3N9GH

Crystal structure of the fab fragment of the human neutralizing anti-west nile virus mab cr4354
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
230
structure length
230
Chain Sequence
b'EVQLVQSGAEVRKPGASTKVSCKASGYTFTHYYMHWVRQAPGQGLEWMGIINPSGGSTTYAQKLQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDWGSNYVWGSYPKYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab fragment of MAb CR4354, heavy chain
publication title Neutralization of West Nile virus by cross-linking of its surface proteins with Fab fragments of the human monoclonal antibody CR4354.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 50
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2010-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n9gH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n9gH01
5JUEH 3HHRB 4I0PB 2KH2B 2E6PA 3RUGE 1A47A 3IFNL 4JO3H 5EIVA 1IVLA 3O6KH 4EDWL 2Q1EA 2EH8H 2X1PA 5GS0H 3DJ9A 1B4JL 2G75B 5C0CA 3VD5A 3BKJL 3QH3A 1CDJA 4Y19D 4KU1A 5CWSA 5T1MA 3X13B 4HGMA 5D71L 2J88H 3S35H 1YC8A 3QFJA 1QBLH 1MLCB 3DUHA 4FQ2L 1D6EB 5DJDA 1X5HA 2V2WB 4PJCE 2GJ6E 4LHUB 4R2GC 3DV6A 5K9JL 3ZYJA 3GMLB 3H3BC 5GGVY 1CU4H 2VXSL 1Z9OA 1OTTC 2FZ3B 4KK9D 4PYGA 4JRYA 2X9WA 5GS2H 1RUML 4PR5B 4LSRL 4TNVK 1ZT1A 4U1LA 1NGWB 1YEJL 4YK4B 3EFFB 3LEYL 2ESVE 1FCGA 1BD2D 4XCEB 5HGGS 4Z7NE 1DN0B 1PSKH 4PJXE 3TNMA 5AYQA 5SV4A 2VABA 5SWZD 1NANI 5BMFL 4GBXB 7FABH 3VG9C 2CMRL 3V6FB 4GAJL 1FL6A 4XNMA 4AM0B 4FXKB 5IVZB 1EHLL 3S9DB 1ZGLA 4FZ8H 1N0XL 3HMXH 4HV8B 4BQBA 4DEPB 1RULH 4KWUA 3OL2A 1BBJB 4Z77A 1CS6A 3ZO0A 3DO7A 2R1WB 3G5ZB 4Y5VC 2V7NB 4RGND 2RFXB 3RVVD 1MHPL 3WXWL 4AYFA 3NABL 1U8OA 1KCKA 3OKYA 4TSAL 5EUOB 2PW2B 4DGYH 1MAMH 2WMPA 1T7WA 3FMGL 1SYSA 5C09E 4NO0A 1F11A 4FQHA 3GJFB 3OAZK 3LY6A 1YN6A 3QRGH 2AJUH 3M17A 3PWJA 4HWNA 4OJFH 2IANB 1I85A 2DQHH 1DN2A 3BD3A 4DGVL 4HIEA 1NSNH 3IU4L 3TBWA 4MYWB 1G9ML 1TZGL 4ZUWA 1MH5B 1IKFH 4JDZB 1X5FA 2HJKB 1QLRA 1GOGA 1TTGA 2XZAH 5JORA 2R29H 4P5TC 4B7IA 4WFEE 2DLFH 1AQDA 2VDOL 1T2JA 2AJ3A 4Q9CA 3A0OA 1EPFA 3LKOA 5FGCE 5C0AB 2VUYA 2P8MB 3D0VB 2A9NL 5TPWL 3IJHA 1EAJA 1BVKA 1DVFD 2PXYC 2A74B 4OKVB 3JWNC 5I1LA 1T1YA 2Y07L 1FPTH 1KIUA 3HAEA 3U9PH 3QEQA 5K33A 5C0FA 3RBSA 3UTZB 1XH3B 5HHXH 2QQLH 3ARDB 3KJ4B 3NVQA 1C16B 3S36X 1K85A 5I18H 3P73A 5C07D 3SDCA 1CGWA 3V4VL 2D03L 5F88B 2ATKB 3MGTA 5DRXB 4WTXA 4G7YH 4JRXD 3VXRB 3MRLA 1AR1C 3IDJB 4ZTOL 3TCLB 4F9LA 3HE6B 4PJDF 4K94L 3CLEL 2J8HA 4EI5D 4EN3D 1ZXQA 2IANE 3L3JA 3BZEA 3OG6B 4M93C 1I1RA 4MD4A 1OP3K 2A6JB 4JZNB 2BDNH 4PP2B 2P48B 5ITBL 4PLJC 3G6AB 1CT8A 2Z91B 3QXAA 2P43B 1ZHKA 5GGQL 3DXAE 3MO1A 1JRHL 5DD5H 5IBLC 3UP1A 2A9ML 1T83A 3UPRB 1WWAX 2VLRB 1KFAH 2WQRA 1QRNB 3H8NA 1ZHLA 5EN2A 5I2IB 3U7YH 5ESAA 4ZUVA 1T5XA 3P0GB 5F9DC 3TWCH 1RMFH 4C57C 5J6HA 3MFFB 3SDXE 1J8HD 3ULUL 4EI6A 4HWUA 1P4BL 2X4QA 3FQXA 5DSCA 4JQIH 3K4ZA 1UYWH 1JF1A 2XWJB 3MCKB 5DUBB 2XA8L 4UDTA 5D2NA 5EOTA 1UACH 1PZUB 5I66B 1D5XA 4N9GA 2AXJA 3PUCA 3PWPD 3KPLB 4RMVA 5DMYA 5KSVB 3B9VA 1FE8L 3DROA 4PGCA 5IM7B 1VSCA 3BN9C 4DKFH 2LU4A 5HYQB 1CCZA 3MTRA 3BISA 1VADB 5HVGB 2AXHA 1YA5A 5HBBA 4ERSH 2AS5M 3MXVL 3HI1B 3EJYD 1ZEAL 3A67H 5E9DD 4RFOH 5CILH 5HHPB 1QSFB 5C6WH 4YDKL 5I16A 5CS7A 5ID0B 4KJYB 4Y2OA 1CDGA 1D5MB 4KPHH 3C2SA 3MV7D 1CGTA 3C5ZB 3NCJL 2ICCA 1LEKA 1DQLL 5DHYB 3HR5A 3A6OA 1UXSA 2VLRE 4QKXB 5A3IC 3IS0X 1QFWI 2LE9A 1QFOA 2A0LD 4KQ3L 1OB1A 5EO0A 5DJCB 3G04A 5FCUL 4M7ZB 2HJLB 2XY2A 4PB9H 1K2DA 3O8XB 2IH1A 2HN7B 2DL2A 4N8VB 3DETD 2M1KA 3HB3C 3T2NL 5T1DH 4R3SB 4X5XB 1OSPH 4RGMB 3UBXA 1QO3B 2FX8H 3UXFA 5ICZA 2IEPA 2ARJQ 4JAMA 4PGDB 4F8TA 2DTMH 5GGUA 4M7LH 4YO0A 3EGSA 3O6ML 5EBLB 1ERNA 4ELMB 1Q9LB 4MGXA 2GQHA 3C60B 5KSBB 1JPFB 1MFDH 4XCYB 1FO0H 4NFDA 4OZIA 4DN4H 1OQXA 4HLZG 4LVHB 5DGRA 3SE4A 1EEQA 4L29B 3V0WH 1QSFE 2W9LA 3OKEB 2DQUH 3TBVA 5D72H 3OTTA 4NWUH 3VWKC 3T4YB 2HLAB 1WBYB 2VLKB 1SY6A 1HE7A 4JCLA 3CFKA 5D7LB 3V0AC 3RQ3A 4XAKD 4J7RA 3EYSH 3W2DH 5C0CB 5SWSE 1VGEH 3QEGL 2EE9A 1TZHA 4QXTA 3BP6A 1KOAA 2LAGB 1JGEA 3GHBL 4V1DE 2P5ED 4JVUA 3QH3B 5D5MA 4LSQH 4QHLA 2YUWA 5CWSB 4TRPL 5F1IA 5T1MB 4PJFA 3VH8G 3SJVD 2ORBH 4PREA 3S3SA 4NZJA 2Z31C 3OB0H 3QFJB 4BUGA 3RZCA 1U6AH 5IW1A 3DRTA 5DJDB 1AR2A 1HCVA 1LK2A 4EBQL 1OAKL 5E5UB 3WN5A 4DN3L 3D3VD 5B39A 3P0YL 1KCSL 4JRYB 1FZKA 3QIWA 4P2OA 4G8GE 5MHSE 3B4NA 4WFFD 1FFPA 2HH0H 1ZT1B 2I5YL 4U1LB 2DWDA 2OMBA 3RWHA 1B6DA 3T0VA 3QWRD 4ELME 1QFHA 3BOVA 1YNLH 1A3LH 4XT1C 3GFUA 3RIAF 4HKJA 2NX5E 2NZ9D 1CTNA 2VABB 1WF5A 5T3XL 4KQ4L 4ZS7H 1WICA 4LARL 1FL6B 4L5FH 4XNMB 4BQ8A 4X80H 2ID5A 1ZGLB 5AEAA 1AGCA 4AIZA 1D6VH 4FFYH 3KJ4C 4XPHH 4HHAA 3JV4A 3MRCA 3CFBA 1MFCH 4YDJA 1XCQA 4BA8A 4Z77B 1FNHA 3DO7B 5D7LE 3EJJX 4YX2H 3IAGC 4F15B 1M71A 2APXA 5I75C 3KLAA 2FLRT 1U8OB 4ALAL 1BFVL 2P46B 5CIPA 4C56E 3TFKC 4ODHL 2LAAA 4IDJH 5D6DC 3MV9A 4OF5A 4PGBA 3O4OC 4HW6A 4Q74A 1SYSB 4XC3H 1A64A 1F11B 2IQAA 4FQHB 4TYUA 3D87B 2EDRA 3IDYC 4P9HC 5JHDD 2R39A 2N1KA 2V9QA 1YN6B 3M17B 1MUJA 3B6SA 3PWJB 2E7LA 4IRSD 4HIEB 1FAIL 3TBWB 3TZVD 1JN6A 4WDIA 1Y0LA 5KVEH 4ZUWB 3Q6FA 3FB7A 4NM4H 2FO1A 4MLSA 4MD0A 4PJIE 1QLRB 5DUPH 5CZKA 2CXKA 5DURB 5GZND 5JORB 2J4WL 2VDKL 1AQDB 2AJ3B 4HUXA 3AREA 1NCCH 2PF6A 2W9EL 1LD9A 3STLA 4JKWA 4MLIA 1N6QH 3WS3A 1U8PA 3CFEA 3LKOB 4OGAD 2GYSA 3GJFK 3GSWA 3H2WA 4LFHG 1FNSH 5SWQA 3IJHB 4OZ4A 2JE8A 1MCKA 1KJMA 4JPKH 1RHHA 4NKIL 4NZDA 3QAZB 1O7SA 4YEEA 4M43H 4V2CB 5L7XL 1BVKB 3SE9L 3AMLA 4M48L 4MWFA 5C70A 3BYYA 5I1LB 3NIDE 3NZHH 1WEJL 5EH1A 3HAEB 5JDJA 1KPUA 4PUBH 2GK0A 3QEQB 2B1AH 2IPTL 5C0FB 2MKWA 3K81A 3P73B 4HWEL 3HUJE 3SDCB 5F6HI 5M94B 1FORH 5E8PA 5T33H 3MGTB 1I7RA 5ABDE 2YWYA 1KG0A 3MRLB 1EZVX 1H8SA 5FFLA 3IKKA 1WISA 1MCJA 2Q7YA 4YHMH 3C5ZC 3DVFA 3K80A 3L3JB 3T77B 4H88L 3BZEB 4MD4B 3VRJB 5F7DA 2X4PB 4PBWD 3LAFA 3V95A 2B39A 1JRHI 3W39A 3QXAB 4WW1A 3F58H 5AZEH 5BXFA 4X6DE 3QQ3A 2YSSA 6FABL 2DLGA 1F97A 3MO1B 1TVDA 3C08L 4G6KH 4OZHF 4P4RA 2OCFD 2A77H 1U8QA 3O8XC 4NP4H 3W0WD 3RWIA 2VZ3A 4W4NA 1ZHLB 5EN2B 4JFDA 5ESAB 4ZUVB 1T5XB 3IS1X 1C5CH 4FQJH 1T2QH 3GBLA 2EIDA 5J6HB 1T4KA 3O3DA 3PABA 2RIKA 5IMOA 3P30H 1U41A 4EI6B 2X4QB 1RZJH 3FQXB 4X7EC 5EU7E 1JPST 4OD3H 4CRPA 4DAGL 1HK6A 4LPYA 2VNCA 2YD2A 4OIIL 1G0YR 3DMMD 3UROR 1MJ7H 2BCKA 4UDTB 5D2NB 3REVA 3QEQE 1A6UH 1D5XB 4PB0L 1KXTB 4N9GB 4QYOA 3NH7H 4MJID 4Z7OE 3D85A 1H8OA 3DROB 4TULH 5HDBE 4OCMC 2R9HC 3KLHC 4DW2L 4AY0A 5F9AC 4LASL 4PS4H 2PTTA 3DSFL 5IB1A 3IRPX 3QHFH 4KZEL 4IHOA 2D0FA 5I16B 4KK5D 1V05A 2P49B 4OUUA 4QXWA 5FM8A 1IT9L 1CLZH 5HVFB 3MV01 3BHBA 2COQA 1RUQL 5I74C 3SCMA 4G43A 3RWFA 5FUOL 4OLVL 4Z7WE 1Q0YH 4L8CA 3HR5B 1C1EL 4HBQA 3SOBH 5HHQA 1UXSB 4U7SA 3ULVH 3QJFA 2KZ1B 4OCXL 2OJEB 2F54A 1OB1B 5EO0B 3KAAA 4EDXA 1IAIM 5DDHA 4GUPA 1ZLWK 2W0LA 3Q2CA 5DQ9A 4IMKC 1K2DB 3NA4A 5IB2A 5BS0A 4JR9H 2IH1B 1UEMA 5I76A 4R2GD 3O2DH 2AJVH 3ULVF 3F12A 4DVBA 1OTTD 5FYLD 5D7IE 3WUZA 1UFUA 3UBXB 1T7VA 2Y25A 4LGPB 3T0EB 5ICZB 4JAMB 4HC1H 5GGUB 4DKEL 4YO0B 3EGSB 2H3NA 4O4YH 2D4DA 3CAFA 1RI8A 5JOFA 2JLLA 3U36B 5D8JH 2B0SL 1YNKH 2E9IA 1HHIB 5I1EH 1Q72H 3TT3H 4ISVA 5I6XB 1RUAH 1GGTA 2P8PA 3BGFB 5INDA 4P2CG 4OM0H 5C2BL 3L3HA 4K8RC 2UVEA 4S1SL 1LNUA 2HKFH 3HI6H 1OGAE 3VMOA 1DBAH 3CFKB 3VFUA 3MLZH 3ARQA 1KJ3H 3LPGA 3UDWC 5KSAC 5I1DA 4PJHF 4QXTB 1TZHB 3BP6B 4P23A 1JGEB 4F58L 2XZCL 1S7RA 5D5MB 1UH3A 4U3XA 4QHLB 5KJRH 4MMZC 1AFVL 1I7TA 2JJTA 5F1IB 2YOCA 3GZKA 4FQLL 3I3EA 4PREB 3DOSA 3RZCB 5IW1B 3DRTB 1LK2B 3WN5B 3HNVL 4L3EA 4HUVA 4HK0A 4IEFB 1FZKB 3BGAA 4NC2B 3QIWB 3T0EE 1N64H 1EHXA 1ZA3A 1VENA 3ZHLA 2VXQL 4DCQB 1FFPB 3I2CL 5C0BA 2DWDB 4XMKH 4NT6B 5CJOL 4JFZH 2WQ8A 3RWHB 5BRZA 4JKPH 1SY6L 4P5TD 1G7LA 5EZIL 1NFIA 4HKJB 4HWBH 5A2FA 2GHWB 5EOCH 3FRPA 5EU7C 3AS0A 5F96L 4Q7DA 2AJXH 5IVXE 2FNBA 2I25N 3SN6N 1AGCB 4AIZB 3LKPA 4Q9RH 5HYEA 4HHAB 3JV4B 3TJEH 3CFBB 2NY7H 4GXUN 1XCQB 2PXYD 4WENB 4OZGF 2HFTA 2MQCA 2W0FA 4OUOA 2NMSA 3UTTD 4H1LA 3OJDA 2Y06H 1M71B 3RTQC 3V7AE 3KLAB 4DK3A 3RWDB 5HVWA 2DKUA 4M6AA 3KPQA 5CIPB 1MFAH 2C3GA 1BOYA 3BAEH 1HSAA 5LGHL 5DD3H 3MV9B 4HS3A 4PGBB 2EICA 2IQAB 2BFVL 2E6JA 4K3JH 1Q94A 1AR1D 5JMOC 5DF0A 3UJTL 2ZKHL 3FHAA 1AJ7L 4E0RA 2V7HA 1MUJB 1XR8B 3B6SB 4YHPA 3T2QA 1WZ1H 1NBVH 3PWVA 4UILH 4XNUL 3BX7C 3VD9A 4OZFA 1JN6B 2XNAA 1RV6X 4WDIB 1Y0LB 3NOIA 3MPCA 4PLJD 3Q6FB 1UCBL 3FB7B 5DJXA 2UZXB 4MD0B 5HVHB 1YUHA 3DLQR 4LDLB 1QPXA 4UAOB 1BOGA 1FVEA 4Z6AT 1NMBH 3TA3C 5IBLD 1NEUA 4KVNL 3GB7A 4HUXB 1U8LA 3AREB 4YHKH 3FB8A 1LD9B 3STLB 1BWWA 3ARTA 2GJ6D 3EO9L 3WS3B 1U8PB 3CFEB 3QBTB 1IGML 1J0ZA 3GSWB 2F8VA 4MQTB 4WO4A 1MRFL 4B41A 4OZ4B 1GIGL 4XC1L 1CK0H 1KJMB 1RHHB 4PJ8A 3EFDH 2HTKC 2W9DL 4S0SD 4MWFB 4W4OC 2ESVD 5C7XL 4M7KH 1CLOH 1HNFA 1KPUB 3WFBH 3SGKA 2GK0B 4FNLH 3N85L 1S7SA 4FP8L 5E0QA 2GY5A 5JIKA 1M05B 1L9NA 4LSUL 2XOTA 2R15A 4B7LA 3QUXA 2DMCA 3LD8B 2LTQC 4JFXA 1TJHH 3BN9D 5E8PB 1I7RB 5FUZH 1KG0B 2NY3C 4LIQL 4KHXH 3QO0A 1F4WH 3MCLH 3TP4A 3VXUA 4G9FE 5CSGA 2V5TA 1MCOL 5L8JB 5GRVL 1XR9A 1NANH 4UV7H 5F7DB 3VA2C 4AZ8A 3O0RH 4P5MA 3HPJA 4PJBF 2QSCH 3NN8A 3L5JA 3G9VA 1KBGL 2Q3ZA 3H3KA 4TNVF 3MUY1 3V8OA 3W39B 4WW1B 5BQ7A 5BXFB 2J5LB 4P59L 3QQ3B 5C09D 2YSSB 3T65B 4X5LA 2D3VA 5HD8C 5IMMA 4P4RB 5FGRA 1KIRB 5F3HA 1U8QB 2ADJA 1LO0L 4X9FA 3RWIB 4RQQA 5A3ID 4X4XA 3RU8L 4LHUD 4JFDB 1V7NH 2C1OA 3U48A 4K2UH 3VGFA 6CGTA 4F57H 2PO6A 3DX9B 3T0EC 1XF3A 1T4KB 3O3DB 2XTLA 3PABB 5IGXL 5IMOB 4XBGA 2XQYG 2HMIC 1OLLA 5KANI 2YUZA 3U0PA 3HB3D 2OLDA 3OAZH 4NQEA 4PJAA 1LO2H 2ZUVA 2BCKB 4WFED 3REVB 2NR6C 3CFCH 4F9PA 5LJYH 2D7NA 4OCYL 3VWJA 3L5WA 1P69B 3MYJA 4P46C 4QYOB 4BH7A 5HPOA 3WIIH 3D85B 4HXBL 1I9JH 3MODH 5F7UA 3SKJL 4QXUL 4OF8A 1O7VA 4G6MH 2R8SL 5IBTH 1UA6H 2P42B 5IWLA 3L6FA 3B9KC 2EIEA 4RMRA 1GGBH 2PTTB 3Q3GA 1E4XL 3CMOL 1NKOA 4IHOB 4NQCD 3VWKD 1N4XL 4OUUB 3DHMA 5EZLA 3EYUH 3TNNA 5AZ2H 3BHBB 1B3JA 3D1MC 3SCMB 3KJ6L 4G43B 1OWWA 3SKMA 1Z3GH 4MAYA 5E7BA 3MXWH 1I3UA 3U9UA 4LSSH 4L8CB 2HT2C 5HHQB 5LAXA 1N5YH 2MPAL 4M6OH 4ZOCA 4K55A 3QJFB 1JE6A 1VPOL 3HC3H 5F72S 1RZGA 3WUWB 1NLDL 5HPMA 4AEHL 4KUCF 2F54B 2YRLA 3TJHC 4EDXB 3KPRE 1MY7A 5DDHB 4GUPB 2Z31D 2HT3C 5DQ9B 3KHQA 4XP4H 2ED7A 5IB2B 5BS0B 4I9WE 2HFGH 2I60L 4NDMA 5I76B 4OLZL 2GTWA 4AQ1B 4FMKA 3OB8A 1TQCC 3DXAD 3F12B 1H3UA 3JUZA 1U36A 1FLRH 4DVBB 5DRNA 1BX2A 3TLRA 4M3KB 4Z95L 4WHCA 2H9GA 1JBJA 1OP3H 5E8NB 3G08A 2H3NB 4RSVA 5E56A 1KLUA 2GT9A 2YD1A 3Q1SH 1CDIA 2G60L 3HRZA 5JOFB 1AQKL 4QXGH 4QOKE 1IAKA 4ZNEA 3F8UB 4M1DH 2AJZA 2MCPL 1A4KA 5JXED 1AKJD 5DC9B 3MLRH 4ISVB 4RRPA 3GMQA 4Z7UA 5E6IC 2C3XA 2IBBA 2P8PB 5I15L 4K9EH 3DO3A 3G5YA 1LNUB 4TN9A 1ZLVK 2CIIA 4WI4A 4PRPE 2HLFC 4P48A 2E8ZA 1FQ9C 5D7SH 3BFOA 1FIGH 1PGRB 2NNAA 1HHHA 3VFUB 3SGEH 4CU8A 3UBXI 1UM5H 2VC2H 1MCSA 5I1DB 2V2TA 4P23B 3TFKD 1KN2L 5SX4H 1S7RB 2FH8A 3V5DA 1I7TB 1IBGH 3BZ4A 2D4FA 2F54E 2OTUB 1U95A 3AY4C 1W72A 3P0VL 5IROC 3UTOA 2LABA 4NNPL 2W65A 5E99H 2IPKB 4JVWA 4PJ7F 3QG7H 4L3EB 3RPIA 4HK0B 1J0IA 3VFGL 4KGLA 2B2XH 5F9OH 1OQOA 2VLRD 3IKCA 4G6JL 4JG0L 4Y4KA 1II4E 1ZA3B 4KK8C 5I1JH 3BKMH 4IOSD 3QIBC 5C0BB 4M7JL 5BZDA 4RWHA 1CFSA 5BRZB 1FV1A 1G7LB 4FFZH 1V3KA 1MJUL 3GNML 3VE0A 5E1HB 3WO4C 4LSPL 5ELIA 1A7NL 3LKPB 5IQ7H 3HS0A 1A6VH 3LD8C 2W0FB 1RUKL 3ETBF 2RAMA 3REWA 4H1LB 1QLFA 2BSTB 1S9KC 1J1PH 4JKMA 3OJDB 2X89A 3O6FC 1YJDH 3SO3B 5T1KA 1U8MA 2WBWB 1GRWA 1PJ9A 3F65A 43C9A 3D9AL 1HSAB 4XVUD 3G6JA 3L9RA 4HS3B 1QSFD 3S36H 2C1PA 3FN0L 1EHAA 3DUUA 1Q94B 4X4ME 3WFDL 3NA9L 2HFEB 5GRUH 1HHKA 2VXTH 4E0RB 2V7HB 1GSMA 1I9IH 3BZFA 2DQIL 3C5ZD 4L3EE 4JHAL 2FO4A 4J4PC 3H0TA 4OZFB 3QP3A 2XNAB 5SWSD 4Z7VE 4V1DD 2D7MA 1RAMA 5DJXB 5A43C 3GRWA 1YUHB 2VH5L 4EDWH 3D18A 3OXSA 1BOGB 1FVEB 2FWOA 1B4JH 1A3RH 2MOVA 4Z7QF 5ETUA 3GB7B 3O8XD 1U8LB 4ZODA 4FS0A 2Q20A 2DDQH 3BKJH 4KJPC 4MNHA 3PDOA 3QUYC 4RX4D 1A9BA 3RVTC 2IG2H 4Y4FC 4GAYA 2JCCF 1V3MA 1GYAA 4G3YL 4WO4B 3KPMA 4YDIL 3QWQB 2R0WL 4L8DA 4G8GD 5MHSD 4LRNL 5DJ8A 1RHFA 5C0IA 2CRZA 5K9JH 1AD0A 3VFVA 3AM8C 2VXSH 3C60D 3RDTC 1FNEA 3L3KA 3CSPA 4JQXC 3GM8A 2VZOA 2NX5D 4LSRH 4PJ5E 3OAUH 5MP6H 4O5LL 1IGCL 4FQCL 3QUXB 3VXME 1IM9A 2YPLA 4LVOB 2R9HD 2VRAA 4RCAA 2UY6A 1T03H 4PJXF 3D69A 4NO2A 1D5BA 1KUMA 3PGFL 1L7TL 5GRVK 2PCPB 1OHQA 3C09C 3QO0B 3H6JA 3KLHD 5BCAA 5BMFH 3BO8A 2CMRH 1ONQA 4GAJH 2VN4A 2EDTA 5D7LD 1EHLH 5EU4A 2OMNA 4KRMB 3CX5K 3SPVA 1N0XH 1XR9B 1KTRL 2BNRE 4P5MB 3SGJC 4MJ6A 3HPJB 4C56D 3NN8B 5CJXC 1EEZB 4X6EA 4GG8A 5BQ7B 1MHPH 5TH2A 2P1YA 1K3ZA 2Z92A 3NABH 2H32A 5IMMB 5F3HB 3ZT7A 3C8DA 4W81A 3ZDZE 2ADJB 4TSAH 1KC5L 4JQVC 4RQQB 2R4RH 3D6GA 1HXMA 3K2MC 4LMQI 2C1OB 2DM4A 4BFIA 1OF2A 2I26N 4I18C 3NAAH 4C4KO 1TZIA 2PO6B 1XF3B 5F3BA 1H3GA 4XBGB 1HSBA 3M45A 1UM4L 3U0PB 3ZTJH 4DGVH 3X17A 4NQEB 4PJAB 3S4SG 3CJJA 4JHBA 1JZ2A 1EAPA 2R69L 5J13B 1G9MH 1RZFL 1HEZA 2ZUWA 5LBSL 2LQRA 3VWJB 3L5WB 4R4BA 1BWMA 3MYJB 4L4VA 4BH7B 5BV7C 3RP1A 2MWCA 4FQQA 5E1AA 5E8OA 3A6BL 5EDXA 1CQKA 1E4XI 4P2QA 5EU3A 5CUSH 2VOTA 3L6FB 4ZXBC 5FHBL 2A9NH 2HG5A 3Q3GB 3WHE1 4K8RD 3C6LC 5KVGL 5B38G 5IHZA 4XTRC 5EZLB 3TNNB 2HA1A 3GJFH 1KSRA 1R3IL 4XNQA 3RA7H 2Y07H 5J9PA 2AGJL 3SKMB 4MAYB 3HZYA 5FK9A 3BJ91 4DOHE 3U9UB 2NY6B 3B9DA 1MCBA 5KSAD 5LAXB 5EUOF 2AJYL 1P4IL 4M4RA 3V4VH 1XGUA 2D03H 3C9NA 5TGBB 3CVHL 5HPMB 1ZANL 5TFSL 4ZTOH 3QNZA 2BNQA 2HT4C 4NDMB 1G7MA 2GTWB 1JPTL 4M03A 1EVUA 1QKZL 2AEPL 3JSSA 2UYLA 4LHUG 1L6XA 1TPXC 4BM7A 1FNGA 5ITBH 1BX2B 4FZEH 3WNPA 4UB0L 1MVFA 2H9GB 4MXVE 3VG0H 3G08B 3H9HA 5GGQH 4TVPE 1JRHH 1KLUB 2GT9B 3PWLA 3HRZB 1SBSH 3TVMA 3RX8A 1P7QD 2R1XA 1IAKB 3BPLB 2AJZB 2E7MA 1A4KB 3ZTJG 2VN7A 3GMQB 4K3DH 4Z7UB 3WE6A 3FB5A 1JZ7A 4Z0BH 2ZUXA 5FF6A 1TJGL 3G5YB 3VFSA 4G8EB 2CIIB 3RNQA 5IJKC 4JB9L 5D93B 1U3YA 2NNAB 2PYEA 3FQTA 3QDAA 1HHHB 4IBLT 2BNUA 3RTQD 3M8OH 5CEZL 4F8QA 1UJ3A 2V2TB 4LNVA 1HOCA 4LAQL 3LEXA 1HKFA 3DVIA 3ULUF 4P9HH 1L9MA 1B90A 3V5DB 5D1XC 1IJ9A 2ZPKH 3BZ4B 2ZUYA 1P84K 1HZHH 5JR1L 4WU5B 3V2AR 4NIKB 2DI9A 1W72B 2IJ0C 3RGHA 3MXVH 5CEYA 1ZEAH 3LH2L 1D9KB 1MQKL 2QQKH 5E2UL 3B5TA 3IKCB 4Y4KB 2AEWA 1BZ9A 1N6UA 4FQXC 5BZDB 3UO1H 4WTZA 3NCJH 4UQ3A 1CFSB 1DQLH 2R0ZL 1FV1B 2HFFA 3TA3D 4POZC 2IGFH 4J3SA 1GC1C 3OQ3B 1H15A 3K8MA 3IETA 4KQ3H 1VA9A 2UWEA 1JIBA 2XG4A 4RMUA 1NFKA 2XKUA 5HI3C 3KVQA 2YUXA 5F9WB 2BSED 2HRPL 4OI9A 3GIZL 2WM0A 1ADQA 3BYTA 1K5NA 2GSGA 4X7FC 3HS0B 3HR6A 1BQLL 2HTKD 3CZJA 3R06A 3ZL4L 4RDQF 1W72L 3REWB 1ZLWH 2XIDA 5JQ6H 4P2YA 4LKCA 3VU2A 2F19L 5T1KB 3UYRL 1U8MB 1YN7A 5CHNA 1KENH 2Y5EA 1M1SA 3O6MH 3G6JB 3L9RB 4XX1E 5ECJE 2W92A 3K8LA 5K9QI 2C1PB 4R4FL 2NY3D 3DUUB 4CNIA 3LS4H 3RWCA 1OGAD 1HHKB 1OARH 4GQ9L 2WBJA 4GXVL 5KZCD 2CUHA 3BZFB 1NBQA 4Y7MA 2FO4B 4KVCL 3H0TB 1CDHA 4PRIA 5LQBL 3EYQC 1J7VR 3CLFL 4CAGA 1K9TA 3OGOE 1OD7A 3D18B 3OXSB 3LVEA 2EDYA 1RURH 1K6QL 2FWOB 2CUIA 5HD8D 1DANU 2EDEA 2VKWA 2VAAA 3PGDA 5ETUB 3QEGH 2C4XA 3F5WB 4FHBD 3GHBH 4MNHB 2R0LH 3PDOB 4TRPH 4U2YA 4GAYB 4YZFF 4YHYB 3G6DL 4APQC 5D1ZA 4LRIA 3KPMB 3S88L 4L8DB 4NN7C 3T0ED 4XI5C 3NTCL 5DJ8B 1UM6H 5DUMH 4S1RL 3IFLL 5C0IB 4XP1L 1AD0B 3VFVB 4M7LT 5F7YC 4WWKC 3BPNC 3KPOA 3P0YH 4N0RA 5ENWB 2NR6D 5H37G 1FNEB 3L3KB 4NCC1 4EXPX 3OPZL 4PG9A 1K4DA 4RDQG 2I5YH 3OGCA 4P46D 2EDOA 4RAUA 5DVLA 3G6JE 1IM9B 2YPLB 4ELMF 5KSBF 4CU7A 1QG3A 3D69B 3GRWL 4NO2B 1D5BB 3VFTA 3QSKB 3PNWA 5EWIL 4KQ4H 3BO8B 2Q87A 1ONQB 4LARH 3B9KD 5EU4B 2MQ0A 1S7UA 3SPVB 5I1HL 3BUTA 3P9MA 1QBBA 1LDPL 3FQNA 4XXDA 4UU9A 1J0YA 4MJ6B 4X6EB 3DNKA 4GG8B 1J86A 3ARFC 4CN4A 1RZKH 2JJUA 3WNOA 1N26A 5TH2B 3BUYA 5HI4C 2Z92B 5J12C 5J8OA 2H32B 2HT2D 3KXFA 1BIIA 3RVXD 2EC9U 1OAYL 1HXMB 4J8RA 4TSBL 4BFIB 1OF2B 1W0VA 4HAGA 2H45A 3AS3A 4JFYA 1T89A 3TJHD 1TZIB 1C7SA 2HT3D 1IZKA 5F3BB 1JF5A 2DLEA 1HSBB 2NY5C 5DJYA 4E5XA 4DFHA 4KRPB 4LLUA 1FAIH 4N8VG 1EAPB 2VQ1A 4JY5L 1HEZB 2AERT 3S97C 1R3HA 3P4MA 4R4BB 4QY8A 4L4VB 2GFBA 1NUDA 2YPLE 4ZYKA 1KTLA 4FQQB 5E1AB 2J4WH 5E8OB 2VDKH 3SDAC 4BQ6A 3UMTA 4K8RH 4P2QB 5EU3B 2QHRL 1U8HA 2HG5B 5E5MA 4GMTL 2ZOLA 4NKIH 1W8OA 1U9KA 3S34L 3NCFB 4H25A 5IHZB 5L7XH 1F4XL 2HLFD 3SE9H 3NIDF 4RGOL 4XNQB 3RFZC 1RIHH 2MHAA 5J9PB 2A6KA 2ZWLT 3UYPA 4OKDA 5IR1A 3JTTA 3HZYB 5FK9B 2IPTH 2DLIA 1MCWW 32C2A 2L7UA 3IDNA 4X83A 1FYTB 4KGJA 2EO9A 1D9KC 2X1WL 3RY6A 4HWEH 4G9FD 1XGUB 3C9NB 4YXHH 2FGZA 4JO4L 1BD2A 4YIQA 2X7LA 5D2LA 1GGCL 3CPLB 1E4KA 4NNXA 3QNZB 2FIRT 4OFIA 5SWZA 1LEIA 5SX5H 1WT5A 4MCYA 3D2UD 1VACA 4JO3L 3QO1A 4JJHA 4N68A 2UYLB 3N1PC 3ARED 1MCRA 4PBVC 1FNGB 4GSDH 4KK8D 4JCMA 3QIBD 4M6NH 5JLZA 2FATL 2OK0L 3QUKA 3H9HB 3T3ME 5HHOB 3MRJA 3ZKXC 5F7MC 1WZKA 5IVNA 3C08H 2J12B 3TVMB 2V2XA 3DWTA 3HAEH 2R1XB 1QBLL 4P2QE 2P24A 2V9RA 4UOW1 4OI8A 4OTXL 4RWYL 4MA7L 3WE6B 1BGXH 3VXPA 3FB5B 4J3WA 4UBDD 1JGLH 5FF6B 1KYOK 3VFSB 4MDIA 1MREH 3RNQB 3MJ8B 1TCRA 3KPNA 4O51A 2PYEB 3FQTB 5DJ0A 3TM6A 3ZDXE 2BNUB 4B50A 3O6FD 1FYTE 3PL6B 3GSUA 4Z7OF 2QQQA 1UJ3B 4IJ3C 1VFUA 1T1XA 4M9PA 1FNFA 5AWNH 1HOCB 2CR3A 1QR1A 7FABL 1MF2H 1YECH 2XN9A 2DJ4A 4CVZA 4NQDE 4U7KA 5CGYC 4FZ8L 4AENA 1RULL 2RB8A 1U93A 5CEYB 3HE7B 3UZVB 4YQXH 1YEIH 1PQZA 2R2HA 2ERJB 4KZEH 4KI5F 4J4PD 1QLEL 3O81A 2VQTA 1AH1A 1IT9H 1TLKA 1RUQH 5DI8B 1DVFA 1FNLA 3J8F7 1BZ9B 2QTEA 4OLVH 4DGYL 1QEWA 1MAML 1DBKL 5HHOE 3MRDA 4BFBD 4UQ3B 5FXCH 2HFFB 3KPRD 1C1EH 4R9HA 4U1NA 1NC4D 4I9WD 4OCXH 4JJ5A 4KJPD 1H15B 5C07A 3K0WA 3QUYD 3RVTD 1JFQH 3IETB 4C54A 4Y4FD 1YPZE 2UWEB 3AXLA 2DQHL 1NCWH 4JRXA 4TQEH 4ZOBA 4PP1C 4G6FB 4XXCA 5DEZA 1K5NB 2GSGB 3FFCE 1J0HA 5MI0B 1A7RL 1IKFL 2OTPA 3R06B 1JWSA 4EI5A 4EN3A 5IEHA 1OGTA 2ARJA 4OGYL 4HMCA 3VGBA 2R29L 4LKCB 3RDTD 3VDBA 2DLFL 1V8HA 1AGDA 2VERN 1E6JL 4QOKD 1FFNA 3HAEG 4H8WC 1IGFL 5BOZG 3QHZH 1YN7B 4ZFOA 3RBGA 5CHNB 4DKEH 1OAQH 3T08A 1ZHBA 3HKFA 4CNIB 1X5JA 4PRPD 2B0SH 5LGKA 3RWCB 1T66C 5C6TL 5ID1A 4R7DA 1W2KT 5C2BH 1AD9A 4HSQA 3B8SA 1CGUA 3DPBA 4GW5A 4TSCH 1GPOL 4PRIB 1UT9A 2AI0L 2QQLL 4ZPVA 5KANG 4L4TB 5E2VL 5I18L 4IS6A 1AIFA 4YH6A 2EEDA 1HQ4A 2F54D 2E6QA 4G7YL 1ZMYA 4HG4J 1W0YT 3EO1A 5J89A 3PGDB 1C5BL 2VAAB 4O2EB 3LRGA 4N5EC 1DJSA 4TNWK 4F58H 2XZCH 1G1YA 3PWPA 3QHTC 5CLTA 3U4BL 1NFDE 2BOCA 2UWEE 2V17L 3DX8A 4FQLH 1IC4L 3MQIA 5D1ZB 4LAJH 2OP4H 3BDYL 5CKAA 4KK6C 3VJ6A 5E9DA 3HNVH 2FR4A 4U3CA 3GDBA 1IQWL 5IT2L 3KPOB 4GH7B 4QTIL 4RA3A 4XH2A 5DD5L 5D70H 2DB8A 2ICWJ 4PG9B 1K4DB 2ICEA 3T04D 1BQSA 1KFAL 1ZLSL 3OGCB 3U7YL 3MV7A 4RAUB 5CJOH 4OIAA 4XNYH 1B0WA 1SY6H 5AUMB 1CXLA 35C8H 1JNLL 1RMFL 2QADC 1DQQA 4JM4H 3LN9A 1F42A 4OZIF 5FGBC 3VFTB 3T0WA 3O9WC 3PNWB 3MSPA 2OI9C 3LV3A 5F96H 3IGAA 4JQIL 7CGTA 3QDGE 4ZXBD 4ODUA 4Y4HC 1S7UB 3VGDA 3S5LB 2D9CA 3P9MB 1UACL 3TO4C 4XXDB 4UU9B 1JHLH 4L4TE 3I6LE 1RIVL 3QUMA 2K1MA 4POYA 3RY5A 4XNXH 5CGMA 3KGRA 1BIIB 3I6KB 3KWWA 1MFNA 5I1AA 3O45A 5D5MF 3E8UH 2DQGL 2MMXA 4J8RB 4L3ED 5CILL 1W0VB 3ES6A 3CNKA 2HJFA 2BFVH 1EUUA 2DTSA 5TF1H 4JFYB 2NLJA 5E6ZA 2O5XH 1M7IA 2AQ2A 2ZKHH 2DM2A 1AJ7H 4KPHL 2HT4D 4XHJC 1X7QA 4XNUH 5DJYB 3GSVA 4E5XB 4LLUB 1JF6A 3BSZL 1G84A 2MCG1 2VQ1B 1MWAA 3QDJA 5F89A 3OX8A 1R5WA 1R3HB 3N1QC 5B3JF 1UCBH 3DURA 3P4MB 4QY8B 5C0EA 1TVHA 3UBXG 2DQCL 2GFBB 4M5ZH 4ZYKB 1CN4A 4HIHA 5TJWK 1KTLB 5TE4H 4TUOA 4OLWL 4PB9L 1XZ0A 3VRLE 2AKRA 4XHQA 2CD0A 5HI5D 3MZGB 5EB9A 3LB6C 3EO9H 3MJ7B 2P5EA 1IGMH 4QHKI 3RX7A 3ZE2F 3GI9L 1U8HB 5DJZB 5CIPH 5E5MB 5F1NA 3SJVA 1GIGH 4LPUA 4XC1H 2ZOLB 1OSPL 3PL6C 3EOTL 2GEEA 4PJ5D 2FX8L 4H25B 3ZLQC 2ZG3A 2W9DH 3VXMD 5C7XH 1RQ5A 4M7LL 1CWVA 1B2WL 1P1ZA 2MHAB 2A6KB 5ESQA 2NY2C 5IR1B 3D3VA 3JTTB 3TYGL 3H9ZA 4FP8H 1S9WB 1FG9C 2WUBL 32C2B 3IDNB 5DD0L 5B8CA 1UZ6F 4ZSOA 4YAQA 3UTSE 3MROB 5I8KH 1KT2A 3HE7C 4PTUA 3V7AG 1ZKAA 1IL1A 1FGNH 1BD2B 2ERJC 2KL6A 4YIQB 5D1XD 3V0WL 2X7LB 5D2LB 3WIHH 1IEBA 3HA0A 4QHNA 2BNRD 4LIQH 4NWUL 4NNXB 3QIUC 1SHMA 1P9MA 5SWZB 4QRRB 3MRMB 4MCYB 1VACB 1WAAA 2ZUQC 8FABA 4KAQH 3VGAC 1LP9A 3W2DL 4OCSH 3QPQC 4PJGA 1JL8A 5B39G 1WIOA 3U46A 3BDBA 4FQXD 3Q6GL 1JWMA 1A6WH 3BGMA 4RGNB 3QUKB 5LCVH 1A6TA 4Y89A 2ORBL 1T80A 4MQXC 4HDIA 1R3KA 2E8YA 2V2XB 4POZD 5MI0C 3NIFF 3RU8H 3J7HA 2P24B 5E8DH 3RWJA 4N0YL 3ZE1F 4XWGL 5AG9A 4YUEL 3VXPB 5HI3D 1UENA 5JHDA 3WDHA 3VFWA 4MDIB 1KB5A 2EECA 1VFOA 3AB0B 4J3TA 4OIBA 4CKVX 4BJLA 1TCRB 3KPNB 4IRSA 1F4AA 5DJ0B 4O58L 4WRLA 5KS9A 1MFEL 3TZVA 1YNLL 1A3LL 1XF1A 4OCYH 1IC5L 1F2QA 3ARYA 3EIFA 2E27H 5C0DA 3GSUB 4U0RB 4XNZC 5ILTL 1FSKB 1T1XB 4HXBH 1K8DA 1CE6A 1QR1B 2XN9B 1EEUA 2Y4SA 4CVZB 1O5DT 3R8QA 4AENB 1D6VL 2R8SH 4KV5E 1BF2A 4HUWA 4K71C 4XPHL 1U93B 1MFCL 1H0DA 3MFGB 4MX7A 2XICA 4QRRE 2IFFH 4YX2L 1PQZB 1SMOA 1YEDA 2R2HB 1E4XH 3VI4E 2D0HA 3MUGA 1N4XH 2IH3A 3LSOA 3EYQD 1EBAA 1BEYL 1DVFB 3KJ6H 1DSFL 3P11H 3RRQA 4GG6B 1QEWB 4RIRB 1B9ZA 4XC3L 4LDOB 3MRDB 1UXWA 3UCRA 2QR0A 4U1NB 4OD2A 4XCCH 2MPAH 1G7QA 4K7PX 1VPOH 4JJ5B 1NAMA 4I8DA 5C07B 2NTSP 1S8DA 2VJXA 5CZXC 1UZ8A 1CFQA 1WFTA 4AEHH 5FYJE 4JRXB 4APQD 2CR6A 4OLEA 2Y72A 4YGAB 2I60H 4OAWA 4NM4L 1T7XA 1JWSB 4HPOL 5EO9A 4EI5B 4EN3B 5IEHB 5EORH 1OGTB 5DUPL 4TVPD 2NY4C 2GY7B 1JV5A 5I73B 1EVTC 1AGDB 2JB6A 3D48R 2AQ3A 1FFNB 4Z95H 1NDGA 3S96A 4ZFOB 3RL2A 2XN9E 3VMNA 1FHGA 4H0IA 1EUTA 1NKRA 2G60H 1ZHBB 2C3WA 4XMLL 2GAZA 1MIML 1DEDA 4JPKL 2WNGA 3W0WA 4M43L 4OFDA 2MCPH 5EIIA 1ULVA 5E2TL 4N5UA 4R7DB 2GIYA 3OF6D 4MAYD 1IFHH 3WJJC 1B0GA 3LIZL 4GW5B 3V6OE 4ZPVB 5GGRA 4PJ9C 1S7TA 1BLNA 3IFPA 4IS6B 4J3UA 4PD4J 1AIFB 1OWRM 3ARFD 4GG6E 3PIQA 1FORL 1F3DJ 1HQ4B 3DMMA 4UNVA 4QRSA 5HI4D 1DUYA 2GK2A 3EO1B 3NMEA 4ZO9A 4WTWA 3SE3A 4MJIA 1KN2H 2IAMC 1VCAA 4ZAKC 2BOCB 4ZFOL 4YR6A 3GMPA 3P0VH 1FG2A 1H9VA 5HYJE 4MNGE 3L3GA 4HK3N 5B4MD 1NCDH 4ODXA 1MELA 2FR4B 1YEKL 5FO8A 4JZJC 4JO2L 2XKSA 4XH2B 2LVEA 3BVNA 4G6KL 3WHE0 4JG0H 1QSZA 5F1SA 2ICEB 1NBYA 2Q7NA 5I30H 4YC2C 3IFOA 5JW5A 3FRUA 4M7JH 3MV7B 4UDUA 1QYGH 4TUKL 1T2QL 1HILA 3BH9A 4KJWC 3SDAD 1DQQB 4KDTC 4Q6IC 4H0HB 3GNMH 3P30L 3EYVA 3LV3B 3MA7A 1RZJL 4QRTA 3IGAB 2X70A 4PG2C 4OD3L 5IFJA 4ODUB 4LSPH 5DLMH 3WNNA 1MJ7L 4S0TD 5J4MA 1ZT7A 4X6FA 1A6UL 4MJ4A 5HGAA 5T5NF 4M4PA 3NH7L 3QUMB 4GRMA 1RUKH 4ZFGH 2APBA 3VMPA 2OM5A 3VFPA 5F6IB 2EO1A 5HHVL 3MNWB 1ZS8A 4LNRB 3KWWB 4J3XA 4AG4H 3G5XA 3O45B 1D9KD 5I1AB 3D9AH 4NSKA 2X44D 4YFLI 5JMRA 2ED8A 1DBBL 1G6RA 2VZVA 2DM7A 4OCWH 1F45A 1F6AA 4IRJB 3FN0H 2DS4A 2HJFB 2B8OT 2FX7L 2H8PA 2NLJB 2DQTH 1NBZA 5I8EA 1MVUA 3OKDA 3ALWA 1M7IB 1T1ZA 3PF2A 1DDHA 4KUZH 1LWRA 1X7QB 2DQIH 4B53A 3GSVB 2E7BA 2YD3A 3SO5A 3BE1L 1C5DA 1GCFA 3JV6A 1QNZL 3RJQB 1EERB 5CFHA 4JPVH 4HS6A 1MWAB 3QDJB 3OX8B 1R5WB 1XGYH 2WINB 3DURB 5I17A 4BK5A 5C0EB 3MV7E 4OQTH 3DVGA 4Y5VA 1TVHB 2VH5H 2PNDA 3TEUA 1SVZA 4HIHB 1UJTA 4TUOB 3QUML 3LQAC 2FH6A 1XZ0B 4N90E 2AKRB 4H1LH 1MPAH 3K1DA 2P5EB 3C6SA 1TTUA 3LRSA 2B4CL 5F1NB 3SJVB 4YDIH 4R90H 2R0WH 1F6LL 3OJVC 4GW4A 2DLTA 2YPVH 4LLAA 1P1ZB 3D3VB 1MHHA 1SM3H 1YEEH 5T5NG 1EBPA 3TC9A 5B8CB 3O3EA 5D8JL 4YAQB 1IGCH 1YNKL 4OZFH 1KT2B 4FQCH 4PTUB 1CFVH 5I71C 4WWID 2FIKA 1IL1B 1MWAL 3TT3L 2XZZA 4P5TA 4OM0L 4WUKH 4QHNB 3V6OC 5IESH 2VSDA 1I9RH 2A6IA 1G0DA 4J3VA 3HZMA 3IU3B 4LQ1A 5IHBA 1KJ3L 8FABB 1V5JA 3GK8H 4YXLH 3QDJE 1LP9B 4UV4L 1I7UA 3DYOA 2PXYA 4PJGB 2MJWA 3OB0K 3U46B 1YQVL 3UTTA 5JIPA 1IAOA 1JWMB 2VLLB 3RIAK 3V7MA 1FGVH 3L3IA 4HDIB 5CJBA 2YWZA 1R3KB 3I9GL 1YQ2A 1L7IL 3HMWH 4OLUH 2P5EE 5K9QG 3WIFA 3RWJB 3X3FH 1KELH 2ZNWA 5D7JC 3BZDA 3IT8D 3FRPG 4PP1D 5IJVA 5JHDB 2O5YL 5LVEA 2XQBL 3VFWB 1MCLA 4JM2B 1G9NL 1KB5B 3ZDYF 2EIZA 4NHCH 1UM4H 2Z0BA 3RUGA 4XMKL 1QACA 4O2FB 4JFZL 4FRWA 3PDGA 5KS9B 2GITA 2BVOA 2R69H 3TZVB 1OL0A 3QDME 5LBSH 2VXVL 1SMAA 4QF1A 5C0DB 5AAMA 3H3PH 1CE6B 1K8DB 2C4FT 2DJSA 2NXYB 3HC0A 1CF8L 3TO2A 1P6FA 3A6BH 3HPLA 3E3QE 1VKXA 4Q9RL 5KTEH 4HUWB 3TJEL 2NY7L 1H0DB 4MX7B 4PJCA 2GJ6A 4MB4A 4P9MH 1T66D 2FECL 5FHBH 4DZ8A 5AD0A 3EO0A 3RVUC 2IH3B 1PKQB 1LP9E 4P57A 2XTJE 4U4BA 4OZFG 1MFAL 3NFNA 3CDGA 3BAEL 2ESVA 5CCKL 3THML 1KB5L 4ODWA 4NUGH 4K3JL 1UXWB 2PW1A 1OTSC 2QR0B 4OD2B 1G7QB 1BJ1H 2AJYH 1P4IH 4N5ED 4C59B 2RR3A 1NAMB 3BPOB 4MAUL 4HZAA 4HIJA 1S8DB 1NBVL 4UILL 5DD1H 5EU5A 4JREB 1UZ8B 1CFQB 1HH6A 1XF4A 1R5IA 4Q97A 5JHDE 5DK3A 4L9LC 2YK1L 3L1OH 3MLXL 4OAWB 5EO9B 4PJAF 4X7SH 5F44A 4EQ3A 3QCUL 1QKZH 2AEPH 4N8CL 5KS9E 1JV5B 1UGNA 1NMBL 2JB6B 4YHKL 1OT1A 3VDAA 1NDGB 3S96B 4OFKA 1GH7A 4L9DA 3X13A 5C09A 1E6OL 3IB4A 2QADD 1E4WH 3PE9A 1CK0L 2WWMC 2GAZB 3O11A 3MNVA 3MREA 5JXAH 1P2CA 2GCYA 2VE6A 3W0WB 3O9WD 4L8SC 3UC0L 3WSQL 4WHYH 5EIIB 1CVRA 3ABZA 1NCAL 1CBVL 2VKXA 4KKAD 4Y4HD 4GJTB 2YS4A 1NAML 3AU1A 2CO6B 1B0GB 1TJGH 1NMAH 1ZWIA 3K7UA 1FYTD 1PKQE 5J3HC 3TO4D 1Q9WA 5GGRB 1Y18A 2FEEL 1P7HL 2BC4B 1S7TB 1BLNB 1L0YA 2NXZC 3IFPB 2IWGA 4NQDD 3PIQB 1TJHL 2YN5A 3DMMB 4IRJC 1ZLUK 3WL9A 4QRSB 1DUYB 5CEZH 4LPTA 5CP3A 4HJJH 1CG9A 2FX9L 4KHXL 1HN1A 5E08H 4MJIB 1S9YA 4OSUL 2H2PC 1IRAY 4OV5A 5IBUB 4FXKA 4AM0A 1LO5A 3U79A 4PRNA 1R6VA 4YR6B 5JR1H 3MNZA 4ZUUA 2YBRA 3O0RL 5IHUH 1FG2B 5JDSA 2R1WA 4DKAA 3LH2H 5TE7H 3L3GB 1U2HA 2V7NA 4ODXB 5HHOD 3VCLA 5FO8B 4GRWE 4XP5L 5TDNA 4E42A 1JTTA 1FP5A 3BVNB 4JDTL 4NQCA 3VWKA 3AGVA 1NBYB 2WV3A 3CSYB 3IFOB 5JW5B 3FRUB 2LV4A 4QCIA 3EOBB 3T0DA 3BKCH 4UDUB 3I50L 2R0ZH 4RMSA 1HILB 3BH9B 5BJTA 1TIUA 5C2UB 1MI5E 3WXVL 3FFCD 3N1MC 1G9EA 4X4ZA 3EYVB 3MA7B 4IIQC 1ZHNA 4QRTB 4Z7UF 2X70B 5IFJB 4LHQB 4LQFL 1LO2L 1CIDA 3CFCL 3GIZH 1ZT7B 4MJ2A 3PL6D 1GJIA 2Z31A 4LBEA 4X6FB 3AS2A 4LLYA 4R97C 1BQLH 2AXFB 4TPRH 5HGAB 3ZL4H 2NYYC 1W72H 4R2GB 4LLVA 4HUUA 3TH3T 1O0VA 3DXAA 2NY2D 4WGVB 1M7XA 2F19H 4PRBB 1UKTA 1ZS8B 2FJGB 1UA6L 2P7TA 3G5XB 3HE7D 4NSKB 4WHYG 1RJCA 1G6RB 3LKQA 4MQSB 4OV6F 1F6AB 4LCCC 1Z6JT 2H8PB 2ARWA 2D7QA 4IDLA 3QIUD 1NBZB 5I8EB 3SDXA 1MVUB 3UX9B 1VDGA 2XTJC 3EYUL 5L0QC 2A74A 1DDHB 1S9XA 1AKJA 5JW4N 3VG9B 1GOHA 3STBA 4UOW0 2I9LB 4KVCH 1C5DB 1Z3GL 3JV6B 3LMJL 2KQMA 3LEVH 5IFAL 2P8LA 3MXWL 4M3JA 2IFGA 4HS6B 3JTSA 1N5YL 3CLFH 3CH8A 5I17B 1QHOA 3HC3L 4KRNA 2VZSA 4LCWA 3DVGB 4Y5VB 4GRLC 1QR4A 4EJ1C 4DQOL 4M62L 4MQXD 4G8FA 1V3JA 2A6DA 4JM2C 3W9DA 1AGBA 4HIXL 5FYLL 4E41B 1JZ6A 3NPSC 2CDEA 5D6DA 4P3WA 3LRSB 2GSIA 2F5AL 5J11C 1FLRL 1M4KA 3WFCH 3S88H 4PP2A 5ISZB 3NTCH 4RRPG 1G6RL 1P6AB 15C8L 4S1RH 3IFLH 2R0KL 4A2LA 4XP1H 2Z91A 2O61A 4GW4B 4Y1AE 1MCWM 1MHHB 2BJMH 2NTFA 1HHGA 3KDMA 3O3EB 3G6JF 4M1DL 4TNWF 2FIKB 3QDGD 3MLRL 3B9AA 5CP7A 4P5TB 4CN1A 4WY7L 1RIUH 3MFFA 2YHGA 3SKNA 4D2NA 3QG6B 4L4TD 3I6LD 3NIGE 5KVFL 1CVSC 4O9HL 2A6IB 2XWJA 5GZOC 1BFSA 2BVPA 3I02A 1RFDH 3HZMB 1JYNA 1UM5L 1A1OA 3KYOA 1CR9H 2WBKA 5HXMA 1I7UB 3I75A 2PXYB 2CRIA 5HDQH 3UTTB 1WFUA 5IM7A 1IAOB 3QFDA 5ACLA 3SE8L 3L3IB 3LKSA 1OAYH 5KAQF 3RX5A 3FN3A 4E41E 5E99L 1RJYA 3FHQA 3WIFB 5CZXD 1T7YA 4QRQA 1QSFA 3ZYOA 3QG7L 4HJ0C 3D39B 2B2XL 5ISZE 5IJVB 3VXNA 5ID0A 1PVHA 3RKPA 2N56A 3PDDA 3VD7A 3Q5OA 2EIZB 4HX1A 1NC2D 4MNQE 3PHSA 3RUGB 3C5ZA 4I0KA 4M93B 3K2UL 1OOAA 2GITB 2BVOB 4IOFC 3BT2L 3JWOC 3N0PB 4WU7A 5SWSA 5E24E 4QF1B 4WI6A 2R23A 4V1DA 3V4UH 3FO0H 4CVWA 2XACC 1PEWA 5F97E 2A1WL 2FECI 3HC0B 3AAZA 4NO3B 4GMSH 3TO2B 3HPLB 5KOVC 1VKXB 3O8XA 2OQJA 5IQ7L 1AHWC 5CLWA 1WIUA 2H32H 4MS8C 4PJCB 2GJ6B 4RX4A 4DZ8B 3HRPA 5AD0B 3EO0B 3KR3H 5DVKA 4I2XE 5JQHC 4HEME 5B21A 1DFBL 3S34H 4HFUH 4G8GA 3UTSD 4K3GA 3MR9A 4PJ9D 4RGOH 3F62A 4PGDA 1YEFL 3IJSA 5JA8B 3NFNB 3CDGB 2ESVB 4I4WA 2DOCA 3S36L 4ODWB 4OT1L 3HZVA 1MCNA 3VFRA 2PW1B 4JKLA 1CTOA 2NX5A 5BOPA 3IDMA 3QXDA 5J1SC 3SKUD 5EU5B 1I9IL 1HH6B 1BHGA 2ITCB 5CD5C 4GW1A 4KRLB 5KAQG 3D39E 1R5IB 3OMZA 1X9QA 3LDBC 4OI7A 3CVIH 1OLZA 3OR6B 1BBDH 5E2WL 4F37K 3O2VH 5D7LA 4HMDA 1A3RL 3P4OA 4C56A 2DDQL 2FATH 2OK0H 3HG1B 2IG2L 4F7MB 1GGYA 5C09B 5EULV 1FVDB 1TJIH 3O11B 3MNVB 3MREB 3GO1L 1P2CB 2GCYB 2VE6B 4OTXH 4RWYH 2V5RA 2FJFA 3LS5L 4MA7H 4WVRA 2FEEI 3BWUC 4NHUA 4BELD 1NL0L 1IMHC 3AU1B 3EDKA 1ZWIB 3TN0C 4IMKA 1Q9WB 3OAUL 1Y18B 1BQHA 5MP6L 1IZJA 4PJIA 2VWEC 1Q1JL 1S7XA 5F8RC 3WL9B 2F5BL 3BD4A 1T03L 1CG9B 2XFXA 3NZ8A 1S9YB 4QRRD 5FGCB 5ADOH 3PWNA 4OV5B 4GKNA 1LO5B 4L1HA 1GHFH 4PRNB 1DQTA 3MNZB 4ZUUB 2YBRB 4R8WH 3UJJH 5E2JA 3INUH 5JDSB 1NGYA 5KW9L 1YEHL 2YD7A 1FYHB 3VCLB 5J1AA 5TDNB 4E42B 1QLEH 4TVSa 4FQ1L 4NQCB 3VWKB 3L5IA 2PN5A 4XVJH 4HK3J 5T3ZE 2R4RL 4QCIB 3HUJA 5IFHH 5J6GA 2CDGA 3HG1E 1DBKH 5FYJD 5I1GL 5BJTB 3NAAL 3L7EB 3UDWA 5KSAA 4MXQC 4BSJA 3DARA 1OCWH 1CGVA 2KQNA 1ZHNB 2EH7L 4U1GC 3CXHK 3O2WH 2P5WE 2Z31B 1PZ5A 4LBEB 4LSDA 3CGTA 1A7RH 4LLYB 3QEHA 2R2CA 2XN9D 4DVRL 3UTPD 4X6DA 4LLVB 3B5HA 4HUUB 4OGYH 4J3OC 1KCLA 1KNOA 3DXAB 3GI8L 4WFHE 2VMFA 1E6JH 1HH9A 1IGFH 3WHXA 2P7TB 5GJTH 5CUSL 1ODAA 3G5VA 5DMGC 1A5FL 3LKQB 4PJDE 1P7QA 3KLSA 3SDXB 4J12A 2AK4D 4H20L 1EEYA 2HYMA 1P5UA 1S9XB 5C6TH 1AKJB 3RA7L 5L2KE 1J11A 3K1KC 5E5RB 5IW6A 4PY7A 4HUNB 2CK0H 1JUFA 2P8LB 1GPOH 2AI0H 4NQCE 3JTSB 1I8LC 4GKOA 4HZLA 4EVNB 3VXQA 5E2VH 4Z18A 3IDXL 4LCWB 2EDHA 3QI9C 4LVNC 1ADQH 1HHJA 3KPPA 5T1LD 1W8NA 3UTQA 5GS0C 3RTQA 2JKXA 5I75B 1C5BH 4G8FB 2A6DB 5HYJD 1U3ZA 2C9AA 2WLZA 1AGBB 3QNXA 5IK3A 3B3IB 3SBWC 1AO7A 3U4BH 3W9DB 2UWEF 2CGRL 2CDEB 3T77A 1TDQA 2UV3A 2GSIB 2V17H 3O4OB 3VRJA 1IC4H 5D7JD 1JYVA 3VD4A 3MRKA 2X4PA 3S3JA 1XCTA 3BDYH 3IDYB 5EBWA 4FZEL 1XGQB 2O61B 1FNAA 3VG0L 4D0BA 5FCSH 1IQWH 5IT2H 3NCBB 2XPGA 4QTIH 4Z7WA 2X1QA 5HHME 2H2SD 2NTFB 1HHGB 1SBSL 2ZSWA 3KDMB 4I0CC 2WLYA 1ZLSH 2VLJE 5ADPL 3PP3K 1Z2KA 4FXLA 4K3DL 1JNLH 5CP7B 2YA0A 3ORJA 3TA3A 1T0MA 4Z0BL 3SKNB 5GXBB 3SGEI 1CD1A 1FZMA 3E2HC 3NACH 2BVPB 3U1SH 1IGYA 3I02B 3EYOA 5SX4I 5D7IA 3M8OL 3RVUD 1A1OB 1RPQA 4U33A 3KYOB 3W81A 1ZE3C 4NKQB 3MBXH 1WTGT 1RIVH 3I75B 5C0NC 2X4UA 4LCWE 4UT9L 4W4OA 2J6EA 5C08E 4P9HL 5JW4M 1I1AC 2ZPKL 3QFDB 2RCSH 1HZHL 1OTSD 4WTZG 3LKSB 3C8HA 4U0QB 2RBLA 1SYVA 2F8OA 2VXUH 4NCC2 2DQGH 2QQKL 1T2XA 1R3LA 1RJYB 3IDGA 4QRQB 5DO2C 4K7PH 4Z8FH 4ODTH 1RU9L 4WI9A 4HKBA 3ZTNH 3VXNB 4XPBL 4G9DA 1OGAA 1FN4B 4HX1B 4FABL 2CIKA 3UO1L 1RZ8A 1LO3H 2KDGA 3BSZH 2EEAA 3QWOA 4MXWH 4N90D 2ATPA 4WU7B 5SWSB 2IGFL 2DN7A 2R23B 4YFLF 4V1DB 4HT1L 2OJEA 2DQCH 4C55A 4EXKA 4P4KC 3QUZC 1X5KA 5CJ5A 4OLWH 1FJ1A 2DLHA 3AAZB 4ODSL 2WWMD 2OQJB 2A83A 3IF1A 4AEFA 3GI9H 2F74A 2J7LA 1F58L 5A16A 5JQ6L 3W11C 3EOTH 5J3HD 3LKRA 5HYFA 3T0EA 4G8GB 4LEXH 3MRRB 3MR9B 4MA8L 2APTA 3X14A 1CXEA 2NXZD 3IJSB 1KENL 1B2WH 3SQBA 4I4WB 4BQ9A 4IRJD 1X6NA 3TYGH 5DD0H 4POUB 2WUBH 3HZVB 2YXMA 3U36A 1G0XA 3VFRB 4D9QE 1MRCL 2NX5B 5FAAA 3LS4L 3QEUA 1HHIA 3IDMB 4P46A 3QXDB 1OARL 2YZ1A 5GJSH 3TBTA 5EBMA 5IVXA 4Y0GA 2X5PA 4GW1B 1XGRA 3WBDA 3QDJD 1AY1H 3CK0H 1NUNB 1T6VN 2VDRL 1V7ML 1CGYA 3B9KA 3UJIL 1JGVH 5CMAA 2VQUA 4UIMA 1RURL 4X99A 4KDVA 2OSLA 5BO1L 5HY9A 3DGGA 3P4OB 1F3DH 4DUVA 2WIMA 3IJYA 4N0FA 2FYYA 4OFYD 4C56B 1QFPA 5KG9A 5I74B 2QLVB 3Q6GH 2R0LL 3S7GA 4ZOAA 4FTVE 3EUUA 1HWGB 2EKJA 5LXGL 1JYWA 1A3QA 1NCBL 2JJVA 2HKHL 1UM6L 1BVLA 5DUML 4N0YH 4XWGH 2FJFB 1RZ7L 3CFIC 4HKZA 1QBMH 4YUEH 4NHUB 5JHLH 3ZKMC 1CICC 3FQWA 3QDMD 4DCQA 1BQHB 3FN9A 1PW3A 3QJHA 2NYYD 4PJIB 4NT6A 1F6FB 4DJMA 3BIKA 4O58H 1S7XB 3MX0A 1MFEH 4U6VH 4RAHA 2X05A 4YBLC 4WI2A 1IC5H 5ILTH 3ZE0F 1VERA 2XFXB 4BFGA 3NZ8B 4N0UB 5D2LF 3PWNB 2H1PL 4GKNB 5F1KC 2Q8AL 3ZHKA 4KV5F 3CU1A 3D0LA 2XTJD 1NGYB 4J1UA 3H42L 1RZKL 1LDSA 4JFEB 3OSKA 5E6IA 2CRYA 5J1AB 2ZUUA 4KMQA 2JK5A 3RWDA 3LKNA 1UEYA 5DK0A 1BEYH 3UPCA 1DSFH 3HUJB 4HGKC 5J6GB 2CDGB 5D6CB 4JY6B 2APFA 3IXTA 3EBAA 4Z76A 5TF0A 5KSAB 1RJZA 2D7PA 4JM2D 3OAYH 3OKOA 1XR8A 4G9FA 4JFHE 3VDCA 3NGBC 5FGSA 3BKYL 1RSFA 3MLVL 4YXKL 1W0WA 3EDFA 1MLBA 3AY4A 5IROA 1PZ5B 3QEHB 3WIHA 4HPOH 2DICA 2A73A 4OLXL 3D2UA 3BEVA 2CJUL 4X6DB 5FYKD 4NM8H 3VI3E 2NXYD 1KNOB 1Y6KR 1A7QL 1PBYA 1HH9B 3WHXB 1NUGA 4K8RL 3QIBA 4N0UE 4X98A 5A2IH 3P4NA 1HI6A 4MVBC 3RGVC 3G5VB 4HJGB 25C8L 4TUJA 4XMLH 1MIMH 4FFVC 3U82B 1P7QB 4KY1H 4LGRB 1EEYB 5E2TH 1RIHL 4JFEE 5IW6B 1SJVA 2RQ8A 3H7LA 4PY7B 3LIZH 5GRWA 2VUOA 1JUFB 3ARGC 3TPUA 1M05A 4PBXA 4HZLB 3MA9L 3V0VA 3VXQB 4NBXB 4GG6F 5F8QC 3FL7A 1X5GA 2DMKA 4YXHL 5D96C 3KPPB 1HHJB 1WCBA 5BVJA 3UTQB 1D7FA 3O6FA 3RTQB 1RK1A 1F8TL 4I13B 1JNHA 2Y23A 4XPGL 5IK3B 3QNXB 1AO7B 4YHNA 1ZLUH 5HGBA 1FVCA 3BQUC 3TF7C 3MRBA 1T20A 4HJ0D 3MRKB 4XPFH 3ALPA 1XCTB 5FYJU 1UWGL 4GSDL 5EBWB 4CVXB 1KPVA 4Q58C 4M6NL 2J8UA 1YEKH 3V52L 4D0BB 4N1EA 3IDIA 3T65A 2XPGB 3MOAH 4JO2H 3UZQA 4Z7WB 4J4PA 1MRDL 2QSVA 1EHNA 1KIRA 4IOFD 4HUMB 2ZSWB 5K59F 2FHCA 1MI5D 1EJOH 1DR9A 5F1OB 4PY8J 4TUKH 3DHJA 4WHTA 4KTDL 5KVDL 1BGXL 3MYZA 5I0DA 2AVGA 3KPRA 3TA3B 1T0MB 3DX9A 4S2SA 1JGLL 1NC4A 1CD1B 1MREL 4MS8D 1FZMB 5TE6H 1KACB 3QUYA 3ZYIA 1NLBL 4Y4FA 1IGYB 3EYOB 5D7IB 1B6UA 3MV8E 3CFJA 2X4UB 5AWNL 1MF2L 1YECL 2CRMA 3JWDC 3AM8A 3ZKQD 3CXDL 3ARXA 1DZBA 3RDTA 2X9YA 5HHVH 4CW1A 4JQXA 4JN1L 4QOKA 3FZUC 5J0BA 5GSVB 1NAKH 1SYVB 4S1QH 3L5HA 1AO7E 1U3HB 3TH4T 1RJLA 3QPXL 4YQXL 1R3LB 1DBBH 1YEIL 2LTQB 2MQ3A 3IDGB 4HD9A 3V9FA 5CD5D 2BOBA 1UB6A 2FX7H 2YRZA 4V2BA 5IF0A 4K7FA 2NY3B 4HKBB 4PRPA 3ULVE 4G9DB 1OGAB 4BUHA 1CQYA 2WP3O 5KZCB 5ALBH 1MAJA 2CIKB 3BE1H 4XBEH 1RZ8B 1QNZH 1KCRH 3QWOB 3CDYA 1R5VA 2EDWA 5HJ3A 1D5IH 5DS8A 2ATPB 3SGJA 5CJXA 3WUWA 1JFQL 4OGZA 3BP4A 4R0LC 3LHPH 1NCWL 3QUMH 5IMKA 1ETZA 4TQEL 1NH6A 1FJ1B 4D8PB 1AI1H 3MLTA 1HKLH 2A83B 4JQVA 3IF1B 2L4OA 1JJUA 4ZFFA 1CXIA 2F74B 1JNNH 2B4CH 3C8KA 2ADGA 4Y1AD 4PRAB 5A16B 4I18A 1EIBA 3LKRB 1ES0A 1YY8A 3QHZL 4LCIL 1LVEA 3X14B 1IQDB 5E8NA 3MLYL 1OAQL 4PJHE 1I4FA 2I9TA 2FEDC 3QEUB 4P46B 1MWAH 2Y36H 2OR7A 2RGSA 3TBTB 5EBMB 5IVXB 3NCMA 3MGAA 4N9OB 1XGRB 5DJ2A 5DMIH 3NFSL 4TSCL 5I1KL 1A14L 3B9KB 4ZXBA 3I85A 5CMAB 4KROC 5SV3A 4QNPF 4UIMB 1PG7L 3C6LA 1WFOA 4X99B 2OSLB 2NCMA 4UV4H 4OCRL 5HY9B 3DGGB 3IJYB 4JG1L 4N0FB 2FYYB 5KG9B 4E41D 4WI5A 1YQVH 2ZOKA 3MOQA 4UTAH 1ZVHA 2OTUA 4WJ5A 2VISA 2OP4L 5ISZD 4X4MA 3I9GH 1L7IH 1DP0A 2VDML 1KV3A 2XT1B 4MXQD 3VW3H 4XWOC 3BMWA 1BVLB 3I6GA 1DCLA 4MNQD 2IPKA 2FB4H 4HKZB 5K9OA 4XP9L 3FQWB 2O5YH 4G5ZH 5D70L 4BZ2L 2XQBH 5FO7A 1G9NH 4Z7VA 1J0KA 4N1CA 1PD6A 4D9LL 1RZJC 4RFNC 2L0DA 3QJHB 3BIKB 4XNYL 1TQCB 35C8L 2AK1L 1FFRA 4GS7C 3C5JA 2FGWH 2VXVH 4BSWA 4JM4L 1IAIL 3BIBX 2VDLL 1I7ZB 4R26L 2BMKA 2BSRA 5DMGD 5EG6C 2N7BA 1A6AA 2MFNA 1CF8H 4OQTA 4B5EA 3D0LB 1JHLL 1Z0NA 4YHOH 3QZWA 5IW3A 5DR5L 4J1UB 4WEUD 2BSTA 1WAAF 4HBCL 5E6IB 4XNXL 3V79C 1LP9F 1JCKA 2JK5B 4ZOEA 3LKNB 4PJ5A 4PJGF 1XF2A 5DK0B 3T3PF 5IJKA 3VXMA 5CCKH 2I24N 3THMH 3E8UL 1LEGA 3QI9D 1KB5H 3IXTB 5GS0D 4U31A 3D39D 5TF1L 1F4HA 2SEBA 4Z76B 4M1GL 5ANME 2O5XL 1WUNT 2HFEA 1RJZB 3ULVC 4GLRI 3P77A 4MAUH 3OKOB 4OCNC 5FOBA 4G9FB 5D1XA 2W0PA 1MJJA 1QRKA 5GPRA 3MCG1 3QXTA 2BNRA 5AAWA 5JW4R 1J10A 1W0WB 2DJUA 4JM2F 1MLBB 4LLWA 4EOWH 2CSPA 2YK1H 3MLXH 2DWEB 3EOYG 3DYMA 1JGDB 1TCMA 2A73B 3D2UB 3BEVB 3QCUH 4M5ZL 5KS9F 2X40A 4NJAH 2JB5L 4N8CH 1QSEE 5ACZA 3JZ7A 4Y5YC 5TE4L 2DQDH 5GS2D 2VSCA 3NCEB 4RAVB 4QRPE 2WWKO 3CC5A 3KG5A 4FQXA 3OBAA 3QIBB 4X98B 1IGIH 1E6OH 1HI6B 3P4NB 5TDPA 4JEGB 4TUJB 4X7TA 1XGTA 5GHWH 5EU6A 4ONHA 1J8KA 3ZKSD 4PLNC 3UC0H 2WW8A 3WSQH 3EJZC 4F37F 1U92A 3ISWA 3MJ9A 1NCAH 1CBVH 5FM4A 4RMQA 3L7FA 2XY1A 3WO4B 1I1CA 5EZOL 1NAMH 4NUJA 4CJ0A 3TPUB 1J1XH 4LSVL 4M8VA 3U2SA 2O93L 3V0VB 5I8KL 1QOKA 5C0ND 1U3HC 1EFXD 1PKOA 1FGNL 5FDWA 5DYOA 1WCBB 5SX5K 5BVJB 3WIHL 1DE4A 1KEGL 3QCVH 3O6FB 3W5MA 2H6PA 2PCPA 1RK1B 2FX9H 1IILE 1DUZA 5EOCJ 5CD3A 2CK2A 1PY9A 1JNHB 4OSUH 2Y7QA 2YD9A 1WITA 4YHNB 5HGBB 2G5RA 1FVCB 4QLRA 4JHWH 5FB8A 3MRBB 5DO2D 1T20B 1YDPA 5IOPB 4I3RH 4KAQL 5T3ZD 2X4SB 4OCSL 1EEZA 2K9UA 1AE6H 4ZTPH 1PG7X 1KPVB 4HWZA 4JGMA 3HG1D 2HRLA 1OAXH 2J8UB 1A6WL 4XP5H 3IDIB 2DQFA 5DRZA 5LCVL 2G2RA 4JDTH 4KMLB 3CFDA 5E8DL 3I50H 4P4KD 3QUZD 3CX2A 4WHTB 2IC2A 2QSQA 3KPRB 5FYKU 4S2SB 2P5WD 3WXVH 3OKLB 5J57B 1NC4B 2V5YA 3QUYB 4LQFH 2QEJA 4Y4FB 4Z9KB 1E27A 5F93C 1XT5A 4WFHD 4APQA 1S9VA 1F4YL 3W11D 1NGZA 2E27L 5D1QC 3CFJB 2EDNA 2WZPD 2JELL 4WWKA 1KCVL 3RDTB 3WS6C 5DZNA 5E4EC 4CW1B 4QOKB 3BP5A 1F02I 4X0KA 1SQ2N 2R2EA 3ARBC 3JVGC 5L2KD 2BK8A 3U30C 5E94A 1RJLB 4LSTH 2IFFL 5DTFA 3LCYA 2BOBB 1UB6B 2YRPA 2ZCHH 5IF0B 4K7FB 3TYFA 4MHHI 1QFWM 4PRPB 3C09B 1ZTXL 4HQQL 2FD6L 1NGQL 3P11L 2J8UE 2AXGA 5GRJL 5H8DA 2QQNL 3LMJH 3OF6A 4N0CC 5IFAH 2R1YA 3F6IA 3N50A 1R5VB 5HJ3B 5DS8B 4XCCL 3CSBA 4DUWA 5TGBA 2EZ0C 3ARFA 3KYKL 4DUXA 3H9SE 4NRXA 5FV1L 3BP4B 4DQOH 3VGGA 4M62H 5IMKB 4WUUE 1PX4A 1BFTA 1ETZB 5HYSA 3PWUB 1MAKA 1CXHA 2B5IC 4Y5XC 3MLTB 4HIXH 1FLTX 5FYLH 3TGXA 5E00A 3PJSA 3P3YA 4ZFFB 3CUPA 2F5AH 5EORL 4CDGC 3C8KB 4MZ3A 5GGVH 2ADGB 3W82A 4I18B 4NQVA 5HHMD 3ZKMD 1CICD 5DHVA 1BJ8A 5T5FL 1G6RH 15C8H 3JUYA 4OF3A 1ES0B 2R0KH 1KCUL 5JO5A 1YY8B 2VLJD 4CL7A 3RL1A 1X5ZA 5ICYA 5JOEA 4OF0A 5CKGA 1A1NA 4XMPL 4W6WB 1I4FB 4ORZC 2I9TB 2BX5A 4LLDA 4MJ5A 2OJZH 5BV7B 3KPSE 1J1OH 4KKBC 5C1MB 5GS1B 4AL8L 1S3KL 2V9TA 1IFHL 4WY7H 2X10A 3SDAA 5DJ2B 5IBUG 2R4SH 4G8EA 3PP3H 2BVQA 4PJ7E 1DQDH 4NZUH 2AJSL 5KVFH 4LCWD 4O9HH 5C08D 5MENA 4ZXBB 3DRQA 3RWGA 4PRHD 3C6LB 1JPGA 3QNYA 1FL5A 3V6BR 4S1DC 4R7NA 2E7HA 2VL5A 2HWZH 2NW2A 1XIWC 2ZOKB 5JIHA 2NY1C 4WEMB 4WJ5B 1IAMA 3SE8H 2VISB 4L8BA 4WU5A 5GGRY 4ORGA 2Q8BH 1D9KA 1FBIL 3I6GB 2AEQH 1NCDL 5K9OB 5KSUA 4O00A 1MCHA 3U7AA 3MRNB 3TT1L 5FO7B 4Z7VB 5I30L 3VD3A 1AC0A 4ONGL 5CBAA 1IAII 1QYGL 2P44B 3K2UH 3SQOL 2Y5TA 3BT2H 4NBYB 3C5JB 4OFPA 4BSWB 1TPXB 4JDVA 4ODVH 1CFBA 4Y2DC 3FQUA 4WV1C 3B9EA 3NBNA 2FHFA 2BMKB 2BSRB 4P2RD 4WGWB 4MVBD 3RGVD 1MY5A 2A1WH 5DLML 1KIPA 1A6AB 1Q9KA 5GGSA 2XQYK 3PXHA 4FFVD 5L88H 2C3HA 5KBNC 3QZWB 3RI5K 4YEFA 4NGHH 1CIUA 4ZFGL 1Z9MA 4MA1B 2FLBT 5F7KC 1DFBH 4JPWH 3ARGD 4D9QD 4D3CH 4PJ5B 1XF2B 4JFOA 3B43A 1YEFH 4AG4L 4ETYA 4DTGH 3VXMB 3IAQA 1LEGB 2UUDK 4I3SH 4Z7QE 1OM3L 4OCWL 2EKSA 3BW9A 4OT1H 5E70A 1NCUA 2SEBB 2DQTL 2JCCE 2EDDA 5FHAL 4BYHA 3P77B 4KUZL 5FOBB 1MQ8A 3STZA 3BQUD 5D1XB 1MJJB 1AP2B 2Q6WA 3QXWA 2BNRB 5IQ9A 3B83A 4JPVL 4LLWB 2ENYA 1XGYL 2FRGP 5E2WH 4O02L 3RUGF 4DK6A 4OQTL 1IC1A 1LGVA 2BXYA 3CMGA 4LFHD 2F58L 4X9BA 3OWEA 4JFQA 1OPGL 5ACZB 1H5BB 4FTVD 1QFUH 4UTBH 3HN3A 1MPAL 3FKUS 3F5WA 3MUHL 2IF7A 3T4AB 3CC5B 4FQXB 4GOSA 2Z93A 1MCEA 3P9LA 5TDPB 4X7TB 4R90L 1XGTB 4KHTL 3WFEL 3GO1H 5EU6B 4ONHB 1P4LA 3OXRA 4PJCF 5DD6A 3HNTH 2KUTA 1U92B 2YPVL 3LS5H 3N9GL 5ICXB 3HCVA 3L7FB 1NL0H 4K9EC 5J1TC 4D0DA 5ENWA 2BRQA 4NUJB 1SM3L 1YEEL 4XGZA 1DQJA 3U2SB 4GXUM 5BW7C 1CFVL 4DFIA 1Q1JH 3K74B 4I3GA 3K3QA 5FDWB 4QGYA 5DYOB 2F5BH 4P49A 4Z7NF 3RY4A 1DE4B 2BERA 4WUKL 3OJMB 1MOEA 3CCHB 2H6PB 4B0MM 3FZUD 3BI9X 1DUZB 1PDKA 5CD3B 1N2RA 4MA3A 3SDDC 2Y7QB 5IESL 1I9RL 5T3ZH 3BD5A 2N4IA 5FB8B 1YDPB 4ONFL 5M7QA 3CH1A 5CEXA 3GK8L 3BIAX 5GRZA 4YXLL 1NMCC 4LU5H 4ACPA 5KW9H 1YEHH 1S5IL 5FDYA 4HWZB 1A1MA 3X3GH 5DRZB 2DQFB 1SEBA 3SDYH 1GC1L 4FQ1H 4DOHB 1S7WB 2G2RB 3MJ9L 1EJ6A 1ZVYA 1FGVL 2DIJA 4Y16C 2K3TA 3CFDB 3HMWL 1MEXH 5LG1A 2ENSA 4OLUL 4JFHD 4UMGA 4UUJA 3X3FL 3DVNA 5I1GH 1KELL 4XB7A 5I1CL 2NY0C 3L3OA 3DX7A 5DA0B 5EU6E 2APVA 4NQSB 5I8CA 3RAJL 5EA0H 4NHCL 5HHNA 2EH7H 5CP3H 4OQ1A 2CUMA 1E27B 2PTUA 4APQB 1S9VB 4D94A 5EC1A 2DF3A 4NN7B 1NGZB 3VGEA 3H3PL 2BVUA 5GS1C 4DVRH 1VFBA 2DQJH 4MDJB 3GI8H 4WWKB 5EUOE 1OW0C 3BPNB 1MJ8L 1U58A 1YJDC 4X9HA 4H26A 2FEDD 3H9YA 1KTKE 3BP5B 5KTEL 4ZUTA 4X0KB 4KKNA 2R2EB 3DYPA 4LDEB 2LU3A 4P9ML 3MBEC 4JLRA 5E94B 5LWYL 4JFED 3PV6A 1A5FH 5DTFB 5JW4Q 3TYFB 5FGBA 1QPPA 1DQMH 3O9WA 4H20H 3O4LB 1YZZA 4X7DC 3QQ4A 2YMXL 4Y4HA 2AXGB 4WW2B 4KROD 2R1YB 4NUGL 3FT3A 1E4JA 1FYTA 1DLHA 3TO4A 1JI1A 3IDXH 3ARFB 4NQDA 5DD1L 4NRXB 5C0AE 3CPLA 5J12B 5HYSB 4RA0C 4BZ1H 3ARWA 2ICWA 3MLUL 4TVPL 2Y9RT 1NEZA 3GEWB 4XWOD 3L1OL 5DZLA 5CSBA 2CGRH 2YPKB 3PJSB 5E00B 5I9QC 3CUPB 2GUOA 4OLYH 4X7SL 4LEOB 4HLZH 4C4KT 2UZIH 4NQVB 2L7JA 5DHVB 3FT2A 1EMTH 3MMEA 3QDHA 5JO5B 4F7PB 1TQBC 5JPMA 3RL1B 1WWBX 5K93A 5ICYB 1A1NB 5HHOA 2IADA 4XP6H 1E4WL 4MSWA 3BDXA 3ULUE 3ELAT 3C5SA 1VHPA 3P40A 5JXAL 4Q9QH 4LLDB 4MJ5B 3VXRE 3VXOA 3ULSA 5ADPH 4NOBA 1ND0A 4KI1A 1MFBL 1YPZA 1KJVA 4NNYB 4I0PC 4HH8A 4MA1C 3SDAB 3SDXF 4YHZL 1NMAL 4X4YA 3MV8D 3FFCA 2BVQB 4D9RD 2F53D 3MJ8A 3O4LE 5MENB 2ZJSH 1HIML 3GSQB 3DRQB 3RWGB 3S6CA 4AIXA 1JPGB 1MCPH 3PL6A 3QNYB 4HJJL 1TETH 1FL5B 1HYSC 4R7NB 5CAYB 2VL5B 5E08L 3HNSL 2NW2B 1AO7D 3KS0J 4UT9H 1QRNE 3FOLA 1YY9C 2FBJL 3DECA 4L8BB 2NY5L 4ORGB 5ERWB 1Z5LA 5IHUL 3ULVD 3HE7A 5TE7L 4JZOA 2OX5A 2YKLH 2Z8WC 1H5BC 5KSUB 4YK4C 1RU9H 4QRUA 2CKNA 3ARRA 3P9WB 4XPBH 3UYOD 1VFMA 3QIUA 5DEGA 5DI8A 4FABH 5C71A 2K7QA 3B5GA 4JFFB 3WKMH 2ILLA 5CBAB 3BKCL 3FO2A 2QBWA 4GBXC 4HPYL 1G9MC 2Y5TB 4JDVB 5DT1L 5FUCE 4XCNA 4ZQKA 3FQUB 4HT1H 3U7WL 4DEPC 1OAZH 4HLJA 2VZ1A 3S37L 3SGDI 1NFDA 4WI7A 3B2UC 4MB3A 1BAFH 1I3GL 1KIPB 1YYMH 3ZKXB 4ODSH 4DKDC 1Q9KB 3FAXA 5F6HJ 5GGSB 5IB4A 5DWUH 5CZVH 3EZ8A 4TPRL 3EJZD 4HAFA 2CKBA 5MENE 3BPCA 2JJSC 1F58H 5A2JH 1OP9A 1SVCP 1FH5L 2E5EA 4MA8H 1LQSR 4JFOB 1ZGLM 3ESUF 1U3HD 4NYLA 2QV2A 2X6MA 5DJ6A 1UVQA 2EKSB 3BW9B 1ROWA 1G7IA 2I27N 1MRCH 4OF6A 1XF5A 4MMXC 4YZFE 3WEXA 4IJ3B 2RJMA 3QDGA 1JK8A 1L4IA 2AV1A 1EGJA 2DM3A 1OY3B 3STZB 2Q6WB 4YWGL 3Q48A 3LEVL 3DV6B 4KC3B 1SBBA 5IQ9B 3X12A 4L4TA 4K94C 2VDRH 3FTGA 1V7MH 3WCYA 1U42A 4LLQA 4JFFE 3UJIH 4YHLH 3VFOA 4JFQB 5DGQA 2ZUSA 5BVPL 5GQBA 5BO1H 3DX6A 4O2EA 1RY7B 4YE4H 3U4EA 1B4RA 5KSBE 3TNMB 2BHUA 2Z93B 3P9LB 5JXEC 5LXGH 3WFCL 3ME0A 1VGKA 1NCBH 1Q38A 1H3TA 1HYRC 1P4LB 3OXRB 2HKHH 4IRZL 5DD6B 3AMKA 3KYMA 3ARDC 2HMID 1RZ7H 4RNRA 1OT2A 1OD9A 2VLKE 3PHOA 3HCVB 4D0DB 2OS7A 2BJML 2AABL 3ULUC 3JWDH 4JE4B 4XGZB 1DQJB 4U49A 5T3XE 5D1QD 3HE6C 1NC2A 2OTWA 5C0CE 3V5HA 1YMMD 4CUCA 4YBQC 4K3EL 5AUMA 2R56H 2GKIA 1RIUL 4UT7L 4NO0B 2X9XA 1BZQK 1OP5K 2PR4L 1N2RB 3ARBD 4MA3B 2GI7A 3QFJE 2H1PH 1VEMA 4WW2C 2VR4A 2Q8AH 3S5LA 1RFDL 1KEML 2DIAA 2XXCB 3OV6A 3CH1B 5F7FA 5CEXB 2PTVA 1CR9L 4DWHA 1ZSDA 4JRYE 1LMKA 9CGTA 5L8LB 3H42H 1A1MB 5HDQL