3N9GH

Crystal structure of the fab fragment of the human neutralizing anti-west nile virus mab cr4354
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
230
structure length
230
Chain Sequence
EVQLVQSGAEVRKPGASTKVSCKASGYTFTHYYMHWVRQAPGQGLEWMGIINPSGGSTTYAQKLQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDWGSNYVWGSYPKYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of MAb CR4354, heavy chain
publication title Neutralization of West Nile virus by cross-linking of its surface proteins with Fab fragments of the human monoclonal antibody CR4354.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 50
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2010-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n9gH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n9gH01
2R23A 2ZZUT 2DQTH 3BXNB 4NJ9L 4PJDA 5BO1L 3L7EB 4N90D 3KPRA 4M1DL 4WI8A 4NSKA 1LNUB 3KPSA 4ZODA 4PJ5A 4TULL 3LQZB 4EBQL 1W0WA 3HCVA 2C5DC 3IFOB 5JPNA 4K7PY 4DN3H 1TVDA 3LKPA 4L8SA 4ESKA 2OL3A 2H2SD 4GKSB 1IGCL 3PQYB 5L0QB 3VFWB 5EZJA 1ZLSH 4WNQA 3WV0A 5E95B 2JJWA 2EKJA 4M7ZB 3GSUB 2UVFA 3W9DB 1A4JB 5DRWB 5F96L 5GIRB 2NY0B 5TQ0H 3WKNA 2DQGH 3TBSA 3ARFD 5DD6B 3ZKXB 3VWKA 4MA3A 3B9KA 4DZ8B 1LEKA 4M1CC 4KZEL 4JFFA 1CG9A 1F11A 1N7ML 4OD3H 3GGWA 1FAKT 3HMXA 5DUML 1IVLA 1U95B 1FLRL 1FNFA 4Y5YA 4P46B 2Y25A 4ZUSA 2VWEC 2XIDA 1H0DB 2HRLA 4UOW1 1FBIL 1U8HA 1WWBX 1J11A 4CAGA 3UTSD 15C8H 4BFGA 5LGHL 1PLGL 4O00A 4LHQB 4IOIA 4FQLH 2BY2A 3D3VE 4BKLA 4QNPE 4Y5XA 2YSSB 1W72H 1IM9B 5D6CA 1B88A 4DAGH 3RBSA 5ACZB 3KPLB 4XTRC 4NCC2 3GBNL 4XWOC 2MKWA 3AAZA 2CSPA 2FLBT 2GY5A 1I1CA 3HUJB 3S7GA 3G6JE 3MTRA 1A0QH 4Y7MA 3RKDD 2VAAA 3T3ME 1N3NB 3PWJB 3IJSA 5B39G 1FFPB 2H6PA 4OUUA 3LZFH 1RPQA 4JFOA 3SDYH 4AH2B 4KMTH 1IGFH 5CINL 1I1AC 1YY9C 2VQ1B 4F80A 2E9JA 2CLZA 5EIVA 5ACMA 1BHGA 2BZDA 2BDNL 2IANE 4OM0H 4WDIB 1V3KA 3PWVA 1NCAL 4UIKH 2FECI 1J1XH 1YY8B 2PETA 1WQVT 4MQ7B 3GMRB 3OKDB 2B39A 3KYMA 4K3EH 5IVNA 3S35H 5SWZB 3IDJA 1KCSH 4XWGH 3KLSA 1J8HA 3U36B 2EIZB 1R3LA 4PLNC 3T0AA 2EXWC 3X13A 4RMRA 4CW1A 4Z7NE 1A6UL 3EYOA 4X6CA 5IB1A 2Q76A 2EDTA 3KPMA 1FG2B 4RIRB 3R0NA 3SKNB 5HY9A 3FFCB 4X9BA 3C6LC 4WEUD 1RAMA 2OL3L 4EQ3A 1FNSL 5FK9A 2QHRL 1IAOB 4OZIA 4RSVA 3JV6A 4LRNL 1S9XA 1FRGL 4PJFB 4EVNA 1T03H 4JN2B 4I77L 2YUZA 3HI6L 5DMJB 1S7XA 5CWSB 4O4YL 1ZLWH 3QIBA 1MJJB 3MBXH 3GMMA 1SEBA 4L3EA 1QG3A 3A6OA 3CX2A 3JV4B 5A40E 3H3PH 1HXYA 1ZLVK 1H5BA 2R1XB 1WFUA 5I1IL 5C71A 1FORH 4X6EA 3UTZB 5J6GB 3MREB 5ANMB 4HIXL 1NAMA 4RGNE 1RULL 1G7PB 2Z93B 1JN6A 5EUOB 1BJ1H 3F7PC 4FTVA 2UWEE 1Z9MA 4PTUA 3OR7B 4F7CB 4XP5L 1Y0LB 4PIRF 1VKXB 2VN4A 4K71C 2HJLA 3V4VL 4LSSL 1U8MA 2DF3A 4MJID 3SJVD 4K9EC 2AJUL 4BQ6A 1HQRB 1HKLH 1S7WB 4N8VA 4LF3A 1UEYA 3CFDA 4R2GB 1NC4B 3CC5A 1E4KC 1WISA 4M9OA 1KT2B 3BD4A 5DJAB 1UB5A 1S9YA 2E7HA 2DWEA 3MOAH 5DQDH 4LSPH 5FYJL 2BNUA 1CXIA 1IEBB 3QULA 3U79A 2HT2C 4BFBD 4DFHA 5I15L 1QOKA 2B5IC 1XF3B 1MRDL 2VIRB 4ZNCD 4FFWC 4ELMA 3P0YL 3UEZA 4PJEE 2FD6L 3QO1A 2FB4H 4TTDD 1DTUA 4JFHE 5FGBA 1NKRA 2BERA 6CGTA 5DS8B 2MSPA 4U7MA 1FIGH 1KJMB 5FM4A 1C5DA 3S8WA 5IG7B 3BUTA 2D4DA 2CLRA 1INEL 1JNNH 2E3VA 2W0KA 4MSWB 1CGSH 4HIHA 1NAKH 4DGYL 3PP4H 4BH7B 1GYAA 1OM3L 1P4LA 2OJZL 1I1AB 1BFOB 4ZTPL 3U9PL 3WFDL 4K7FA 4ZXBA 2C4FT 3FT4B 4M7JH 1NJ9B 5CSGA 2ZCHL 3AVEA 4QCIA 4RGNC 4NN7C 1LILA 1K6QH 3GJEA 3DX7B 3HC4H 4HUXB 5GGVH 4EDWH 2X4OB 2EYTB 5ALBH 1XGRB 5ACLA 3GIVA 1UM6L 5D72L 1BF2A 3O2VL 4JG1H 5ID1A 2E7LC 3LOWA 1D5BA 3AREB 1FE8H 1S7SA 1G9NL 3QNYB 1QD0A 3EO9L 3BQUB 4MA1B 3VXRE 3WYRA 4GQ9L 4ZUTA 1T6WA 4JPWL 3UDWA 1I1RA 5CEYA 4E41A 1YUHA 4F8QA 3B43A 3D3VB 3U2SA 3AC0A 3RIAF 5ALCH 2YC1A 1MH5A 3ILPB 4G3YL 2A73A 5TGBB 3QH3A 4NCC1 5F1KC 1NAML 4FQXC 4HFUH 2PR4H 3EYFB 2AXHA 3VDAA 1XGTA 4WV1C 5BVPH 2F9BT 2VKXA 4N5ED 3PDDA 5GZOC 4ZFGH 1QBLH 5CJQL 3G6JB 2FJGA 3D9AL 2OSLA 3F65A 5I18L 1JPST 1U3HB 3LV3A 3ALPA 1KLGA 1YJDL 4K71B 3EDJA 3E6FB 1J05A 1C16B 3RVTD 1BOGB 1E0OB 1P7QB 4KQ3L 1JBJA 2IANB 5IB2B 1XF4A 3MA7B 4HWBH 2LAGB 1CIUA 2BVQA 4WW1A 4MNQE 5D7IF 2WUBH 4PBVC 2NPLX 5ID0A 4PGEA 5E9DA 3R06B 4LKCB 2B5IB 5IW1A 2DQUL 4LCIL 3OKEB 4KDWA 5DQ9A 3GUTA 1A5FH 1JL8A 5IHBA 1ZANL 4YDIH 3LSOA 3WXVL 5JUEL 5DD0L 43CAB 3VJ6A 3W9EA 5E2TL 5BMFL 1IQWH 4LASH 4HV8A 4JHZA 1YNLH 4OLVL 4RRPA 5J12B 3O4LD 5CP3H 1FL6A 3VD4A 4PJ9C 2BRRL 3EFFA 4JO4H 2I27N 5JZ7D 4PG2A 1GAFL 3CFEB 5CP7A 1CL7I 1EVUA 3KWWB 1R3IH 5KBNC 3E3QC 4WI3A 4WFHD 3ARDA 3V5HB 4XNMB 1IL1B 5DMKB 3G5ZB 5KS9F 3BKCL 3EYVA 2WSKA 4QRPE 3IDIA 3NIGF 4QO1A 2W9DL 2OQJB 4N0YH 2HWZH 3H7BA 5J1AA 5CJ5A 3SBWC 1UJ3B 3QNXB 4YPGA 4D0CA 3L3HA 4NQEE 1M6OB 4RGNB 4NN7B 5C0ND 2Y6SD 4JFQA 1M05A 2UWEB 4G8GA 1S7TA 1JVKA 1I9JH 3K81A 3LS5H 3RIFK 4GBXC 1CGUA 4HUWB 3PP3K 3WFEL 2R9HC 1WFNA 3EHBD 4LHUA 1A6AB 5IMLA 3ULUH 4ALAH 2FIRT 1NQBA 1KPVB 2EC9U 1R0AL 3GI8H 5E6IC 2PO6D 2IBBA 5T33L 2LQRA 3TZVD 1ORSB 2MCPL 3KLHC 2BJML 4DVRH 2DJ4A 1F13A 2ORBL 3BKJL 2IAMC 4JZOA 3PDOA 1FPTH 3PXJA 4PJEB 3B3IB 4X4YA 1OF2B 1X5GA 3QUXD 4U3HA 2AW2A 2F5BH 2XV6B 4NKIL 1QVOB 2JE8A 1G9MH 2G60H 3CK0L 3JTTA 2UYLB 1MLBA 5DA4A 4QRSA 2CKNA 5FYLD 4OZGE 1K8DB 3L7EA 4OTXH 2VLRE 1SYSB 3BKYL 2VDLH 5DEZA 1SJEB 3KDMA 3WDIA 3DGCR 5B3NA 1LNUA 4S1QH 4EI5B 2OR9H 2GI7A 3LQZA 4UV7H 2VN7A 1MJ8H 1NGZB 4HIIA 5ESAB 4JGJA 2LU3A 1EO5A 4FABH 2BCKB 3T0DA 1R6VA 4MB5A 2WUCL 2KL6A 3MR9B 4GKSA 2WK2A 3NPSC 4JFED 3VFWA 1MUJA 4PREA 3VXNB 4M7LL 2Y06L 4OKDA 5DK3A 3QCVL 1DBJH 4OZHA 3SGJA 4HMEA 3MO1A 2CD0A 3GSUA 4HUMB 1A4JA 5DRWA 3W9DA 5IWLA 5GIRA 2HH0L 1S3KL 1ZVHA 2HJKB 1EX0A 2XOTA 5F7UA 4Z7QE 5DD6A 5EU4B 3EJYD 4YBLB 5FGCE 5FHAL 3VXRB 4DKAA 4GAYA 5ITBL 4NWTH 3VWJD 5GGSY 4ZYKB 2R0KL 3HNSL 3VXSD 3UYOD 3RHWK 4M00A 1OP9A 1MF2H 3A67H 4WY7L 4P46A 1I8IB 3ARFA 4MHHG 1I9IH 2RGSA 5IBTL 4LPUA 2IH1B 4AEHL 4P4RB 5DT1H 4LBEB 2NNAB 3IFPB 2DN7A 4HC1A 3NCYS 1JZ8A 2YSSA 3DX8A 1EMTL 5IROC 5ACZA 2O5ZL 2ZCKH 3KPLA 1GRWA 4J3TA 1CGVA 1SM3H 4KRPC 1HNGA 5DRZB 5DYOA 1NBVH 1FC1A 5C07B 4GBXB 1HHJB 5FO9B 4RX4D 5L6YH 2Y9RT 3PWJA 4ZPTA 3WJJA 2QR0A 2R56H 3GBML 1P4BH 1QBMH 1FFPA 4PRBB 4PV9B 4MNQB 2GW5A 5HI3D 2A38A 3R4DA 5C92A 5DMIL 1TETH 1VSCA 3WNPA 2DM7A 4TYUA 4NKDA 2EECA 3IGAB 3UBXB 1X5IA 2EO1A 3JWDH 4YHNA 5EU7E 4XCEB 4HLJA 2I24N 1IC7H 5JDSA 1NLDL 4U1HB 3WS6A 2IH3B 4POUB 1YY8A 2X4UB 4MQ7A 4YK4B 5DVNA 1U8LB 1ND0B 4KVNL 5C1MB 1QLEH 3IXTA 4FFVD 3U36A 5FHBH 2YA1A 2EIZA 4WU5B 4LSDA 4WU7A 4K23H 1HIMH 4M1GH 4QRPD 3DURB 1CFVH 1PSKL 3CSGA 2X4TA 3QQ9C 4YDLC 4F57L 2GK2A 5J13C 1DL7H 3P9LB 3NZHL 5EG6C 4RIRA 1FG2A 5F7FA 3E2HC 4OLWH 3OR6B 4O5LL 5L7XH 4LNRA 1IAOA 2VZVA 1NFKA 4QRPB 1RUAH 5F8QC 3BEVB 2ZSVB 4NOBA 4YQXL 2DQEL 1Q9OB 4Z6AT 1NEZA 2CRMA 4NQEB 5D7SH 5EH1A 4X0KA 2F5AH 1ZTXH 4JFYA 2EDLA 3JV4A 3ZE1F 2R1XA 4W4OA 4YHLL 3UTZA 5J6GA 3MREA 5ANMA 1X5HA 3MLZL 2GJ6B 1WBXB 5GRZA 5LWYH 1L0XA 4U1LB 4GAJL 2Z93A 4H8WL 4LQFL 4U1KA 5EUOA 1FH5L 3OR7A 4JDTH 1Y0LA 3KHOA 1VKXA 4ONGH 3MBED 3VXPA 4JY5L 5F97E 4WFGE 1HQRA 3WN5A 2XKNB 3VG0H 1H3XA 3MLXL 3CXHJ 1G9NC 1HKFA 1KEMH 4HC1L 5DJ6A 4XGZB 5DJAA 5J0BA 3QHZH 2DIJA 2X42A 4OF5A 4Q9RH 1IEBA 2I60L 3QQ3A 5LKNA 2VIRA 2PW1A 1KGCD 1I1YB 4TOYH 4OZGB 2VLRB 3DSFL 3A0OA 1PFCA 3VFSB 3ZDXF 2H2PC 3VU2A 5DS8A 1H3WM 4XPBL 4YHMH 3QXVA 1OWRM 3K46A 2DD8L 5IEKB 4JO2L 1GZQB 5I1KL 5K9KB 1KJMA 4X6DF 2HTKC 4NO3B 3VFGH 1KCKA 5LBSH 2YA2A 3L5HA 4MSWA 1NUNB 2EEAA 1C1EL 1M71A 2IPKB 1YJDC 4RFOH 1KJ3L 5IGXL 4K7PL 4BH7A 3MJ9H 4NQDD 3H9HB 1JPGB 4W70A 2NZ9C 1BFOA 2PNDA 4CVXB 4LEOB 3PHQB 1TJIH 3S37H 1AFVH 2XRAH 1NJ9A 1GGBL 4XPAL 5DC9B 5L2JB 3QP3A 1ADQA 4RAHA 3C60C 3TM6A 4P4KD 1BF8A 3DX7A 3EOYG 5MERA 4WTWA 2FX9H 5KZCD 2X4OA 1F2QA 4Y89A 3MXWH 1XGRA 1AO7E 5FGCB 1QZ1A 3BMVA 1JHTB 2J3SA 3TCLA 3BWAB 3QUZB 3H7LA 3AREA 5J13B 4OD1H 3QNYA 4N8CH 2Y5TB 1TTGA 3BQUA 3HB3D 4LSVH 3MV7D 4GAFB 2VDQL 4YHPA 2OTWB 3QI9D 4OD2B 3WIIL 1BQHG 4GXVL 4ZUVA 3D3VA 4HZAA 4PGZA 4D9RD 4FRWA 4IRSC 4XMKL 5FA4B 3ILPA 4S1DC 2XQYK 3RWHB 2VDOL 3P73B 4KWUA 4XCCH 2ZPKH 4HWZB 5EIIB 3FOLB 5DJXB 5HVHC 2FHBA 1IC1A 5BRZE 1MCDA 1CZ8L 3HPJB 5B8CC 3BZEB 3I84A 3G6JA 2CMRL 3OHXB 1TNMA 1U3HA 1K3IA 2EDHA 1R3KA 1RURL 5D96B 4RMUA 4NGHH 3S34H 1JYXA 1KB5L 1HOCB 3EIFA 4LL9A 2VSCA 1X5ZA 3E6FA 1S78C 4PJBF 3ARYA 5I1LB 3QDJE 1D6VH 4LSRL 1L6ZA 3FQWB 1BOGA 1F3RB 4U49A 1BJ1J 1P7QA 3MROB 4MS8D 4XPTL 2IANA 3JSSA 4JKWA 2DICA 2VZOA 3NN8B 4QLRA 5EWIL 3NGBC 5IMOA 3PGDB 5SV3A 1D5MB 3B5HA 3CUPB 4GOSA 1P7KB 2R1YB 2QQQA 1U92B 1LO4L 3R06A 4MDJB 5CJXA 1HH9B 1S9KC 4LKCA 1DN0B 3LS4L 5FCUH 3OKEA 4WEMB 5FAAA 1K5NB 3WSQH 2CGRL 4IOSD 1DP0A 1KPRB 5JXEC 2B1AL 5ESVB 4WWKD 1ZLWK 4XPHH 3X11B 3VW3H 4RISL 2Y5EA 3FONA 4KXZI 3BO8A 3FB7A 3MGOA 3VFMB 1PD6A 1TLKA 1XR9A 4OF3A 3CFEA 5C0CE 2FZ3B 4PP1D 4KTDH 1CT8A 3V5HA 4CDHA 3O4LA 1IL1A 4OQTH 3G5ZA 4M7LT 4XNMA 5DMKA 1BP3B 1ZA6A 4I5BA 4OGXH 4KGLA 5MP6L 4HJGA 3PWPB 5GRUH 2JJTA 4H5SB 5I1EH 1M6OA 3C60B 2QEJA 3FRUB 1HEZB 1RJZB 3ZKSD 2UWEA 3MOBL 1ZXQA 4QXGL 1L7TL 4LAQL 4LK4A 4HUWA 1I3UA 2AXGB 5JR1L 1AD0A 1KPVA 1IGML 2I9LA 4XX1E 3O6FB 4PRIE 3WXWH 5I2IB 2PYFA 2IG2L 5FUCC 4HUVA 2W0LA 2AI0L 1MRCH 3DTXA 3FMGL 5DJYB 2AJSH 3M07A 4J4PA 4DGVL 2ZG1A 4MJ4A 4KK6C 2DTSA 2R69H 5B4MC 1ZHBB 4G5ZL 4EJ1C 4K94C 3B3IA 4X9IA 4LLDB 1OF2A 1XCTB 4YWGL 3DOSA 4NM8L 2JKXA 1CR9L 4TPRH 3TZVA 4ELKB 3O8XB 2UYLA 1E6JL 5B8CB 4OZFB 5HHOD 5FV1L 4ZS7H 4PD4J 1K8DA 5D1QB 4K9EH 1SYSA 1UA6H 2NY4C 4IMLB 3O11B 3D39E 5DDHB 1SJEA 4N9GB 1YEJL 3THMH 3JXAA 2NY3C 3U0PA 4EI5A 3RZCB 4HULB 2JCCA 1RZJL 5C0AD 4FZ8L 1F4YH 3IF1B 2DQIH 5DRXB 5ESAA 4HBCL 5I0DA 1G7HA 1UT9A 2BCKA 2GCYA 1HH6B 3MR9A 3MRRA 3PIQB 2GUOB 4JN1L 1EJOH 4PFEA 5CBAB 4NPYB 4LGPB 5J11B 1A3RL 1QHPA 3VXNA 3VFTB 2ZOLB 4KPHL 2YEZA 4OJFH 5KW9L 1F42A 1AO7B 4M3JA 1M7XA 4AMKL 2OK0H 4EN3C 3FB5B 1A47A 1X5LA 3M45A 4QF1B 1TMCB 4WJ5B 4CADA 3TT1L 3WIHA 4ZO7A 2AP2A 4M6NL 4NN5B 1TCRB 5JW4N 5EU4A 3VCLB 4K2UL 1Y6NR 3VXRA 3NVQA 1VGKB 4PD4K 3UAJC 4FFYH 1FL3A 3GSQB 4HGKC 4ZYKA 2HT4C 3HZYA 1YYLH 3REWA 1DEEA 1JZ2A 4YH6A 2D3VA 3AS3A 3ZKQD 2IH1A 3MRGB 1CLZH 4P4RA 3BN3B 2QL1A 4X7TB 3VWJA 1RY7B 2NNAA 1IC4L 3IFPA 3QJHB 5BRZB 5ITFB 4KHTH 1N2RA 4YO0A 3WLBB 1P6FA 1V8HA 4Y4HD 5F7EH 2BY0A 4MJ5B 5IFAL 1DBMH 4N5UA 2GFBB 3P4LA 4QRRE 1BQLL 2H2SC 4WTZA 2IBZX 3NFPB 3QDJB 3AM8A 2Y36H 5C0GA 2GJJA 4JJ5A 1EO8L 4H8WC 2E27H 4PRBA 1Q0YH 5EDXA 1KIUA 3T2NL 4U0RB 4MNQA 3ROOB 5CS7A 1QFWL 3IGAA 5JHDD 4UILL 2WZPD 2Y4SA 3V8OA 3QUMH 5CJBA 4AYFA 1KFAL 2NTSP 2KDGA 3SDAB 2XKSA 4GMTH 5F6IB 4XPGL 1ED3A 1CF8H 1OW0A 4RMQA 3ZTNL 1U8LA 5JOFB 4NFDA 1DLFL 3O9WB 4M5YH 3SCMD 4R0LA 2L0DA 2V17H 3D6GA 3FFDB 4OCRH 3RVVD 4DKEL 1JPSH 4F3FA 3P9LA 2NY3B 2MPAH 1N5AA 3H3KA 4P2OD 2C3GA 1MQKL 5GGUA 5FYLL 3WJJC 4TUOA 3OR6A 5C0CB 4NRXB 2HFEB 4JG0H 5H37G 5D7IE 5IVOA 1CICC 2HFGH 4QRPA 1QRKA 5I8EB 4PRHE 5KOMC 3BEVA 5EC1B 5HBBA 2WWMC 4NQEA 5HHNB 5IJKA 3H42H 3L3GB 3RKDC 4AG4L 2C3HA 3WIHL 3LPWA 4G8FA 4UT7H 3Q2CA 5H37H 4R8WL 5FGSA 3CFCL 3MFGB 1W8NA 3T1WA 1RUPH 4ONHB 3C87A 1RZFH 1WBXA 2EE2A 5K33A 3U1SH 3GMLB 5BO1H 4PRIB 4M1DH 3HHRB 5F7YC 4LMQE 2YOCA 1WTGT 2MQ0A 3GO1H 2GQHA 1N26A 1FV1B 4EBQH 2FEEI 2XKNA 2PYEE 2YK1H 3HNTL 2YD4A 4KJWD 5H8DA 4M48H 3BX7C 1KJ2A 5L8JB 4XNYH 4EKXA 4ODVL 4WTZG 3TLRA 5KS9E 1NUFA 4KVCL 3NIGE 3D39D 4UOW0 4XGZA 4XAWL 1T5WB 3RU8L 1BD2D 5C0RL 4DW2L 1IGCH 4D0DB 3MBEA 1NGXA 5JXAL 1GCFA 3OKKB 1I1YA 3UBXG 4OZGA 1IZKA 1V7NL 1UH4A 4NFCA 2H26A 4U3CA 1EERB 1B0GA 3K0WA 1F6LL 1GZQA 1PQZB 5K9KA 1OAXL 3OXSB 5EOTB 3GSOA 4XVUC 1NMAL 5F9OH 1PBYA 4GSDL 2VABB 3TT3L 4TSCH 1N7MH 4Q9QH 5DUMH 3NFSL 3GNML 1FLRH 1N6UA 1JPGA 5DQJA 4NYLB 2J1KA 5J89A 2RB8A 5C0JA 5LGHH 2BY3A 3QCTL 1JRHL 4MA8L 1FFOA 1U8JA 5L2JA 1JGVL 2HN7B 2OI9B 5C0BD 3EYSH 2V9QA 1WEJH 4MCYB 3IU3B 4YGVB 1A14L 1NPUA 4O2CA 1Q0XL 1VFBB 2ATKB 5FKAB 4LFHG 3GBNH 2DLFH 2KQMA 4PLJD 1DQQB 2ZSWB 2A6KA 4R4FH 1HXMA 1CLYH 2Y5TA 1NGPH 1C12A 4FHBD 1B4JH 3F7RA 4OB5L 5I74C 1PW3A 3BRDA 2VH5H 1U91B 2WWKO 1YEFH 4XC3H 1AGFB 4TTDC 1UM5L 3LKRA 3T04D 3I02B 5CINH 1FGVH 1ZHLA 4ISVB 4NZRH 3RGVD 2NX5E 3RWHA 2BDNH 3P73A 2FR4A 3DETD 4NZJA 4XNUH 3I75A 1R5WA 2BOCB 3QI9A 5EIIA 1NCAH 3MRHA 3FOLA 4QRRB 5DJXA 5E8EB 5BV7B 4HEME 4HXAL 3MRIB 3BZEA 2YPKB 2Y1VA 4PGDA 3L3KB 4QWWC 3OHXA 4G9FD 4GRMA 1Z3GH 2YD5A 1T66D 1U3JA 1HOCA 3BDBA 1KJ2L 3ARZA 2IF7A 5I1LA 1E4XL 1UWEH 3FQWA 2R1WB 1S7UB 3MROA 1J9CT 5GGTL 5E2VH 1OPGL 1HINH 1FNSH 4TVPD 2QHRH 3VA2C 3KGRA 4LRNH 3NN8A 4XP1H 2H32B 3PGDA 1P7KA 2R1YA 3QRFM 3OWEA 2QSTA 4O4YH 1HH9A 4TVSa 1DN0A 3BI9X 2CKBL 2IJ0C 4NHCH 2CLVA 1RHHB 2X70B 5BQ7B 1QACA 4D94A 4GW5A 2MWCA 1U8KB 3V95A 5I1IH 4N9OB 1K5NA 1KCRL 3UYRH 3MRDB 4I0KA 1IT9L 3G9VA 1BWWA 3QG6B 4EI6B 1RULH 1AH1A 1MQ8A 5ESVA 3T1FB 1AC6A 4PRDB 4RWHA 5DHYB 2JK5A 3X11A 1WZ1L 2X6MA 2GJZB 4HIEB 5D7IB 1YDPB 2BVYA 4WFED 1H3VA 4JKLA 4P2RB 3PWUB 4PRHB 3HC3H 3EKCA 4WGWB 4LPVA 1PJ9A 4N5EC 1AGCA 3UPRB 2FZ3A 2ZUVA 2BHZA 3Q48A 2XG5A 2FGZA 1HNFA 5FYJH 4LU5L 1S8DA 3IKCB 1DUZB 2M2DA 4MD0B 4H5SA 3S5LG 3FRUA 1HEZA 1MHEA 5J1SC 3P0YH 4CMHC 3RVTC 2FD6H 2Z91A 5EU6E 3BDYH 4XVJL 1M4KA 5EOCH 3KNBB 3P11H 3HZKA 4NQXA 2PYEB 5KSUB 1UYWL 3CZJA 4DOHE 1FLTX 1EFXB 4OCNC 1INEH 5D5MF 4ORGB 2YRZA 5KS9B 4JM2F 4NQCE 3EO1B 4CMMB 2CUHA 5AZ2L 5HHPB 4KRLB 4ZTPH 3U9PH 3WFDH 3ZE1E 4TSAL 2YWYA 1FCCA 4RFNC 4K55A 3AGVA 4YX2L 3DGGB 2OMBA 4LLDA 1G7IA 1XCTA 2FSEB 3X3FL 3H0TB 4LSUH 1GGUA 3C09B 2HTLD 3WLWD 2IFFL 3O8XA 5JZ7C 3K74B 2A77L 2C7UA 2VXSL 3PWNB 4M3KB 2VISB 3UJTL 4OZFA 1VPOH 5E70A 1G1CA 5AZEH 1DN2A 1IILE 5D1QA 1EEQA 1UM6H 4KI5F 4PJGA 1GH7A 5D72H 3O11A 5DDHA 4N9GA 5HHXL 2X10A 4YLQT 3PL6D 5ERWA 4MHHI 2B1HH 3RZCA 3TCXA 1G9NH 4P2QD 3S3JA 1MCWW 4XPFL 1A2YB 1YEKH 2QKIB 1FGNL 5D70H 2AEIT 4JPWH 5C0NC 1INDL 2Y6SC 3FOMB 2Q8BH 1KIQB 3W11C 1V3LA 3ISWA 1HH6A 4IIQC 3ZYJA 3PIQA 4S1RH 2GUOA 5J7CC 5C0AA 4G3YH 4MNGE 4G6AD 1AO7A 3TN0D 4KAQL 3ZDXE 1PZUB 3QDGE 4N68A 3BP6A 2PO6C 3TWCH 3FB5A 4QF1A 1IE5A 4JPVL 1PG7W 4Q9BA 5IF0B 3JVGA 3V4UL 5M94B 5A16B 1FDLL 4X6DE 4L8BB 2WBJB 2IEPA 3VCLA 3FQTB 5CIPB 3TBTA 5I18H 2D03H 2DWDB 1VGKA 1YJDH 3GSQA 3QQ4B 1H3PH 4RGOL 1FO0A 4Y5VB 2UUDH 4YZFF 3L3OB 3QUXC 3DSNA 3HG1D 3CVIL 2E9WA 1LO5B 4CKVX 3KPPB 1UM4L 2NX5B 3VXMD 4KQ3H 1EHLL 3MRGA 2VLMD 4Z7UF 2Z92B 5DZNA 4HPYL 1HHHA 4X8JB 1BVZA 3GHEH 3QJHA 5CFHA 2D7NA 5DVLA 5BRZA 5KVMC 4ZUWA 3T09A 5ITFA 4QT5B 3WLBA 2DQUH 4LCIH 1ZS8B 4FQPA 4R3SB 3WDJA 1ZANH 2GFBA 3FO2B 1YQVL 5KOVC 5DD0H 3MA9L 4HF5H 5D9SB 3IRZA 4NUGL 1MOEA 1P69B 3QG7H 3QDJA 1UVQB 4NC1C 4PRPE 4OLVH 3ARBB 1JPTL 1K4CA 3HLAB 3Q1SL 1CD0A 3TA3D 2BRRH 5GJTH 2Q3ZA 2Q86B 4OFYD 5EOQH 5T1KB 1OSPL 5F8RC 2DIAA 4WFFE 3QEQD 1OVZA 2YPLB 5HHQB 1F97A 3V9FA 2ESVD 4RFNB 5CEZE 3SDAA 5TQ2L 2W9DH 4CVZA 4OFVA 3GMNB 4HT1L 4NQVA 1OTTC 1MCOL 4YHKL 3R8QA 3DXAD 5JOFA 32C2B 3O9WA 5HGBB 4Q74A 2VLLB 1R3JA 4LIQL 2LU4A 1QFWM 1F6AB 2EDWA 4ZPVB 4ZSOB 4XNZC 4PJBE 3ECBB 1I85A 4KRNA 35C8L 3SCMA 3CFBA 5C0CA 4NRXA 3L1OL 3VRJB 2HFEA 3OXRB 2XPGB 3V6OE 5F7DB 2IQ9L 2BJMH 5D7LE 5EC1A 4IIQB 3QT2A 2ARJQ 3GB7A 3BP7A 3RWFA 4XXCA 2ORBH 5HHNA 3STZB 1VADB 3D85D 4LLMB 3HE6D 4P2OA 3L3GA 3SGKA 3EYQD 2ZG2A 1NDMA 3OG6B 5EU6B 1BFSA 2W0FB 4NKIH 5E56A 4L5FH 1GXEA 4U0QB 1JCKA 4ONHA 4YBQD 5HI3C 5IJVA 4R0LC 4QY8A 2ERJB 5BCAA 4JAMA 1FO0L 3GMLA 4DOHB 1U2CA 2FH8A 2OTUB 4PRIA 5DURD 2ADJB 1BIIB 5CHNB 1IKFH 4NQCB 5TDNA 1FV1A 3JZ7A 4RAUB 3I50L 2YBRB 5F7HA 4I3RH 1OAQL 2R2CA 3LEYH 2DL2A 4NQSA 1CLOL 4BSWB 4CVUA 5JW4R 1ZT4B 1T5WA 4Z95L 1AXTL 1KTKE 3BEWB 3U4EB 1MIEL 3VGAC 5BW7A 3BOVA 1OP3K 1SEQL 4M7LH 2Y06H 4JFZH 2FWOB 3OKKA 3T3PF 3QCVH 3MV01 4QHKI 1AR1D 4M6OH 2OLDA 1I7UA 3D39A 4FMKA 5HPOA 5EZOL 3QIWC 5I6XB 4JLRA 4UT6H 1PQZA 4ONFL 4X5XB 4HFWB 5EOTA 3LH2L 1HSBB 3QDGD 4R7NB 3VG9B 1RV6X 5ITBH 3UMTA 2VB5A 4Q6IA 3TESA 2VABA 3QAZC 1X5FA 3V6OC 1WITA 1RSFA 4F7TB 4KZDH 2E7MA 3IXAA 1INQB 1WZMA 1IFHL 4LCYB 1QO3B 4WY7H 3EUUA 1TJGH 1ZHNB 4K94H 3RVUD 4YC2C 4MNGB 4MWFA 5D1XB 4AEHH 3DMMC 5FFLA 2R2BB 2W0PA 2WW8A 5T5FH 3H9SD 1Z9LA 1K3ZA 2RHEA 3N1FC 2HN7A 2UY6A 2BMKB 2AK1H 1U3YA 1MCWM 4X6DB 4MCYA 1BECA 4YGVA 3HZMB 3GSNB 2I26N 4J8RA 5E08H 1MVUB 4FG6D 1Z6JT 4F37F 3EW3B 1T7YA 1I8LC 1WF5A 4G6FB 4Y4KD 4ENED 4XNZB 1XGQA 5D7KD 1DQQA 4OIIH 5GGQL 4Z7VE 1BOYA 2ZCLH 4Y4FB 2FCBA 1QHOA 1U91A 3OJVC 3OX8A 4MAUL 4XX1G 1ZV5A 1AGFA 4U6VH 4XC1H 3B9DA 3RL2B 3I02A 3QDMD 4MYWB 1Q8MA 1QBAA 4ISVA 4ETQB 5E94B 2I9TA 4H26B 5CKAA 1C08B 1XF5B 4GXUN 5JORB 3JV0A 1NLDH 4U6YB 4QRRA 1NSNL 3T2QA 5E8EA 4R90H 1J7VR 4KVNH 4WFFD 4IRZH 4X5WB 5DHVA 3MRIA 2BSSB 2YPKA 3L3KA 3C2AL 4PRPB 3NAAH 3RGVA 3QR2A 1DE4A 2CRYA 4U1NA 3AY4C 1CYGA 4P9HH 2X1QA 3NZHH 4LEXL 4ERSL 3G6DH 5FO7A 2YKLL 1REIA 4WI6A 5E8NA 4P4KC 3F7VB 3DLQR 2R8SL 5FUZH 3WNMA 5E8DL 1BJMA 4XVTL 1P4IL 43C9B 3DO7B 3GSWA 4G9FA 3RUGF 4LKXA 3CPLA 5GGSB 4OF6A 4QYOB 4JANA 3EDEA 4G8IA 4D0BA 1LO3H 4IMKC 4L8DB 3UJIH 2A6IB 3VGAB 1ZE3C 1DVFC 4F7PA 3HAEB 3HB3C 5A3ID 1RHHA 2X70A 3DYOA 5BQ7A 3ZT5A 3OF6A 4F58L 3TNNB 5BS0E 4RA0C 1QQDA 2JELH 4YHLH 4UTBL 4W4NA 4M62L 3TYFA 3MRDA 4PJBB 3QG6A 3QIWB 1A4KB 3HE7C 4L4TE 1UQSB 3QQNA 4GAJH 4H8WH 2EKSB 4HK0B 4PRDA 1FH5H 5I73C 5DHYA 2GJZA 1OQOA 1YEEH 2NY1D 1GJIA 1YDPA 2AEPH 5FECA 4I18A 2ED8A 3PWUA 5HGGS 4PRHA 5D7LB 1X3DA 2J8HA 3U7AA 1JZ4A 4U1SB 1WIUA 4U2ZA 4YC2B 5B38A 3S35X 4DCQB 1YEGL 3BGFB 3DMMB 3V6FB 4RMSA 3IKCA 1DUZA 2DLGA 1PEWA 2EXYD 1F4AA 2JF1A 4K8RH 1RJLB 4I9WD 4XCFH 2HRPL 1ZAGA 3V4PL 2IADB 2AJYL 4JKPL 3LKNA 1A7OH 4YHOL 3DSFH 1OARL 4MS8C 1QLFB 4U1IB 3RWGA 3KNBA 3OG4B 1EJ6A 2X5PA 4X6FA 2RFXB 2J8OA 2WLYA 1NGQL 2DD8H 2XZCL 5I1KH 2PYEA 1I9RL 4Z77B 1MY7A 3HNVL 1EFXA 5DD1L 3MMEA 4AT6B 4RMVA 3H6JA 5KS9A 4PBWD 1TVHB 1C1EH 3B8YA 5KVDH 3ZSSA 1AQKL 4K7PH 4WRLA 4P0DA 1KOAA 2X09A 2IGFL 5KVEL 5K9OB 1AHWA 2ADGB 2ADFL 1MVFA 1S9VA 5C9JA 4WWKC 4D9LH 5BV7H 4BUGA 1XCQB 1AGBB 3DGGA 1RZGB 4O2EB 1GOHA 3H0TA 3RWDB 4GRLD 3MRKA 5CGYD 1TZHB 3PWNA 2VISA 2EH8L 2YD2A 4IOFD 3O2DH 5CKGA 4PP1C 5IQ7L 2C9AA 5D2NC 2QHLA 5GPRA 3GMOB 5D6DC 1JUFB 2VITB 4JQXC 4WHTB 4DUXA 4PLKC 3RL1A 1A2YA 3RJQB 5CMAB 3ZT7A 2H32H 2QTEA 1MFBH 2VDQH 3SDCD 3SDXF 4IDJH 3I6LE 4HEPG 4MA7L 1RFDL 4GXVH 3PL6A 3X12B 3DNKA 1T5XB 1TJHH 5TE6L 4JZJB 2VDKL 2VDOH 4TVPL 1DVFB 1LEIB 3VGDA 5GS1B 4BH8B 1NC2B 3A6CH 4GKNA 1CD1B 5CZXD 3O6KL 4G6KL 4NUJA 1RQ5A 4GW1B 5A16A 1WVZA 1CZ8H 4L8BA 2DI8A 2WBJA 4UI2A 4QKXB 5B21A 5I16B 2ITDA 3HE7B 3U30B 4IRJD 4JVWA 3QQ4A 1RURH 2BX5A 3TO4C 1KB5H 4Y5VA 3G08B 4F7MB 2DQDL 1BVLB 3O81A 3BVNB 2AQ3A 3KPPA 2AEQL 2NX5A 2WP3O 1FL5B 4O02L 3T0BA 2Z92A 3VXOB 3PUCA 3VH8A 4FNLL 5F89B 1O7SA 2VMFA 3BP5B 3HG1A 4JQVA 1CE1L 1SVZA 4QT5A 4O2FB 1ZS8A 5AYUL 3EOAB 5I1GL 3VXMA 5ICZB 1ROWA 3QUKA 2PTUA 3FO2A 1CBVH 1WICA 1A9EB 1QSEB 1A1OB 2X9WA 2B1AH 4NP4L 1TQCB 3WHE1 1UVQA 2VZ1A 3KXFE 3ARBA 5CILL 3HLAA 1EDQA 4RISH 4I3SL 2IC2A 1MFCL 4XBEL 5EOCJ 1BM3H 1MFDL 4XNQB 2G9HB 3CFKB 3UO1L 3N1QC 2Q86A 1BWMA 3QIUB 1BLNB 1KJVB 2R0LH 1MWAB 4BZ2L 5HHQA 3D18A 4N0CC 5BS0B 2VR4A 2FNBA 3TA3A 4GW4A 5MP6H 4DK3A 4HJ0D 5DEGB 4ODSH 3TV3L 3HC0B 1H3GA 4L4TB 4U4BA 1DQLH 4YEEA 1NFDF 3ELAT 1ZWIB 4QXGH 1F6AA 1L7TH 4LAQH 3VD3A 4Z18A 4FMFA 5JR1H 1CFSB 3FO1B 2D9CA 4OKVB 4OT1H 3B9EA 3DXAA 5FA3B 1CDGA 2I5YH 2VXTL 5IUSA 3VRJA 2IG2H 5D93B 2J88L 1A7BA 2MOVA 4Y4HC 2XPGA 1S7VA 3FMGH 2EDOA 4XI5D 1U93B 4MD4A 3STZA 1OGTB 4B41A 1VADA 4LLMA 3ARGC 2ZJSL 3WKML 5HGDB 3ZE2F 4Y16D 2OP4H 4ETYA 5EU6A 1JTTA 1UKQA 5CIPH 2Q7YA 2W0FA 3KYAA 2FIKB 2Z8RA 4HS6A 3BPOC 5HTSA 5E4EC 2NY6D 3TJEH 4GMSL 3RTQC 3S88L 1E6JH 1GGCH 2YUWA 2J6EL 5I75B 4J1UB 3D85A 5JMOC 3HE6A 4Y8DC 2ADJA 1BIIA 1YEJH 4NQCA 1JGLL 3KYOA 3TO4B 3GRWH 3QISA 5SWSD 4RAUA 4APQB 2QQLL 1OP5H 1FN4A 2V7HB 4PRNB 2X1PA 4HBCH 1UXWA 4FQ1H 5L88L 4BSWA 3T08A 1ZT4A 3BEWA 4Y19D 3U4EA 1I3GH 2XNAB 5C6PB 2XN9D 1A3RH 3LHPL 4KTEL 3MJ6A 2FWOA 1DBBH 1IQDA 1YZZA 5H2BA 1F4HA 3I6LD 5H94B 3FQRB 5GS0D 3GSRB 5INCB 5D5ME 5C09E 5IIEB 4HFWA 3ARVA 2NW2B 1YPZF 1HSBA 2X4SA 4R7NA 5IOPB 5K9JL 1RZ7H 2PTVA 1QR1B 1DUYB 3MV9E 3Q3GB 3MACH 4F7TA 1JWUA 1INQA 1WWCA 4CJ0A 4LCYA 4TUJB 2NY7L 3QZWG 1NDGB 1ZHNA 3M1BB 2NXYD 1Q72L 5EBMA 1BAFL 4QXUL 7FABL 3QDGA 4J7RA 3QEUB 4K3JH 2DKSA 3OKYA 1IC4H 4XMPL 4BQCA 2HMID 2BMKA 4Z5RB 4Y1AE 4FS0A 1WC7B 4KJWC 3GSNA 2CIIA 4KI5E 5EO0A 3UTTD 1MVUA 2W65B 3CJJA 1F58L 2BNRD 1T0NB 5TPWL 2XWBA 2EDNA 3CDCA 4OV5B 4J3VA 3GMQA 1AI1L 5EC2A 5F88B 3P2TA 4CDGC 1ACYH 3U4AA 4XP4H 4Y4FA 5LJYH 4KJPD 1EO8H 4NNYB 1RIVL 4J3OC 3F6LA 3T2NH 4Z76B 3WO4B 1DDHB 1FVDA 2XFXA 4LVOB 4W81A 4Y4KA 1GGIL 1QFWH 4ETQA 3KXFD 3KLAA 3VDCA 3CSBA 2R0ZL 3AU1B 1XF5A 4BA8A 1KFAH 4P9MH 3NA9H 3ARGB 5JORA 1MELA 2APXA 1IAKA 4U6YA 4XPGH 1OAZH 4FQHB 4NWUH 1A02N 4UV4L 5I8OH 5I9QC 4LSTL 4HS8H 2P5EE 1FNLA 2VXVL 4JFDD 4L1HA 4X5WA 5E03A 2BSSA 3QDMA 4YDKL 3BPOB 3AB0C 4F9PA 5E4EB 4PGBB 3RTQB 4PRPA 4MX7B 2DQJH 4KY1L 5D71H 1A7NL 3QXUA 4YZFE 4DKEH 4U33A 4NO0B 3RVWC 4JQIL 5D1ZC 3T0WA 3MODL 4JFPA 1Y18A 5IFHL 4BYHA 1U8NB 1MNUL 2FH6A 3F7VA 2DOCA 5GISL 4Z7UE 1NUGA 3DO7A 4JKKA 2E6JA 4QYOA 2F74B 2A6IA 2J4WH 1KTLB 1LE5B 1PAMA 4EXKA 4AG4H 1L7IL 3KR3L 2XICA 3KJ4C 4P23B 5J3HC 2AK4E 4OCYL 4PB0L 1ES0B 1UQSA 4HKJB 3W39B 2EKSA 4HK0A 3HTLX 3TVMB 4KROB 3C5ZC 4YHIB 2WINB 5C08E 5D7LA 3HNTH 2KQNA 2R0WL 4C58B 3FQXB 4U1SA 3BAEL 1I8KB 1PZ5B 3WIFB 2VE6B 4PJAA 4EIGB 4DCQA 5MI0C 3RU8H 4HXBH 2AJZB 5CJ8A 3MRJA 1RJLA 5LXGL 5JXAH 3D2UD 3VRIB 2ZUUA 1MCLA 5T3ZL 2IADA 4MAYB 4GKZB 4HD9A 1J87A 4XCNA 3GJFB 5MEOB 1CE6B 1V7NH 3KG5A 4HBQA 3FN0L 4Y0GA 1KCLA 5JPMA 5C8JB 5DK2B 2GTWB 1RK0A 1R3HB 4BM7A 1W8OA 2V5SA 4Z77A 3UTPE 5C6WH 1OAXH 3WFHB 1BEYH 1J1PL 4WW2C 4XHJC 3ZLQC 4ZAKB 3ARPA 4Y8AA 2ICEB 4MB4A 3GNMH 2Z31D 3MRPB 5IHUL 5TE7H 5K9OA 3RPKA 2ADGA 5FDWA 3VFUB 2DYPD 1D5XB 3AXLB 3QA3A 1BZ7A 4UBDD 1XCQA 4ZOCA 1XEDA 1FSKC 2M1KA 4CNIA 3RWDA 1I7ZB 4L4VD 5I9QB 3STBA 4PRAB 1PG7H 5D5MB 5C09B 4JM2B 4QXTB 4J3XA 3MV9B 3RRQA 3HAEG 4K3DH 3BWUC 3GMOA 1UACL 2AJVH 3FL7A 2VITA 4JREC 2VLJD 1WV7T 3QCUH 1G7LB 2QQKH 5D1ZB 2OZ4A 4OB5H 4JM4L 4YFDB 3LMJL 4BZ1H 2ZUYA 1LE9B 4QRTB 5CJOL 1RZKH 4KKAC 3HAEH 3W82A 1UM5H 2CXGA 5FCSH 5CEXB 1G6RB 3T3PE 1T5XA 5HGAB 4Y1AB 4JZJA 2D2OA 4OCMC 1KN4L 1VENA 1P1ZB 5GS1A 3RPIB 1LK2B 4PJCF 4BH8A 2WM0A 2AQ1A 1CD1A 1EBAA 5E5UB 3BPCB 5D8JL 4GW1A 3VGEA 4HXAH 2FO4B 3LDBB 3MNWB 1R5VB 2C4XA 4ZD3H 3KPSD 3VGHA 1N8ZB 4Z7VA 1BGXL 4C56E 3AS1A 1RZIB 3DROA 5CD5D 3QFJE 3G08A 4F7MA 2P5ED 3C5ZB 4AQOA 1BVLA 5FB8B 3SE3A 2JJUA 1VFAB 5HDQL 2C3VB 3WLWC 4F9LC 1CL7H 2VXUH 4KFZC 4PUBH 3RNKB 3WUWG 3TPKA 4W6XB 3EZ8A 2W9EL 4IRJA 3VXOA 4ZO9A 5EA0H 2JTDA 1FYHB 4GRWF 1U6AL 1X4YA 4H20H 1AP2A 2AXFB 3CH1B 1MEXL 5F89A 3BP5A 3J7HA 2CKBH 4O2FA 2RCSL 3RDTB 3EOAA 5ICZA 3VWKD 4U3XA 3B9KD 3IAPA 1KCRH 4G7VL 2VZUA 1IT9H 2D31B 4BK5A 1MAMH 2CRZA 2HKHH 3G5YA 2V9RA 1PEZA 4PJIF 3C8HA 1IKNA 1WZ1H 4Z7UB 4U31A 4LCWB 2E7CA 4G6AC 3TN0C 1NMBL 3NMEA 1QPXA 4XNQA 2G9HA 3E6HB 1K4DA 3UZEA 2DQFB 3QIUA 4HH9B 4P59L 3TF7C 1BLNA 1KJVA 1NCWL 5IR1A 2O5YH 5EO1B 1WUNT 1RMFL 3NCJH 4HUKB 5BS0A 1VGEL 4X8XA 4LU5H 5FGRA 3LEVL 3OB0K 3BN9D 4UMGA 3IU4L 5DEGA 1FSKB 2AK4B 4MQXD 3HC0A 4L4TA 2ZG3A 3HS0B 3MV8E 2LV4A 1LVEA 4JFXB 1GHFL 2BNQE 3MRFB 1W0YT 4KH2A 5BVJB 3G5VB 4HKXB 5C08B 2ITCB 5CCKL 4G9DA 3H2WA 5FA3A 2YWZA 3OAZH 1T89C 4QHNB 5JQ6H 1RJYA 3SO3B 5I1DB 5K9QG 1MAKA 1TITA 1YQ2A 5D2LF 2WIIB 3EZJB 1U93A 4L9LC 3UTPD 4MNHB 2CIKA 1OGTA 3LVEA 1XGYL 2AKRA 3D25B 5GS2D 2QLVB 4TSAH 1N6QL 1QFUH 1YMME 5HGDA 4R26L 1J8HD 5HYQA 4X99B 3X3FH 1YNTB 2FIKA 3O2WH 4LNVA 3QUYD 1EO7A 5C0EA 2NXZB 3EGSB 2OYPA 1FYTE 3U9UA 3NCMA 4LP4A 2VXSH 1OOAA 3UJTH 3BKMH 1OAYL 3L3DB 1SY6A 3T4AB 2R2EB 4Y16A 1F4WL 1RUML 2P47B 1T1XB 3EOTL 4APQA 1FGNH 5C3LD 5I1CH 3MXVH 3RIAK 3V5KB 3QIBD 1DFBH 3VFVB 4L3ED 2XNAA 2C3WA 3GDBA 4V2BA 3MZGB 3RWEA 5DWUL 2ATPB 2NYYC 1FZKB 4FTVD 4WGVB 4JPVH 5I1AB 4O9HL 1U8QB 2P49B 2XZZA 2XN9A 2M8XA 4YPJA 3TIEA 3UC0L 1IARB 5IIEA 1ZGLM 5EORL 2MNUA 2NW2A 4WWID 5IOPA 3FKUS 1ZVSB 5HDLA 1DUYA 4S0TD 3O6LL 4H25B 1D9KB 3BUYA 1MWAH 2VERN 5LAXB 1CVSC 5F9WB 1P84K 1NDGA 4YBQC 4PY7B 1FFNB 3M1BA 1DQTA 1VHPA 1EHLH 4G43B 5TF1L 4JKMA 3QEUA 4EEEA 1RHFA 1KPUB 3WFZA 3U7WL 3F58L 1Z9OA 1WC7A 5FV2A 3NH7H 1ZGLB 2NLJA 1MCCA 1G84A 5AUMA 5F9JB 4LPTA 3TYGH 4C56B 4YGAB 2VC2H 1T0NA 1UENA 1KELL 2D7OA 1CGYA 2DS4A 3QFJB 4OV5A 1A7PH 4WEBL 1QSFD 4NUGH 2XA8L 3U7YL 5F88A 1EK3A 3SDXE 1EEYB 1GIGL 1JPTH 1MCNA 1EUTA 4UQ2A 2O61B 3DVNA 3Q1SH 3FN9A 4NNYA 5F1OB 1AR1C 3MLPA 2BNRA 1MHPL 4Z76A 3OAUH 4HCRA 4GS7C 1T0MB 3MJ7A 3RZWA 5E5MB 1JJUA 1J88A 4KC3B 4JRXB 4Q97A 4HG4K 5T1LB 5TQ2H 1XT5A 4FQHA 4CN6A 1GGYA 1UB6A 3MLUL 3O4OC 5FYKD 2OMNA 5EBGA 1DLHB 5TDPA 5DJ0A 2X7LB 4PGBA 3KXFA 3PQYE 4MX7A 3RVUC 4LIQH 1DQDL 3V6ZB 2Z8WC 2A0LD 3GI9L 3ULUD 5AG8A 4NO0A 1TZGH 4E41D 4P5TB 5FM5M 4XP6L 3DYPA 3ZYOA 35C8H 1IRAY 2D7TH 5ADPL 5JIPA 4FG6C 1JGUH 2IQ9H 5DEFB 4Y4KC 4NZUL 4M93B 4BK4A 4ENEC 5T3XE 5IFJB 5C0IB 3QXDB 1KTLA 1LE5A 3TIDA 5LCVH 1AGDB 1D7FA 3MV8B 4IDLA 5HGHA 1J0KA 4QTHB 3S9DB 4M8QB 4OAWA 3R1GH 2NY5L 2BNQB 3NPZB 4FP8H 4I0PD 4P23A 3CMOL 4FXKA 4GG6A 1JNHB 1CDIA 2H1PH 1OSZA 1ES0A 1XIWB 4PTTB 4HKJA 5ECJE 4F9PC 4S1SH 5FF6B 3W81A 2BSRB 4G80A 5SWQB 4PJ8B 4P5KA 2FATH 5IBUG 3RUGB 3UTOA 3TVMA 4Z7OE 4WO4B 2ED9A 4M43L 4AK1A 1SBSL 2WINA 4PV8B 5GS0L 4X9HA 3C08H 1FYTD 5L8LB 3DV4B 3K2UH 2B0SH 3BSZL 4KUCF 5AEAA 5IMKB 3ROLB 1TPXC 3FQXA 3SE9L 1OAQH 1PZ5A 4YE4H 2VE6A 1BX2A 3IFLH 5MHSE 2F54D 4F2MA 5E9DD 1CLOH 1YMMB 1WBYB 5IB4B 5EFIB 2AJZA 3AS0A 5M7QA 4UDTB 1MIEH 4DGIL 1TXKA 3VRIA 1OP5K 4DVBB 2IALA 1NFDE 1JV5A 4BFIA 1P9MC 1OGAB 1YNKL 2PKDA 2YRPA 1NGWB 3P77A 4GKZA 4KK8D 4MAYA 1UCBH 5FXCH 1MFAL 8FABA 1UXSB 3GJFA 2NY2B 5MEOA 4LSQH 4JVPA 4V1DE 5DVMA 4JO1L 3KYKL 2GTWA 4NT6B 1R3HA 4RMTA 4ONFH 3VXUE 3D2UA 4H1LB 1QNZL 1MCSA 3LH2H 3Q5OA 1JZ3A 3WFHA 1KCVL 2Q87A 3TNMB 5A3IC 5SWZE 4G6JH 3RX5A 2XTJD 3HA0A 3QHTC 4H88L 5IEHB 5KSAB 4ZAKA 2GY7B 2GK0B 2VZ3A 1OAUH 1IFHH 2ICEA 3ARDD 2CRIA 2FBJL 2P45B 5FKPB 1KTDA 5JW3H 4GS7B 4XB8A 3WL9B 3VFUA 4KHXL 2F19L 1D5XA 3AXLA 3W5NA 3VI4F 5A2FA 3Q5YA 3DHJA 1FHGA 4LRIC 4Q0XH 4G8GD 2NY1C 2QADD 1I7ZA 3D0VB 3MCG1 4Q6YA 1P2CA 3T0ED 1ULVA 5GSRB 4JM2A 2OM5A 5T1DH 4ONOA 5I1HL 3DUUB 1G1YA 1MCEA 5EZLB 3K8KA 1KULA 1ITCA 1QFOA 2HYMA 4XVSL 2EXYC 2DKMA 3MLRH 4ZNEA 1G7LA 5GGQH 2VDPL 1M7DB 2A6DB 2X9YA 4J6RH 4P3CL 4YHYC 1QBBA 3C5SA 4MAUH 4QOKE 3JTSA 5C2BL 5CEXA 2V7NB 3S96B 1QEWB 4Y1AA 4PR5B 3CX5J 5HGAA 5E2UH 3HI5L 5ABDE 1ZKAA 2PTTB 1P1ZA 1LK2A 1RIHL 5E6ZA 3BPCA 3L5XH 1D5ZA 2VWEE 4OBSA 1JP5A 4DTGH 1ZMYA 3I9GH 2VXQH 2FO4A 3MNWA 4CU7A 3U4BL 1YPZE 1T2XA 1N8ZA 3SDXB 4GG8A 3WEXB 3SEPA 5GSVA 3WBDA 4WUUE 3QRGL 5B39A 2EH7L 2V2WB 1WAAA 5FB8A 3JWOL 4P49A 4KXZH 3SOBL 4Q2ZB 2IPTL 2C3VA 3L5WA 2DQTL 1A7RL 4GRLC 5GHWH 3PQYD 1GOFA 3RNKA 4R7DB 4FQJH 1YMHB 5E8DH 4XVTH 1P4IH 2FDBP 1S9WA 4LDLB 3BIKB 5E2JA 2AXFA 3CH1A 3BJLA 4ZFFA 3GJFH 5C2UB 2P5EA 1C5CH 4OZ4A 2VLKE 5A1AA 2NY0D 4YFEA 1UWXH 2QQNL 5CGTA 4EOWL 4DN3L 2FX8H 1T83C 1JPFA 2H8PB 3MLTB 3SDCC 2UZXB 1II4E 4YUEH 5GJSH 4F15C 4KKNA 1YC7A 2HFFB 1MSPA 1U8IB 1ZLSL 2D31A 5LQBH 5IB3B 3BHBB 3W0WE 2DLEA 1PGRB 4MGXA 1KYOJ 4X6BB 4PPTA 4P46D 5TQ0L 5HHME 2DQGL 2CDEB 2YRLA 3E6HA 1IM3B 5CZXC 2DQFA 1NCCL 1X44A 3MRBA 2X9XA 2NR6D 4QHMB 2YN3A 1ACZA 3CVHB 1XZ0A 3O3EA 5EO1A 4YJZL 4M8VA 1IM9D 3BZ4A 3DRQB 1YEGH 3PWLB 4IRJC 1UZ6F 2EDRA 5DUPH 1LEGB 1EA9C 4KDTC 4AIZA 3LD8B 1D5IH 5E7FA 1L0QA 2AK4A 15C8L 3HS0A 4F33B 4JKPH 3RX8A 3WFBH 5DSCA 4YHOH 4UTAH 5ICYB 4P2YA 4FQLL 5FUOH 2OXGA 1P5VA 1BVKA 2VR9A 3GM8A 5DJ8A 5BVJA 3O3AB 2XZAH 4HAFA 1W72L 1NGQH 1S7QB 3V7MA 3S4SB 2Z0BA 4LPWA 4YEFA 1TENA 4LOUD 1MHCB 3AFLA 5J1TC 4U1JB 4JB9L 1G6RH 4FA8A 2Y7QB 3BGAA 4M9PA 3K3QA 2J5LC 5I1DA 1U3ZA 2Q20A 3CCHB 1A0QL 1W0VA 2WIIA 2IGFH 5KVEH 4U1GB 5DJDA 4LLQB 1NFDB 1TTFA 1KLUA 3ZL4H 2QBWA 3LZFL 2NQCA 5SWZD 3SDYL 4EUPB 4KMTL 1IGFL 4X99A 5F7MC 4V1DB 1YNTA 4NKQB 4KU1A 5DTFB 1KBGH 3VXUB 2YPVL 2EH8H 3LKQA 4OM0L 5BZWA 1MRFH 2IWGA 2P8PB 1J1XL 2R2EA 2VDML 3FFCD 5JA9A 1ZLUH 3DVGA 4K3EL 3S35L 4I8DA 1RJCA 3GK8L 1T22A 3QUYA 3HR5B 3L3IB 3CXDH 3EOBB 1N64L 4NKOB 1JWSB 3JBG7 3V5KA 5L2KE 4G6ML 2VZTA 1T7VA 4M4RA 3VFVA 4FXLA 1Q9WA 4I48B 1XGPB 3MUZ1 1UGNA 2VDKH 4LCCC 2X4NB 4AQ1B 4JY4B 1G9EA 1QFWI 4JY6B 1T03L 1FZKA 2HVJA 3O6KH 4FOMA 3MLYH 2YZ1A 3IVKB 4X80L 4XI5C 3MBXL 4C83A 3ULVD 3H3PL 3WHE0 1A6VL 5E8PA 4R2GD 1ZVSA 1NC4D 1FORL 4FQIH 4WI4A 5CBEA 3W2DH 4QOKB 4H25A 2DQDH 3OPZH 1D9KA 3ZE0F 1A7QL 5LAXA 1H15A 1BQHB 3HMXL 1T7ZA 4MJ6B 2NY6C 4IJ3C 3LQAH 4X7FC 4LARH 1F3JA 1HKLL 4H0HB 4AL8H 1KPUA 4FNLH 3Q6GL 4BQ9A 4XP9H 2N56A 3RA7H 1AGEA 1YPZB 4MCZB 1ZGLA 5AYUH 5I1GH 3OGCA 4C56A 2O26U 3MOAL 5DQDL 1F4XH 4LSPL 4Z78B 4DEPC 4HWBA 2ID5A 4WUUB 2YD3A 3JUZA 1F90L 3BPLC 4NP4H 4A6YB 4HAGA 1EEYA 4JHWH 5CILH 4WI9A 1LO2L 4ZFOB 1ORQA 2MQCA 1I1AD 4BFEA 4XBEH 3ZDZF 1FIGL 2V5YA 2J5LB 1CFNB 1IGJA 1T0MA 3NTCL 1LK3L 2VLKB 1QSFA 1MCHA 1NLBH 3LKSA 4PJCE 2ZKHH 1TIUA 4BZ2H 3NZ8B 5CP3A 1NAKL 5BOPA 4LPCA 3PP4L 5T1LA 3BZFA 4KDVA 3CDYA 4CBPA 4DK6A 5F1NB 3OQ3B 1DLHA 3TV3H 4NDMB 1N0XH 3TEUA 2E5EA 4XHQA 1GPOL 4M7JL 3ARED 3W0WB 2A83B 2AJ3B 5E7BA 4PB9H 3V6ZA 3BQUD 3IRPX 4ODHH 3ALXA 5ISZE 1BQSA 5HHMB 5C0DB 3IAGC 5GGVL 3HC4L 4EDWL 4NZTH 4I13B 2FL5B 4P5TA 4PS4L 4OCWH 1MCKA 4AY0A 4J3WA 2VXTH 4G8EA 2JIXB 3FO9B 1AY1H 3D3VD 2DAVA 1JHLH 4LLVA 3DX9A 1FE8L 3V0VB 1C7SA 4Y2DC 5DEFA 3X14B 1XH3B 2R4SH 5IFJA 3C6LB 3E1F1 4CN4A 1CDHA 3QPXL 4R4BB 5C0IA 3OAZK 1AGDA 3STLB 2HT3D 4NM4L 4B50A 3MV8A 2Y07H 4QTHA 4M8QA 4NHUB 5ADOL 1U3HD 3V52H 2VKWA 2ZOKA 2CDFA 4R97C 1JNHA 1TQBC 5BJTB 2MJWA 3E3QE 1JRHI 1XIWA 4KJQC 4L29B 4PJIE 3CLFH 2J6EH 2X4RA 4PJ8A 4X4MA 5JHLH 1NCBH 3RNQB 25C8H 1AXSB 5BVPL 1P7QD 4I0PA 2IAND 1AKJB 4PV8A 1QBLL 3B8SA 3SDDC 5GGRY 4TUKL 3QB7C 5IMKA 4RNRB 1TTUA 3V0WH 4FN0A 5C07E 2PW2B 1G0YR 4ZQKB 1CD8A 5IB4A 5EIQA 2HJFA 5CD3B 4UDTA 3ET9F 4Q9CA 4LLYA 1OTSD 4KTEH 1FYTA 3NA4A 2AABH 4F7EB 4HZLB 2BVEA 3MCLH 2F54A 2WUBL 3SKMA 4QHUA 2WP3T 3BPLB 5EU5A 4YDVA 4EXPX 2VJXA 4YDIL 3PGFL 5D7JC 5L2KB 5D2LE 5IEHA 5KSAA 5GZND 2GK0A 1IQWL 4X7SL 4LASL 4C4KT 4XXDA 5IKCB 2VL5A 5HHVL 1YNLL 5FKPA 1V7MH 3JWOC 3WL9A 1DQJA 1MFNA 3D87B 5IK3A 3Q6FB 2Q7NA 1T1YA 4QXUH 4RGND 2FO1A 3I3BA 1E4XI 1X9QA 5BZDB 4R6UA 4O51B 1ONQB 4L3CA 5EUKB 5EB9A 5JW5B 4JHAH 3D0VA 3MX0A 1I1FA 1R3IL 2PXYC 4BSJA 4WIQA 4R96B 1LQSR 1U58B 5GSRA 1F58H 4XBPA 5TPWH 5F3HB 4N0YL 2HWZL 5FYKL 3L3JB 1ZEAH 1AI1H 4G42B 1RK1B 1NBYB 3WNOA 1MFEH 1JF1B 1OD9A 2YN5A 4DFIA 3DI3B 2A6DA 1I9JL 3LS5L 3LRGA 3T0EA 1A3LH 4TNVF 1RIVH 2X2YA 2JJSC 4J4PD 1JZ7A 2GJ6E 3ULUL 5BXFB 5DR5L 4FQCH 4M6ML 1X5AA 4Y2DB 1GGIH 3NFNB 3K4AA 4JFHD 4PR5A 2G2RB 3KPRE 4NBZB 4WHYG 2X4PB 4PJ5E 4D8PB 4Z7WF 1Z5LB 5INDA 2FJHA 4URTB 5GZOD 4DVRL 1QYGH 3X3GL 3IDGB 4UV4H 5AAWA 3HZVA 2VXVH 2SEBA 2GITA 4HQQH 1PVHA 4YDKH 1FPTL 1P6AB 2Z31C 4EI5D 3SDXA 5C7XH 3WEXA 3QUMB 4FQXB 4KY1H 3GMPA 4WHYH 3DO3A 2F5BL 4L1DA 4WV1B 4UBDC 1QA9B 1XR8B 2V2WA 1G9ML 2G60L 2Z35B 2IQAB 2J12B 3BXNA 4Q2ZA 5F6HJ 4RQQB 5IFHH 3SDDB 5GISH 4R7DA 4HX1B 4PJCB 4H1LG 4YBHA 1AC0A 4H0IA 4S1QL 4D9QE 2OR9L 5MENE 4UV7L 3CFJB 5HD8D 1NCDH 3IFOA 1WFTA 1MJ8L 3S36X 4JFFE 4FABL 2MFNA 4DQOH 3PQYA 5IBLD 2H8PA 5HYJE 1AIFB 3BYTA 5FEBA 3S97C 3VXRD 5HPMB 5ISZB 3U0TB 4H1LH 1JZ6A 1QRNE 2APBA 4P3DB 1U8IA 3EYUL 1UKTA 4POZD 5IV2B 3RAJL 2ZNXA 4GQPH 1K85A 3BHBA 1JYWA 3ES6B 3P4MB 5K9QI 1B4RA 1AE6H 4X6BA 3OKNB 1BBJB 1PDKA 4GRWB 4AEIH 5FYJE 5D7JB 4DZ8A 2DM3A 2VAJA 4QHMA 2R0WH 5T5NF 2XA3A 3FZUD 1SMAA 4PJ9B 4IBLT 2LVEA 4GLRI 2CR3A 2GTZB 3DRQA 1U95A 3PWLA 1T2QL 2AAVA 1H0DA 1LEGA 1MF2L 3A67L 5CD5C 2B2XL 2FGWL 3IDYC 1I9IL 4L8SC 5T3ZH 5C07D 4GBXD 4PJIB 2PXYB 4F33A 3B4NA 5ICYA 2C4FU 2DQHH 2WQ8A 1IM9A 4Y88A 3O3AA 4N0FB 1S7QA 1PX3A 4NN6C 5E2WL 5IT2H 4Q7DA 5I71C 4MNQD 4U1JA 3RX7A 2C3XA 3KLHD 2AGJH 3ZKND 2Y7QA 1NBVL 3HUJA 3LB6D 5I66B 3VWKC 3B9KC 4POYA 1N3NA 2RIKA 1JTPA 1QLRB 1OCWH 1NFIB 1SQ2N 5E6IB 2AV7B 4LLQA 4MZ3A 3QHFL 1P4BL 1QBML 5HXMA 1SHMA 4AH2A 1X5KA 3SQBA 1FFRA 2VQ1A 1A3QA 4Y5YC 1TETL 1P53A 4LVNC 5E0QA 2IAMB 3E8UH 5KTEH 3JWDL 3MJ9A 4WDIA 5DTFA 1JNLL 3VXUA 2HLFD 1IC7L 4JEGB 1MREH 3GMRA 3OKDA 1KENL 1NMCC 4Y5XC 2YD7A 5SWZA 1RIUH 4O58L 3SY0B 3EO0B 5D2LB 5JW4Q 3OKMB 1QLEL 5FHBL 3L3IA 4JM4H 4MQXC 1HIML 4U6HB 1JWSA 3QWRD 4OLYL 4NQED 1J0ZA 2H41A 1B0RB 1DL7L 5CJOH 3SKNA 3TBVB 2R29H 5DLML 4KQ4H 1A6TB 3FFCA 3F6IA 5DMGC 1MPAL 2NCMA 3MJGX 4OLWL 1XGPA 1JFQH 1QR4A 1HI6B 2X4NA 5L7XL 1ZLVH 5AWNH 4PJFA 4JY4A 4RZCB 5I8CB 2GJ6D 4JN2A 1RUAL 5F44A 3NPSB 3G9AB 1OD7A 5CWSA 2JCCF 1MJJA 4S11A 1ITBB 1JHKH 5D7SL 1CFQB 4E42B 2F5AL 1I4FB 1ZTXL 4JGMA 4OCSL 1T1ZB 4TN9A 3PWPE 3RP1A 5T3XH 5F1IB 3CVHH 1G7PA 3F12B 4JO3L 4QOKA 1U8PB 1IAIL 5LWYL 4F7CA 2R23B 1BQHA 1MI5E 3KPRB 3VI4E 3QBTB 3S4SG 1MHHB 4QRUB 4NSKB 1HYRC 3A6BL 4FQQB 3GEWB 3GSVB 4ONGL 3V6BR 1S7WA 4QRQB 4PJ5B 3GHBH 1NC4A 2ZUXA 2VLRD 1KT2A 2P8MB 5JPNB 1JF6A 2OXHA 1YPZA 4MCZA 4M5ZH 2RCSH 4Z0BL 4NOFA 2OL3B 4Z78A 3ETBF 4G7VH 3MUY1 4WUUA 1XF3A 3QIBC 5EZJB 1QKZL 3F62A 4EUPG 1EXUB 3LY6A 3GJFK 2ZUQC 1JK8B 4BSVB 1H5BC 4NN6B 1UWXK 3WJLA 2Z9TA 4KRPB 5I71B 1FZMB 5SV4A 3KJ6L 5F6HI 3HMWH 2XY2A 4ZFOA 4BQBA 3OAYH 4YHML 1IAMA 3TBSB 5MENB 4YDJB 5IG7A 1CFNA 1KCUL 3FAWA 4EUPH 4RWYH 3VFGL 2RR3A 2VLKA 4JFFB 4P99A 3KPNB 1CG9B 2OX5A 2BVUA 3L9RB 3GGWB 3NZ8A 5HYJB 3UROR 1I1AA 3CXHK 1Q9KB 3MJ9L 1QRNB 2AQ2A 4Y5YB 5F1NA 4LVNB 3FT4A 4NDMA 3QUZD 1MJ7L 3S37L 1TJIL 3IFNH 2XRAL 3W0WA 3SQOH 2AJ3A 2DDQL 4IOIB 3PDGA 4HUXA 4OQTA 5C0DA 2EYTA 1A1NB 4X4XB 5CCKH 2FX9L 5D6CB 3MXWL 1XAUA 2F8XC 3D1MC 5FGBC 2JIXA 1E6OH 4YDLB 1EFQA 3AROA 4QTIH 3V0VA 4OD1L 9CGTA 3E2HB 4N8CL 3D48R 1XH3A 1NCUA 3FO0H 4LSVL 4ODXB 3C6LA 2NMSA 3ALWA 4R4BA 3S5LB 2H6PB 4OUUB 1N6QH 1WTLA 4R26H 1ZT1B 1G0XA 1B0WA 2APWA 2QSCH 4NHUA 4EIZC 5IHZB 2N7AA 3K80A 1I75A 2CLZB 4ZXBC 5TGBA 5BJTA 3MNVB 4L29A 4XCCL 3EYFA 3MGTB 1OAYH 3PWVB 4DN4H 2XI9A 3UJJH 4J3UA 1BFVH 5E24E 2XWJB 1AXSA 3TBWB 3KYMB 1F4WH 1KN2H 4ZS6C 4H0GA 3ULVL 3P0VL 4RNRA 1UEMA 3S34L 4NGHL 2ARJB 2PW2A 1UZ6E 3BW9B 3D5OF 3L5JA 4ZQKA 2V5TA 3HN3A 5IB1B 2Q76B 1C16A 3KPMB 1D6VL 2A0LC 5HY9B 3FHAA 3UDWC 3ULUC 5IB2A 1OB1B 1E4KA 3MA7A 2HP4A 1Q38A 4PYHA 3GKWH 3FJTA 1KC5L 2H2PD 3NABL 5FUCE 1ZGLP 1GL4B 4F7EA 3JV6B 5DWUH 4HZLA 4NJAH 4MMZC 4PGCB 4EVNB 2KZWA 4A6YH 1YECL 1AR2A 2HTKD 1OLLA 3GMMB 3RY5A 4OUOA 5FCUL 1SEBB 3BD3A 1HXYB 3KPQB 43CAA 2V5RA 4KUZH 4TNWF 4GAGH 5L2KA 1NAMB 2A2QT 1JN6B 1UH3A 3CLEL 3QEGH 1G9MC 4HKBB 4PTUB 3WUZA 2JB5H 1H8NA 3OJMB 3PWPD 4YXHL 1ZVYA 5TF1H 2P5WE 3C60D 5BZDA 4O51A 2YUVA 5EUKA 5TFSL 5JW5A 3KWWA 1S5HB 4JE4B 1A6PA 3U7WH 3QWOB 1ADQL 4KTDL 5FYJU 2OQJA 4WFGD 2A1WH 4OQTL 1S9YB 5DO2D 2LVCA 2DWEB 1UJ3A 3QNXA 4OGXL 3O6FD 3QULB 1FNAA 2J2ZA 2EE9A 5I1EL 4WEBH 2FHCA 3DHMA 1NBYA 3U7YH 1JF1A 3MNZB 1MI5B 4KK8C 1A6AA 1T21B 5L9DL 1H8SA 5ILTH 4TTGA 2E7LA 3RKPA 5BXFA 4S1DD 1L0YA 1C5DB 4JRYE 4Z7QF 1F8TL 3NFNA 3KHQA 1ORSA 3O8XD 4WENB 4PG2C 3SHSA 1MRCL 1Q1JH 2XXCB 4UNUA 5FO8B 3GZKA 2Z8SA 1QFPA 1P4LB 2XTJC 4IRSB 5D1QD 1E4JA 3UZVB 1EHXA 4ZXBB 2R69L 3NIDF 3ARDC 4K7FB 4PJEA 3RZCD 2COQA 2E9IA 4N90E 3TBYB 3QUMA 4FQXA 1QVOA 1S78D 4QCIB 5HVHB 4TPRL 4WV1A 2IMNA 3ZE0E 1QA9A 1F02I 3GJEB 3SGEI 3ME0A 4B0MM 1JGEB 4MXVF 2BSTB 2QADC 4RQQA 3GIVB 2EO9A 1T0PB 5HYIA 1UA6L 5ADPH 4W6YB 3THML 4HX1A 1XF1A 2VO5A 1KSRA 3CGTA 1S7SB 1AO7D 2E8YA 3CFJA 1NGZA 1F4YL 3N85H 3MGAA 4NZUH 4JZNB 3TH3T 4S0SD 1UWGL 3CMGA 1YUHB 1CS6A 1AIFA 3NGBB 5KAQG 5ISZA 3U2SB 4HW6A 1EJOL 2HKFH 2CJUH 4P3DA 2YC1B 1MH5B 5IV2A 4OJFL 2A73B 1YN6B 4ZO6A 3ES6A 3L95B 3P4MA 2HJKA 3ZDZE 2ED7A 1WIOA 1BBJA 2LAAA 4NNPL 3N9GL 3VDBA 1SBSH 5E5RB 1B2WH 4OGYH 2FX7H 2FJGB 3LV3B 3V8CA 4GKOA 4FFYL 3SE9H 1S5IL 2ADIB 3UTSE 5BRZD 5DC0A 2GTZA 1CGWA 1I8IA 4DGIH 1J05B 5IESH 4PJ7F 5DZOA 5FOBB 4LBEA 2XQBH 5DD3H 5L0QC 4WW1B 3QDJD 3SBWA 3SKOB 2P7TB 4N0FA 4FZEL 1AJ7H 3SGJC 4ZOBA 5IW1B 2ICWI 4M7ZC 5IWLC 1IBGH 4QHLB 5DRZA 2A9NH 4XH2B 5F7EL 3INUH 5C07A 4GBXA 1KCVH 1KACB 2CUMA 1HHJA 5FO9A 2PCPB 4M7KL 3ZKXC 4H88H 1Q9LB 3B2VH 2J8UF 5DHXB 4KK6D 1GC1L 1QLRA 1NFIA 5E6IA 3SDAD 4UINL 3IS0X 4PV9A 4KHXH 3N0PB 2DBLL 1Q0YL 4RCAA 3O9WD 1EGJH 1DANU 2EDJA 4NO2B 2XZQL 2UZIL 2VUYA 3UBXA 4P46C 3ARFC 3H3BC 2DKUA 5CP7B 1HSAB 4B53A 4F37K 2IAMA 4XCEA 2VDNH 2H3NB 3MLWH 5KJRL 2NR6C 2NY3D 4TQEL 4U1HA 2B20A 2IH3A 2X4UA 3EYVB 5GXBB 4GMTL 1Q94B 1ND0A 2E6PA 3H7BB 5J1AB 3SY0A 5I1JL 5C0CD 5D2LA 4LMQI 3L3HB 4M5YL 3B83A 4WU5A 3BYYA 3CFIC 4XVSH 2V17L 3FT2B 5LGKA 3SE8H 4JFQB 1A1MB 2K9UA 3DURA 4QXWA 1M05B 2VDPH 3DI2B 1S7TB 4GFTB 4OCRL 2NY4B 4U6HA 1E4WL 3C9NB 2P5WB 4LHUB 1B0RA 3SN6N 5IMLB 2MPAL 5JMRA 1A6TA 3IJYB 5CZVH 3ZHKA 4DKFH 3I6GB 3HI5H 4XB7A 4P2RE 4PJGF 2HFGL 5I8CA 2ZSVA 5JOEA 1RIHH 3QWRA 1Q9OA 1FAIL 4PRID 2LABA 5ETUB 3UAJD 1CFQA 4JZOB 4E42A 3MOQA 3O3BB 4CJ1A 3H42L 4GRWH 3S3SA 1N5YH 2HT4D 3WS6C 4UT7L 4EN3B 2OBGA 4MJIE 2GJ6A 3SJVE 5F1IA 2EH7H 4U1LA 1RUPL 3JTTB 4NJ9H 3U1SL 2R2HB 2IPTH 3I85A 4JRYB 4QRSB 1DBKL 1A7RH 2WIMA 4OQ1A 3IAQA 1MHHA 4QRUA 4FQQA 3KDMB 4TULH 3GSVA 3GO1L 4QRQA 1FZJB 3ZO0A 2OR7A 3WE6B 1UADC 2YK1L 1PG7X 5E8OB 3BH9B 2NW3B 4M48L 2BHYA 5EPMB 4ZTOL 4HIIB 4XNYL 2P8MA 1R24B 4ZDHB 4UQ3B 3JWNC 2QQNH 1IAIM 4EOWH 1RD6A 3U82B 3BP4B 1MUJB 3BRFA 4PREB 1EXUA 1JK8A 3GSXB 4BSVA 5IROA 2VLRA 4OZHB 3VFSA 1I3VA 4W4OC 5F96H 1FZMA 3MO1B 3I3DA 1OQXA 5IEKA 1PY4A 4YXKL 5MENA 4YDJA 4NO3A 4KZEH 3PE9A 1NCCH 2D9QB 2OCFD 4GAYB 5F9OL 4GT7A 2VOTA 3KPNA 2IPKA 4Z7WE 3L9RA 3TGXA 3ULVC 4TSCL 3WN5C 5HYJA 3H9HA 4R2GC 4Q9QL 2EIEA 1Q9KA 4K8RD 1QRNA 4CVXA 1FBIH 3ARFB 4LEOA 3CNKA 3PHQA 1CU4L 1PLGH 4C59B 3FRPG 3K2MC 3FCTB 3GM0A 2G5BB 1GZPB 3N1PC 3VRLF 5IP4A 1A1NA 2XQYG 3EYSL 4X4XA 1MAJA 1WEJL 1VEPA 4MVBD 3DX8B 1JYVA 1JHTA 4L4JA 1CICD 3WJLC 3BWAA 3QUZA 4U7SA 1D3CA 4JB9H 3UTSB 3UX9B 5DYOB 2DLFL 2OS7A 1VEOA 2Q8AL 2WWMD 1DCLA 4R4FL 3CIQA 1CLYL 4MB3A 5TH2B 4ODXA 1NGPL 2OTWA 1J0IA 4ZPTB 1B4JL 2QR0B 4QRRD 2MMXA 4OD2A 4OI9A 2VH5L 3S5LA 1YEFL 1CICB 4XC3L 1ZT1A 1N4XL 4ZOAA 5FA4A 5IHZA 1FGVL 4NKDB 4NZRL 5F71A 4YHNB 3MNVA 3T8XB 1FZOB 2DTML 4HWZA 4QGTA 2YPVH 1U2HA 4XNUL 5JDSB 4KMLB 1CWVA 3MGTA 2W59A 5CAYB 2XWJA 4R9HA 2VDMH 3HPJA 3TBWA 1JZ5A 2A74B 4OIBA 3IXTB 5HYEA 3GK8H 4WU7B 3NBNA 1KB9J 1N64H 1B3JA 1FQ9C 1Z3GL 2EC9T 1A6UH 2ARJA 2XACC 3SO5A 3BW9A 2X4TB 3AREC 5J8OA 4RDQF 3DX6B 4G6MH 2XWTB 2ICES 3BQUC 4MA1C 4OGAD 3OF6D 1UWEL 2OL3H 1FG9C 1OB1A 2V9TA 2C26A 5E2VL 1G7QB 1HINL 2EDKA 1WWWX 1LDPL 1FRGH 4LNRB 4I77H 1D5MA 3CUPA 4IS6B 1BMGA 2CUIA 2QV2A 3HI6H 4PGCA 4XP1L 2P24B 1FNGB 1U92A 4MDJA 1NEZB 4OI8A 2YPLE 4XVUD 4X0KB 4X80H 4NHCL 4JFYB 2DQCL 3O4LE 4P2RD 4PRHD 1A6VH 3KPQA 3MQIA 4HIXH 2DI9A 1KPRA 2HT3C 3UYRL 5F93C 1MJUL 1U3HC 1A7QH 4HS3B 1CVRA 3GBLA 4U1KB 4XP5H 4HKBA 3HMXH 1KB9K 3V4VH 4LSSH 1HN1A 4JDZB 4ZSOE 4WFHE 2AJUH 3VXPB 3BFOA 3GIZL 3VFMA 2M26A 4UT9L 1KB5B 3WN5B 4F8TA 2O5XL 3HC3L 1RZJC 1S5HA 3Q6GH 4PGJA 3QWOA 3ZSTA 1BIHA 4PG9B 3VE0B 5DJ6B 3T65B 5KSBF 3M17B 5JQHC 4LGRB 5IB5B 2PYED 3O41B 2DJUA 3PWPA 4OLXL 5I15H 1CXLA 3C60A 4MJIB 1MRDH 1EFXD 5CJXC 3SJVB 4NO5B 3QQ3B 1RJZA 1F90H 2BP3A 2PW1B 4KK5D 1OTSC 3MNZA 1MI5A 3BDYL 5EOCL 3WDHA 1LO2H 5IVXF 5CLTA 1T21A 2AXGA 3P11L 3B6SB 3O3DB 3O6FA 2R8SH 1X5XA 5J12C 4HWEL 5I2IA 2WANA 5I74B 3NTCH 1LK3H 2DRUA 4DGYH 1CXFA 1M71B 5DJYA 1OM3H 3OAYK 2JCCE 3BE1L 2OJZH 5FO8A 5F72S 1SJVA 4QWWD 4IRSA 3VFPB 1ZHBA 2EDFA 5GZNC 2DM2A 3CSYB 1C5BL 5I76B 1FJ1B 5GS2H 1GPOH 5FYLE 2ZCHH 3TBYA 3DIFB 4QHKJ 1UJ3C 4LSUL 3VI3F 4ELKA 2JJTC 5B8CA 5MERB 3EJZD 4PS4H 1JGEA 1VPOL 2BSTA 2QSVA 4IMLA 4LDEB 5AZEL 3O2VH 1UJTA 3REVB 1KIPB 4Z7WB 1GOGA 3TCLB 1EZVX 3IF1A 2B1HL 3EO9H 1T80A 5DRXA 4JFEE 2I07B 4GQ9H 4NC1E 1YEKL 5D70L 3QPXH 4JZNA 4YHPB 1GC1C 4NM4H 2KBGA 2Q8BL 2WBJD 1CDBA 5CBAA 4NPYA 2BY1A 2X89A 4S1RL 3EHBC 4ZUVB 3VGFA 5ADOH 4J4PC 3VFTA 2ZOLA 4HPOL 3L7FB 4N8VG 1YN6A 4JPIB 1NAMH 3WHXB 2F58L 4WJ5A 3L95A 3P30L 2AJXL 3TWCL 3TZVC 3VXSE 1TCRA 5CJQH 1HK6A 5JXEA 2NX5D 3D9AH 2JJVA 1J10A 3RWCB 2D03L 5FDYA 4TUKH 1R3KB 3FQNB 4OCLC 4HIJB 2ADIA 1H3PL 4EI5C 2H9GB 5HDBF 3P3YA 5FOBA 3OZ9L 5ICXB 4X7TA 5J57B 4MXQD 1GSMA 1HYSD 4FFZL 4OV6F 3GHEL 4WW2F 3RBGA 5IMOB 5A43C 5MEQB 3ARBD 3SKOA 2ZUWA 2P7TA 5F7LB 5HD8C 5J4MA 2DIBA 3UPAA 4AENB 4CMHB 4MJ5A 2K7QA 4QHLA 3WXVH 4XH2A 5JUEH 5T1KD 5E2TH 3BMWA 3PGFH 3OB8A 5BMFH 4HF5L 2PCPA 4N1CA 5IBLC 3NFPA 1Q9LA 3DARA 4YBLC 2VQUA 2YPLD 3QG7L 4HKZB 4X7SH 2H45A 4DUVA 1VERA 5HHVH 4POZC 4YAQB 4BZYA 3UCRA 1G7MB 5FM8A 5GJTL 1BJ8A 1GAFH 4FXGB 1MCRA 4NO2A 5KANI 3FONB 3ROOA 3BO8B 3CD4A 3FB7B 3MGOB 5EOQL 3NCEB 4P3WA 1XR9B 1HSAA 3EJYC 2H3NA 3BKCH 4S2SB 1CT8B 3VWJC 3O4LB 1ZA3B 2IBZY 3FZUC 1ZA6B 4I5BB 4HK3J 1Q94A 5E1HB 4HJGB 2VNCA 5FYKH 3LRSB 2P4AB 3FFDA 4FQ2L 3FT2A 1A1MA 3W11D 2WV3A 2R39A 4QGYA 3WFEH 3QZWB 3C9NA 3MRCB 2P5WA 4MXWL 1J12A 1R0AH 1PKOA 3AM8C 4M6MH 1AD0B 5DR5H 5SX4H 5EU6D 3IJYA 2I9LB 5T33H 5GGRB 3HI1B 4I4WB 2PYFB 3I6GA 5A2LH 2MCPH 4HUVB 5I8EA 5I19L 2FJFB 2C1OB 5JIKA 3VGGA 3DTXB 2F8VA 3ZKNC 3X3GH 3BKJH 3LB6C 5ETUA 4NQCD 3O3BA 5DVKA 2ZUTA 4D3CL 1ZSDB 2PO6B 3ZHLA 4EN3A 1OW0C 3V7AG 4YK4C 1YC8A 3CK0H 3WNKA 3P4NB 3TZVB 4L5FL 3FQUB 2F8OA 3W5MA 4MJ2A 2R2HA 4JRYA 3BKYH 1HE7A 3LN5B 2MTPA 2BOBB 4Z9KB 4NNXB 1IKFL 2GYSA 1SYVB 4OGZA 2HLFC 3U0PB 2PUQT 3VMOA 1FZJA 2JCCB 3QUXB 4EZMA 3WE6A 1EAPB 1BREA 1H3TA 3BH9A 5E8OA 2NW3A 5EPMA 4FFVC 3PG2A 1R24A 4ZDHA 4UQ3A 4I3RL 1KGCE 3OMZA 3K8LA 1G7HB 3LEYL 2WUCH 3TJHD 1HDMB 4D0DA 2GCYB 3IDXL 4RRPG 3MRRB 3BP4A 5IJKC 3EYUH 2W38A 1QPPA 3RI5F 2HAZA 3RAJH 3GSXA 2YEZB 4JFZL 3ZMRA 2HH0H 4M6OL 1S3KH 4CADB 1DQML 1QTYT 4UT6L 5D1XD 5FHAH 3OXSA 4JFEB 4NQDE 1T6VN 3BESR 5GS3A 2Q6WB 2R0KH 3HNSH 1FL3B 2NZIA 3VFNB 1OTTD 2YUXA 2EDQA 4KZDL 1A6WL 3HZYB 3REWB 1T2QH 1DEEB 1IGIL 4UB0L 4XAKE 4NYLA 2B2XH 2FGWH