3N9GH

Crystal structure of the fab fragment of the human neutralizing anti-west nile virus mab cr4354
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
230
structure length
230
Chain Sequence
EVQLVQSGAEVRKPGASTKVSCKASGYTFTHYYMHWVRQAPGQGLEWMGIINPSGGSTTYAQKLQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDWGSNYVWGSYPKYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of MAb CR4354, heavy chain
publication title Neutralization of West Nile virus by cross-linking of its surface proteins with Fab fragments of the human monoclonal antibody CR4354.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 50
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2010-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n9gH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n9gH01
5F1KC 3V4VL 4PLNC 3FN0L 1RZ7L 3GSVA 1WBZA 5CKGA 5IJKC 3ARQA 2X1OA 1I8KA 2ZOKA 2DKUA 4XPTL 1BFSA 3QWQB 1G7IB 5HVHB 3H8NA 4KRMB 4HK0B 3RGVB 1FZJB 5FHAL 2DICA 1JWUB 4J6RH 1MJUL 5CEYA 4K55A 4PTTB 3TNMA 3MRBB 4RWHA 3T1WA 2CJUL 1QLEH 3Q0HA 4YHPB 2JJVA 2VYRE 4XCNB 5C86A 3KG5A 1P1ZA 1FE8L 3RL1A 2F54E 1BGXL 3H9SA 1EEYA 3F62A 3QUYB 2MKWA 1MRFL 2E6QA 3QSKB 5L2KE 4Z7WA 4DEPB 1DQJB 1F97A 4PV9B 3PXJA 1OGTA 3S37X 3CVHL 5A2IH 2X41A 3VG0H 1ONQA 4D8PB 4MYWB 3DNKA 1G6RA 5FYJH 4KZEH 2R15A 1P4IL 3LH2H 3QUMA 3G6JF 3RTQA 2Y1VA 4R3SA 2X89A 2X4PB 2Q3AA 5LG1A 4ODUA 5HI5C 1PQZA 1R3IH 3ECBA 2BNQB 2GJ6E 2QLVB 4LLYA 5HHNB 3TVMC 4OCMC 4OT1L 3FO9B 4GAYB 2F53D 1A1MB 3BXNB 1UZ6E 3O8XB 3ZZ1A 4HS8H 4TYUA 2IGFH 2P48B 4W6YB 5DC0A 1A1OA 2AXGA 2Y06L 5ELIA 1QLFB 4Y19D 3O4LD 3QJFB 4WUUA 4P4KA 4K07A 4M48L 4CADB 1BEYH 2VDNL 1XGUA 1ZT4A 1WTLA 3BPCA 5E5RB 4D0DA 2JIXA 2WINB 1S7UA 5DWUH 4N0FB 5MI0B 3PWJB 1B6UA 1T1XB 1NANI 5EZLB 4MQXD 3S34H 4R0LA 5HGDA 4LPUA 5IM7A 1EFXA 3U9UB 1JZ5A 2B8OT 5I2IB 5C0NC 4MJIB 3UBXG 4Z7QE 4OCYL 1U8PA 4LQ1A 4R4NC 4APQA 4N8PA 5D1ZB 5C0FA 2H32H 3L5HA 3ZTJH 1FVDA 3B4NA 5HI5D 1CE1H 1SJVA 5FCSH 4ELKA 1NFDE 3O6LH 4Z95L 3GIVB 4K9EL 4S1RL 5FK9A 3WMSA 5CEZL 5IFHH 5DJ8B 1KULA 1S3KL 3FB8B 1WZMA 4G6FB 5IEHA 1MAML 1YEEL 3WKNA 1ZWIB 4GW4B 1RJYA 5F9JA 3SBWC 1MPAH 32C2A 4M3KB 5SWZB 4QYOA 1NMCC 4QRTA 2A9NL 3KHOA 3MA9L 4BH7A 3HZKA 3EO9L 4R4FH 1V7ML 3TH3T 3FFCA 1W8OA 2IFFL 4Y5XA 5TQ0H 2A77L 4X4XA 3GMMA 2KPNA 3G5VA 2FZ3B 4M93C 3QQ4B 4YXLH 3BRDA 2DBLL 2AK1L 4U1IB 5I1KL 1F4YL 3CFCL 3O6FC 1E4XI 2NX5E 3ARFA 4D9QD 1FNFA 4NRYA 5CHNB 1HOCB 4WWKD 3RWDA 4R4ND 3TYGL 4Z0XA 2GCYB 1KGCE 4HKXB 3LRSA 4N8CL 1EXUA 1MFEL 3GMNB 4N1EA 5F93C 4TUJB 5LWYH 5L0QC 4LKCB 4YHNA 1JWMB 4X6CA 4LLQA 2VSDA 3BPNC 4HCRL 4HDIB 5CGTA 1FFPA 2Q87A 1GGBL 3QI9C 1MLBA 3M07A 1QFUH 2A1WH 2VO5A 1IGYA 3KJ6L 4Q6YA 5ADOL 1T21B 5JQ6H 1VFBB 5JOFA 5IF0A 4O02L 2HRLA 1KENL 4PRPA 1F4AA 4UQ3B 3SDCB 3EDEA 3PWUB 4ZG1A 2BC4A 3MRCA 1I1YB 4JLRB 3U36B 2K1MA 2QQLL 4M61A 3UDWA 3VGHA 4HIEA 4NKIH 4AQOA 1FC2D 2VDQH 1ORSB 1AFVH 2D2OA 2VLKA 2DKSA 2C5DC 5DJXB 4B53A 2FECI 5F7KC 4OIBA 3HE7B 5DK2B 5D2NA 1U8NB 5GRVL 3O3BB 1CZ8L 3FQRA 4JREB 2PYFA 4F15B 2BY0A 4EI5C 2IH1A 1A9BA 1WIPA 3QI9D 1QACA 2OJEB 3C2AH 5EOCH 4F7PA 4L9LC 5TE7L 3P77A 2AW2A 2GT9A 3TBSA 1X5KA 2AJSL 3ARBA 1DBKH 5F9OL 3AXLA 4KH2A 1TZIA 5CBAA 3TGXA 4JKPL 2UVEA 5C09D 5FOBB 2O26U 5JXEA 2QEJA 5T3XH 3ZE1F 1MY7A 5DK3A 2XQYK 4PRHB 2EKJA 2FD6H 4YHIA 3AREB 4ALAH 5C0BE 4WFEE 3P4OA 4LKXB 4X8JB 1BLNB 5GSVA 1SJXA 3PV6B 2BSSB 3P40A 4Y4KA 3TO4B 2NZ9C 4XWGL 4JZJA 2J3SA 2Y36L 4Q2ZA 1QFWL 4Z76B 5BS0E 3B5HA 3LD8C 3ZTNL 2DLHA 4PJ7E 4EN3A 4ZNEE 4M1GH 3MCG1 4LF3A 3REVB 1OOAA 1LEIB 4P3DB 5TDNA 1MCCA 3MV8B 1S9WA 4CVUA 1S7VB 2E7MA 1AQDA 4I3SL 1NBVL 5F8RC 1UADC 1RVFH 2HLFD 3QIBA 3KDMA 4MB5A 3HR5B 2NXYB 4K94C 2E7BA 3T0DA 2G2RA 3U0TB 3HNVL 4WFHD 4P46D 1S9YA 4JHZA 4CMMB 3DBXB 3MRLA 3IJHA 2EIDA 5TE4L 4WJ5B 1U9KA 2A6JB 1QPPA 5IMMA 1RUMH 1N0XH 2NZ9D 5JW5B 1E4KA 1JI1A 2A6IB 4MSWB 5D5MF 5B39B 3RWJB 4JO1H 3ARYA 5FKPA 1R0AH 4JDTH 3GSNH 3HAEA 4PJEA 3TT3L 5FA3B 3QFJA 3SE9H 3RWFA 4Y4HD 1UYWL 4MA8H 3MOAH 4D9RE 2OR9H 2Q8BH 3T3PF 5I18L 5DFVD 3Q1SL 2BSRB 1UWXH 3FQUB 1VHPA 3CFDA 1S9VA 2AABH 3ILPA 1CFTB 2AEQL 4LEOA 5KANI 3V6FB 5GRWA 3M1BB 1UA6H 1ROWA 4PJEF 3VGFA 5CGMA 5FDWB 4FNLL 5DEGB 4G5ZH 5CS7A 1A6ZB 1X3DA 1J88A 3F7VA 2CUIA 4U6XB 1BQLL 3MTRA 4D94A 3PIQA 4PG9B 1U41A 4GG6B 5DRXA 1H8NA 4ONGL 3KS0H 3C6LC 2LV4A 1G84A 1F13A 3VA2C 4PJFE 1OARH 3PABB 3BZ4A 3C5SB 3NACL 1F90L 1A3RH 5T33L 1QRNB 4QRUB 3IF1B 3QUZA 1DQLL 2BSTB 3ULUC 3TBWA 4S10A 3GGWA 1U3JA 2YZ8A 2QTEA 1XFPA 3LY6A 4PJ9B 3S96B 3CFIC 4M7ZC 2EZ0D 1MIML 4HJ0C 4U3XA 3PL6A 1LDPL 1EEZA 4MZ3A 3SOBL 5IHZB 1PLGH 1QSFE 3DX7B 4JPVH 1TVHB 4CW1A 4GO6B 5EC1B 3TCLB 1U8OA 2PXYA 4IOIB 4FA8A 5DMKB 3Q6GH 3F6IA 5F7DA 3C6LD 5E6YA 4JO3H 1A6AA 4MJ2A 4N0RA 2NY3C 1I8IA 2E7CA 1KTDB 1YA5A 4MAYC 1LP9A 4Z7OE 1ADQA 3VWJA 4FTVD 1T83C 4QXUH 4L8CB 4ETYA 3HE6B 3TA3B 5DSCA 4NM8L 4RGNB 1WUNT 4WU5A 1FRGL 1R3LA 4PJDA 3WEXA 4AM0A 1K8IB 3T0EE 3ULUD 3ZKQD 1FO0A 4TNWF 1ZT7A 4YDVB 1OAUH 2J88L 1GH7A 5GRJH 4XNUH 3O2WH 3OAYH 4HJ0D 5GGQH 1ORQA 1WBYB 2NYYC 2MSPA 1CD9B 2DB8A 1LP9F 3ES6B 4WENB 1P9MA 3H2WA 5JIHA 2BMKA 4ZFFB 3GMQA 5ECJE 1AKJB 3B9KC 5HD8C 3DV6A 3CDFA 1HILA 3VMNA 2FBOJ 1R3JA 4JVUA 2HTLD 3MXVL 3I85A 3IAGC 1D5MA 2NY3D 1J8HD 3MLSL 3WN5C 3TNNA 5F6HI 4ZFOA 3FB6B 2Z31C 3J7HA 3DI3B 1CGSL 3B9DA 3U7YL 4KJWD 4L8SA 4EXPX 4LCWD 4UTAL 4OF8A 3FOLB 4M7LH 4X6DF 3K7UA 2HG5A 3S3PA 1JMXA 2LQRA 2BNQD 3UJIH 4EUPH 2AJZA 4Y0GA 1MY5A 4MMXC 1NBZA 3FO2A 2D31B 4RX4D 5E8NB 2J8UB 3T4AA 4P5KB 3O45A 2A2QT 1UWEL 3OKLB 2EDRA 4OLYH 3G08A 4FQHA 2YD5A 3VH8G 4HQQL 2WMPA 4I0CC 1MAJA 5GGVH 1P7QD 4PRIB 5LVEA 3VE0A 3T0BA 1KXVC 3HPLA 3DARA 1X6LA 4DAGH 5KS9A 4RFOH 3W2DH 5DK0A 4PRDB 2LVEA 3B9KD 4M5ZL 1LO3H 4MXQC 1LNUA 1YY9D 4X80H 2XKNA 3D39E 3QDME 1ZS8A 2FJFA 1FNSH 2D0FA 3V0VB 2VZTA 5JORA 1PEZA 3H7BB 3OR6B 2Z31D 4AG4L 2A74A 5EBWB 3V52H 2VJXA 1CT8B 3VFUA 1A3LL 2RBLA 2P1YA 2VNCA 7FABL 2GITB 1G7MB 4J3VA 5SX5H 4Q0XL 2FNBA 2V7HB 4OLEA 1U36A 2VABA 4GKSB 3PGDB 3KPRB 5C3LD 3ROLA 4HUVB 1FORL 1RZKC 1S5IL 2QR0A 3BN9D 4JFQA 5IVXF 3RUGB 3VXOB 1UKTA 2R1YB 1INQB 3D85B 4JZNB 3RDTB 2A38A 3VFVA 4WI4A 4YFEA 3TIDB 5C0AE 3UTTB 1EHLL 3JWOH 1FZOB 5B3JE 4BZ2H 3HC3H 2FIRT 2PTUA 3QEQE 4YHKH 4HAFA 1A6VH 3G04A 4WDIA 1N4XH 1CFQB 1FC1A 5F9DC 1RZJC 5DJ6B 1RUKL 1URLA 1ZMYA 4U7KA 5CLWA 3S37H 1OM3H 1U8QB 4JDVB 1HQRA 1IGTA 3WSQH 1KJ3L 2LAAA 1JPTL 3RY6C 3LHPL 1EGJL 3C8KB 1DN0A 1GGTA 1I8MA 1Q9OA 1AO7E 1B4JH 4WNQB 4CN6A 5HHOB 3PWNB 1ZT1B 2ZUTA 4OLXH 1PBYA 3PWPD 2P5WE 2ED7A 1NGZB 2VE6A 4ODVH 4Y5VA 3B9EA 3IU3B 5CWSB 4RNRB 5HHVL 4DQOL 4Y16A 3EFDL 4ZOCA 5DT1L 5IHUL 1JTTA 4PJ5A 1TZHB 2I9TA 4XXDA 5DD0L 5T1KB 5HGGS 5TH2A 2YD8A 5KVDH 4YAQB 5DD3L 3BDXA 4ONFL 2QQNH 4ISVA 4X9BA 5DTFA 1YNKH 4OZFB 4W70A 4PJIE 2OSLB 4OCNC 2EC9T 1DBML 4HFUL 5EBGA 2IAMA 5FO9B 5J1AB 1JPGA 1OTTC 1U92B 3UTSD 2W9DL 2GSGB 3C60B 2VXQL 3BHBA 1OAZL 2W92A 3IDMA 3KXFA 4JR9H 5IBTH 3WL9B 3W0WA 3NA9L 1LE5B 2FATL 4F7EB 5C9JA 2EDYA 3RVUC 3LN5A 3UBXB 1YPZF 5FB8B 2VLLB 1C5DB 1IGFH 4LMQE 4WUKL 3U9PL 3FFDB 3S36L 2CLRB 1Z9MA 3HLAA 3S7GA 2DQUL 1MOEA 1IAKA 3G6DL 3SGKC 3VXNB 1MRDH 1UM4H 4LU5H 4M7KL 3HC0B 3ARED 4K7PL 3UAJC 4KTDL 4PLKC 4UOJA 2JJWA 5GIRA 4O5LH 4Z78B 1IM9D 4P2QE 1KB5A 1DBBL 3DV4A 12E8H 2ZKHH 1IGML 1XIWB 4HJGA 1JNJA 1D3CA 4KTEH 2CMRL 2XWTB 2VDOL 3DSFL 5GZOC 1XGRA 5IKCB 3DURB 4IRJB 2UZXB 4JKMA 5EZIL 4DKFH 1P6FA 4UNVA 5C71A 3KYOB 1NEUA 4JFFD 4LAQH 5L8JB 4A6YB 5EPMA 1FVCB 5EWIL 5F44A 3RVUD 3T8XA 1HINH 5TPWH 1U8KB 1OCWL 4UUJB 5D72L 3DROA 5IJVB 4MJ6A 1UG9A 2PO6A 1G7QB 1YUHB 5K9KA 3BT2H 2NXYD 3KPPB 3I6KA 3O2VH 1T89A 1OGAA 3PDOA 4QHUB 2W07A 5DR5H 3UAJD 1KJ2A 4PLKD 5GS0H 2YRZA 3CDCA 2HLAB 4YHLL 4JFOA 1A0QH 4UAOB 3NFPA 2GEEA 1XH3A 4MNQA 4XHQA 2NNAB 2Q1EA 1DDHA 5IBUG 2P49B 3LKNB 3S88L 1OSPH 5D1XC 1JIBA 1FL5A 5EBMB 1LO5A 5GRXG 3L1OH 3VRJB 3FRPA 5GS2D 4MA3B 3MGTA 2DTSA 3MRDA 1CICC 2BHUA 2MJWA 4MB4A 1J1PL 1G0YR 4KU1A 4OB5L 3GRWL 4YXHH 3MV7A 3H3PH 2G75A 5HJ3B 2VQ1A 5C0DB 3TP4A 4LSDA 1V5JA 3AAZA 3IDIB 1ZA3B 4C55A 4DVRH 5BVPH 4P5MA 4BFEA 3CXHK 4XCFL 5KSBE 5FECB 4CDGC 4QXTB 2CDGA 5J8OA 2DOCA 4XMPH 5E1HB 4LK4A 2XRAL 2FX7L 2B39A 1N0LA 4OJFL 5DJAB 5J11B 5D96C 4HD9A 3IU4L 4Y7MA 1HCVA 4IRSB 3SKJH 1FYTB 2P8LA 3MRJB 3NH7H 4YWGH 4YDIH 2Q7YB 1DQML 5HHXH 3R0MA 3QDJD 2A6KB 4NQEB 3G6JE 5D1XD 5KSVB 4X99A 5IOPA 4CGTA 3GSUA 4XZUA 1MHHB 1RPQA 3L7FA 1HWGB 1KCVH 4ZAKB 1A9EA 4UDTB 1F11A 4JFEE 1WF5A 3NTCH 4ZO9A 1CICD 4XCEA 3WLWD 1CLCA 4HIHB 4G8GE 5AAMA 3VG9C 4F80A 3SKOB 4RAUA 5EU6D 5CJOH 4GAFB 1QO3B 4CU7A 2E9IA 5JW4Q 5ACLA 3WHXB 2V9RA 1CDGA 1KIRB 1D9KC 1JGDA 2FEEI 2WIIB 5J6HB 5C0CB 4RDQG 1D7FA 1JRHL 4UV4L 5MEPA 1FNEA 3BMWA 2CDEB 4P23A 4OM0H 4U1LA 1AIFB 4WGVB 4LASH 4NN7B 1LD9A 3D6GA 2PR4H 3MBEB 5CJBA 4CVZA 5EU5B 1D6EB 3OPZH 1ULVA 4KK9D 2N4IA 3CPLB 4TN9A 5DJDA 5DRNA 2XKUA 1D5BB 4Q58C 5GSRA 1ZSDA 3OAUL 4WW2B 3MO1B 3O6FB 3NIFE 1JN6B 4KUCF 5TF1H 2X1PA 4NCDA 2KZ1B 2APFA 1CGWA 1C5CL 4HX1A 4OFYD 4NKOB 1IAIH 4BM7A 2R1XA 5I1IL 1BFOA 2UWEB 1MSPA 4J1UB 1T7VA 4YLQT 2XN9B 4FMFA 1AKJD 3BGFC 4I9WE 1H3TA 3VXUD 4X98A 4ZOAA 5HYJE 3AU1B 4EQ2A 2J6EA 4I1NB 3QWOA 5FUCE 3QIUA 5DJCA 3FT4A 3L3GB 4GFTB 1CD1B 4XNQB 1BGXH 1HH9A 1VGEH 5CEZD 1V05A 4PREA 3MR9A 2W0LA 3SE3A 3OJDA 2MPAL 1MRFH 1SY6A 4F9PA 2OCFD 1AI1L 4L3EB 3UROR 5ID1B 4DFHA 1PKQE 3ARDC 4PJHA 4KJPC 1RUAL 2IBZY 2AK4B 4ODWB 3BKJH 4Z9KB 3TZVC 3ZLQC 3WJLC 1QBLH 4K3HA 4XCYA 3VD7A 4AEFA 4YHZL 1D5IH 1YDPA 2NCMA 4PRID 4O00A 3VI3F 4GG8B 4OT1H 2EDTA 4P59H 5D6CB 4YEEA 3L3IA 1WQVT 5A2FA 4G7YH 2CLVB 2CQVA 1MI5B 3ZO0A 1XR8A 2HVKB 4F37K 3FO1B 3OJVC 3MREB 1K85A 4HS6A 1BOGB 4XCCH 1CLYL 2HJLB 1C7SA 4NQCD 2VLRE 3ARDD 2C3VB 4KJPD 4G43B 5JW4N 1FL6A 3TZVD 4OLVL 4K7PY 1DVFC 1R24A 3JV6B 4PJCB 5GGTL 1WTGT 3RDTD 4S1QL 3D0LA 1KCSL 2V5RA 3UTTD 2UUDH 3S9DB 4JRYD 43CAB 4Y2DA 4K9EH 5DC9B 5CEZH 4NQSA 2CKNA 4LLWB 2ADJA 1AHWA 3MZGB 5FM8A 4YGVA 5MENE 2VDRL 3S36X 3MOBH 4FFVC 5GRUL 3PQYD 4FQXA 4EI6B 1QYGH 1REIA 3F5WA 5FUZH 5MERB 4OGAC 4TUKH 1IAOA 2XWJA 1A6UL 3P0VH 4M43L 4AEHH 3F8UB 3FQNA 5I8CB 1NFKA 5IROC 4RWYH 1RZIB 4OF5A 5DJZA 3V4PH 1VB9A 3FB5A 2DQTL 2YD9A 4O9HL 4XH2A 2JELH 3BVNB 5EOTB 3V5DB 2B1AL 1U91A 1RUPH 2BNRE 3TJHC 4BZ1H 5D1QC 1AY1H 1F4YH 2MCPH 5ESQB 5FYJE 5HHOD 4L4TA 1DVFD 3CC5B 2NY4B 5K9JH 2VLJD 5E8EB 5CJ8A 1SBBA 2I9LB 4QRPB 1VGKA 2VIRB 4YZFF 4WFFD 1SJHA 4ZTOL 4MQ7B 4FFVD 4HCRH 1MWAH 4Y1AA 2KZWA 4K8RH 4NQDB 1PX3A 1G7PB 4OGAD 2V17H 5I76A 2G9HA 1AJ7L 3IAQA 3TBTA 1K9TA 5H94A 2YK1L 1N6QH 2E9WA 3MJ7A 4WW1A 4F33B 5GGUA 2B1HL 4EBQL 4FQLH 4XT1C 3KPSA 1MHPH 2FGWH 2VXSH 4O2FB 2NY0C 3ZE0F 1IFHH 1RHHB 1XGPA 1F00I 3BAEL 3EYVA 5LXGL 1NEZG 1I8LA 4TQEH 5D1QD 2ESVD 1CG9B 4MX7A 1MCNA 5I1DB 1OPGH 3LVEA 1NAKL 1FIGL 5D5ME 5DUBB 2DDQL 3JWDL 1AD0B 3UO1L 4PJXA 1QSED 1SM3L 4YHYC 1IT9L 1B6DA 1H3PH 3PP4L 1I7UB 2ADFH 2DLEA 2HH0H 3EBAA 1NC4B 1M1SA 2I60H 3T3PE 1YMMB 1HYSD 4UV7H 3V6OC 3GKWL 2VB5A 4POUB 2F8XC 3BWAA 3OTTA 1KIPA 5I1HL 3MACH 2HP4A 4RMVA 2ZPKL 4IOFC 5IB3B 4ZXBB 1AXSB 4H25B 3EYFA 4PJXF 4PGJA 1Y0LA 3T4YB 2JCCB 2V7NB 4M7ZB 1OL0A 1S7TA 2O5ZL 3L3JB 4GW5A 1U8IB 4PRNB 5AUMB 2WSKA 4BFIA 3WFHB 4J3WA 1D5ZB 1ETZA 3EZJB 3BISA 4M4RA 2YD7A 5GS1C 1MRCH 1I7RB 4CNIA 4R6UA 3GI9L 3RVXC 2RCSL 4AT6B 1IAII 3QXDB 1J1OH 5J1TC 2WUBL 3EYOB 2OMNA 4KI5F 4ZUUB 4BH8B 4LPTA 4AH2B 2VDML 2XXMB 4MAYB 3H42L 1ITCA 2A9ML 1VADB 2YA1A 2P43B 4NUGH 1R3KB 1CXFA 1OTSC 1YQVL 1SJEA 4LSSL 2C4FU 3BP6A 2CKBA 4JFHE 4BKLA 4ENEC 5CJ5A 1CE6B 1CYGA 1ZKAA 1QHPA 1S78D 2OJZH 3V7AE 1MUJA 3ZL4L 2GHWB 4TOYL 1YEKH 2F58L 3MBXH 2BOCA 1JGVL 1DUZB 5A2LH 3IDYB 1NBVH 4NJ9L 1YC8A 4OUOA 5L8LB 5FV1L 5ISZD 4JFXA 5A1AA 4U1NA 1JI2A 1A14L 3FB7A 3TBVB 3RVXD 3GSWB 5SWQB 3TFKC 1WVZA 3QG7H 3JTSB 3U0WL 5ANMA 3QUXC 3CZFA 4XGZA 1FZKA 5D7JB 3CU7A 4IS6B 3OBAA 1NCAL 1RSFA 4M00A 2JLLA 2YN5A 4NT6A 3U4BL 5L2JA 1ED3A 3GO1H 1L6XA 3I6LD 5J12C 1OAYH 1OTSD 3ET9F 3EOAA 4RZCB 4L8DB 1DTUA 4ENED 4LCUA 5I18H 2ITDB 3CUPB 5CZXD 1I7ZA 3IDGB 4KZDH 5K93A 2P5ED 4JM2B 1VPOL 2VUOA 1ZANL 4P9HL 3U4AA 4I2XE 3ZE2F 4A6YH 5DGRA 1CF8L 1NLBL 1GL4B 4L1DA 2E7LC 3GSOB 3I6GA 1FYTD 3BKCL 4KROC 4O2CB 4F7MB 5T3XE 3TBYB 4DZ8B 3LKPA 1MCIA 2JK5B 3C5ZC 3TFKD 1J05B 5GRVK 1I75A 4ZAKD 1UB6B 4HUXA 4NNPL 1G9ML 4ONGH 1KPVA 3QUXD 4YDKH 4X6DE 4I18A 3TCXA 4WCYL 5EULV 2ZUVA 2C9AA 4KJYA 3GKZA 4FS0A 3NACH 5TGBB 5DJYB 4G9DA 3EHBD 1QP1A 1BVKA 3SEPA 4FZ8L 2VDLH 1J0ZA 5JHDE 2XTJB 2FR4A 3DRQB 1DQLH 1N64L 5CCKL 1ZTXL 1FGVH 3PWLB 3OJ2C 3V0WL 1DANT 4YFLF 5C0CD 2APWA 1INDH 4QRSA 1FL3A 1NCTA 3QEUB 4OZGA 4XBGB 5EZJB 1MIMH 1BFVL 2QHRL 4JN2B 5K9QI 5BZWA 3NFNB 2PKDA 4G6JL 4YGAB 3SOBH 5HSFA 5FV2A 4GRMA 2VZUA 1XF4A 4MD5B 4UDUA 5E2UL 3ULSA 3C08L 2EYSB 1A7PH 3RUGF 3NPZB 1JNLH 3DMMB 3FAXA 3C5ZD 4KHTL 3UPCA 4NM4L 3MUGA 5CBEA 1GC1L 2P8MA 3X3GL 2D7NA 5DDHA 5HYSA 2PN5A 4L4VD 4QY8B 1NCBL 3SDXB 3HN3A 1V8HA 2YUWA 3WNLA 3RX7A 1FRGH 3VFTA 4F7CB 5MHSD 4MXVF 5IVXE 2NLJB 3BIBX 2I07A 4OD1L 4L9DA 5IBUB 3WS6A 1WCQA 2J88H 3UC0H 2DLIA 3DVGB 4HH8A 1KLUA 3QUKA 3GSQB 1KJMB 2EXWC 1HKFA 5LBSH 5FIEA 3V8CA 1KJVB 3UZQA 4PPTA 1HE7A 3QIWD 1AP2A 5HY9A 1GOHA 3TO2B 4L3ED 3PGFL 4G9FE 4LSTH 5HYIA 3EFFB 3T0VA 5HHMD 4HG4J 2C4XA 5IMOB 2GJ6B 4UOW1 1X5YA 2UVFA 4G7VH 4LBEB 1ZHKB 3HZYB 4WHDA 2HMIC 4UI2A 2H8PB 1CGSH 2VMFA 5ADPH 1AXIB 4R96B 3LDBB 1BBDL 3QJHB 4NRXA 2DWDB 5C0RL 1H9VA 1HSAB 3RL2B 5H8DA 5EUOF 1RULL 4JJ5B 5D8JH 3W82A 2HKHH 4TSBL 3KYMB 1T22B 3P0YL 2Q6WA 1U8JB 1I3GH 3FQXB 1OF2A 4EDXB 3EGSB 1EX0A 1VACB 3SGDH 2ICES 1T7YA 4ORGA 2EXWD 3O2DA 4V1DE 3IDNA 5I16A 4X6FB 2VERN 5LGJA 2CSPA 4ZUWB 3SQOH 1FGNL 1FZMA 4XP4L 1BD2D 4X4ZA 1R5IA 5IQ9A 2FGZA 5DURD 2HJFB 4M5YL 5DQ9B 4FQJH 4RBPH 5DQJA 4F57H 3HTLX 4WEBH 1YJDL 3RTQC 2HMID 4AG4H 1F6FB 2IANE 1KEML 1DLFL 2JJSA 5I17A 4FXKA 3EO1B 2NY6C 3PF2A 5L9DL 1H8SA 1QA9B 3O3EB 1ZHBB 2AJYH 3B8SA 5JR1H 4Q0XH 2Q20A 3STLB 3N1PC 4ZPTB 2O5YH 3MFGB 4B0MM 1RUQL 3BP4A 1LK2B 1YEIH 15C8L 4WY7L 1TJIL 5KN5A 3AUVA 3UBXI 3VXRE 4BSJA 3KLDA 2F53A 4CJ0A 2E7HA 1PG7L 2OMBA 1QEWB 3Q2CA 5D71L 4PR5B 2ZOLA 2FEDD 1FN4B 1I1AC 4Y19A 3O4LA 5C0EA 1V7NH 1QZ1A 4GW1B 4N8VG 4N0UE 3HG1E 3QDGD 4JN1L 1OB1B 2VLME 4DFIA 5C2BH 4G80A 4HGMA 1B0RA 2YD3A 1ES0A 1Q0YH 4APQC 2NY6D 4DGIL 1JF1B 5AD0B 2YUXA 5HPMA 2IALB 1ZA6A 2JTDA 3BQUC 3CD4A 2C3HA 3TYFB 3LHPH 2JJTA 1D5XB 2NY2C 2YMXL 3GMOA 1AC0A 3IJSA 3O41A 4Z8FH 2GY7B 5JLZA 4WHTB 1FP5A 4NQDD 2R23A 3E6HA 5T1LD 3RI5F 4HC1H 3BDBA 1IC7H 5ITFB 2W0FB 3MXWL 3RAJH 4U3HA 2KDGA 3HKFA 4ZFZA 4ELMB 1RFDL 4X7TA 2BVEA 4O4YL 4HXBH 1A22B 1NGXB 1AXTL 4JHAH 2HFFB 4P57B 4HLJA 4PJAA 4DQOH 1I1AD 1VFUA 5CKAA 5IW1B 2D7OA 1EMTL 3WNKA 1ZLVK 3T1FB 1EJOH 1KTKE 2HJKB 3RX5A 3GB7A 5DD3H 3PHQB 1DANU 3MRHB 2R0WH 1G9EA 1RZGA 2HWZL 3BDYH 1NAML 1Z5LA 5E4IA 5J4MA 2IF7A 1NC4D 3BQUD 5CILL 4NSKA 5I19H 1UH3A 1QQDB 1WZLA 1SVZA 4S1SL 2NY2D 1YMMD 3ZHDA 3C6SA 4KK6C 1NC2B 4XPHH 1N59A 2AP2A 3WDHA 1OAZH 1F02I 4NQVB 1QNZL 4QTIL 2FCBA 4WWKA 4EDWL 2L0DA 4RFEB 1Z9SA 4PS4L 3LCYA 5D7SL 1K8DB 3CNKA 1PAMA 1WISA 3B2VL 3O3DA 4PY7A 5C0BB 5I1EH 3QO0B 2A6DA 5JPNA 5KG9A 1CK0L 1YMHA 3RWIB 3S36H 1FH5L 3D18B 2DQUH 3S4SA 3E6FA 3SBWA 3EOBB 3VXMB 2EE2A 4GMSL 3SDYL 1U8LA 4M7KH 3MJ9A 4XBEH 3WKML 2AJXL 3QPXH 2OL3A 1TLKA 4MJ5B 1T2QL 3P4NB 7CGTA 1G7JB 2YWYA 4MMZC 5D2NC 5BOPA 3CK0H 4I77L 4XB7A 2ARWA 5C8JA 2QSVA 3V6ZA 1LEKB 1NUNB 4L29B 4ZQKB 2JB5H 3WO3B 3OGOE 5F7EL 3BIKB 3QCTH 2GFBA 3MROA 3IETA 4O51B 2H41A 4UIKL 4NZRL 4R7DB 3RNKA 4NPYB 1G0XA 3UJJL 4X4ME 4HIIA 1JE6A 1CFBA 4MJIE 3ARBC 4LQFH 4Y5YB 2FH8A 3WE6A 4OI7A 3WIHH 3VD9A 2AEIT 1FG2A 2YPLB 3QI9A 1KV3A 5DRZB 5J6GB 4OLZH 1GAFL 4QRQB 4LLMB 2VL5B 4GJTB 1NBQA 5IFJB 2H6PA 4K3EL 3GSRA 2W0KA 1ZE3C 2UWEF 4YBLB 4JFDB 4OCXH 4Y4KC 4P2OB 2EDFA 2XWBA 3C9NB 1CIUA 4YQXH 5KJRH 5T1DL 3D69A 5SWZE 3SKMA 3V0AC 35C8L 2ZG3A 1EO5A 1H8OA 4I3GA 4X6BB 5KOVC 3LB6C 1G7LA 1OAKL 2W59A 4G3YH 2WNGA 3GBNH 3SGDI 2LTQC 5IR1A 3W9DA 1CTOA 2ZCKH 4EN3C 2A0LD 4Y4FB 4XNYL 1KNOA 5EO0A 3K4AA 5CP3A 4XPGL 5DMIL 1S8DA 5DD1L 3IDJA 5KSAB 1J1PH 5TJWK 4OB5H 4JRXB 2CIIB 1NUFA 4KRPC 4BQBA 4GKNA 3MODH 3GIZH 1KCRL 4FQPA 4F8TA 1YY8A 4L9LA 5F9WC 1OQXA 4H5SB 4KVNL 1MCLA 4WU7A 5IVZA 1CD8A 4NGHH 4PYGA 2XRAH 4PIRF 2FX7H 5C1MB 3IU4H 3IXTA 4PB9L 3VFMA 4U33A 4N1HB 3P11H 1KIQB 5DZLA 1I4FB 4F7TB 3VXSE 2C3XA 1JUFA 4P46A 1EO7A 3PGCA 1BIIA 3KPQA 4X7FC 3MLRL 2W60A 4ZUVA 2C1OA 1A4JB 4MCYA 5TDPB 2BVQB 4ZSOA 4PGDB 4LLDA 1OAXL 1UENA 5IUSA 3Q5TA 2NY7L 4KRPD 5GISL 1NDGB 2IQ9H 5GJTH 5JO5B 4GAJH 4Y4HA 1T4KA 3HCVB 1GZQB 1I7TB 1GZPA 2ED8A 4OZ4A 2D7TL 3IXAA 4PJCF 1OWWA 1JJUA 1NFIA 1TVBA 1QBBA 4G8IB 2Z8VC 4NUJB 4UV4H 3RVVD 5EO9B 2AJUL 5BRZE 2ZCLL 4PLOB 5F88B 1AE6H 3ARVA 2FYYA 2BOBA 2JF1A 4U0QB 3L3HB 1F4WL 4NDMA 4U1GC 3GBMH 4YJZL 2F54D 4MVBC 4JPKL 3VFGH 4NO5B 3QUZC 3VRIB 3RHWF 1B90A 3LSOA 3K3QA 2YSSB 5L2KD 4KHXL 1NDMB 4EIGB 3OAUH 3MRGA 4CBPA 1N5AB 2X4NB 4PRHE 1OP3H 4XBPA 3VXTA 3L6FA 3PL6C 4JQXC 4Q6IC 3KPLA 2Q76A 5IMLB 5EU3B 2WBWB 4HWNA 5I15H 1YNLL 2OI9B 4XPBL 2PXYC 2EYRB 1LEGB 1JK8A 4DTGH 4DCQB 2GJ6D 1DEEB 2QADB 4EUPA 4WFGE 3MRFA 3OKMB 2VAAA 2NR6D 3WHE0 3TJEH 3HMXH 1KC5H 3ABZA 1A6WH 1F5WA 3MV8E 1UB5B 2EDOA 3MNZB 3BH8B 1U95A 1RZKH 3MRKB 4MVBD 1R5WA 1MNUH 4D0BA 3D2UB 1KFAL 2A83A 3C6LA 1QKZL 4LDOB 1CLOL 4WI2A 1UQSB 2X1XR 4NKMB 5CAYB 1MCJA 4BYHA 2ARJB 1BQUA 5E99H 5DHXB 1E4XL 4FTVA 4KQ4L 1HKLH 2DRUA 4YZFE 4OGYL 1N5YL 3FCTB 1JHTB 2AKRB 1VFMA 5FA4A 3OXSA 4DWHA 4JY6A 3MRRB 4L8BA 3LS4H 1P9MC 5ESVA 1FZJA 1N7MH 1RZJH 4PJGB 4XTRC 1JWUA 5A16A 4M6NL 3MRBA 4R90L 4XNXH 4YHPA 2XZCH 4XCNA 4ZUTB 4C56B 1A3QA 1N2RB 1OAQH 2ARJQ 1T20B 2ZUYA 5EOQH 5FEBA 2WWKT 4LPYA 2WANA 5E0QA 4M6OL 4FQCH 3RIAK 1F4HA 1HXYA 3ZE0E 2R2EA 4PV9A 3HAEG 1UM6L 3HC4H 1BQHB 2W65A 4OCLC 3D3VB 5E2TH 4D8PA 5CJXC 1EPFA 1T1WA 3L95A 2C1PB 2ICEB 1F8TH 1Z6JT 5C0AB 5ICXB 1J8HA 1PW3A 5I8EA 2JCCF 3VXPB 2M26A 5M94B 3LKSA 5GS1B 1JNNL 2VR4A 1T83A 2GSIB 4LCWA 3QRFM 2OTUB 3NN8B 1CFVH 1CR9L 2BNQA 5HHNA 4YXKL 4M1DL 3FO9A 1A1MA 5IIEA 2BZDA 2NX5D 5A2KH 2FH6A 5E8DH 3DHJA 4P3CL 5ETUB 1NCWH 2AI0H 4RX4A 3ULVC 4Q9QL 5EUKA 43C9A 3GUTA 2XZQH 1KG0A 5IWLC 1QLFA 1KGCD 4KV5F 3QJFA 1QRNE 5B21A 4FQQB 2PYEB 1L0QA 2D0GA 3PJSB 1BAFL 1E6OH 4M43H 3EYUL 4W4OC 1P7QA 5DUML 4HPYH 3QNYA 4P2YA 4TPRL 1Q0XH 3PWJA 3B9KA 5EZLA 4Q9CA 3D25A 4O9HH 3UP1A 4OBRA 1FAIH 1OP3K 3MCKB 3U9UA 4FFYL 3MRQB 5I2IA 8FABA 3WN5A 4KI5E 2Z31A 1RIUH 2W0PA 2DL9A 3RIAF 1K5NB 5AZEH 1FV1B 4OQTH 1MVUA 2BVOA 2FLRT 1U2HA 3ALXA 4YK4B 1MHCB 4GSDL 4U1HB 2YPVH 3GIVA 1OT1A 5DJ8A 5J89A 5K9OA 1CL7H 4P2RE 4KAQH 4M9PA 5JW3H 1QLEL 4PJIB 5ID0B 1T80A 4ZTOH 3REWB 4WEUD 1YN7A 2YEZA 4RGNE 2HA1A 3RWGA 2CDFA 2HRPH 2ZSVA 4U0RB 2GJZA 5E00B 4FQ2H 1RZ8B 2R39A 3IKCA 3VG0L 3WNOA 4I5BB 3DGCR 1T0PB 2BRQA 4YNYA 5D7LB 5FYJL 4KZEL 3LH2L 5BCAA 3BAEH 4KROB 3HFMH 2V2XA 2ZUWA 4C58B 1JL8A 5LXGH 4ZPVB 3V95A 3ZSSA 1BBJB 5ERWB 3ARPA 3U2SB 3JWDH 3RVTD 1T66D 3U1SL 4YHML 1R3IL 2ENYA 4JKKA 3PP4H 2P24B 5CIPH 2DM3A 4LKCA 4HS8L 2IGFL 4Y5VC 5C0BD 2VISA 3CX5J 4HDIA 4Y16C 2ZSWB 1JRHI 4EEEA 3GKWH 3CMGA 3UPRB 3PWPA 1BZ7A 1FIEA 4ZFGL 3P9LB 3C8HA 4G8FB 5GGSY 1OW0A 3ZE2E 1BVLB 1XCQB 5BS0D 4UU9B 1UJ3B 4HGWA 1HHGB 5C0JB 4ZYKB 5CUSH 4RAVA 1WCBA 3S34L 1I1YA 1VFAA 4R4BB 3MRIA 2WBJB 3QH3A 4POZC 4QHLA 3TT1H 1ZGLB 3T77A 3D9AH 2OZ4H 2Z92B 3FQWB 3WLBB 5HYQA 3HHRB 4BUHA 2RCSH 2X4UA 5DHVA 1CE1L 3P9MA 5DK2A 1K4DA 3O6LL 1EVTC 3QPQD 4NZUH 5IFHL 1EJ6A 5EIIA 3CCHA 3OKOB 2X5PA 3IVKA 2OR7A 3EJJX 3UTSA 4OV5B 1M7IB 5C07E 4PG2A 2A9MH 1MPAL 4XXCA 3SDDB 1GPOL 1GC1C 2GTZB 3MRNA 1CGYA 4R4FL 3SDXF 2SEBB 2L4OA 4MA1B 3KPRE 3WDIA 4UILH 5TQ0L 3VFSB 2F58H 1A6TB 4D9RD 3RUGE 1PZUB 5FOBA 4F2MB 3SDAB 1YQ2A 3QXVA 4NJ9H 4YXLL 1TMCB 2X4OB 4JZOA 2FBJH 4UNTA 5GGSB 4U1SB 3AREA 2CR3A 3K74B 4C4KT 3MLVH 2FIKA 4HMCA 3QAZB 1X4XA 4X8JA 2ICWJ 3NCYS 4Y4FD 4OLWL 1IM9A 3WFCH 2BSSA 2V5TA 3GSXB 2ZUQB 1AR1C 4Y88A 3BZEA 4JQIL 3ETBF 4NZJA 3HUJF 2IH3B 5LWYL 1FLTX 3ARTA 3GSVB 2BXYA 3QCVH 4MXVE 1I8KB 1U6AH 2ZOKB 4NO2A 2PO6C 3Q6FA 4QTHA 5I75B 1X7QA 1MCSA 3RKDC 4JFFA 1KACB 1A2YA 5J7CC 1LEIA 1YEFH 3UTPE 1QFUL 2A1WL 1IMHC 3RQ3A 5CEYB 2NW3B 4OZHF 3TNMB 4D3CH 5JQ6L 1A64A 4OGXH 4PP2A 3T0EC 4XAKE 1D6VH 1VPOH 3QEGH 1P1ZB 1ZANH 4P9HH 3RL1B 4KKBC 3H9SB 1EEYB 4HHAA 4ZD3H 2VDQL 2D4DA 1OD7A 1AFVL 1TENA 4Z7WB 3DBXA 5SX4H 3EOTH 1OGTB 2DJ4A 2IPUK 1BM3H 1QSFD 4F8QA 1ONQB 1NCCH 3P2TA 2DJSA 4UT6H 3KYNA 2A6IA 5B39A 4WCYH 5FYLL 4B7IA 3RTQB 4S0SD 4R3SB 1KPUB 5FA3A 5EUOE 3QXTA 2ORBH 1HNGA 4ODUB 4R2GC 1PQZB 3ECBB 4FZ8H 2GW5A 3MLZH 3RKDD 5EOCL 3C2AL 2D9QB 3BD5A 3V4UH 1YJDC 4X5XA 5ITBL 1A1OB 2AXGB 3RWCA 4YDLB 1DBKL 1CFTA 4PB0H 4Z7UA 4WUUB 4P4KB 4S2SB 3T0ED 2Z35A 1U58A 1XGUB 1ZT4B 3BPCB 4KKBD 4D0DB 5T3XL 2JIXB 2R0LH 1QVOA 3U46A 1X5JA 3H0TA 1WEJH 1A6ZA 3C08H 2FD6L 4AEEA 3V5KA 4HT1H 4PRAB 4ALAL 1NKRA 4GG6A 1LK3H 3BEVB 1NSNL 3AB0B 4KHTH 4R0LB 5HGDB 5IM7B 2RJMA 3PABA 4HULB 3C5SA 4R26L 5JZ7C 3DGGA 1RK0A 4AY0A 3DWTA 1CL7I 3T09A 4NQXA 4KFZC 2NPLX 1U8PB 2X9XA 1NCBH 3QDJA 3VDBA 5D1XA 1FVDB 3IF1A 3HI6H 2BSTA 4ELKB 3FN9A 5FK9B 4PJBA 1GIGH 1RJLB 4UTBL 1UJTA 3CX2A 1CICA 1UVQA 3RZCC 5JDJA 3ZKXC 1TQBC 2EXYC 5HHQA 2FHBA 2QADD 3QCUH 5EU6A 1AD9B 1RJYB 2QSTA 3CVHA 5F9JB 5ICYA 32C2B 1RVFL 4FMKA 4QRTB 3W11C 4BH7B 5EC1A 3HZKB 3TCLA 4HJJL 5F3HA 2YHGA 1IEBA 4NO3B 4XNMA 3QZWB 5BJTA 2YBRB 4Y5XB 3D2UD 3P73B 3GMMB 1BZ9A 1RUML 4ELMF 1KTDA 3U83A 2C26A 1M4KA 3ZT7A 2RB8A 2M2DA 4JO1L 5JZ7D 4NNYA 2E9JA 4RGOH 1TZGL 3S5LB 4L8CA 3ARFB 3MLYH 3D39D 3QDMD 4NRYB 4M8VA 3RWDB 3DOSA 4Z0XB 3SE9L 4MA8L 1JHKH 1BBDH 4OM1H 5D2LA 4NZDA 3MOAL 3TEUA 2OR9L 4TNVK 1KT2A 1NGWA 1H3VA 4N1CA 4GKZB 3Q3GA 3JWNC 4X6CB 3RZCD 4LLQB 5KVFH 1FFPB 4OFDA 3QIUC 1WBYA 4U6VH 5IB1A 4OFYA 1LVEA 1UA6L 3GJFB 2DIBA 1TCRA 4OSUH 4XVTH 3W11D 2H3NA 2HFGL 3ESUF 1IGYB 5IGXH 5BV7C 4G5ZL 4ZFFA 4WV1C 3SE3C 3UZEA 1AKJA 3VXUA 4F9PC 5JOFB 4RQQA 1KYOJ 5IF0B 3AS2A 1FGNH 1YNTA 1WAAF 5JPMA 5IG7B 1CXKA 2COQA 4PRPB 2DQGH 4YX2H 2BC4B 3MRCB 5C0AD 4YPGA 1CGVA 3FRPG 1OARL 4M61B 4HIEB 1RURL 4YO0B 3AS1A 2WWMC 2IBBA 2ZJSH 3BYTA 4IM8A 3FOLA 1A3RL 3QQ3B 4RFNC 5E2WL 1T04A 3QEQD 3RPIA 3VDCA 5CD5D 5D7KE 3T2NH 2PW1A 1XGTB 1F3RB 2J8UA 4P5KA 1I9IH 3PE9A 2EH8H 1XGYL 2RHEA 6CGTA 3FQRB 5F7MC 2XZZA 2PYFB 5IB2A 1UKQA 2FJGA 3O6KH 5C08E 1TETH 5LAXB 4NQEE 3RWHA 1PLGL 1TJIH 4JPVL 4F7PB 3RVWC 1AO7D 4PRIA 3P77B 1UXSA 1QBAA 3TBSB 4MGXA 3Q6GL 2P5WD 4XMLL 1TZIB 5CBAB 1ZVSA 4LLVB 4JO3L 4UT7H 1TPXC 3KJ4C 1I3RA 3EO0B 3V0VA 4LFHD 3OR6A 3JBG7 4X5WB 3E8UH 2WWMD 4YHIB 4QXUL 1VESA 3OKKB 1EV2E 2FL5A 3E0GA 4Y4KB 4NQCA 4BQCA 2WUCH 1RIVH 3ARDA 1MJ8H 2DQIL 4HBQA 4ODHH 1OAUL 4JZJB 4XNZC 4Q2ZB 4DZBA 5C6PB 5GRJL 3PGDA 4XNUL 5B8CC 4ODTH 3O2WL 3TZVA 2MMXA 4HUVA 1JHLH 4XB8A 2Y6SC 1EUUA 4UINH 3RDTA 2HTKC 3MXWH 4LF3B 1Q9LA 3UTTA 4JRYA 4ODBD 3OX8A 5H37G 5SX4I 3T0AA 3VMPA 2F8OA 4O4YH 1DQQA 5T5NG 4DW2H 3AVEA 1SBSH 3LS5H 3DETD 3QIBB 3PQYA 3KDMB 4Z7NF 2OM5A 4OIIH 2UWEE 5FF6B 5IB4B 4P4RB 2G2RB 2BRRH 5I6XB 1L0XA 1CFSA 5F7UA 4B7LA 4M7JH 2XN9E 2CUHA 1S9YB 1ZLWH 4M7LL 5I9QC 5BZDB 3UJIL 1U8QA 5KSUA 5IMMB 5C7XL 3NCYP 3QQNA 4PYHA 1BJMA 3WXVH 4CU6A 4PRBB 4CMHB 3S8WA 4LDLB 5FKPB 3B83A 1Z3GH 3HAEB 4PJEB 4WNQA 1KB5L 4P2QD 5CZKA 5HHOA 4ODXB 4FXLA 1ZT1A 3QFJB 1KPRA 4MXWH 1DVFA 4OLYL 3RWFB 1KF9B 2Y6SD 3C8DA 1QFOA 4RMRA 5GGVL 2VR9A 4DAGL 3CFDB 3IU3A 1S9VB 4RFOL 2XA8H 4RNRA 2AK4E 3W2DL 3ILPB 1LO3L 1U3ZA 4LEOB 4X80L 1UACH 3QULA 1TZHA 2YC1A 4LSPH 5IW6B 1FNSL 4IEFB 2WBJD 1QUNA 1UXWB 5D7IA 2DF3A 4YAQA 2KBGA 3EDKA 4U1JA 3WFDH 5I0ZA 5IROA 2C3WA 4JGMA 3V52L 5JIIA 4OZFA 3B2UC 2VKXA 5DRXB 3TESA 3C5JA 3OZ9H 3SE4A 3PHOB 2B7DT 1MI5E 4LVNC 5J1AA 4KGLA 3BZ4B 3EOYG 5D1QA 2ESVA 4NN5C 1ZLSH 1P53A 2Y4SA 1QSEA 1LE5A 3QUZB 3T0XA 5F7EH 5FO7A 4OQ1A 1RJCA 2W9LA 3TBWB 3GGWB 3WJJC 4NZRH 5FB8A 4X0KA 4QRRE 2VITA 3ZKSD 3UJJH 4FOMA 3ARSA 3GK8H 1GVIA 3HC3L 1X5FA 5DJ0A 1EEZB 3SDAD 5AEAA 2EEBA 4PJCE 4YHKL 4CRPA 1J11A 1A6VL 5DYOA 1W8NA 1N4XL 4CW1B 3UTZA 4LVOC 1A1NA 1U8OB 3B2UD 1G9NC 4Z78A 5E4EC 3S37L 1HI6A 1OM3L 5F7DB 2UZIH 1A6AB 1GCFA 1I8IB 3KR3H 5T5FL 2KKQA 2DMCA 3DURA 5J57B 1LP9B 3VWJB 1B4JL 1CDHA 4HUNB 2PW2A 4EXKA 5DSCB 2FO4B 3I2CH 4WU5B 1S7RB 3EKCA 4PJDB 1GJIA 4AM0B 1SMOA 4KK8D 1FO0B 4XNYH 1ZT7B 4UUJA 4HEME 4LDEB 5IJVA 1A7RL 4ODVL 1N3NA 5DD1H 3RX8A 3STZB 1G7QA 1ORQB 1XMWA 3V6OA 4BSWB 4E42B 2X70B 3VCLA 4JFED 3DLQR 3NBNA 1ZLWK 4G8GD 2YD2A 4QRPE 5KVDL 3G5YB 2BMKB 3IS1X 4OF7A 5EDXA 2QQNL 3GMQB 2Z4QA 1YNKL 1FSKC 3DV6B 5DA0B 2GAZA 2DI9A 4KVNH 4RRPA 5KW9H 2WLZA 1R3JB 4P5TC 1IAMA 4J23A 1INEH 2X4QA 1D5MB 4IMLA 3BUYA 5EORH 4LHQB 4PJGF 3TNNB 1DE4A 5ISZA 2AJVH 4ZFOB 5TE6H 5DO2D 1DEDA 3W39A 1HH6A 1R5VA 4L8SB 5FUCC 1MAKA 1ZXQA 2PNDA 1K3ZA 4JR9L 2HG5B 5IBTL 4CN1A 1MCOH 3NCMA 5EBMA 2R2HA 2BCKA 4ERSH 3H9HA 3PNWB 1PD6A 4LSRH 4MA3A 1H3XA 3MLRH 5FFLA 1NBZB 3FO2B 2YS4A 2W1NA 3Q5OA 1UEMA 1XR9A 3T4AB 2R56H 5J3HC 4G6AC 3EUUA 4JVWA 5HJ3A 3U4EA 2AJ3B 3G08B 4FQHB 1VCAA 5HDLA 4LSQH 3QFDA 1JGEA 1NPUA 4DUWA 1MRDL 3SHSA 4G6KH 4LU5L 3SO5A 1UEYA 2HYMA 3QDAA 3HPLB 3VE0B 2P45B 2J5LC 4QXTA 5KS9B 2D7TH 5DK0B 4GS7B 5J13C 4O5LL 1LNUB 3MJ8A 5ENWA 12E8L 2P5EA 2ZKHL 4P5TD 2EO9A 1ZS8B 3DX8A 2X4TB 1VSCA 5DJAA 3SO3C 1U3HC 5FHBL 4I18C 5IVXB 4KTEL 4I9WD 5LGHH 5HYJD 1MQ8A 1FYTA 2A74B 5DEFB 1EIBA 3PHSA 2Q7YA 2PTVA 4DKFL 2A6KA 2JCCE 5KSVA 3OGCA 2XI9A 3VFUB 1U42A 4LAQL 3N9GH 5E03A 1R3HB 1RJZB 4ZAKA 5AWNL 4HWBL 1HINL 5TPWL 3QUXA 1UH2A 2PCPB 4HIHA 1EAJA 2E8ZA 4GBXC 4J3SA 5J3HD 2CPCA 4G6AD 3BGMA 3RA7H 1QO3A 2QR0B 4JFQB 4XRCA 3BT2L 1F3JA 4JANA 1G6RH 1BF8A 4KV5E 3VFVB 5FM4A 1I1CA 3U30C 3IRPX 3VGDA 1JPFB 5DR5L 5C0CA 4LCYA 5GS0L 4LVEA 2VXVH 1BP3B 5FYJU 2CDEA 5EZOH 3OR7A 3G04B 1U3HD 4WDIB 1A0QL 4LVHC 2E7LA 1AIFA 4G42A 4JPWH 3WXWH 5I71B 3MV9E 3O0RH 4MQSB 4XI5C 5EU5A 4Z18A 1OSPL 5F7YC 3MUJA 4KDVA 3C5ZA 1IGTB 4X9HA 3NPSB 2LU3A 1D5BA 3SE8H 4WW2A 3B6SA 4QOKE 4GBXD 5FYKH 2VZSA 2DMKA 4RMWA 4M02A 4YXHL 5I1LA 3H3PL 2VLRD 3ZYZA 2NY1B 4DVRL 3F7YA 5BVPL 3OWEA 2E6PA 5F89A 2VE6B 1VKXA 1MCWM 3HZVB 5E9DE 1E4WL 1JZ4A 4XMPL 4R90H 2IJ0C 1IQDA 4A2MA 4PJ5B 4FRWA 1E6JL 2D03H 2I25N 4XXDB 3RNQA 1DBAL 1BWMA 3SKJL 5TH2B 5E6IC 1NLDH 1UWGH 2HT4D 5GGVY 5T3ZH 5MEND 1EERB 3NH7L 4HUWB 4YDIL 2DLGA 5DTFB 3QIWA 4XI5D 4ZODA 5D93C 1YPZB 3CFEB 4L3EA 1UM6H 1P2CA 4OD3L 4ZTPH 4PP1D 5ID1A 3PUCA 1KCVL 1QFWM 2IAMB 3VXRB 5INCA 3SN6N 1GGCH 4LMQI 2DJUA 4WRLA 4KPHH 4ODWA 3U82B 4RGMB 2UYLB 3BHBB 2YOCA 5IT2H 5CJOL 1P84K 3KXFB 3W0WB 2WK2A 5HXMA 1MQKL 3OJMB 1FJ1B 2BNRD 4BQ8A 1JVKA 5MP6H 3WO4B 2GYSA 5FYJD 4OZIA 3LN5B 1J0JA 4JE4B 3VRLF 3TIEA 5F3BB 3LV3A 3HLAB 3LIZH 1IAKB 4IDJH 4M62H 3SKUD 2XTJE 5E6ID 4Z5RB 2X05A 1EGJA 1E28B 2PR4L 4IRZH 4P9MH 5GIRB 1KB5B 1BD2A 3DV4B 3K46A 4HJGB 4LOUC 1EA9C 2DAVA 2D7QA 2C3VA 2WLYA 3BESR 4PGCA 1VEMA 5TF1L 5I1CH 4M3JA 3M45A 2MOVA 1IAIL 1MFAH 3I75B 3DO3A 4GSDH 1ZAGA 2P8PA 4JY4B 4N5UA 3T8XB 4AK1A 2RAMA 4DKAA 3DROB 4NWUH 4L3CB 4MJ6B 1LO2H 4B5EA 3U6RA 1H5BB 3SDXE 3O9WC 3V5HA 5K9KB 4EI6A 5MERA 3RGHA 3I6KB 4PJ8B 1OGAB 4OBSA 3BEWA 5I8CA 1VGEL 3PDOB 1DQDH 5HYSG 1V3MA 1KJ2B 1KTRL 2R4RH 3VFRB 5C9KA 1L7IH 2IG2H 4CVXA 4LOUD 4MQXC 3C87A 3FTGB 3BP7B 3NCJH 3NFPB 1B4RA 1XH3B 3PP3K 5B22A 3VGGA 4GLRH 4MNQB 3QDGA 5DVLA 2JJTC 3BKJL 1DDHB 3HUJE 1QBLL 5JOPE 3F12B 4Y2OA 1BHGA 1FL5B 1LO5B 4PTUA 5EO1A 3AGVA 1RZFH 2I9LA 3U1SH 4YHMH 4OCWH 1D5IL 3MGTB 3HPJA 4P59L 4M7LT 4Z7WF 2ICWA 2HAZA 2FX8H 5IV2A 3MV7B 5C6WH 2G75B 4G7YL 2FO1A 3O9WD 5T1MA 4NQDA 4OZHE 5T1LA 3OKEA 3HA0A 1QRKA 4B41A 2DQHH 4ZFGH 3QR2A 5DRWA 4YC2C 4BSVA 4WO4C 2CDGB 3BO8A 4XCCL 4E41B 1XF1A 2I24N 5E7FA 1I1AA 5GJSH 4JFHD 3WIIH 3ZHLA 1OSZB 2Q86A 1CG9A 5C0IA 2YUZA 1FNHA 1AD0A 4C54A 3JV0A 5D9SA 3WCYA 5IOPB 3QB7C 3GSUB 4XZUB 4WWKC 4J8RB 3S3SA 1I7UA 3L7FB 1TQCB 2Z8WC 5JW4M 1A9EB 1F11B 1GOGA 1NC4A 3BQUA 4XCEB 5LKNA 4NNXB 2F5AH 1XF2A 1YMMA 4RAUB 5DVMA 2H2PC 3QO1A 4DVBA 3MOBL 4TVPH 1NL0H 4XAWL 2XA3A 2V5SA 1QYGL 4I48B 5FUZL 4TUKL 1QSVA 3P0VL 1GPOH 2OXGA 1F4XL 4AEHL 1T0MA 4OTXL 4H25A 3BH9A 3HAEH 4RWYL 4WO4D 3GJFK 3V4PL 1QLRA 1JGDB 1AGCA 4ORZC 3L3JA 5AUMA 5HTSA 5MEPB 2JELL 4ZS7H 4P23B 1W72A 2NQCA 4HIXH 1D5ZA 1GHFH 1RUPL 2W9EH 1A7OH 4BZ1L 3TN0B 3RPKA 1AY1L 1LD9B 2MCPL 4MZ2A 5JDSA 1JGUH 1I7RA 1XF3B 5HDBF 2EDBA 4CVZB 2VQTA 4AT6A 5K9JL 4GRLC 3GRWA 3LQMA 4NN6B 1HZHH 4OLWH 4ZUUA 5DJDB 2ZWLT 1FFNB 5DRNB 4AH2A 2EDKA 4JQIH 4NQUA 5GSRB 1ZSDB 5T3XD 3CMOH 2EE3A 4YUEH 3WYRA 4HX1B 1IQWH 2H2PD 2OQJA 1VADA 1T7ZA 4N0CC 1MWAL 4RSVA 5K59F 2R1XB 4H8WH 4K8RL 2DBJA 2KQNA 1IC5H 2V17L 3SCMC 1CE6A 4DKEH 2N7AA 2V6HA 4X98B 1N6QL 2ZZUT 3VXSB 4KXZH 2GK0A 3QWOB 4FQLL 5JHDD 1DUZA 1EEQA 3STBA 3FT4B 1MHPL 2FGWL 2VXSL 4BA8A 1A7QH 5M95B 1IFHL 4WIQA 2ZG1A 1HH9B 4TQEL 4X6CF 3OHXA 1DSFH 1OPGL 4ELME 3L9RA 3P4LA 1M71B 4GRLD 5I8KL 1H3PL 4R97C 2BDNH 4GKOA 2ADFL 3L5WA 3L7EA 4IJ3C 4MJ4A 2AV7A 2HH0L 5HGHA 3NIDF 3NGBC 5FYLH 1I1RA 4JFPB 2I60L 5ALBH 2VUYA 3E2HC 1MEXH 4UV7L 4XCYB 4FQIL 4N0CD 1TITA 3MACL 1YDPB 5BRZB 2J2ZA 1OY3B 3SCMD 1ADQH 1AGEB 3CUPA 3ALPA 4DUVA 3IDGA 1JCKA 3GMLB 5ITBH 3L3IB 2AXJA 5KVMC 2ATKA 5H35B 1FVEA 1Y6KR 4JM4H 1FO0H 2YD6A 4Z7VA 5FAAA 1WAAE 4XP6H 2HLFC 1T7XA 1T03H 4LHUB 3A6CL 4HS6B 3TBYA 4O2EB 4DZ8A 1MRCL 1EHXA 2CK0H 4P46C 1J86A 4PY8I 1J1OL 1UB6A 4ZO8A 1NSNH 1XF5A 1LGVA 3VXME 2BERA 4G9FD 4X9GA 1IGJB 1FL6B 1QOKA 4R26H 2CUMA 1KB9J 3X3FH 4Z7VF 4NUGL 3BPOC 5GXBB 2N1KA 1OVZA 3QEHB 1QTYT 2QQKH 3D0LB 4Y4HC 2NXZC 3U0PB 3DRQA 3NCBB 4WI3A 3S4SG 4D2NA 1WC7B 1VEPA 3ZDZF 1AGFB 5DMGC 4Y2DB 4O58H 1DBJH 3QA3A 4NQSB 4CN4A 1LE9A 4UTBH 2B5IC 2ADJB 5DFVC 1AHWB 4YGVB 2OJZL 4NC1E 3QNZA 3QEUA 3VWKD 1YEKL 3MBXL 2A73B 4XBGA 5EZJA 5L8KB 4FQXB 1HXMA 3F5WB 3NFNA 1IKNA 4I0PC 4DGVH 4WI5A 4MD5A 4GLRI 3FQNB 5E1AA 3CFKA 4OI9A 4KC3B 3D1MC 3DVFA 5FGCB 2EYSA 4JVPA 5DJZB 4HJJH 3GMRB 3MFFA 1YEDA 4V1DD 3QG7L 1C16A 1JF6A 1GGIL 5IVOA 2H45A 2JB6A 2YPLE 3VGAC 2LVCA 4TSCL 4NKDA 2IADA 3T65A 3ULVH 4J4PD 4QY8A 3IS0X 1TZGH 4L4TB 2MQ0A 4WWID 3GO1L 5SV4A 1G7HA 1OAYL 2F54A 4F7CA 1P5VA 2NXZD 5LCVH 4JFDE 5DMGD 2IAND 5L2KA 4NFBA 3PG2A 2YA0A 2AXHA 4KZDL 1SEBA 1J0YA 2EZ0C 4Y1AB 4A6YL 4OKVA 5I74C 4R7NB 3LEXA 4I0PD 5I76B 1H3UA 2NTFA 2HFGH 3LPWA 5H94B 4JHBA 1QR1A 4Z7NE 3MJ7B 5KVGH 2B4CC 2H1PH 4WW1B 2X4SB 1NQBA 3G5ZA 3KPSB 4JRXE 5IMOA 2GJ6A 4TNWK 5GGTA 4W68A 3VXRD 4YDKL 1XGPB 3B9AA 5EU4A 3B9VA 1J0IA 4MX7B 1RURH 2EDJA 4U6HA 2OX5A 2EKSA 1DUYA 4PJXB 5DVOA 4M8QA 5E2WH 4G6MH 2VDLL 1Q9KA 3HG1D 2VLMD 3MZTA 2X7LA 5HVHC 3QHTC 3K8LA 1FGVL 3PWVB 3RGVC 3QNXA 1NMAH 1IGCH 1HSBA 3X14B 1XGYH 4YBQD 1INDL 3DVIA 3MGAA 1BX2A 3BWAB 1EAPB 1L9NA 4JQXA 3FRUB 1KIPB 4Q6IA 1DFBL 3I3DA 5DD6A 1CDYA 2VXUH 2DYPB 3ORJA 4H1LA 4Q9RH 3QUYC 2AGJH 3EYFB 3G9VA 4P49A 1Y0LB 4DEPC 1A7PL 3L5IA 1JNLL 1S7TB 1ACZA 4GW5B 3J8F7 2HJFA 4XMLH 1NGYA 4F9LC 2HTLC 3L3OA 1NFDA 3L3KA 4BFIB 4OAWA 1IC1A 3X17A 3HNTL 1ETZB 1B2WH 4TSAH 3JWOC 1PGRB 4P2RB 4EKXA 1TFHA 4CNIB 4KJWC 1UC6A 1B0GA 3B3IA 5SV3A 5CD3A 3FT2A 2FLBT 5FDYA 4UMGA 3TWCH 3LMJH 1JYNA 1N6VA 3O8XC 5AAWA 3RGVD 2DQIH 5EBLA 1DCLA 1EEUA 3LEYH 3UC0L 4QCIB 1JWSA 2R1WA 5AYQA 3D87B 5IFAH 4LCCB 3MYZA 3ARGB 5DI8A 1NCDH 1A4KA 4PJ8D 1SJEB 1Z0MA 4K71B 2Z8RA 5LBSL 2YRLA 4UNUA 4W4NA 3BP6B 2I27N 2CKBB 3QUYD 3QXAA 2NX5A 4H0HB 5AYUL 8CGTA 5F7NC 5MI0C 4LSTL 4PJDF 3MNWA 2BOCB 4EJ1C 1YY9C 3DPBA 4AZ8A 3BGAA 4GW1A 4G7VL 4LAJH 5GS3A 4JFXB 5FGBC 3VMOA 4JDZB 1HEZA 4U1NB 1MCEA 5I73B 5ADPL 5I30H 2J8HA 5IHLB 5D1ZC 5AD0A 5ANMB 1UWXK 3CZFB 5CJXA 4XP1H 4XGZB 5C7XH 5D8JL 1FZKB 4ZS6C 3O8XD 2AXFA 2HKHL 2WP3T 1WFTA 1D5XA 3VFWB 5HDOA 2VDPL 3RIFF 2N7BA 4NT6B 1KB5H 1I3GL 1KLGB 3BN9C 5ITFA 5IHBA 2W0FA 4FN0A 3X12B 3DXAE 3RWEA 4KKAD 4LCUB 1P5UA 3GDBA 4E41D 3SQOL 4GXUM 2YRPA 1VA9A 4FZEH 5IWLA 2DWEA 1U8HB 5D70H 5IW1A 1CVSC 4FQJL 4F57L 4WEBL 1FBIH 4MJID 4ZOBA 3K1KC 4W4OA 3LKPB 4PJGE 4JPIA 1MCBA 3UJTH 5HGAA 5C07B 4Z77A 3M8OL 3QT2A 5D1ZD 2LFGA 4D9LL 2X1QA 3DX9A 4HUXB 1X44A 5AZ2H 4C56E 1MWAB 3FMGH 1MFDL 2AJYL 4ZS6D 5KS9F 3ULVF 4MHHG 5JR1L 4G6FD 4JFZL 3ELAT 1KJ2H 2O5YL 3DIFB 1M6OA 4G9DB 4GUPB 4NQVA 1BVKB 4KKLC 1YEIL 4RFEA 4AJ0A 5SWSB 5SWZD 2D7PA 2FR4B 3D3VE 2F74A 2BP3A 1OW0C 1U93B 5EC2B 5C0BA 4KUCD 1FL3B 1Q9WA 3ILQC 4XP9L 3RWIA 3SDCC 4GXVH 4HWUA 2D3VA 4QT5B 1V7NL 5BZWB 5IMKA 4GRMB 4IIQB 3KGRA 1XF4B 3TN0D 3ULSB 2F19H 5C2BL 5BS0A 3LKQB 1WZ1L 5JUEL 4U1KA 4MJ5A 3P4NA 3BWUC 1C5BH 1Q0YL 3HE7C 3MSPA 4PJ7A 1G7JA 4ZNEA 1YYLL 5HHPA 2P8MB 2PYEE 3FZUD 3HI5L 4ODSH 5T5FH 4EVNA 5HYSB 5DDHB 3OAYK 5C0GA 2XNAB 1MCWW 1LEKA 4K7FA 4QKXB 4L29A 4JREC 4F15C 4Z8FL 5GS0C 4KKLD 4PG2C 4HC1L 4XXCC 1IC7L 3RAJL 2ZCHL 3OKNB 4R7DA 4AIZA 1C12A 3HNSH 3C09B 3VXSD 1Z2KA 3O81A 4U7SA 1QD0A 4PJ7F 1A7RH 5I8OH 4FXGA 3ZHKA 4HXBL 4LEXH 4JHAL 3ILQD 1KLUB 3SDCD 2MQ3A 2YPLA 3INUH 1HN1A 5DRZA 3CXDH 3X13A 1EJOL 2I26N 5FKAA 1AP2B 5EUOB 2IQAA 2R2BA 3AREC 4QLRA 3V9FA 3WDJA 2Q8AH 1QFHA 2R0WL 4PV8A 3HE7D 3BDYL 1S7WA 1WFUA 1YN6B 2RGSA 3TO4C 3AFLA 5I19L 4MNGE 3IFPA 3K81A 3AM8C 3CDGA 4XPHL 5GS0D 1TJGH 2O5XH 1MJJA 5BRZD 4Y4FA 1BWWA 1W0WA 5D7LE 5DJ2A 2EECA 5H37H 4DKDC 1EVUA 4EIZC 1MCKA 2Q6WB 5DXWA 3BPLB 2EIBA 5I1EL 5D6DA 4LLAA 1OF2B 4HF5L 2WIMA 3L5XH 3FKUS 3O6MH 3GNML 5HI4C 4PJFA 4ORGB 3MV01 2NXYC 4LHUD 5I16B 4HV8A 4PRHD 3ARUA 4XBEL 4TTDD 1JZ2A 2K3TA 4HH9B 3QPXL 3BFOA 1MHEB 1R5IB 5IQ9B 5SX5K 4X7EC 3TO4D 5DQJB 3CK0L 5FHBH 4E9LA 2VDKH 1U8MB 1MH5A 5FM5M 2J6EH 1I4FA 1XGQA 3R1GL 2JB5L 5F1NB 4FXKB 4WFGD 2HT2C 3SJVE 2XG4A 1QSFA 2B20A 3QCTL 1JV5A 3KYAA 2EDWA 1PYWB 4YIQB 3W5MA 3U7WH 4JO2H 5AWNH 4E5XA 5BV7H 4HWBH 3MV8D 1IEAA 4PGDA 1SY6H 5HBBA 4LQFL 3WIHL 5HI4D 3MYJA 4MCZB 5F6HJ 5KN5B 3P30L 1I7TA 2O93L 5DUPH 4OLZL 2F53B 3CAFA 2ZOLB 3BD3A 3O4LB 4OCXL 1I85C 4YQXL 2VXTL 3T0EA 1KSRA 3WUWA 5KJRL 3MRMB 3WHE1 2QKIA 3ZYJA 2G5RA 4G80B 1B0RB 4G3YL 1ES0B 3GBNL 2ZCKL 4HS3A 2PF6A 3VRIA 2HT2D 3N06B 4NFCA 3VW3H 1N8ZA 2V5YA 5HPMB 1ZA6B 4JY5H 1NDMA 3GM0A 3GMOB 4PJ9C 4XVSH 3WLWC 1N5AA 3IJSB 3O41B 3DUUA 1DQTA 4UB0H 2EYTA 5I66B 3E6HB 3MODL 3GIZL 4ZFZB 4NBYB 4KI5C 3TVMB 1F58H 2Y7QB 3BKMH 3EW3B 2YA2A 5IBLC 3OKDA 1HHJA 1LEGA 2VTFA 4HXAH 4DCQA 4PJAB 1E4WH 2CRYA 4G8EA 1DEEA 4NGHL 5EN2A 4S0TD 3NZ8A 3OKMA 2UZYB 1BOYA 1E6JH 1DBAH 2E8YA 3BKYH 3GB7B 3P11L 3JV5A 3MNZA 3BH8A 3HE6C 1MCRA 1QRND 5C08B 4RGNC 3MRKA 1T6WA 1BJ1J 4L5FH 4KK9C 3L3DA 3D2UA 4OD3H 3CGTA 2F5BL 4U49A 3H9SE 5GZNC 4NIKB 4PJ9D 5E08H 4JHWH 3C6SB 3BW9B 1N59B 5ICZB 4Z7WE 1JZ3A 1V3JA 1JHTA 2HVJA 3D39A 3QDMA 5F71A 1W0VA 2IQ9L 5GJTL 1MQKH 4GAJL 2DYPD 4LSUH 1Y6MR 5I1AB 3KLAB 4HK3J 4KI5D 3PDDA 2LABA 1SVCP 5IBLD 1DJSA 4DK3A 4HMDA 3O3DB 3SQBA 2A6DB 5JPNB 1BFTA 3RZCA 3FT3B 5KG9B 1YMHB 2FX9H 3WFBH 3S4SB 3DYMA 4KMTH 3CFBA 4I4WA 1NMCB 4QHNB 3OXRB 4HBCH 5B39G 1AE6L 1U8LB 4P2RD 4K9EC 1AC6A 2AQ3A 3HE6D 3TA3D 4Q97A 3GBML 2VWEC 4RGND 1BQHA 3VFGL 3ALWA 4WUUE 2UY7A 2C1PA 5C0AA 5ICXA 4M93B 4BQ6A 1PDKA 1RMFH 5GZND 2R0KH 3BRGC 5FYKE 3ARGD 5CMAA 2OTUA 3NN8A 3QEQA 2GFBB 2JE8A 3MROB 3IETB 1CDIA 3LQAH 3UTQB 5I15L 4LGPB 3HS0B 4MDIA 5T5NF 3QISA 5L0QB 4HIIB 3R06A 2APVA 1WSST 1IBGH 3WE6B 4DTGL 3BPNB 3BMVA 3CLEH 3UZVB 4J7RA 1FG2B 1NAMA 3QI9B 5C92A 3GBLA 1JGLH 3TJEL 1AO7A 3HMXL 3R4DA 1KC5L 3CLFH 1A6WL 3N85H 5FO8A 4WV1A 1RZKL 5T3ZE 2I5YH 1CDJA 3JVGC 1FLRH 1NH6A 1MNUL 4NZTH 2P5WA 4JG0H 2XWBB 4OD2B 5HDBE 2DQEH 2C4FT 5C09B 1FDLH 3SKMB 4AIOA 2APTA 3KWWB 5E99L 1G7LB 3ME0A 1HKLL 4AEIH 3W9DB 4R97B 1NANH 3SPVA 1MHCA 1S7SA 1MJ7L 1KNOB 4U1HA 3RDTC 3LS4L 2ERJC 2NY5H 2BY1A 5K59E 1I9JL 1N7ML 1RZJL 1S8DB 2BNUA 3IDJB 1EBAA 1XEDA 1G9NH 1KBGH 4XNXL 3LAFA 2XZCL 4PJIA 4UT9L 1OAQL 1Q94B 4EI5B 4PJHF 5EOQL 1OLLA 5INDA 4JO4L 4FQCL 5HGBB 1CI5A 1H3GA 4NWTH 1YY8B 1SEQH 4L9LB 1RZ8A 5C07D 1N6UA 5IVZB 4X6CE 1WT5C 3HC4L 2XY2A 4I5BA 5E2TL 4K8RD 3DYPA 3CU1A 1F8TL 2CKBH 2DQDH 3IXTB 3VFMB 4MD0A 4QRRB 3KPRD 3VD4A 4WTWA 3TH4T 1JUFB 3PGCB 1BIIB 3NIDE 3KPQB 1CFVL 3D85D 1DN2A 4PRPE 4ZUVB 4F3FB 3UXFA 4MCYB 5E8DL 4NKQB 4ZSOB 5KTEH 2V2TB 1NCWL 2AI0L 4LLDB 4PGZA 2XZQL 5B8CA 4P2QA 2VLKE 2ZSWA 3LD8B 1UCBL 2EC8A 1NBYA 4X6EA 4XAWH 3PDGA 1T4KB 4G8FA 3ROOB 1GZPB 1BVLA 1E6OL 3A6OA 5D2NE 1F4XH 2F15A 4OZ4B 4OTXH 1GOFA 4YHOH 4HPYL 4HKBB 3JV4A 2X09A 1F3DJ 4LIQH 1Q0XL 2D0HA 5CJQH 1NFIB 3ZE1E 1TVBB 5F1IB 5KOMC 1T6VN 1J87A 3SE4C 1O7SA 3BZFB 3UTPD 1FAIL 1CCZA 4HUUA 3W9EA 4R4BA 2WBJA 3S6CA 1BVZA 2FYYB 1RIUL 2BOBB 4JB9H 4U1MB 1ZGLA 3C60C 2Z92A 1SYVB 4NDMB 4XAKD 5AZEL 1KXTB 2AEWA 4OQTL 5DC4B 1KTLA 1JPSH 2YPVL 2WW8A 4KVCH 1IM3A 2NW2A 3OSKA 2MHAA 3MRGB 1CL7L 4KAQL 3ZDZE 5JW3L 4NHUA 4M6ML 3L6FB 3KPTA 4KQ3L 1HYSC 2Y23A 4YEFA 3KPLB 2GTWA 1O7VA 5T1KD 3S35L 2HRPL 1C08B 3UYRL 3GHBH 4FQ2L 1JK8B 1ND0A 3DTXA 2R69H 1XIWC 3VH8B 5EA0H 3IFOA 3SDAA 3MRFB 1NCNA 3HRZB 5HVGB 5IESH 3DO7A 2IBGA 2X4OA 4IRJC 3HFML 4JGJA 5GGSA 4AENA 1W0YT 4U1SA 5DD5H 3C60D 1E0OB 1YEJL 4D0BB 5I8KH 1B0WA 3GSXA 2CIKA 2A83B 3ARZA 3C6LB 3N1FC 5KSBA 1A7NH 2DD8H 4FTVB 3MA7A 2G60H 2XFXB 5HYFA 5FA4B 3X11A 4FQIH 4RA0C 3OXSB 4JY6B 2EIZA 4L8BB 2X44D 4TVPE 2GUOA 2OTPA 4NRZB 5ESVB 3BI9X 3W81A 3EYSL 3WJJA 2NW3A 4TULL 5A16B 4NP4H 3G6JA 5CZVH 5CUSL 1S78C 4PJEE 4J12A 5JW4R 2QSQA 1XIWD 3QFJE 4HPOL 5KSBF 3A67H 1M7DA 1KEGH 3MC0A 4K3DH 3O11A 4UAOC 4JFEA 2H9GA 4IRJD 3DVNB 1HXYB 4G8GA 3RP1A 3TT1L 3V2AR 3D9AL 2R2EB 1PZ5A 2OZ4L 4JQVC 3A6CH 5EU7E 5DMYA 2W65B 2UUDK 3OL2A 1T1WB 3L95B 2NY3B 4NZUL 4GQ9H 1J8HB 5I8EB 3MNVA 3CXHJ 2QJDA 3LKSB 1KPUA 2BJMH 5TFSH 5J56B 3GMPA 2R29H 4LCWB 1JYXA 4K3JL 5IB5A 4YE4H 4IOSD 1KELH 5IIEB 2O61B 1WBXA 4NO0B 2YN3A 3MV9B 4R8WH 5EUKB 43C9B 3GUTB 1KG0B 5CZXC 1HDMA 4UIMA 4FP8H 4UILL 4OZFG 2ADGA 4S2SA 3P4MB 5J11C 5FM5O 2BVYA 4IRSC 2FBJL 4QOKB 4EOWL 1P7QB 2OTWB 2E3VA 3G5XA 3U7AA 4PRAA 3QNYB 4ZOEA 3MLVL 3B9KB 5HDQH 2ICCA 3D25B 3BEVA 3WFCL 3CFJA 1T5WA 4P5TA 3O2DH 4ZAKC 5BMFH 3I50L 2XZAH 1GGIH 3THMH 2DQJH 3AMLA 8FABB 3WN5B 5HYJA 2Z31B 4TSCH 1Q1JL 3QCVL 5E9DB 1MCDA 3GJEB 3D48R 1RV6X 1U6AL 3NCFB 5FYLE 2C3GA 1MVUB 2BVOB 3EHBC 2AERT 5IEKA 5F70A 2FB4H 3NIFF 3TVMD 4X4YA 3QG6A 4HEPG 3NVQA 1YEFL 1RJLA 2ITCA 2VZVA 1MVFA 5K9OB 2IPKA 4D3CL 1LP9E 5D7KD 4OGXL 1AD9A 3MLUL 1T2JA 4HFWA 1V3KA 1KCUH 1PKQA 1YN7B 1D6VL 2YEZB 1UFUA 3I02A 3QEGL 4JEGB 3FJTA 4PJDE 3RWGB 4IRSD 2CDFB 2GI7A 4NN7C 4ZD3L 1L9MA 1F6AA 2ZSVB 2OYPA 2GJZB 2DQCH 4NO3A 3I9GH 3MBEC 5C08D 3EOTL 4NQED 3QZWA 2YBRA 3B5GA 3IKCB 2FDBP 1BM3L 2VOTA 3P73A 4PLJC 1NCCL 1TDQA 1ZEAL 4YNYB 1X6NA 1TTFA 1T0NA 4UT6L 1JNHB 1U3HA 4KY1L 4WW2C 5E7BA 2V2XB 5C0ND 3ZYIA 4BFBD 3S5LA 1H15A 2ORBL 4JFYA 5K33A 1JMZA 2VQUA 1UZ8B 2P44B 5JIKA 3IFLL 3MLZL 3UX9B 4U6YA 1H0DB 1HQ4A 3V4UL 4GKZA 3VFPB 2VISB 4GBXA 1YEHH 4PB0L 3KPOA 4RRPG 2VLRA 3MLXL 1LWRA 5LGKA 1JZ6A 1U3YA 1BZ7B 3GJFA 3PWPB 1DFBH 5EG6C 1FNGB 2R0LL 3LKOB 3LPGA 1WEJL 1AGBA 3FONA 4HGWB 4OKDA 3MBED 3QIWC 4HT1L 1LILA 4RAVB 5IG7A 1LK3L 4PLJD 1WCBB 1S7XA 4MD4B 5GGRY 1K6QH 2QBWA 1JYVA 1VFAB 1HIMH 3MRIB 3HNTH 4YO0A 3QH3B 3O6FD 3M17A 4M6AA 1S5HA 1Y18A 4QHLB 4YFLI 3T77B 3WIFA 5MENA 3MRPB 4IMKA 3QQ3A 4OZGF 3AS3A 5KS9E 3ULVE 3FQTB 5HYQB 4U2YA 2X4UB 1FFOA 1ZGLM 5DHVB 3HI6L 3P9MB 3NFSH 4QF1B 1XGTA 1PSKH 1K4DB 2ENSA 1K4CA 1GIGL 1M05B 2XN9D 3JUZA 5EIIB 3CCHB 5CSZA 1WV7T 3IVKB 3N0PB 3ZDXF 3UTSB 5DS8A 3QCUL 1PFCA 2Z9TA 2DTMH 5LAXA 1HHKA 2BY2A 2BNRA 3TPUA 4HWZB 3MRNB 3LZFH 3HUJB 3N1QC 5AYUH 2X42A 1JTOA 4J3OC 3DUSB 4LLVA 3EO0A 3A6BH 5ESAB 1T5XB 1KCKA 4X5WA 1HCFX 4JZOB 2AK4D 5E6IA 4RGOL 3OV6A 5A2JH 3IDXH 3MLYL 2FIKB 3OKKA 1CXIA 3KPMA 4OZHB 1IM9B 2WBKA 1JHKL 3BZEB 4OM1L 2OR8A 5GGRB 2CGRH 1MF2L 3MJ9H 5FCUH 1J5OH 4LNRB 1P7KB 2OL3H 5KVFL 2VDPH 4NO2B 4HKZA 4EI5D 3DUHA 2X4RB 3Q6FB 4QTHB 1MI5D 2P7TA 5TDOA 1X7QB 4U6VL 2BVTA 5FGSA 3O3AA 4JFFB 1A2YB 4OSUL 4XVTL 2HKFH 5IGXL 2DL2A 3S35X 1X5HA 2XG5A 5D5MA 1WGOA 3K4ZA 3WS3A 3U48A 4PP2B 1E27A 2DQGL 4AIXA 2FEDC 4RIRA 4YX2L 3WFZA 2H32A 2L7JA 4NOFA 5DHYA 2GIYA 1BJ1H 5FF6A 2YKLH 4P4RA 4QRRD 5IB4A 4ZO6A 1Q38A 4HHAB 2AV1A 3FO0H 1T1ZA 2ZJSL 1YYMH 1T1YA 2VH5H 3QWRD 3RI5K 5DVNA 2NY4C 5BZDA 4PBVC 3CSYB 3M8OH 3T2NL 4AL8H 3CSGA 5DF0A 4D9LH 3KYNB 4I3RL 4ONHA 4PJ5E 4PGEA 3DSNA 4PRBA 1EHNA 5LQBL 1DZBA 1MFDH 1I9IL 2EH8L 3RRQA 3V6BR 1C8PA 3QHFL 4ODXA 4JFZH 5C6TL 3O6KL 2DM2A 1TETL 1YPZE 2Y07H 3HZMB 1A5FH 2R4SL 2Y5EA 2X9YA 2QL1A 4X5XB 3RWCB 1EDQA 2J1KA 3IJYA 4Z7UB 4XP9H 2DQFA 3KXFE 5IW6A 3O9WA 3W0WE 4UT7L 2Z35B 5TQ2H 5CP3H 1U58B 1K2DA 1UXWA 1JFQH 2VC2L 1QVOB 3RBGA 3H0TB 3U46B 3VD3A 2BVPB 1I1FA 3E8UL 4V2BA 4QHMA 5CIPB 3V5KB 3NABH 2ILLA 5JUEH 1WZ1H 2NY4D 1J0HA 4HZAA 2AQ1A 3PHOA 3DJ9A 4QRPD 4XPFH 1Q72L 1YYLH 2WUCL 2LE9A 1RIVL 1MJ8L 5MEOB 4ODHL 4U7MA 3HI5H 3DGGB 1RK0B 4LSVL 4NQXB 5ALCH 1F45A 4ODTL 2OK0L 5JIPA 3VXQA 1JHLL 3QDJB 4OCRH 4MNHB 1QPXA 1S9XB 4LCIH 5D1XB 3ESVF 4UINL 4XC3H 2ZCHH 4ZXBC 4PJBB 3RU8H 2H26A 3HI1A 4XWOC 1CICB 1MCFA 2IC2A 1UVQB 3G6AB 4BK5A 1TJHH 5HHQB 4JRWA 3PXHA 5EU6B 2FSEB 3FOMA 4DW2L 3CVHB 5ICYB 1SBSL 1MFBL 3LS5L 2BXZA 3SKNA 1UM5L 2PTTA 4C83A 4OIIL 2BRRL 2QSCL 4DN4H 3V7MA 5F3HB 1IEBB 4M7JL 6FABL 1P6AB 3S98A 4WO4A 4XNMB 2XQBH 3BD4A 4N0YH 5BJTB 2WWKO 2FJHA 5BQ7A 1LQSR 3DRTA 1BZ9B 3GEWB 3WXVL 5D96B 1OGAE 1Z3GL 4NNYB 1JZ8A 4PJAF 3BOVA 2BFVH 2FO4A 3JXAA 1A02N 4MXWL 4I2XA 1S7RA 5BVJA 5D2LB 4ZMAT 1T3FA 4K94H 3KYKH 4ZXBD 4ETQA 2ATPA 2ADIB 4ZUSB 3BP5A 1KT2B 1NGWB 4XWOD 5BXFB 4XPAH 1IKFH 1MFCH 3LQZA 3Q3GB 4MNQE 2XA8L 4FG6C 3VG9B 4AMKH 3STZA 4MAUH 4RBPK 3HRPA 4KJQC 4HF5H 1UACL 3IDYC 4BSWA 4E42A 2X70A 5IB1B 4LSPL 3GNMH 4X6DA 1TCRB 4RCAA 2H3NB 5CEXB 5CSGA 3WFDL 3G5YA 1P4LA 4GQPH 4URTB 3VXUB 1D9KB 4RQQB 1IILE 1YNTB 1FHGA 5JPMB 3OZ9L 3MV7E 5JHDA 3UYPA 3BE1H 1P4BH 4YPGB 4CU8A 5JXAH 5D7JC 4MAYD 1ZHNA 3QYCA 3K8MA 3MLTA 1MIEH 4H20H 5JHLL 1ZLSL 4PUBH 1T04B 1MCPH 4TRPL 3R1GH 3RPIB 4E41E 4GRLA 4HZLB