3N8EA

Substrate binding domain of the human heat shock 70kda protein 9 (mortalin)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
159
structure length
159
Chain Sequence
DVTPLSLGIETLGGVFTKLINRNTTIPTKKSQVFSTAADGQTQVEIKVCQGEREMAGDNKLLGQFTLIGIPPAPRGVPQIEVTFDIDANGIVHVSAKDKGTGREQQIVIQSSGGLSKDDIENMVKNAEKYAEEDRRKKERVEAVNMAEGIIHDTETKME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Stress-70 protein, mitochondrial
publication title Substrate binding domain of the human Heat Shock 70kDa protein 9 (mortalin)
rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 42
structure length 159
sequence length 159
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.34.10 Mainly Beta Sandwich Substrate Binding Domain Of DNAk; Chain A, domain 1 Substrate Binding Domain Of DNAk; Chain A, domain 1 3n8eA00
4F01A 3C7NA 3DQGA 3D2EA 4JWIA 4EZZA 4FL9A 4R5IA 4F00A 3DPPA 4R5JA 1DG4A 3C7NB 4JWCA 2KHOA 5E84A 7HSCA 4HYBA 1U00A 4EZTA 5TKYA 4PO2A 4WV5A 3D2FA 4R5LA 2BPRA 2OP6A 3DPOA 4E81A 4WV7A 4JNFA 4EZVA 3QNJA 1DKYA 4EZUA 1Q5LA 4EZPA 4EZYA 3DPQA 1YUWA 1DKXA 4EZRA 3N8EA 4EZQA 1DKZA 4EZOA 4EZNA 3DOBA 4JWEA 4EZWA 4R5GA 4EZXA 4JNEA 4EZSA 2V7YA 4HY9A 4JN4A 4JWDA 1BPRA 1CKRA 2QXLA 3H0XA 4B9QA 4R5KA
chains in the Genus database with same CATH superfamily
4ILIA 4F01A 3C7NA 3DQGA 3D2EA 4JWIA 4EZZA 4FL9A 4R5IA 4F00A 3DPPA 4R5JA 1DG4A 3C7NB 4JWCA 2KHOA 5E84A 7HSCA 3ZEFA 4HYBA 1U00A 4EZTA 5TKYA 4PO2A 4WV5A 3D2FA 4R5LA 2BPRA 2OP6A 3DPOA 4E81A 4WV7A 4JNFA 4EZVA 3QNJA 1DKYA 4EZUA 1Q5LA 4EZPA 4EZYA 4I43A 3DPQA 1YUWA 1DKXA 4EZRA 3N8EA 4EZQA 1DKZA 4EZOA 4EZNA 3DOBA 4ILGA 4JWEA 3SBTB 4EZWA 4R5GA 4EZXA 4JNEA 4MQDA 4EZSA 2V7YA 4HY9A 4ILHB 4JN4A 4JWDA 1BPRA 1CKRA 2QXLA 3SBSA 3H0XA 4B9QA 4R5KA
chains in the Genus database with same CATH topology
4ILIA 4F01A 3C7NA 3DQGA 3D2EA 4JWIA 4EZZA 4FL9A 4R5IA 4F00A 3DPPA 4R5JA 1DG4A 3C7NB 4JWCA 2KHOA 5E84A 7HSCA 3ZEFA 4HYBA 1U00A 4EZTA 5TKYA 4PO2A 4WV5A 3D2FA 4R5LA 2BPRA 2OP6A 3DPOA 4E81A 4WV7A 4JNFA 4EZVA 3QNJA 1DKYA 4EZUA 1Q5LA 4EZPA 4EZYA 4I43A 3DPQA 1YUWA 1DKXA 4EZRA 3N8EA 4EZQA 1DKZA 4EZOA 4EZNA 3DOBA 4ILGA 4JWEA 3SBTB 4EZWA 4R5GA 4EZXA 4JNEA 4MQDA 4EZSA 2V7YA 4HY9A 4ILHB 4JN4A 4JWDA 1BPRA 1CKRA 2QXLA 3SBSA 3H0XA 4B9QA 4R5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F01 A;  3C7N A;  3DQG A;  3D2E A;  4JWI A;  4EZZ A;  4FL9 A;  4R5I A;  4F00 A;  3DPP A;  4R5J A;  1DG4 A;  3C7N B;  4JWC A;  2KHO A;  5E84 A;  7HSC A;  4HYB A;  1U00 A;  4EZT A;  5TKY A;  4PO2 A;  4WV5 A;  3D2F A;  4R5L A;  2BPR A;  2OP6 A;  3DPO A;  4E81 A;  4WV7 A;  4JNF A;  4EZV A;  3QNJ A;  1DKY A;  4EZU A;  1Q5L A;  4EZP A;  4EZY A;  3DPQ A;  1YUW A;  1DKX A;  4EZR A;  3N8E A;  4EZQ A;  1DKZ A;  4EZO A;  4EZN A;  3DOB A;  4JWE A;  4EZW A;  4R5G A;  4EZX A;  4JNE A;  4EZS A;  2V7Y A;  4HY9 A;  4JN4 A;  4JWD A;  1BPR A;  1CKR A;  2QXL A;  3H0X A;  4B9Q A;  4R5K A; 
#chains in the Genus database with same CATH topology
 4ILI A;  4F01 A;  3C7N A;  3DQG A;  3D2E A;  4JWI A;  4EZZ A;  4FL9 A;  4R5I A;  4F00 A;  3DPP A;  4R5J A;  1DG4 A;  3C7N B;  4JWC A;  2KHO A;  5E84 A;  7HSC A;  3ZEF A;  4HYB A;  1U00 A;  4EZT A;  5TKY A;  4PO2 A;  4WV5 A;  3D2F A;  4R5L A;  2BPR A;  2OP6 A;  3DPO A;  4E81 A;  4WV7 A;  4JNF A;  4EZV A;  3QNJ A;  1DKY A;  4EZU A;  1Q5L A;  4EZP A;  4EZY A;  4I43 A;  3DPQ A;  1YUW A;  1DKX A;  4EZR A;  3N8E A;  4EZQ A;  1DKZ A;  4EZO A;  4EZN A;  3DOB A;  4ILG A;  4JWE A;  3SBT B;  4EZW A;  4R5G A;  4EZX A;  4JNE A;  4MQD A;  4EZS A;  2V7Y A;  4HY9 A;  4ILH B;  4JN4 A;  4JWD A;  1BPR A;  1CKR A;  2QXL A;  3SBS A;  3H0X A;  4B9Q A;  4R5K A; 
#chains in the Genus database with same CATH homology
 4ILI A;  4F01 A;  3C7N A;  3DQG A;  3D2E A;  4JWI A;  4EZZ A;  4FL9 A;  4R5I A;  4F00 A;  3DPP A;  4R5J A;  1DG4 A;  3C7N B;  4JWC A;  2KHO A;  5E84 A;  7HSC A;  3ZEF A;  4HYB A;  1U00 A;  4EZT A;  5TKY A;  4PO2 A;  4WV5 A;  3D2F A;  4R5L A;  2BPR A;  2OP6 A;  3DPO A;  4E81 A;  4WV7 A;  4JNF A;  4EZV A;  3QNJ A;  1DKY A;  4EZU A;  1Q5L A;  4EZP A;  4EZY A;  4I43 A;  3DPQ A;  1YUW A;  1DKX A;  4EZR A;  3N8E A;  4EZQ A;  1DKZ A;  4EZO A;  4EZN A;  3DOB A;  4ILG A;  4JWE A;  3SBT B;  4EZW A;  4R5G A;  4EZX A;  4JNE A;  4MQD A;  4EZS A;  2V7Y A;  4HY9 A;  4ILH B;  4JN4 A;  4JWD A;  1BPR A;  1CKR A;  2QXL A;  3SBS A;  3H0X A;  4B9Q A;  4R5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...