN A;  5BON A;  1VRL A;  1SOI A;  3Q2S A;  1G0S A;  3X0O A;  3SMD A;  2I8U A;  5GHO A;  3X0Q A;  5CFJ A;  2DSB A;  3H95 A;  3O52 A;  4YPR A;  3R03 A;  3ZR1 A;  3O6Z A;  4V14 A;  2KDW A;  1R67 A;  2A6T A;  4HVY A;  1HZT A;  3AC9 A;  1XSB A;  3L85 A;  3OGA A;  5C7T A;  2B2K A;  1PPV A;  1U20 A;  1VIQ A;  2FVV A;  2YVN A;  5ANU A;  1MR2 A;  2YVO A;  3Q91 A;  2AZW A;  1I9A A;  2G74 A;  3Q2T A;  4DYW A;  1V8T A;  1MQW A;  3FJY A;  2A8Q A;  2VNP A;  1V8N A;  3I7V A;  1QVJ A;  1RRS A;  5FSI A;  2GT4 A;  3EES A;  3FSP A;  1SJY A;  3MGM A;  4JZS A;  2A8T A;  1SU2 A;  1KTG A;  1VK6 A;  1F3Y A;  5ANT A;  3X0N A;  3P6Y A;  4S2Y A;  1PVF A;  1VHG A;  1XSA A;  3I9X A;  5DPK A;  1OW2 A;  1PUQ A;  1RRQ A;  1PUS A;  3X0K A;  1V8R A;  2GB5 A;  4HFQ A;  3X0L A;  3BAP A;  2A8S A;  3A6S A;  5ANS A;  3GWY A;  3O8S A;  2B0V A;  1SZ3 A;  3HHJ A;  1TUM A;  4N1T A;  4S2W A;  3WHW A;  3BHO A;  5CFI A;  3GRN A;  3A6V A;  1IRY A;  3U53 A;  4ZG0 A;  3X0R A;  3F13 A;  4MPO A;  2PQV A;  1VIU A;  2QJO A;  1VC9 A;  3GZ5 A;  1K26 A;  1PPX A;  1V8U A;  1Q27 A;  1X51 A;  2CL3 A;  3MDG A;  3EEU A;  3RH7 A;  3X0S A;  1VC8 A;  5GHJ A;  3EF5 A;  1JKN A;  3A6U A;  3COU A;  4JZT A;  1KT9 A;  5GHI A;  1V8L A;  3O61 A;  1K2E A;  2A8P A;  4YOQ A;  1JRK A;  2O1C A;  4JZV A;  2DUK A;  1RYA A;  1HX3 A;  3EXQ A;  3X0J A;  1G9Q A; 
#chains in the Genus database with same CATH topology
 2DSD A;  3DKU A;  5I8U A;  1VHZ A;  1NFS A;  3ACA A;  3F6A A;  3GZ8 A;  5DD4 A;  2FML A;  1NQZ A;  3X0P A;  4KTB A;  3DUP A;  1MQE A;  4C9W A;  3A6T A;  4JZU A;  1Q33 A;  1V8I A;  2DSC A;  3MDI A;  2RRK A;  1MUT A;  1V8M A;  5FSM A;  5GHQ A;  1V8Y A;  5LPG A;  3Q93 A;  3X0M A;  3CNG A;  1Q54 A;  2PNY A;  4C9X A;  4ILQ A;  5ANV A;  1MK1 A;  2R5W A;  4KG4 A;  1XSC A;  3GG6 A;  3ID9 A;  2DHO A;  2I6K A;  4K6E A;  2YYH A;  5FSK A;  1V8V A;  2O5F A;  3Q4I A;  5GHN A;  3SHD A;  5BS6 A;  5FSO A;  2I8T A;  1V8S A;  1X84 A;  3HYQ A;  1MP2 A;  2QJT A;  2KDV A;  4ICK A;  5DEQ A;  3ZR0 A;  4KYX A;  5ISY A;  2XSQ A;  1PPW A;  5IW5 A;  4N1U A;  3FK9 A;  2GT2 A;  3KVH A;  3SON A;  2YVM A;  3BM4 A;  4NFX A;  5ANW A;  5C8L A;  5IW4 A;  2JVB A;  1NFZ A;  5C7Q A;  5GHP A;  3Q1P A;  3G0Q A;  1PUN A;  2J8Q A;  3O69 A;  2QKM B;  2YVP A;  3MCF A;  3FFU A;  4IJX A;  4NFW A;  2G73 A;  4YPH A;  3N9U A;  2VNQ A;  5FSL A;  3FCM A;  2Q9P A;  1NQY A;  2W4E A;  1VCD A;  3X0I A;  1V8W A;  2ICK A;  1KHZ A;  4S2V A;  4KG3 A;  2O5W A;  4S2X A;  3P5T A;  3QSJ A;  5GHM A;  5DDG A;  3I7U A;  3GZ6 A;  2ICJ A;  5HZX A;  1X83 A;  2A8R A;  3E57 A;  2B06 A;  1GA7 A;  3J7Y e;  3N77 A;  2FKB A;  5FSN A;  5BON A;  1VRL A;  1SOI A;  3Q2S A;  1G0S A;  3X0O A;  3SMD A;  2I8U A;  5GHO A;  3X0Q A;  5CFJ A;  2DSB A;  3H95 A;  3O52 A;  4YPR A;  3R03 A;  3ZR1 A;  3O6Z A;  4V14 A;  2KDW A;  1R67 A;  2A6T A;  4HVY A;  1HZT A;  3AC9 A;  1XSB A;  3L85 A;  3OGA A;  5C7T A;  2B2K A;  1PPV A;  1U20 A;  1VIQ A;  2FVV A;  2YVN A;  5ANU A;  1MR2 A;  2YVO A;  3Q91 A;  2AZW A;  1I9A A;  2G74 A;  3Q2T A;  4DYW A;  1V8T A;  1MQW A;  3FJY A;  2A8Q A;  2VNP A;  1V8N A;  3I7V A;  1QVJ A;  1RRS A;  5FSI A;  2GT4 A;  3EES A;  3FSP A;  1SJY A;  3MGM A;  4J7H A;  4JZS A;  2A8T A;  1SU2 A;  1KTG A;  1VK6 A;  1F3Y A;  5ANT A;  3X0N A;  3P6Y A;  4S2Y A;  1PVF A;  1VHG A;  1XSA A;  3I9X A;  5DPK A;  1OW2 A;  1PUQ A;  1RRQ A;  1PUS A;  3X0K A;  1V8R A;  2GB5 A;  4HFQ A;  3X0L A;  3BAP A;  2A8S A;  3A6S A;  5ANS A;  3GWY A;  3O8S A;  2B0V A;  1SZ3 A;  3HHJ A;  1TUM A;  4J7G A;  4N1T A;  4S2W A;  3WHW A;  3BHO A;  5CFI A;  3GRN A;  3A6V A;  1IRY A;  3U53 A;  4ZG0 A;  3X0R A;  3F13 A;  4MPO A;  2PQV A;  1VIU A;  2QJO A;  1VC9 A;  3GZ5 A;  1K26 A;  1PPX A;  1V8U A;  1Q27 A;  1X51 A;  2CZR A;  2CL3 A;  3MDG A;  3EEU A;  3RH7 A;  3X0S A;  1VC8 A;  5GHJ A;  3EF5 A;  1JKN A;  3A6U A;  3COU A;  4JZT A;  1KT9 A;  5GHI A;  1V8L A;  3O61 A;  1K2E A;  2A8P A;  4YOQ A;  1JRK A;  2O1C A;  4JZV A;  2DUK A;  1RYA A;  1HX3 A;  3EXQ A;  3X0J A;  1G9Q A; 
#chains in the Genus database with same CATH homology
 2DSD A;  3DKU A;  5I8U A;  1VHZ A;  1NFS A;  3ACA A;  3F6A A;  3GZ8 A;  5DD4 A;  2FML A;  1NQZ A;  3X0P A;  4KTB A;  3DUP A;  1MQE A;  4C9W A;  3A6T A;  4JZU A;  1Q33 A;  1V8I A;  2DSC A;  3MDI A;  2RRK A;  1MUT A;  1V8M A;  5FSM A;  5GHQ A;  1V8Y A;  5LPG A;  3Q93 A;  3X0M A;  3CNG A;  1Q54 A;  2PNY A;  4C9X A;  4ILQ A;  5ANV A;  1MK1 A;  2R5W A;  4KG4 A;  1XSC A;  3GG6 A;  3ID9 A;  2DHO A;  2I6K A;  4K6E A;  2YYH A;  5FSK A;  1V8V A;  2O5F A;  3Q4I A;  5GHN A;  3SHD A;  5BS6 A;  5FSO A;  2I8T A;  1V8S A;  1X84 A;  3HYQ A;  1MP2 A;  2QJT A;  2KDV A;  4ICK A;  5DEQ A;  3ZR0 A;  4KYX A;  5ISY A;  2XSQ A;  1PPW A;  5IW5 A;  4N1U A;  3FK9 A;  2GT2 A;  3KVH A;  3SON A;  2YVM A;  3BM4 A;  4NFX A;  5ANW A;  5C8L A;  5IW4 A;  2JVB A;  1NFZ A;  5C7Q A;  5GHP A;  3Q1P A;  3G0Q A;  1PUN A;  2J8Q A;  3O69 A;  2QKM B;  2YVP A;  3MCF A;  3FFU A;  4IJX A;  4NFW A;  2G73 A;  4YPH A;  3N9U A;  2VNQ A;  5FSL A;  3FCM A;  2Q9P A;  1NQY A;  2W4E A;  1VCD A;  3X0I A;  1V8W A;  2ICK A;  1KHZ A;  4S2V A;  4KG3 A;  2O5W A;  4S2X A;  3P5T A;  3QSJ A;  5GHM A;  5DDG A;  3I7U A;  3GZ6 A;  2ICJ A;  5HZX A;  1X83 A;  2A8R A;  3E57 A;  2B06 A;  1GA7 A;  3J7Y e;  3N77 A;  2FKB A;  5FSN A;  5BON A;  1VRL A;  1SOI A;  3Q2S A;  1G0S A;  3X0O A;  3SMD A;  2I8U A;  5GHO A;  3X0Q A;  5CFJ A;  2DSB A;  3H95 A;  3O52 A;  4YPR A;  3R03 A;  3ZR1 A;  3O6Z A;  4V14 A;  2KDW A;  1R67 A;  2A6T A;  4HVY A;  1HZT A;  3AC9 A;  1XSB A;  3L85 A;  3OGA A;  5C7T A;  2B2K A;  1PPV A;  1U20 A;  1VIQ A;  2FVV A;  2YVN A;  5ANU A;  1MR2 A;  2YVO A;  3Q91 A;  2AZW A;  1I9A A;  2G74 A;  3Q2T A;  4DYW A;  1V8T A;  1MQW A;  3FJY A;  2A8Q A;  2VNP A;  1V8N A;  3I7V A;  1QVJ A;  1RRS A;  5FSI A;  2GT4 A;  3EES A;  3FSP A;  1SJY A;  3MGM A;  4J7H A;  4JZS A;  2A8T A;  1SU2 A;  1KTG A;  1VK6 A;  1F3Y A;  5ANT A;  3X0N A;  3P6Y A;  4S2Y A;  1PVF A;  1VHG A;  1XSA A;  3I9X A;  5DPK A;  1OW2 A;  1PUQ A;  1RRQ A;  1PUS A;  3X0K A;  1V8R A;  2GB5 A;  4HFQ A;  3X0L A;  3BAP A;  2A8S A;  3A6S A;  5ANS A;  3GWY A;  3O8S A;  2B0V A;  1SZ3 A;  3HHJ A;  1TUM A;  4J7G A;  4N1T A;  4S2W A;  3WHW A;  3BHO A;  5CFI A;  3GRN A;  3A6V A;  1IRY A;  3U53 A;  4ZG0 A;  3X0R A;  3F13 A;  4MPO A;  2PQV A;  1VIU A;  2QJO A;  1VC9 A;  3GZ5 A;  1K26 A;  1PPX A;  1V8U A;  1Q27 A;  1X51 A;  2CZR A;  2CL3 A;  3MDG A;  3EEU A;  3RH7 A;  3X0S A;  1VC8 A;  5GHJ A;  3EF5 A;  1JKN A;  3A6U A;  3COU A;  4JZT A;  1KT9 A;  5GHI A;  1V8L A;  3O61 A;  1K2E A;  2A8P A;  4YOQ A;  1JRK A;  2O1C A;  4JZV A;  2DUK A;  1RYA A;  1HX3 A;  3EXQ A;  3X0J A;  1G9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...