3N9GL

Crystal structure of the fab fragment of the human neutralizing anti-west nile virus mab cr4354
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
220
structure length
220
Chain Sequence
QSVLTQPSSVSGTPGQRVTISCSGSSSNIGSNTVNWYQQLPGTAPKLLIYGNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNGPVFGGGTKLTVLGAAAGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Neutralization of West Nile virus by cross-linking of its surface proteins with Fab fragments of the human monoclonal antibody CR4354.
pubmed doi rcsb
molecule keywords Fab fragment of MAb CR4354, heavy chain
molecule tags Immune system
source organism Homo sapiens
total genus 45
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2010-05-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n9gL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3n9gL01
5D5MA 4KJWC 4MLIA 1OF2B 2UWEE 2OI9B 4NP4L 5D96B 5DRNA 3O8XC 3MBEC 1P4BH 3QG6B 5B8CB 4O2EA 3SGDH 4Y8DC 4LMQI 3ARRA 5B4MD 1CLZH 4F8QA 5JDSA 1V5JA 5HDQL 5MEQA 3ZKXC 4F9PC 1S9XB 2BRRH 3TNNB 2BJMH 5DMGC 1KCLA 4X9BA 1X5KA 3V6OE 5LG1A 1H8OA 2EEDA 3W2DH 3QIBD 3U46B 3IDIB 5DD3L 5EC2A 4G8IA 1HOCB 1QR1A 1QQDB 3ALPA 2VRAA 3ULUL 5H37G 2AXFA 2R0WL 2ZCLH 3WE6A 3CAFA 4NJAL 1E4XH 3QIWB 1S3KH 5IHUL 1IGIH 3S35X 1DLFH 4HEPG 5HHVL 4YC2B 5DC4B 4KK5D 3QR2A 1EEQA 4MQ7B 5C3TA 1KYOJ 3C5JA 1WBXA 4ZS6D 1MCQA 1F4HA 3QUZB 3C08L 2VLJA 1EO8H 4X5XA 1NGQL 2KQNA 3S9DB 4PBVC 2XZAH 1KLFA 3HG1E 5DQJB 3QDJA 2AABL 1JZ2A 3G5VA 3LIZL 1R3JA 1AHWC 1G6RL 1YQ2A 1CFVH 3WN5C 4PJGF 1G0XA 4NC0B 2AERT 3RY6C 5I8CA 4U4BA 4F33B 1MHHB 4AQ1B 4MA7H 3IGAB 7CGTA 2XXCB 3HR5B 2YXMA 3G5ZA 5GHWL 4Z76B 5D7JB 1CK0L 3MV9A 1GC1C 1N2RB 2BVUA 2BDNH 4HT1L 1X5GA 1NAMH 5C0IB 3MA9H 4LNRB 2CUMA 1OOAA 2Q8AH 4CNIB 5SX4H 1CDUA 1DCLA 3F12A 1BD2A 3RPIB 4ONFH 1N5YL 4JRYA 4A2LA 1TVHA 1JGDB 3TO2B 1F42A 5CD3A 4GFTB 3C2AH 2M8XA 3KNBB 4LSRH 4MNQA 5FEBA 3MV8D 3NFNA 3NIGF 5FGBA 5F7MC 5BO1H 5C0CE 1IC7L 2IFGA 4GAGH 5F72S 3R06B 3E6HA 3I02B 1P7KA 4RNRB 3C6SB 5ERWA 1U95B 2DWEA 3WFZA 1C1EL 2X9XA 4E5XB 3SGDI 4BSVB 5F71A 5IV2A 3HA0A 3O6LL 1D6EB 2Z31D 1F8TH 5B38B 3IF1A 4I3SH 4NHUB 2OL3B 2A6DA 1FC2D 5ITFB 3T65A 4F7TA 1ZEAH 2E9IA 2A73A 1PEZA 3TH3T 5E6IB 1AGEB 4LLUB 1XAUA 3QUXD 2JE8A 4M62H 3N1QC 1A4JB 5D1ZA 3VD7A 2Y7QB 4Q6IC 4L9DA 4XPGL 4NWUH 5E8PA 1VCAA 2BXZA 4MAYA 5GGTL 5GPRA 1NJ9B 2HJLA 5J56B 2GFBA 3FHAA 1H5BB 2R23B 5DJDB 3RNQB 3GO1H 5T3ZE 4OD2A 2CKBA 3GNML 2FWOA 4FQ1L 3DMMC 1SJXA 1UA6L 3L3IA 4ODHL 4IRZH 4LKCB 1TXKA 4LSQL 1KB5B 2YHGA 1FZJB 3FT2A 4KROB 5E8NB 3TIEB 5IGXL 4P4KC 4DUWA 4U6HB 1CFQA 2X70B 4Y2OA 2CLZB 3TFKC 5DQDH 5HHQB 2APVA 3SDAC 3STBA 3I3EA 4WY7H 3CJJA 2EDKA 1X5XA 1WFNA 3NPZB 4PJHB 3SO3B 3KYNA 3FT4B 3LKPA 4ODTL 4TUKL 5KW9L 4JFDB 4O51A 5D7LE 4HIJA 1EVTC 2BOCB 4U6XA 5I1IH 3QA3A 4JO3L 1IQDB 3ZYOA 2D0HA 4KJYA 4XX1G 5C0ND 4NQSB 3RUGA 5FF6A 4G8GD 3FN9A 4MNGB 5C0BE 3L9RB 1T1WB 2R9HC 1F4YL 25C8L 1DANU 5EUOB 3RZCA 4TNVK 3DWTA 5SWSB 2BFVH 1INQB 3BW9B 3WDHA 3BWAB 2PXYA 5JHDB 1SQ2N 2AEIT 2FEEL 3DO3A 3SGJC 4I77L 3ULUE 2ZUWA 4PGBA 1Y0LA 3OR7A 3RKDC 3H0TB 3MLRL 1ETZB 4S1SL 2ZOKA 2HT3C 3T2PA 4FFWC 3NFPB 3MO1A 2Q86A 3R8QA 1ODAA 1XT5A 4ZUVA 1U91B 2E7LA 1YYML 2VO5A 3CZFB 4YBLB 3TV3L 3O6FB 4L8CA 2EKJA 3CVHL 2EE3A 3GDBA 1JWUB 1HHJB 3GB7B 4EQ2A 4RAHA 3KR3H 2XZZA 3N06B 1T7VA 4PJCB 5DD5H 1XFPA 4ZSOB 1O7VA 5C8JA 5L8KB 5IBTL 4U1MB 3LKNA 5EUKA 1PFCA 5IM7A 4KJPC 1DQJA 1CLCA 3ULVC 4HK3J 1X5JA 1YJDC 4AYFA 3FO2B 5DFVC 2IAMC 2HVJA 4PRBB 5F3HB 1F6AA 3FHQA 4WIQA 4F58H 3KPPA 2BY0A 1A6TA 1A7NH 4YHMH 5J6HA 4HS6B 5HYJE 5I18H 1PYWB 1C5BH 1WWBX 5DZNA 2Q1EA 2AS5M 2X4OA 5HGBB 5SWZB 1CGWA 3P4NA 3QT2A 5DJYB 3VFNB 5JA8B 4WWKA 3BUYA 4KXZH 3MRQB 1CTOA 4OZGF 5ENWB 2J6EH 3BKJH 3TNMB 3UTTA 1X7QA 2I9LB 3C5ZC 4XNZC 1EHAA 1JBJA 3L5JA 1Q38A 1OB1B 3TZVB 1HDMB 4JVPA 3QUYA 1ZOXA 2E7MA 3LKSB 4ORGB 4WFED 1MREL 3BSZL 3L3HA 1FLRH 4GS7C 3RJDA 1BFVL 5I1CH 2ED9A 4P2RA 1F00I 5EPMB 4GW4A 5HTSA 3U4EA 3UJIL 2J8UE 1Q1JL 3BIKB 1QOKA 5FYKE 4F7CB 3Q48A 5IROC 4NQXB 1ZSDB 1RUPL 1QA9A 1JK8A 4UQ2A 2FJGA 1RI8A 3QIWD 1K8IA 2VZSA 3LKOB 4U3CA 1OTSC 1NFIA 3VXUB 4PRDA 5E9DD 4WHYH 1L0YA 2KKQA 3HNTH 4Y1AA 5JXEA 1U8KA 3MLSL 3MJ7B 5DC9B 1A7OL 3BRGC 2P5EE 3GSRA 5T3XD 3O2VH 2KBGA 4PUBH 3FOLA 5CFHA 3QUZD 1EEYA 1BQHB 3D25B 4HV8A 4Y2DC 2ITCB 2HTKC 2RCSH 4IM8A 4N0YL 5IOPA 4HK0B 1JWSB 2EYSB 3E0GA 4QRQB 4JDVB 5FFLA 1U3HC 1R3LB 2DI7A 4Y5XA 3FQRA 1EUUA 5CJ8A 3V7AE 4E42B 35C8L 5C0FB 5SX5K 5AAMA 5GS1A 2R4SH 5D7JD 2HG5A 1M4KA 4G6ML 4IEFB 4ELMF 4QXWA 3F7QA 3VXRB 2IF7A 4MLSA 1JJUA 1LD9A 1C5DB 3WS3B 4QTHA 2YRLA 5BRZA 3QH3A 5EBWB 4NNPH 2NY4B 3EO1A 3RL1A 2AJUH 4C54A 3SDXE 1SYSA 2HA1A 4OI8A 1DBBH 5ID1B 3TO4B 1T7ZA 4TVSa 5L2KE 5I1JL 4J8RA 3HI5L 4HZLA 3VRLF 4C83A 3M45A 1C12B 1EUTA 1OAKL 5L8LB 4PRNB 1R5VA 5ETUA 5F3BB 1T1YB 4A6YB 1CLYH 4KXZI 2NY3B 3SGKA 5I6XC 1FAIH 4Y4FB 4ZOEA 1JZ7A 5JIHA 4BH8A 2L4OA 5DWUH 5DRZA 2C1PB 1FPTL 3JV5A 1IQWH 1RZGB 3V0WH 3S88L 3GSUA 3VXMB 1AJ7L 1J86A 1KFAL 1MQ8A 3ZE1F 1PKQA 1T03H 3WIHA 1I1AA 3W9EB 2R8SH 2YD9A 1HNGA 3WD5L 1DTUA 5I2IA 1B0GB 4NGHH 5E6ID 2ZUYA 3V5HA 1OQOA 2R2BA 4U1LA 3BX7C 1MNUL 2DQGL 2NR6D 3P11H 4Z7NF 2GTZB 3BPOC 4YXKL 3IDXL 2PW1A 1X5ZA 1QTYT 3MNZB 5CD5D 3GUTB 5JPMA 5IB5B 2P8MB 3WHXB 2OL3H 5GGQH 3IETA 4NKMB 1CG9B 3LRSB 5B39B 3NA9H 4QRUA 5AZ2H 4XI5C 1MOEA 1U8HB 4AG4L 1X5HA 2DM2A 5LGHL 3NAAL 1UM6L 4KROD 5E2UH 2OSLA 4C55A 1A6AA 5I8KH 2AJZB 4Y4KB 1QBMH 3HR6A 1CGUA 1S8DA 1BBJB 4NCDA 3RWFA 2EC9T 4JDTL 4M5YL 3CSBA 1U2HA 3RI5F 4TVPL 1AO7E 3VXTB 3K8KA 4JY4A 1VDGA 1D5XA 1N64L 1SBSL 1KB5H 4ZOCA 1JPST 4RWYL 5BV7C 5EORH 5CILL 5INCB 4JFDD 2Z92A 2A6JA 3KPLB 1G7PA 3AREB 1GOFA 3VI4F 5CMAA 1RK1B 4FXGB 1JHLH 4EVNB 1A2YB 1CD1B 3GMLA 5GZOC 5C08E 1FJ1B 4WCYH 5F9AC 5HI4D 5F93C 1I8LC 2O5ZH 3EOAA 3EFFB 2X42A 5IT2H 1JN6B 1UKTA 1NEZG 4EUPB 1JRHH 5GGSY 2FX9L 3BMVA 5SWSD 3AB0C 1EGJH 1KBGH 4XMPL 4KK6D 5JHDD 2NLJA 3PWVB 1NPUA 5I17A 2ATKB 4LDOB 1KCSL 4JO2L 2UWEA 2VL5A 3N1GC 2WWKT 5AZEL 1CDGA 3V95A 3RGVB 1DP0A 1FFPB 5C09E 3NZ8B 4XPFH 4CADB 5JORA 3V6ZA 2GJ6E 5GRJL 1W0VB 4HIIB 4Z9KB 2KDGA 1TTUA 4RX4D 5TE7H 2WAHA 1KEGH 1U8LA 2BNRB 4K71B 2X6MA 2BSTB 4NOBA 1TJGH 4JVWA 3MFGB 3GSXA 1MCPL 4NO3B 3MLUL 4PJAE 2AXGB 4P5KA 3GMOB 5JW5B 2QSVA 2PO6B 3MRLA 5HYFA 4PJIB 5GRUH 5DT1L 1WV7T 3DVIA 1P4LA 3D69A 3FL7A 3LV3B 3RX5A 2GITB 5D7KD 2P47B 3ZSSA 4JFYA 2R29H 3NCJL 2GY7B 4PD4J 1ZVSA 4U2ZA 5GIRB 3SKOA 3R0MA 2VC2H 4ZNEA 1DFBL 5DURB 2V17H 5CS7A 3MOBL 5J1TC 5SWZD 1OP3H 4OSUL 3WEXB 1RJZB 3AS0A 1WZ1L 1UXSB 5TH2A 4L1DA 1S7SA 2N7BA 3U9PL 5IB3A 1UC6A 1OAQL 5EC1B 4BK4A 1II4E 3B8YA 3K4AA 4OGYL 2CRMA 4L8SB 4OIBA 3QSKB 4JREB 4DKDC 1FBIL 1A1MA 3TZVD 1BAFL 2F19H 2H32A 1P7QA 2D7MA 1XGRA 1BLNB 3U4BH 4HMEA 3F7RA 4QYOA 4WHTB 1CCZA 3MRBB 5I9QB 4BZ1L 3EHBD 5EUOF 1QNZH 1FG2A 2EDRA 4HH9A 3HNVL 1KCVL 4KHTH 4Z78B 2FSEA 1AR1D 4ZAKD 1H3GA 5KSUB 3U0TB 3EUUA 2QQKH 2VDNL 5JQHC 3H7BB 3I6LD 2BERA 1JRHI 3VXUD 4OF0A 4LVHC 4Y5VB 4NRZB 4K2UH 3WLBA 4HMCA 5LWYH 3V4UL 4AH2A 1UJ3B 5C0CA 4YO0A 2HKFH 3WUWB 2WUBL 4D8PA 4J3SA 4X9FA 1MWAA 3VFPB 4DZ8A 1J1OH 4LU5H 3LD8C 2EE2A 2B5IB 5EA0L 1V7NL 3WLWD 2XKNA 4PJCF 5FDWB 5GGUB 4LPUA 4KZDH 4KTEL 3WKNA 2F54E 4X0KB 3CMOL 3LMJH 3LHPH 1IC5H 2ZG2A 1XEDA 5GSRA 3DECA 2EYTB 1TQCB 2NX5E 5D1QC 1I9JH 2CIIB 1GGUA 3BT2H 3VXRD 2E9JA 2VDMH 3T77B 1AC6A 2X4NB 4NO0B 4LFHD 3SJVD 2H3NA 3X3FH 1B4JL 1LEKB 1UACL 5I1HL 1MJUL 3JUZA 1IGYB 3G6DH 4QXTA 2JIXA 2NY4D 2A6IA 4LCIL 3BO8B 2WIIB 4TVPE 1AC0A 4XGZB 3TO4D 1X3DA 1ZHBA 3JWOH 3PV6B 1I7TB 4JFXA 5DJ2A 5CINH 1EHNA 2FEDD 3GGWA 4AJ0A 2VQ1B 3QQ3A 3VCLB 1ZE3C 1HH9A 2BSED 2W0LA 1J0HA 2VJXA 4Y4HC 5DDHA 2NY3D 4XVJH 5F7NC 4BZ2H 4P9MH 1IFHH 4PJBB 1IT9H 2C26A 2AGJH 1J1XH 4JFZH 4Z5RB 3QEQE 5MEOB 3U0PB 4RMQA 5K9KB 1DL7H 3VXMD 2VQUA 4LAQL 3VW3H 5IKCB 4CN6A 5SV4A 3VGHA 1HEZA 3K7UA 5E7FA 4YQXL 4PR5B 4XVUD 5L6YH 1E0OB 2R0LH 1L0QA 3QUXA 3D0LA 4L3AA 5D7LA 4A6YH 4DK6A 2QHRL 1RJYB 4YFDB 2JJSC 5HYSG 4C56E 1CF8L 2GQHA 4M5ZH 2XPGA 5IMLB 1JI2A 4L9LC 4MZ2A 3ZT7A 5C0BA 2APWA 3I6KA 2ZSWB 4NM4H 1D5MA 1YDPA 3DYOA 5T5NG 2AI0H 5EU7C 2OZ4L 1OSZB 4FQ2L 4EJ1C 1FE8H 4HKZA 3I2CL 3DSFH 4UV7L 1LP9B 4WW2B 4MJIE 4CMMB 3WNOA 2E9WA 3MRJB 3L3JB 4NKDB 4QT5A 3GJFB 1CICD 4JAMB 4P3CL 1C7TA 2OM5A 5T1LB 1CGXA 1EDQA 2JB5H 4E9LA 1PY4A 5I74C 2W1NA 3SGEH 3DURA 4Y4KD 4YX2H 2MPAL 1A3LH 4XCEA 3D18A 4M1GH 2FBJL 4Y89A 4ZXBA 4S10A 2LU7A 2DLTA 3TIDB 1TNNA 4QXGH 1NGWB 3HG1B 4OZGA 43C9A 4J3OC 2XWTA 4YDLC 1B88A 4R0LC 3IVKB 1IC1A 4N0UE 3BPNC 4APQC 1G6RA 4JRXE 2ZCHH 1Q94B 1T0MA 2V2TB 3OX8B 1N7MH 2HN7A 1KJ2B 1KELH 3VWKC 3W39B 4JHWH 3QHZL 4P2QB 4X4MA 5ESVA 1NC4B 4Z77A 5DMYA 4H20L 1ZTXH 1QSEE 3S36H 1KN2H 1U8PB 3QISA 3H9SB 4EI5B 2HFEB 4OV5B 3EYVA 4GRLC 4LLVB 4F2MB 1LEIA 2HLFC 1OPGH 2JELH 5C9JB 3SCMC 3ZMRA 2Y23A 4N0CC 4PJEE 1XGTA 1KIPA 3RGVD 2AEPH 3CZJA 1XGUA 4FFVC 4RDQG 3UC0H 1OWRM 3HC0A 1K2DB 5KVFL 1RULL 4BFIB 4OM1H 4EUPH 3FB5B 1B0RB 1JUFB 4L3EE 3M1BA 1NFDB 2BNRD 2WQRA 5D93B 1ZLSL 2XN9A 3ARBA 1MCEA 5FYLL 1FNGA 2R1YB 2DL9A 1GGIL 3DRTA 3GK8L 4RMTA 1IKNC 1RPQA 2D31B 4UNTA 5D8JL 2PO6D 4W6XB 2CKNA 3PNWA 2EH7H 3MRDA 2UYLB 2Y25A 1G0DA 3DVGA 3KJ4B 1T83A 2YD1A 4OD3H 4RMVA 5A16B 1A9BB 1CDCA 3HNSL 2H26B 3INUH 2VLKB 1IARB 3C60B 5F6HI 1N6QL 2DIAA 4P59L 2FX8H 2K7PA 4U1NB 3CSGA 3DJ9A 4N0RA 1RHFA 4UNVA 5HGHA 4CJ0A 5DURD 3N0PB 5D6DC 4ALAH 3KPNB 4GW1A 2Y07H 4P46B 5DK3A 5LBSL 4WV1C 3GHBL 5DD1H 1AGFB 3VRJB 3MUGB 2GK0B 3K2MC 2K3TA 3E8UL 4ZTOL 2AJXL 2W9DL 2ZOLB 2CUIA 3SGEI 3C2SA 4MA1B 2NCMA 5HD8D 2O5YH 1JV5A 3MLZL 2VAAB 4KKBD 4N9GA 1N6VA 3W5NA 1V05A 3T1FA 1YYLH 4G43B 4FTVA 5LAXB 3WHE1 2Q7YB 3KXFB 5IWLA 3AM8A 2P8PB 5DI8A 1LE9B 2G5RA 4FQIL 4F15B 4L5FL 2E8YA 4NJ9L 4X8XA 1WZKA 3HS0A 3UBXB 4OD1H 4BQCA 5ANME 3OWEA 3MZTA 2ZP0T 3Q5YA 4QF1A 1Q9WA 1L0XA 3MA7A 3QIWA 4YPGA 5E24E 3SKUD 4IOSD 3UMTA 1MPAL 5EOTA 1YECL 5E9DA 3GBNH 3TH4T 2OMBA 2QSTA 3EJYC 4BKLA 2WSKA 4R97B 4YHNB 1P69B 4XCNB 2A77L 3OF6D 3UPAA 5IFJB 1RMFH 2CLRA 4JPKH 3VFUB 4R4BB 3UTSE 2B0SL 3UTZB 2FLRT 5B38G 4J1UB 5E8EB 1VFAB 4U33A 3KHQA 4K3EL 2NW3B 5AUMB 4LK4A 4LLWB 5C6TH 3QIUB 4I18B 4NZUL 4X6FB 1ZGLP 3HI1A 4EDWH 3WSQL 4I0KA 3TVMC 2BVPB 4UUJB 4HPOL 4FQQB 1T5WA 4PGEA 3L5XH 1MEXL 4Z76A 5FYJL 1I85A 1CQYA 3O3EB 4KTDH 3F5WB 4RQQA 1QBLL 2PYED 3T1WA 4NO0D 3K2UL 3ROOA 1K6QL 3OJDA 2ZJSL 4P23B 2OK0H 5BZDA 1ZHLB 2YD8A 2DRUA 4TULH 3G04B 3WJLC 4HUWB 3QUKB 3HUJA 4HBCL 3QRGH 4GG8A 3W0WD 3IJYB 4JM2A 5FIEA 3ARGB 5C7XL 1SY6H 2DQEH 3PQYA 4X6EA 1FYHB 4RFOL 2GSGA 3D39E 1H9VA 3TH2T 1BFSA 2IBZX 4NQDE 4OLEA 3SE9L 1FN4B 4RNRA 1MIEH 3LCYA 3DXAD 3DV4A 4BFBD 4R2GB 1MLCB 5T33L 4XVSH 1EMTH 4PRPB 4D0BB 1WISA 3G6JE 1J8HA 1WBYB 5C0RH 3QDME 5HYJB 1YPZE 5I73C 1I1FB 5D1XC 1KN4L 3OPZH 5FYJU 4GKSA 4JKPH 4PJXF 4FQLH 4BM7A 3MYZA 3C6LC 1FORL 1A22B 2B20A 1OAUL 4XWGL 4AZ8A 5JUEH 3VG0L 4K3JL 5DJAB 1MCOH 3KWWB 5CCKH 3PP3K 5DYOA 3FOMA 5BVPL 1DVFD 3B5HA 4QHUA 3T08A 4P3DA 3CLEL 5HY9A 4HUUB 2UZXB 3RRQA 3UJJL 5DJ6B 1DSFL 4EBQL 1AQDB 1G7LA 1KIQB 4Y19B 1UWGH 4OB5L 3SPVB 2ATPA 3T8XA 1A1OB 3EDDA 5FYLE 1ADQH 5EBLA 4WHDA 4RGOL 4QLRA 3THMH 2J8UB 3QCUH 4AM0B 5FO8A 3OKOA 3O3BA 1CGYA 4X99A 4KI1A 3OAUL 3RDTC 4N1CA 3T04D 5MP6H 5T1LD 4OAWA 3BRFA 5IQ9A 1WCBB 3CXHK 4OQTL 5J57B 2CLZA 2BOBA 2P5EB 3ALWA 3CFJB 4OCSH 3GKWL 1BQSA 4PTTA 3P30L 5L9DL 2CK0L 4K23H 4LBEB 5DF0A 5KSBE 3VGAC 1DBKL 4PJAA 4PJ9B 2R1WB 5GJSH 5JOPE 1N59A 4JFDA 5FAAA 1MFEL 1ZT1A 4K3GA 3H3BC 2Y36L 3VDBA 4Z0BH 3MRGB 3LRGA 3T2NL 5CEXB 3DIFA 4Q9RH 3PHSA 4HK3N 2HKHH 4YBQD 1X4XA 1S7QA 5EU6E 4BSWB 2OS7A 1RUAL 3AY4A 4JPIA 1IGFL 5KG9A 3IAQA 4Q2ZA 5I30L 4P2QD 4ZTPL 1YY9C 2BNUB 3RWCA 1GCFA 3WIIL 1FYTE 2IQAA 4H25A 4DEPC 5E00A 4PJBF 2A9MH 4S0TD 5JHDA 3H9SD 4KVNL 5E8DH 1HHHB 2YSSB 4N68A 1IBGL 3E2HC 3TBSB 3TBTA 3SDXB 1FNAA 1KJ2H 1RUKL 3NFPA 4JFQB 2PUQT 3IDUA 4OF3A 4NM8L 5IVNA 4WI2A 5HHPB 5L2KB 2EE6A 2FX7L 3IJHA 4RX4A 4S1DC 2AJ3B 3CZFA 2HFFB 1LE5A 1DBAL 4JG1H 4KDWA 4XBPA 2BK8A 4XC1H 1UQSA 3RVXC 1S7RB 5HI5D 5DJZA 1Q0XH 1FVEB 1MHPL 3OHXB 4UIMA 4HCRH 4OF7A 3AMLA 4U3HA 5CHNB 3EGSA 4PP2A 4OCYH 3O9WC 1JWMB 1T2QL 3C9NA 5CJQH 3CK0L 4WEUD 3FO2A 3D0VB 1LP9F 4WW2F 4LQ1A 4LEOA 3LN5B 1SJVA 2FATL 4U7MA 3MV7D 1BQHG 2VLKD 4JQVC 2YZ1A 32C2B 1D5IH 3TYFB 1MI5E 4LCYB 3JWDC 1MLBB 4PJ7E 5FKAB 5DK0A 5SWZA 3HRZB 5KN5B 4XPBH 8CGTA 5LCVL 2COQA 4OLXL 2DBJA 4KUZH 2D0GA 5MENE 2CRZA 2CD0A 4KK8C 2FJHA 3TN0A 2FIKA 3KVQA 4NO2A 2GK2A 5D71H 5ADPH 3CVHB 3GSQB 1X5IA 2X4PB 3ZL4L 2F54A 1SJHA 3FFCE 4JG0L 1R5WA 1TVBA 1QHOA 4HULB 3KXFD 3F58H 3EOYG 1A6VH 1IE5A 3LOWA 3MRRA 3L5WA 3UEZA 1WTLA 5F9WB 1YNLL 2E3VA 4K7PX 4HIXH 1CGVA 1JGEA 3OJ2C 2WBJD 1NCDL 4PY7B 4PRHD 5T5FH 1T80A 1BZQK 4ZAKA 5T3ZH 5HPOA 1NMAL 2C7UA 5A3ID 1N26A 4MB4A 1AO7B 3BP6A 4IOFD 1KCRH 5E2WH 1P9MA 2X10A 4ZPVB 1ZGLB 3QEGH 2A38A 5MEPB 4BH7B 1JYWA 3Q3GA 2VE6A 4LLYA 1JMXA 1CFTB 2IPUK 1GH7A 1K8DA 1K3ZA 4JFHD 4LAJH 4RIRB 1WTGT 5C08B 2ZUQC 4AEIH 1OGAA 3WKMH 1NFDF 2X1PA 1F2QA 4B5EA 2N7AA 2NY2B 1K9TA 4FQXB 3UXFA 1K5NA 2B2XL 3QIUD 3OXRA 1NGZA 4KHXH 5EZIL 5F7DA 3OGCA 2E27L 5H8DA 5J1AB 4QRQA 4JDVA 4YXHL 4ORZC 1FDLL 2PCPB 3BP7B 1YUHB 3VDAA 3GRWL 3HZKB 1AQKL 5CIPA 4QRRB 3ULUD 5I16A 4N8VB 4Y16C 2NNAA 1NANH 5HDQH 1GGYA 1DQLL 5C09B 3SJVA 4IIQA 4N0FA 4Z7OE 4P5MB 3PWNB 5I76A 2GJ6B 5F8QC 5E1HB 4OIAA 2H1PL 1QLRA 1MUJB 4M7LL 5C6PB 4IRSB 5B3NA 3ARGD 1AP2B 1RK0B 2WLZA 3HPJA 4WTZA 1A6ZB 1LK2A 4WO4B 3EYFB 3W9DB 1Q72L 2B4CL 5HPMA 1RZIB 4BFGA 4JFFA 3ULUH 2R0WH 3VFRB 1CGTA 4WGWB 4NJAH 2YD2A 4MD0B 1UENA 4FQHA 4R2GD 3DRQB 4PRPD 1JCKA 2IEPA 3D3VE 5BVJA 2VR5A 1KTDA 3C08H 3VGEA 1G7HA 1L9NA 1I9RL 1NGQH 3WV0A 4X6DE 4KZEL 4NBZB 1DUYA 3TLRA 3VXMA 2GT9A 4HFWB 4E0RB 2Q7NA 3LIZH 3CFEA 4UAOB 1CN4A 3NGBC 4WEBL 4E41E 2HTLD 2DYPA 3BDBA 3IFLH 4LHJB 3DVNA 3EJZD 2H41A 4N1HB 4JQXA 2JJUA 2VMFA 3AFLA 3O45A 4EUPG 3MNZA 3Q6GH 4K8RD 3GUTA 5JPNB 4OTXH 4N5EC 4FRWA 1RZFH 4LCWB 1CK0H 2QLVB 2IMMA 4Y19D 5ALCL 2YUVA 4GUPA 1S9WB 3RJQB 4DGYL 2HVKA 4HT1H 5IB1B 4AIOA 4DN3L 5B39A 4ETQA 4KDTC 2EDJA 4U7KA 5GS0C 2EO9A 5FYKD 1N5YH 3MLTA 4CVXA 3UBXI 1UB5A 1ZLVH 3RWJA 1CICA 2ERJB 4EN3C 1JPFB 1MFNA 1W72L 2K9UA 1HH6A 1NGXB 4U6YA 3NCBB 4Y4KA 5D70L 1QUNA 2P24B 3ULUF 1IC7H 1WBZB 2P5ED 1OHQA 5JW4N 2O61B 3WXVL 3HZVB 4X7DC 5DO2C 5F88B 1QYGL 3BZFB 1ORSB 3D85B 5FYKH 3DUSB 2KH2B 1NKRA 4UU9B 1NLDL 4PJ9D 4YFLI 1KV3A 5GJTH 1NANI 5DS8A 3N50A 1MAJA 3O6LH 3CPLB 5KVDL 5DMKB 5HGAB 2Z8VC 3T0XA 1GZQA 5F1KC 2MSPA 2PTVA 4GRWB 1G7MB 2GJJA 2NX5B 2W0FA 5TGBA 1WC7A 5B4MC 3B83A 4XPGH 4YHOH 1A3QA 2NY1B 1QFUL 4NZJA 5JO5B 1FZKA 1QZ1A 4LIQL 3RAJL 5GGTH 1O7SA 1BVKA 3G6AA 3QIBC 2ZUXA 3IDNA 2FHCA 3HLAA 4KRPB 4MXQD 3GNMH 1FL6A 3CNKA 2EIBA 4XX1E 2RHEA 4FQ1H 1UA6H 3IKCB 4F3FB 2ORBH 5L2KD 1HXMB 2R4RL 3LVEA 4LSQH 1QSVA 4BQ8A 4ERSL 4BQBA 2X89A 1FL3A 2LTQC 5IGXH 2J8OA 4KK5C 1T22B 2Z4QA 3OKMB 5ESAA 4ZS6C 5JW5A 4CN1A 1MFCH 3SDCB 3QJFA 3QEQB 2MTPA 3Q6FB 2AQ1A 2VZOA 3QHTC 1NUFA 1W8OA 1S5IL 3EYOA 2J8UF 3QDHA 4ODTH 5D2LA 2WZPD 1I3VA 3IJSA 3QQ4B 3WUWG 4MDJB 3MGAA 3KDMA 4TUKH 5KW9H 5K59E 1QBBA 4HIHB 5FO7A 4MWFA 4C56B 4BELD 3U7YH 1S7UA 1PY9A 4O00A 2AK4D 4GXUM 1OQXA 1D5BA 3ARFB 3AXLB 2FGZA 1HINL 4HWUA 4BQ9A 2FECL 2YBRB 3HE6A 3MRCB 5DUBB 1UB6B 4FZEL 4ONHA 1IAIH 3U1SL 4L8SA 3O4LE 2BY2A 3ULVL 5DUPL 3QDGA 2OZ4A 3OJVC 4TPRL 4MJIB 3B9DA 4YHIA 4Z8FL 4O02L 4X5WA 4MJ6A 3MLRH 5J3HD 1R24B 1IGTA 4LCCB 5EO1A 5EB9A 3CFCL 5EFIB 2OXGA 5F7KC 1CIDA 1SM3L 1NKOA 5C2BL 3TV3H 3S4SB 3F62A 4PJXA 3SOBL 3CVHH 3L95A 3PUCA 4JFEB 2R15A 1VFBB 3ARYA 2JB6B 1FFOB 4G9FE 2YRZA 3C8HA 3ILQD 5KSAB 3RKPA 2VITB 1JYVA 4Y5VA 2HMID 1NCUA 4X5LA 1D3CA 1JHTB 5E1AA 2Z31C 5LVEA 5EZLA 4N0UB 4CKVX 5DVOA 2RFXB 3BHBB 1CFBA 1BP3B 2B39A 4JRXB 1HILB 1ZMYA 2MCPL 5C07A 1RIVH 1AD9A 1LO3H 3H9ZA 5C08D 4U1GB 3OZ9H 2CDEB 2NY2D 4FNLL 4FQXD 1NCNA 2APBA 1QSEB 5KJRL 4P4KD 5DTFB 2J8HA 2OJZL 4JLRA 4XVTH 4Q97A 1TETL 3KPRB 3BJLA 3SDAD 5BMFH 4QRRD 1KGCD 1EJOL 1U92B 3S5LB 5H94A 1JNHB 4XP5L 4HJGA 2PYEA 4PJEB 5CP7A 5IHBA 4M8VA 1A1NB 1FL5A 5CZXD 2NW2B 2R2HB 1ES0A 4CN4A 4X7TB 2GJ6D 2XZQL 3ARPA 2VLLA 3E3QC 5C0AB 4D9LL 3HC4L 3W0WA 4NQCB 3V7MA 3BO8A 1QG3A 3FQXB 5GGVL 3UJIH 5KOMC 4PY8J 3ZLQC 1HWGB 2R9HD 1I8IA 4YUEL 4IRJB 1RUPH 3MNWB 1P5VA 1M1SA 2F9BT 1BQLL 5EOQL 3GMPA 3PWPD 3DXAA 4UILL 4PRAB 4HIEB 1VEOA 3IXAA 5EO0B 2D4FA 4MCYA 1ED3B 3V4VL 1DDHB 5FUCE 3MLSH 4JJ5B 5J12C 1G9EA 3BXNA 3IXTA 1HHKB 2J1KA 1CT8A 5C0NC 3VE0A 3R1GL 3O4OB 2IBZY 3A6CL 4NKOA 5CJXA 1M7IA 4IOIB 4N0YH 4X8JB 5J6GB 3OKNB 3WHE0 1M7DB 1LK3L 1PD6A 2OTUB 4KVCH 2DLHA 5BXFB 1UFUA 2GSIB 2J12B 2IGFH 3IKKA 4EKXA 5DSCA 1DVFA 4JZJA 2BCKA 5EU6A 4M43L 1FIEA 3L5IA 1DQDL 1RSFA 4LCWD 1GOHA 3VGFA 4OV6F 5DFVD 3X14B 5L8JB 2IAMD 4JB9L 3BP5B 2IALB 5DJ8A 3BQUB 1FYTA 5BW7A 4EI6A 1VENA 1P2CA 2DBLL 4P2OB 2GUOA 3WS6A 4EXPX 2BSRB 5ANMB 4G8FB 1URLA 4S2SB 3ARDB 2NXYB 1TZGL 2E7BA 3GJFA 4JAMA 2MFNA 2D0FA 4CMHC 3ARZA 1Z5LA 1X4ZA 4W4OA 4I8DA 5I1JH 4PTUA 1GIGL 1FAKT 3HI5H 4UDUB 4YDJA 4M48L 3O11A 2EIDA 1INDL 4I5BB 3WO4C 1TCMA 2V2XB 3CXHJ 1OAKH 3WDJA 1KG0A 3GFUA 2XWBB 3WFEL 4YHYC 1NGWA 3BD4A 3UTSB 3D85D 3PJSA 4PV8B 3BGAA 3DGCR 3OB8A 2JCCE 1MFAL 4QXUL 5I66A 1FPTH 2ADFH 3MOAH 4M6OL 1E28A 4JDZB 4F7PB 1OTTD 4JCLA 1AJ7H 2VISB 3VXSE 1QEWB 5GISL 5IJKA 1BWWA 2OI9C 5D96C 3WD5H 2VN4A 4R3SB 3ULVE 5B8CC 3P0YH 2CJUL 1ORQB 1L7TH 5DQ9A 2FCBA 4P2QA 4PJ8B 2NX5D 4YHLL 3PWUA 1MNUH 1OTSD 1EHXA 3RNKB 4CGTA 4L1HA 4YXKH 1FVDA 2NY1D 5HHOD 3ZE2E 3O3AB 1CFNA 4PJ5E 5K93A 3P9MB 4FQPA 4MNHB 4M3JA 2WUCL 3WFCL 5KSVB 1TFHA 5BV7L 4KRPD 4GRWH 3HE7B 4FMFA 2OTPA 2F8OA 1B0RA 3GI9L 3FFCA 4AG4H 4YGVB 3D39B 3A0OA 4NQDB 3UBXG 1UM6H 3B9EA 4YC2C 3TC9A 4JZNB 1U3HD 1H3VA 3MREA 2DMCA 4LCUA 5H2BB 3IFOA 3OAZH 4QRPD 3G6JB 3QUZC 3SDCD 2YK1L 4CVZB 3QUMB 3GMNA 4JDTH 2UYLA 3DV6B 4M5YH 2VZ3A 3QDMB 5BS0E 1G7IB 1I1CA 1YPZB 5HHNB 2D03H 4ZFFB 1WVZA 2FBOJ 4H1LA 2UY7A 2ZNXA 1N64H 1SBSH 3B5GA 3MRNA 3MV7A 2VLKA 3LH2L 3REWA 3S35H 5CILH 2EKSA 4X80L 3TT3L 4MCZB 5E2VH 3BWUC 3QNZA 3S98A 2ICES 1NBZB 5DLML 1H3XA 1IEBB 5D7JC 5FO9B 2GK0A 1FNEB 4MMZC 2FX9H 1WQVT 1XF3A 3EO0B 3GSNL 4WJ5A 4XMPH 3FB7A 4YIQA 3BESR 3FO1B 5I8EB 2BVEA 4KY1H 4JO2H 4BA8A 4I48B 1HSBB 3KXFA 4HJJL 4P5TA 1JZ4A 3DX8B 1FZOA 2GI7A 3MR9A 4NN6B 5AZEH 1HQRA 1LE9A 1AGCA 3RTQB 1LDSA 4GRWF 5GRJH 4U1HA 5FM8A 2QKIB 3U6RB 2C3GA 2H2SD 2VDQL 2WBJA 3HMXL 4PRHA 3TA3A 2DQFA 3EDKA 1U3ZA 2LV4A 1A64A 4OQTA 4V1DA 3V52L 3ESVF 5EZOL 1MCPH 4JFED 3QWRA 3MLUH 4NT6A 4LLAA 4XXCA 1HQ4A 2Y4SA 5KSBB 2AV1A 5E94B 1XMWA 1X5AA 2FHBA 5DT1H 3ZHKA 4YHNA 5ACLA 5J89A 1I9IL 5ICXB 4K7PY 5F9JB 4ZO6A 5JMRA 4JRXD 2B1AL 3RHWF 1FNFA 1YEIH 5E6IC 2YPVL 3VGGA 3NCJH 4XI5D 1F13A 3MJGX 43CAA 4GAYB 2X4SA 2R2CA 4NNXB 3D3VA 1X5LA 1XIWB 1NBYA 1A9EB 1NDGB 2OTWB 4PG9A 5CD5C 2P48B 3DX6B 3GBLA 2OQJA 3MOBH 1CE6B 3TBYB 3IFPA 4OSUH 4JGUA 3GIZL 3PWJA 1H5BC 4KPHL 5AYUL 1WZ1H 3KPRD 4Z7QF 1S7VB 1KPVB 2EXWD 3DHJA 3MRFA 4C4KT 4EDXB 3QFJD 5CWSB 1FO0L 3U9PH 3L3OA 1OAQH 4H88L 1T3FA 4OGYH 5C0JB 4LPTA 3S36X 4D3CH 5KS9A 4M8QA 5F7WC 4JKLA 3V4PL 5CKAA 1CXLA 1AFVL 1FBIH 2UUDH 1DLHA 4OFIA 3WJJC 3NA4A 1BAFH 4MGXA 4KROC 4XC3L 1INEH 1JNJA 5C0AD 3STZB 1KENL 4NQCD 5IHZA 4BZ1H 3MLVL 1U58B 15C8L 1U8JA 3ROLB 1KCVH 4OZHE 1DN0A 3SO3C 3IT8D 4FP8L 1MF2L 5D6CB 2DQHL 2Y06H 2VDNH 1F4XH 1AD0B 1WGOA 1MLCA 3VWJB 6FABL 1TCRB 3OMZA 2ZUVA 1MCIA 2Q6WB 4ZUUA 1P5UA 4ZYKA 3W81A 1UT9A 3TWCH 1MI5B 4D9RD 4PJ7B 5D7SL 3KJ6H 5HI4C 5TDNA 3LAFA 4HGWA 1JGUL 3I6GB 5HYEA 3P77B 4X9IA 5EA0H 1S7XA 5MENB 4ZO8A 5IR1B 3DTXB 1Q0YH 1NL0L 4GG6B 3V7AG 1YN7B 2NYYD 4KK6C 4L8DA 4KTEH 3VXOA 3MROA 5ADOH 2VXUL 1QFPA 4KJQD 3LPGA 4U6VL 5D2NE 3AMKA 3BP4A 1R3HA 4UDTA 2H6PB 4I2XE 1DJSA 3GMRA 3ES6A 4YPJA 5JZ7D 4ODUB 4AT6A 3JVGC 2ED7A 4MVBD 3QCTL 3BQUD 1B4JH 4YBLC 3O6FC 1MJUH 4P2OD 2XZCH 4NQVA 1UZ8A 3H42L 5KBNC 3ARDD 3U82B 3UPRA 2VYRE 5DVMA 3GHEL 4IS6B 4JGMA 1L9MA 3VFSB 5FK9B 1BX2B 3MBEA 5IMKA 3V5DA 4JRWA 2OJEA 4PJEF 4WI4A 1FIGL 4DVRH 3KPMA 4P57A 5KZCD 3KPSB 1ZLUK 3UTSD 4F9PA 2IH1B 1G7QB 3G5YB 1CBVH 2R1WA 3VXPA 5JR1L 2QQNH 2BVQB 2ESVB 3L3GB 3MRHB 4RBPK 1EXUA 3JTTB 5EZJA 1TJIH 3S7GA 5CBAB 3LKQA 4LAQH 4HD9A 1U93B 4ESKA 4JPVL 4QHLA 4XCYA 4YQXH 1ZLWH 5DEFB 4UTAL 3OB0K 4JO1L 5DJ0B 1FFNB 1T66D 5DRXA 2IANE 3OKDB 3TZVC 4YHPA 3ZDZE 4PJFF 3U7WL 5INDA 1V3MA 5C0EB 1A02N 5CBEA 4HWBL 2YEZA 4UT9H 1T0PB 4J3VA 5FGCE 1W0WA 2WQ8A 3UO1H 4FQ2H 3EHBC 1AHWA 1XCTB 3I2CH 1TZIB 3HE7D 4JFQA 4UV7H 3ZKSD 5J11B 3X11B 1PX4A 2DLGA 1MCKA 3RY6A 5ESQA 4LSPL 3ZDYF 2Y5TB 4NQDD 3CFDA 1KCKA 4D9QE 1QSFA 4I3RL 4CJ1A 2MPAH 5D1QD 3C5SB 3UTPE 2FBJH 1XF5A 4QHMB 4X6DB 4QWWD 5ABDE 1KLGA 1FG9C 2NXZB 1UZ6E 5GGRB 2ZPKL 3VFOA 3WLWC 3FJTA 4KAQH 4E41B 3CGTA 9CGTA 3A6BL 5FKAA 1AE6L 2PF6A 3DGGA 3CCHA 2V9RA 3DX9B 5KN5A 3JWOC 2AK4A 2LABA 3QHZH 5F21B 1R3KA 2EO1A 4IDJL 3D5OF 4H20H 1JGVL 1YN6B 4X7SH 1QLEL 1S5HA 1HI6B 1T4KB 4N8VG 1EFQA 2NY4C 1HSAB 1UWEL 2XNAB 1HYRC 1K85A 3EZJB 1BQUA 4UB0H 5IB2A 1N0LA 2NY5H 1MCJA 3TO4C 1HCVA 3RI5K 3WNLA 5ICZA 5DZLA 3QXAB 1JPSL 3RTQD 5KVFH 1RULH 4NFCA 2EZ0D 2JK5A 2FEDC 3U30B 4HDIA 2MJWA 5HJ3B 4Q6IA 1U8IB 4LLDB 5BJTB 5FYLH 2NY3C 3QDAA 2FR4A 4Y4FC 1GGIH 1FCCA 5TF1L 3PIQA 3GK8H 5IEHA 2XRAH 5D8JH 2Z0BA 1ZGLA 1E27B 1IM9A 1C08B 2XWJA 4UBDD 1GAFL 1D6VH 5ACZA 1MIMH 4WFGD 3KYMA 1MH5B 5DK2A 1RU9L 3RWDA 1DQQA 3ZYIA 5IB4A 3HNSH 4LLMB 3OKEA 2DMKA 5CJOL 4YDVA 3T0AA 7FABH 1N6QH 4P59H 4QOKA 4OI7A 1KIRB 3A6OA 1QVOB 1RAMA 3ZYZA 2P43B 4KI5D 1F45A 2I24N 4KQ3H 1XIWD 4P4KA 1TZHB 1ZWIB 5TFSL 5LBSH 1MCFA 4DWHA 3GHBH 2D7QA 4FHBD 2IWGA 8FABB 2P5WE 1EEZA 4OFPA 3UYPA 2NTFB 3SDAA 1N0XL 3E8UH 2AJXH 1YPZF 1S9VB 4U6TA 1F3DJ 4QRRA 4HKXA 5IK3B 3IDJB 1EPFA 4GO6B 4HF5L 5IBLC 3SDYL 4YJZL 2X2YA 1KPRA 3OG4B 3FO9B 5FHBH 4AEHL 4APQD 2APFA 3CC5B 1DEEA 4RCAA 5MI0B 3ZTNL 3JUYA 4FQIH 2Q3AA 2NZ9C 2QR0A 4L5FH 1RK0A 3BYYA 4ZUWB 4OZFA 3MC0A 4WI8A 1YMMD 1CGSL 3S37L 1WICA 4YAQB 3I50H 3O3DB 3PWPA 3MODL 3HZYB 1MPAH 5GGSA 2Q76A 1YECH 1UEYA 5K9JL 2CKBL 3VWJD 2YPLA 1YY8A 3FTGA 1MCDA 1QRNE 3SGJA 3FQUB 5FKPA 3AREC 2HLFD 2DI8A 1M71A 1AXTL 2H8PB 2P8LA 2B0SH 2DWDA 4KMTL 1DBML 1RQ5A 1MRFH 1NGYB 2ZWLT 1ZT4B 2HAZA 3EOBB 4NZUH 2R2EA 2DI9A 3H3KA 5IFAL 2DKSA 4RISL 4JPWH 5KSBF 3WSQH 1RHHA 3VXSA 3O4LB 1I7UB 3L7EA 1G9ML 4WU5A 1KTRL 3IU3B 4R96A 5D5ME 1JE6A 3FCTA 1IEAA 2NPLX 3RGVC 2IAMA 1H15A 1BJMA 1KJVA 3BKML 2VTFA 3DBXA 1PVHA 3QJHA 4UQ3B 4DTGL 5FHAL 1SBBA 3K2UH 1CFSA 3MGTB 2VL4A 4KI5F 4K71C 1J1PL 2ZJSH 1UH4A 1VA9A 1NEUA 1XGQB 4HBCH 3VMOA 1KJMA 3SKNB 4JANA 4W68A 3GSOA 2V7NB 3RL2B 1CIUA 5C7XH 2PO6C 4CW1A 1UM5L 4G9FB 2Y72A 2YN5A 3SE9H 1EEUA 2VABA 1VADB 2O61A 5K9OA 3C5ZA 1CDYA 5DJXB 3UTQA 1MAKA 3MBXL 5F1IA 3D85A 1ORSA 3KPSD 3B4NA 1ZVYA 2X4RB 4LF3B 1MHEA 3MACL 5EOCJ 3MLYL 3FAXA 1HZHH 2PW2B 4ELKB 2ESVD 2O5XL 3NABL 5IF0B 2BSSB 1RFDL 3RX8A 4GKNB 2VLJE 2EIZB 4HEME 3QEUA 5IROA 1FORH 1F90L 1U8MB 5CEZL 4J3UA 1ZS8A 5HD8C 3VG0H 1A7QL 4K3JH 1EV2E 4KKBC 1T6VN 1C16A 4HKJB 4L8SC 5F7EH 3S96A 1R0AL 4JREC 3MUY1 1R5IB 5HHOA 5TQ2L 4ZFGL 3IYLW 2V5TA 1M6OB 1W72B 1YQVL 3EJYD 4G6AD 3F7YB 3UYOD 3CLEH 4WTZG 3FQNA 4NRXB 3UJJH 3BE1L 4POZC 3UZVB 1DSFH 4EBQH 3MRKB 2C9AA 3LSOA 4PJ7F 1LEGB 1MCSA 4OB5H 4Y2DA 2HT4D 5I9QC 1QKZL 3MV9E 4RGOH 4FABH 5F7UA 2FJFB 2PTTA 2G60L 2Z35B 4OZIF 1U8NB 3MCLL 1HXMA 3F65A 3IDGB 1IEHA 2JJTC 4PGDA 1P1ZA 3LB6C 4GG6F 3MCKB 1NC2B 3NFSL 2EDOA 4MXVF 3OAUH 4MD4B 3S3SA 2AV7A 1BD2E 1U3HA 1NCWL 3MJ9A 1LVEA 3S34L 1CXFA 1N8ZA 2PN5A 4QRPA 3CDGB 1BWMA 2YD7A 1UJ3C 3DUHA 3V0VA 3MLWL 3QZWA 3GKWH 3P30H 4MNQE 4YNYA 1F4AA 4TUOB 1Y18B 4R7NA 1DBKH 4CU8A 4ZPTB 1KNOB 3CFKA 1JMZA 1MFEH 1WF5A 4E41D 2Y36H 4WU7B 5EBMB 2Z93B 3QO0B 2DAVA 3T2NH 1I7ZB 2ICEB 1BBDL 3DO7B 4LOUC 3NTCH 4ODSH 1TQCC 4X83A 1RUAH 2P7TB 4ODWA 4HGKC 1KULA 1IGFH 3NIDE 1A5FL 5HVFB 5I30H 2WV3A 1RURH 4NKIL 4ZTPH 4U31A 1CDHA 1RZ8A 3WIIH 2ADGB 3HI6L 3VXQA 1TLKA 2ARJA 1IGJB 4KUCD 4ACPA 1VKXA 4DOHE 3S5LG 4TUJB 2NQCA 4UT6L 4KVNH 5GS3A 1H0DA 2VDOH 1KLUB 4GW5B 5ELIA 2QQLL 1G7JA 4LSVL 1XF1A 4XT1C 3X3GL 1RVFL 3EFDL 1RUKH 5FOBB 2VQTA 4HPYL 4NM8H 4QRSA 2FX7H 3FZUC 1BZ7A 2ZNWA 4M6NH 1AGBA 4QRTB 3WNKA 4JFPB 4HQQL 3FRUB 4JFEA 1GRWA 4LPYA 3HPLB 4M7JL 1MHPH 2WM0A 4MJ2A 1EFXB 2C3VB 1OM3L 4D0CB 2JCCB 4F9LC 1T2QH 3LS4L 3LDBB 2RJMA 3CK0H 4IMKC 3SQOL 3EYUL 1QO3B 3QEHA 1KEML 3JV6B 2FATH 3H7LA 5CKGA 3RWGB 3X13A 2FH8A 5EH1A 4S11A 5C3LD 2VIRA 3CH1A 5CGMA 4I0PB 3P73A 3RDTD 1ZT7A 4G9DB 3QNXA 1LDPL 3B3IA 3QI9B 3IU4L 2EYRB 5IW6A 5LCVH 5F6IB 1NUGA 4OLXH 3ZTJH 4PJ5B 2X4QA 2DS4A 3UROR 3V6OC 1OSPL 3RY5A 3QFJA 4NO5B 4M7LT 5C0DB 4KH2A 4WW2C 2CGRL 5GRWA 1A3RH 3VFWB 2B1HH 5BZWA 4O2FB 5T1DL 4NSKA 1G9NL 1BIIB 4XNMB 2O93L 1S9YB 3W11D 4QHNB 2VXVH 3K46A 4HJ0C 5TDOB 4XP9L 1I8LA 1YNLH 2A83A 5DD6A 5ILTL 2DN7A 3T3ME 1NCDH 2MHAA 5IG7B 1F02I 3CUPB 4KUCF 5BS0B 1AKJB 4PJDF 1T04B 3Q2CA 4HC1A 4U1IA 2XQYG 2FGWL 1OAZL 2OXHA 5IMOB 3MYJA 4PGCA 4PJFA 2G9HA 2WP3O 3NCEB 5CEZE 5I8OL 4QY8A 2HJKA 5FECB 1XF4B 4Z7VE 4GRMB 1T7WA 3MSPA 4MSWB 5I75B 4XB8A 4S1DD 5I1LB 3V79C 4Z18A 3GSWA 5IEKA 3RVXD 5EZIH 5E5MB 2W60A 4EI5C 4M61B 3LQZA 3E1F1 1J9CT 1FDLH 3O4LD 1MQKL 4O2CB 3GSNA 3WIFA 3GRWH 4AQOA 4KK9C 1AQKH 4MJ5A 2FYYA 5F89B 2RIKA 5D7IF 3EKCA 1TJHL 3QAZB 4L4VD 3X14A 2CMRL 4ZUTB 5HVHB 3PABA 4HUKB 2IALA 3UTTE 3ZE0F 1KTLB 1T5XB 1XH3B 5EU3A 3GSVB 5D93C 4AIZB 3SKMA 2H1PH 3GMMB 5HI5C 5SX5H 2RQ8A 5MERB 3CVIL 4JZOA 5ISZE 4G9FD 1Q72H 2B4CH 3U2SA 1WCQA 1W0YT 4P2RE 4NQUA 4P99A 3DROB 3PGDB 4QCIB 1MVUB 1YEDA 3KJ4C 1FVCB 4AENB 4BUGA 2SEBA 4HUXB 3C60C 3B2VL 4OLWL 4MA3A 3OL2A 4X98A 1E6JL 1K4CA 3DUUB 1SEBB 4M3KB 4Z7WE 1PKOA 3TT1L 3H9HB 4JFOA 4OBSA 4Y1AE 2ZSVB 2LFGA 4KZEH 3HC3L 4P46C 6CGTA 4GKZB 3FONB 2X4TA 4K9EH 1OAYL 3ILPA 4CAGA 5EOCL 1N5AA 1I8MB 2PR4L 4WEBH 1HK6A 5I71B 3GI8L 4XXDA 1OD9A 3VJ6B 2Z8WC 4XRCB 4MA1C 2F74B 3QCVH 3QWOB 3WFDL 2BHUA 2Y1VA 3MTRA 1D9KB 2DJ4A 2YKLL 2A6KB 2GIYA 4HLZG 3D2UB 4Q0XH 5K59F 3AROA 5ALCH 3OG6B 5C70A 4F15C 4DGYH 1T1XA 3MRIA 3RVWD 3OXSB 4DN3H 4ISVA 3BZDA 5LXGL 4UMGA 2VZVA 3LN4A 5A3IC 5BRZE 4OZHB 2R1XA 1CXHA 3FMGH 1W72H 2ED8A 4R97C 1E4XL 4GMSL 5D70H 1S3KL 1YZZA 5D1QA 4LP5A 5CEYA 4JCMA 2Y5EA 4X6CE 3QUMA 5IJVA 1T21A 2QEJA 1XCQB 3KLSA 2PYFA 3G5XB 4Q7DA 3GIVA 1BREA 2EIEA 1YEGL 5FB8A 3N1PC 3KG5A 3MMEA 4CRPA 3QIUC 4I18C 5E4EB 2HRPL 4K7FB 2DQIL 3PGCB 5KVDH 4OCLC 1LNUA 4HG4K 3WNPA 1CFVL 3BVNB 4JM4H 4JN2A 5D2NB 5E95B 1S7TA 3ULUC 1PKQE 1FV1A 1DBJH 3FKUS 4MA7L 4UOW0 3UPCA 1T2JA 4I2XB 4DW2L 4Y4HA 1BFOB 1YEHL 3KYOB 3RWEB 4I1NB 3RAJH 3X12B 4P23C 2V2WA 1I1YA 5HDBF 1MWAL 3MCG1 4NYLB 2CR6A 4R7DB 4TTDD 3QYCA 1NAML 3ARGC 3DX8A 1IM3A 3TF7C 2Q8AL 3BPLB 1JGLH 4ONFL 5KANI 3B9KB 1X44A 4NQEE 3FB8A 4ERSH 3MRPB 2JJSA 1Q9LB 3C2AL 3PHQB 2XTJE 4U0RB 4LSRL 5JLZA 4R2GC 1T0NB 4G6FB 5BO1L 4NOFA 4L9LA 5HVGB 3IDMB 1EFXD 1IMHC 3RIAF 2ZKHL 1AGDA 1KPUA 2CDGB 5ICXA 3ZDXE 1ZANH 2H9GA 4LHUB 5DHVA 1S5IH 2XKUA 4OT1L 3P4OB 5IMMB 3HAEA 2HTLC 2ILLA 1T89C 1LO5A 1F8TL 1QLFB 4HWNA 4V2CB 1ZHKB 5LGJB 3EJZC 2F53D 3MFFB 4I3SL 3T3PE 4GSDL 4OCWH 4G5ZH 1F58H 2IH3B 2XACC 4I0PD 1ZEAL 4F57L 5IW1B 2DKUA 1AH1A 3FQWA 4M62L 2IANB 1LO2L 3NCMA 1IGCL 3V5KB 1DQMH 1HINH 1DQTA 1V7MH 5CWSA 3BAEL 4PRIB 5FGCB 4HWBA 5FA3A 3VXNB 4FZEH 4FXKA 3U1SH 2R0KL 5T1KB 5DUPH 1ERNA 4R0LA 4Z8FH 4O02H 4APQA 3KPOA 1MRCH 3ULSA 4MXWL 1DE4B 4M9PA 2HLAB 1Q9OB 4WEMB 1FGVL 4HHAA 3VWKA 2ENYA 3C8DA 1SM3H 1YMMA 5C2BH 3QXDA 3SOBH 3GJFK 1X6NA 4WNQB 3ZZ1A 2DIJA 3UDWC 1JPGB 1AKJD 5BS0D 5DQDL 4P49A 4PJ9C 4HFUL 4GRLA 3L3KB 5DEGB 3TCLB 2JLLA 1MHCB 2APTA 2BVOB 5ECJE 3SCMA 2W65B 2FB4L 3C8KB 2P1YA 2MCPH 1FO0B 4RMSA 4KMQA 4OGZA 4I4WA 3TJEH 4R4FH 2LVCA 5I1IL 2NY0B 5E2TL 3MGOB 4U1KB 3KLHD 5E6YA 3PDOA 2X09A 2YZ8A 2FRGP 4OZIA 4FNLH 3SEPA 3JV4A 1K4DA 1DUZB 5J9PA 4GG6A 4F7MB 2ITDA 5EU5B 1IKNA 2OJZH 4ZNEE 5AD0A 4GBXB 1H8SA 2YC1B 3WO3B 1TETH 1HN1A 4WUKH 1JPTL 3VFMA 2BFVL 4LSTH 4MXQC 2C3XA 4PLNC 3PL6B 3BZEA 4XP5H 1RZ7H 3O2DA 4OQ1A 3BEVA 2XZQH 4FZ8L 3P9LA 1WAAF 1HHIA 5E8OA 4MD5A 4Y5YB 5D6DA 3HC4H 4KGLA 1XF2B 3LQAH 4WV1A 1PJ9A 3AAZA 4HMDA 3U36B 4LKXA 4YUEH 5DD5L 1AXIB 5EOQH 2WIMA 1KB9K 4PGZA 4UILH 5EU4B 1MCWM 1VACA 4XNQA 3T0EB 3V4VH 2FECI 3QULB 2VLMD 1QPPA 5ICYA 3M8OL 3LEXA 5IP4A 4P4RB 3R1GH 5KOVC 4GJTB 3HB3D 1S9KC 3A6CH 3KLAB 2JKXA 2P5WB 3T2OA 1JHKL 4MZ3A 2A74B 2BMKA 4OCMC 4KWUA 5CP3A 2PKDA 3NACL 4Z7UA 4X4YA 4KRNA 3VH8B 3WL9A 2LAGB 1NCBL 3DETD 1ONQB 1Y6NR 2FO4B 3VRIB 1KT2A 3QXUA 2F5AH 4M43H 1OP9A 1Z9SA 5J3HC 5K9QI 1DQDH 3D2UD 1DEDA 3WCYA 3OKKA 4JB9H 2WINB 4ZOAA 3BH9A 5F9WC 2FNBA 2GAZA 5IVZB 4O58H 2DBLH 1CXEA 3JTSB 5JNYA 3L3DA 1CWVA 3ILQC 3TVMA 2QL1A 2HMIC 1CXKA 3SY0A 4JR9L 5DA4A 1GIGH 2VKXA 4M48H 1QRNB 1INDH 3BGMA 3TYGH 4K7PH 12E8L 3BJ91 3MV8E 1W2KT 1KUMA 3WFEH 2C1OB 3ZTJG 2NY7H 1A7RL 2NY2C 2W38A 4FQXC 1MFAH 4QXUH 3WJLA 3FT3B 3AC0A 3MRMB 3QQNA 2A2QT 1ND0A 1BVLB 4G8EB 5GISH 3MNVB 4TOYH 2AXJA 4X4XB 2I60L 2Q20A 3STLA 2X1OA 1XR9B 4CU7A 5I1DB 4QTIH 3GMQB 1B2WL 2AKRA 1NCAL 5FCSH 5T3XL 1IAOB 4YHLH 3EYQD 5D5MB 5CZXC 5DRNB 1R3IH 4XH2A 5E03A 3T0WA 3KLDA 4O2EB 4PJDA 2X5PA 1I8KA 4DUXA 2X7LA 5JDSB 4AMKH 5MEQB 5D1XA 1EAPA 3WFCH 4IRSC 1JTPA 2DM7A 5EN2A 1BF8A 4WO4C 1A8JH 1F11A 1CD0A 3C6LA 2XTLA 2Z91A 3B9KD 2ADIA 2EDTA 2MKWA 1DBBL 5EC2B 4G8IB 1QR1B 1GPOL 4LLDA 5IVXF 2AXFB 1TPXB 3UP1A 4G6FD 4HX1A 3WE6B 4U0QB 3D9AL 1MRDH 2YK1H 1F3JA 2ICWA 2EDHA 1G84A 3LRHA 3C5JB 5D7IA 1WBXB 2YPKA 5I1GL 5DWUL 4LHUD 4UAOC 3LH2H 5HDLA 2VLJB 2IPTH 4X5XB 3V0WL 3B43A 1HE7A 2D7TL 1GXEA 4OZHF 2O26U 4OZGE 3QDJB 4WUUD 3BKYH 3IRZA 3G5VB 1R3JB 3RDTA 3V0AC 4J4PD 4PP1D 4FQJL 3MOQA 2IAND 4X4ZA 4Z7VA 5I8CB 3D1MC 4G8GE 1S9VA 4XP4L 3DHMA 4PRID 3G5ZB 5DRWA 4X4ME 4M03A 2BNQA 3MV9B 1IKFH 5T1KD 3QFDA 5GGQL 4UIKL 3BZ4A 2ERJC 3NA9L 3CFIC 4MQSB 1H3UA 3F12B 1BD2B 2GY5A 1NAKL 4JRYB 5ALBL 1TVHB 3P4LA 5KANG 3HMXH 5DJCA 2CK2A 5A40E 2HFGL 3V52H 5I8KL 1PQZA 5FA4A 5EZOH 4MNQB 2HWZH 3NFNB 3L6FA 3BIBX 3FB6A 4H26A 4LARL 3E6HB 1Z9LA 4OUUA 1P7KB 1A4KA 2XN9E 1ITCA 5ERWB 5ISZA 3FQUA 2DWEB 1L7IL 1OTTC 1VGKA 4OKVA 1I9IH 4K94L 5D72L 3B8SA 1KB5L 1IL1A 5IV2B 3T4YA 2VERN 4Q6YA 5T1MA 1BVZA 3IF1B 5FM5O 4O4YH 2A6DB 3T65B 1ZT4A 4F7TB 4IMLA 4Z7WA 2NY1C 2A73B 5T5NF 1NSNL 2HJFA 3X17A 5D1ZB 3GIZH 5L2JA 5F1OB 4MJ4A 5F9DC 1XZ0A 4KPHH 5AYUH 3O9WA 5E8PB 2VLRA 5HVWA 2C4FT 1FO0H 4KRPC 4L4VA 2IPKA 4MAYB 4OJFH 2HJLB 2GFBB 1RUQH 5HDOA 3VRLE 4JQVA 3BDXA 4OD2B 2CKBB 5F9OL 2FWOB 4JGJA 4XPFL 5B21A 3L3IB 1KENH 4FTVE 1MFBH 5IW3A 2IADA 1RJLA 1JNLL 3SDCC 3MLVH 3FT2B 3LQMA 15C8H 1TJGL 4KKAD 2XG4A 4PBWD 2CO6B 4G6KL 4HUVA 1CFQB 2P44B 3ZKQD 5TQ0L 1VADA 5FOJA 1CYGA 2DQHH 2P46B 5BOZG 3FFDA 1CE1L 4DGVH 3T0ED 2QQQA 3KPQA 3KYNB 5E9DE 3LKPB 5ID0A 2UY6A 2WLYA 1HHGA 1SYVA 4X6CA 5T3XE 3K74B 4O51B 5D7SH 2CDFA 3TPUA 4HIJB 1A6WL 4U6XB 1JGUH 3QA3B 4FA8A 1U8OA 3DX7A 3ARFC 4KJYB 2P5WD 1UGNA 5CGYD 2I07A 3C09B 1X6LA 5FF6B 3RUGB 5A2FA 4OLYL 3O6MH 3MJ8A 4NCC1 1UZ6F 2VXUH 4RDQF 3RZCB 4RAVA 5JOFA 3KS0J 4U6VH 1Q9KA 3NN8A 2PXYB 4OZFG 4LCCC 1KXVC 4YLQT 1A47A 3QCTH 4HAFA 2FZ3A 4PGBB 1Y0LB 2H2SC 3OR7B 3PXHA 3VI3F 1I4FA 3MUZ1 3WNNA 2ZOKB 2DB8A 3PP3H 4ZFOB 2G2RA 4WFFE 3MO1B 2Q86B 3MCKA 1KIUA 4ZUVB 4POUB 4XCCH 1QNZL 3GHEH 5I1AA 5KSAC 4L8CB 5CUSL 5IVOA 4KHTL 1PSKL 2OLDA 3HUJE 4B7LA 3G08A 1I3RA 2V5MA 1CDIA 1QRND 3NCYS 3PQYE 4NQEA 2EC9U 5C8JB 4Y16A 1FIGH 3F6IA 5SWQA 4YDIL 3LKNB 5EUKB 4NNYA 3RWIA 4DCQA 4CU6A 1MFDL 1YMHA 2J5LB 5IM7B 1DQJB 1GGCH 5LWYL 1CZ8H 2MQCA 4U1GC 5JR1H 1CL7L 2HVJB 4DFIA 1F6AB 3TBVA 4OGAD 1J8HE 1UWXK 4DN4H 1A6TB 3EAKA 1ULVA 1J1OL 4LRIC 4LU5L 4NUJA 4OIIL 1BOGB 4CUCA 5J6HB 4JPVH 1WZMA 2EXWC 4HG4J 4UTAH 3NCFB 4JO1H 3REVA 1CD8A 2X4OB 4KZDL 1O5DT 3P4NB 4ZDHA 4V2BA 3LHPL 4WDIA 4XBGA 1B90A 2A1WL 4WWKB 4Y7MA 3M17A 3BUYB 1AXSA 5E08H 3UTTB 4XTRC 1X7QB 1GOGA 3BT2L 2MKLC 1SJEA 4PY8I 2DQJH 5GRVL 4KRLB 4GT7A 5K9QG 3PGFL 4RRPG 3QUYB 3G6DL 3TBWA 2FD6L 4GLRH 3L3HB 1D5ZA 4IRJC 4P2RB 4GW4B 4XAWL 4LSPH 2XY2A 3ZKNC 3U4EB 3PWLA 4JFPA 2D4DA 3JWOL 4NDMA 4PREA 2XYCA 4DUVA 3WBDA 5IESL 3P4MB 4HKBB 5CINL 1QA9B 1CLOH 1JK8B 4N1EA 2FJGB 4UQ2B 1K8IB 4DZBA 3RZWA 5HYQA 3P3YA 4PRDB 3KGRA 4XVJL 3O4OC 4Y1AB 3S3JA 1U8KB 3GSRB 4BZ2L 1IFHL 1IT9L 4JFZL 3FOLB 4KDTA 1GVIA 5H35A 3O6FD 4R4NC 1EEYB 4HV8B 2F53A 4PJGA 3EJJX 5EO9A 3BN9D 1SEQL 1DL7L 4EN3A 3QDJD 2VXTL 2NYYC 1WAAA 4WI6A 4R26L 2NY6B 4JFDE 4KJQC 4TSAL 5IOPB 2R0LL 3LN9A 5EIIA 1ZA6A 2CRIA 4KKLC 3MXWH 4IDJH 2OP4L 4CDHA 5JZ7C 2QSCL 3GZKA 1JGVH 4MVBC 4Y5XB 3FQRB 3BQUC 2W0PA 1WIUA 1NMCB 1I75A 5GS1B 2G75A 4P2OC 2HG5B 4RGNE 4XZUA 4YR6A 1UWEH 2AI0L 4F7EA 3ARDC 2NXYC 4NN7B 4QTHB 3ARQA 5JHDE 5BRZB 3K0WA 3QH3B 5AG9A 5IHLB 4ZQKA 1NEZA 2D7PA 5J13B 3EO1B 4PJHF 1JPSH 1BD2D 3RL1B 4MQXC 4JRYD 1SYSB 1P53A 5HGDA 4XNXL 3ZYJA 2B7DT 1S7WA 4ZUSA 4HUNB 4HZLB 4MNQD 4C83B 2E5EA 5TF1H 1RZKL 1H8NA 1A3LL 1G1CA 3AS3A 1HIML 4OI9A 1R5VB 5ETUB 4LVEA 3QIBA 1GAFH 5I15H 4QXGL 4KKCC 4HWZA 1J0JA 4BH8B 1TVDA 5DRZB 4G42B 1QHPA 5CJOH 3QNYA 3GSUB 4N8CL 1OCWL 1FCGA 2ZCHL 4PJ8C 4WHCA 1PKQB 4GLRI 4MX7A 1T66C 2WMPA 3CFBA 1I1AB 2C4XA 1KELL 5GRXG 1QSZA 5I2IB 1SVCP 4HBQA 3D48R 4LLQA 5E5MA 5TFSH 2YWYA 3E6FB 1GZPA 1KTKE 3V5HB 3ECBA 2R2BB 4U1LB 1ZTXL 4O2CA 3OBAA 1KN2L 1N0XH 1N3NA 2G5BA 5SWZE 2DQUL 2PW1B 3QXTA 4JHZA 4OZ4A 4PV9B 1J0KA 2Q8BL 4MAYD 5JPMB 3HE7C 4L4TB 4HF5H 2BVTA 4NPYA 5DVNA 3SDYH 1NAMA 2CO7B 3OKLA 4L3CA 3IETB 4PB0L 4AIZA 3PHOA 5A2LH 3CIQA 2HYMA 3ZTNH 2XTJB 4QRUB 4OM1L 1AIFA 2XFXA 3SKJL 3VA6A 1UVQA 4EIGB 1GHFH 2LU3A 4D0DA 2BC4A 5L0QB 3TPKA 4KQ4L 2VDRL 2OSLB 1KACB 3DROA 1A6AB 1JF1A 4QWWC 3VMNA 3DYPA 3MODH 1S8DB 3RWFB 1JFQH 2CKBH 1NH6A 1FP5A 1KB9J 1Z3GL 3BGFB 5J4MA 4G80A 4OD3L 4JY4B 1EAJA 1D5XB 4ODXA 1S78C 1AXTH 1FFRA 4H5SA 1E4WH 2NY5C 4UINL 2Z92B 2A6JB 3MV8A 3FN0L 1G7PB 1M05A 1DBMH 4NWTL 4XCFL 5CMAB 5EDXA 3BYTA 5GRYA 1HKLH 3GMLB 4XRCA 2Y9RT 1T1ZA 1FRGH 5IFAH 4EEEA 1OGAE 4RISH 3RBGA 4YDKL 3EOAB 4XAKD 4Y4FD 2XXMB 4Q9CA 1JNNL 5IVXA 3SE4C 1T20A 3RZCD 2Z31A 2VDKH 1G9MH 4IHOA 2FL5A 2O5YL 3U9UA 3N85L 2YXFA 1U9KA 4NN6C 2PXYD 3VD9A 2NLJB 5I17B 3RTQC 3VD4A 3HZMA 1YYLL 3BKMH 2V7HA 2EZ0C 5FHAH 2ARJQ 2UWEB 3PXJA 2VL5B 3VXRE 3BEWA 1J1PH 3LS5L 4S1QL 3SJVE 5JORB 5DXWA 5TDPA 5CSZA 3V6FA 3V6ZB 4DVBA 1U8LB 3EDEA 4UBDC 3VDCA 3GSXB 4PB9L 1OGTA 4P5KB 3MRLB 4JFFE 1ZV5A 4QEGA 3MBXH 3VG9B 1CD9B 5IBLD 3FQTA 1P4LB 1KOAA 3D69B 4FFZH 1H3WM 4JKWA 3MLYH 4LHUG 4KI5C 2YUXA 4RFEB 2GJZA 1XIWC 4IJ3B 1I1RA 4JFYB 1QFWL 2O5XH 3NABH 4DFHA 3L5HA 2NZ9D 3VFTA 1ZVSB 5L88L 3SKOB 1XGPB 2DLEA 4X6BA 3VXME 1TNMA 5CEZH 1HXYA 3BDYH 2F8VA 5F96H 4H8WL 4WWKD 5TQ2H 3L5XL 4ZFGH 5TH2B 1Z9OA 1S7SB 5IB3B 1YQVH 4JY6A 1HKFA 3RWEA 3LPWA 3ARED 3HCVA 3O41A 3MV11 4NYLA 3F7VA 4G8GA 1A1MB 1IAKA 1KC5L 3QUYD 1QKZH 2H32B 4RMRA 3MLPA 5HYSA 1P7QB 1XGRB 5LJYH 4WI9A 4NRYA 1J18A 3MCLH 2C3WA 3RUGF 2J4WH 3PP4H 4QYOB 3NFSH 5JHLL 3GM8A 4MDIA 1BZ9A 1FG2B 1RJCA 4HH9B 3DLQR 2M1KA 3VWJC 3WFHA 3O6KH 5B3JE 2DLIA 1NCWH 3KYAA 4TQEL 2FSEB 1FZMA 3EOTH 3S34H 1C8PA 1HYSD 4WRLA 1MIEL 4L4JA 4QNPF 3BH8A 2CDGA 2YA0A 3HFML 2W9EL 4Y1AD 5JXED 3WLBB 4XNUH 4AL8H 2EH8H 2ICCA 4AH2B 5C0CB 2EDBA 3BUTA 3T3MF 2CIKA 4ZFZA 4YO0B 1UXWA 5LGJA 3OR6B 4WUUA 3B6SA 1MWAB 4DZ8B 2NY6D 1ZHNA 1BBDH 5C0GA 5JUEL 5JIPA 2XKNB 2A9NL 3BPCA 1MCOL 3AU1A 3LPFA 1A5FH 4JKKA 4NKIH 1YNTA 3LKRB 5JDJA 4ELMA 2J6EA 3HI6H 4PRIA 5GSRB 1U8QA 4JO4H 5E6ZA 4M1CD 3QO1A 3VFVA 4UT6H 1J0IA 1UWGL 1KCUL 1U0QA 3I75A 2QQLH 4QHKJ 2H3NB 4L29A 5BRZD 2OR7A 1RVFH 1YEFL 3EFDH 1OF2A 1J5OL 4QXTB 2JIXB 4HPYH 2A6IB 3QG6A 4OCNC 1GGBL 1OT2A 5KAQG 5B8CA 4KMLB 1PEWA 4JFXB 4UTBL 2BNRE 5DJ2B 1S9XA 4QGYA 1EX0A 3GGWB 4GMTL 2IBBA 3TNNA 2YN3A 4OCSL 3CSPA 4XBEH 4MAUL 3QQ3B 1OM3H 1HH9B 4POZD 3L3KA 5DDHB 3LS4H 3U46A 3IDIA 4W81A 3SQOH 3EYUH 1HOCA 4LDEB 4S0SD 1QQDA 1KEMH 3SO5A 1JTTA 1UM4L 4LGRB 4X7FC 1KJ3L 4Z0BL 4P0DA 3LB6D 5D2LE 1TTFA 4OCXL 1HEZB 4TRPH 1I1AD 2DD8L 4XHJC 1PW3A 4G6AC 4F7MA 4MQ7A 3QUXB 5HHME 3D0LB 1LDPH 1RZJL 3TJHD 5D7LB 2I5YL 3IU4H 2QBWA 3QUZA 4DAGH 3VH8G 1OSPH 5DQJA 2HT4C 2XPGB 2HP4A 5E8DL 5C0BB 3I6KB 4L4TD 5J11C 2CGRH 1BJ1H 1YC7A 1D5MB 1YDPB 3WIHH 3VU2A 4OF8A 1G9NH 1CI5A 4F33A 1F3DH 1MHHA 4HKZB 3QDGE 4PJIF 3IGAA 2XTJD 4LOUD 3HR5A 4XP9H 4M7KL 5MHSD 1GYAA 1GL4B 5ILTH 4QT5B 5D7JA 1BGXL 3L1OH 1N2RA 1YC8A 5KTEL 2K7QA 3DURB 2IQ9L 4PLKC 5C0IA 4LNRA 4PJXE 2NXZC 4CNIA 4XCEB 2FGWH 3D18B 4OCYL 1OAZH 3QXVA 3T0DA 1JI1A 1IGML 3HRPA 3NIFF 4ZXBB 3RPIA 1OLZA 3BI9X 1JGDA 4OZGB 3TO2A 2XWTB 4JEGB 5I8OH 4TSBH 2DTMH 3KNBA 1G6RB 3FZUD 3R06A 4HS8H 2BHZA 5C07E 3I02A 3HHRB 3D87B 3C6SA 1U95A 2HN7B 2RAMA 2E9BA 2DQDH 1N6UA 4E5XA 3ARVA 4PFEA 4M1DL 4BSVA 3JXAA 5ESVB 4Z77B 5KVGL 2BY1A 1MQKH 1PG7L 3KYKH 1D6EA 3VRIA 5B38A 3I3DA 4ZNCD 5D71L 4NHUA 2OL3A 1X4YA 1TJHH 3KAAA 5ITFA 3EYVB 2CMRH 3SE8H 4GAJH 4JN1L 4U2YA 1LEIB 5E6IA 1AGEA 4LLUA 4PYGA 3U30C 1A4JA 3F58L 2HH0L 2Y7QA 2PYEE 4PPTA 4Q74A 1XGTB 1XGUB 5ACMA 3HC0B 4P9HL 1F5WA 3IFNH 1NJ9A 4Y88A 5T5FL 1H5BA 3W0WE 2R23A 2XN9B 3ARBB 5DJDA 1VPOH 1FNGB 3RNQA 2J7LA 3DRTB 1KCRL 5E2WL 1U6AL 2JJVA 3PNWB 1FH5L 3MRDB 3B2VH 4LKCA 4OLWH 4YK4B 1KB5A 3WJJA 3DXAE 1E6JH 3DVGB 4J23A 5F8RC 1FZJA 1J88A 4OLVH 5E8NA 3TIEA 4S1RL 3GM0A 4U6HA 1MCBA 2X70A 4HJ0D 4AEIL 2IJ0C 3MJ6A 3DI2B 5HHQA 1OAYH 5HGHB 4PJHA 4KHXL 4GW1B 3FT4A 2X44D 3HG1D 4ZS7L 3WFDH 1EGJA 4LP4A 1A7BA 4YXLH 2YKLH 2BOCA 3ELAT 4P2YA 3T3PF 3NBNA 2APXA 1JV5B 1IQDA 4UV4L 4N9GB 3ETBF 3UZEA 5MI0C 3W11C 5JQ6L 4NQSA 3T1FB 4MNGA 4FTVB 3L9RA 1T1WA 4LPWA 4LPVA 5CZVH 4FQCL 5EUOA 1P7QD 1NC4D 3P0VL 5DI8B 5LXGH 5SWSA 1P4IH 4MHHG 1INQA 3BW9A 1LP9E 3BWAA 4OGXH 4EI5D 3HS0B 4EIZC 2N1KA 4QF1B 5FUZL 1Q9WB 4GMSH 3MA7B 4KK9D 4YPGB 5A2IH 3H0TA 1ETZA 5EOTB 5E9DB 5K33A 2H32H 4IBLT 3JVGA 5E99L 2UWEF 2VNCA 4BKLB 1RUMH 2IPUG 1U91A 1YEGH 2ENSA 1U3YA 3O6FA 1WFOA 4LNVA 2CLRB 5C0CD 5IQ7H 4XP6L 1JWUA 1HHJA 2HRPH 3GB7A 3P40A 2DQIH 4PJCA 4ZSOA 2X1WL 4J6RL 4U1MA 3IFLL 5CSBA 5C92A 4RWHA 1FC1A 2B4CC 3HI1B 2DJUA 1FNSL 2VH5L 4PRBA 5F3HA 3B5TA 3Q6GL 2AJSH 4GXVL 1T5WB 4PGEB 4DW2H 1MCLA 4EZMA 4M6AA 3C60D 4OTXL 4P2QE 1YEHH 1JP5A 1LWRA 1JZ5A 1RZFL 4HS6A 2VWEE 4XPAL 1PYWA 1MWAH 5FYJE 1B6DA 4RQQB 4PYHA 3H9SE 1IJ9A 5HGBA 4P46D 3ROOB 3VFNA 5DJYA 3OJDB 1BEYH 5BZDB 1MCWW 3A67L 2F58L 2JIXD 5JW3L 3B2UD 5JTWA 3PF2A 3MRQA 4K9EC 3HUJB 4R8WH 4GG8B 5ENWA 3TNMA 4JM2B 2OR8A 4K8RL 2D7NA 2I9LA 5T3ZD 4XMKL 3O2WH 3PQYB 4X6EB 1OB1A 2GSGB 2W92A 3TZVA 1NCCL 1HDMA 1NFDE 4ODBD 2R56H 4RZCB 1NBVL 1UYWH 3LKSA 4ORGA 4AEFA 1NDMB 3SDDB 3QPQD 2ZKHH 3DV4B 5EPMA 5FYKL 3BIKA 1J8HB 4P2CG 1UCBL 4F7CA 5GJTL 1A6UL 4NQXA 4OT1H 5B22A 1ZSDA 4GKSB 4GSDH 5BQ7B 3LKOA 3MV7E 1C5CH 2VLKE 4F57H 3VXUA 2E7HA 3SE3C 3MJ7A 4BJLA 1LO2H 4HXAL 5D7LD 1G0YR 3EIFA 1E4KC 4EXKA 1IGCH 4YHOL 1BQHA 3D25A 4JHAL 4NZTH 5DYOB 3BAEH 1E4XI 2ITCA 3FOMB 3RVWC 4QHUB 4WWID 4P3DB 5HY9B 4NFDA 2EDYA 5C0BD 2R0KH 1N4XH 1G7LB 4HK0A 1OW0C 1H3TA 2ATPB 3T8XB 3O0RH 1JWSA 3RPKA 2EYSA 4MXWH 5EBLB 3RBSA 3IS0X 3PDGA 1R3LA 2ORBL 5JIKA 5FO8B 3OKOB 4NP4H 5FYKU 5C0FA 3TM6A 4E42A 2EDXA 3KXFE 2KL6A 3HTLX 3O3BB 1OAXL 1FGVH 1TQBB 2KZWA 4X99B 5FUCC 3VXRA 4OAWB 5IQ9B 1C5DA 5GGRY 3WS3A 1RIUL 2D2OA 2EDFA 5EWIL 4PRHE 1MFCL 1BOYA 2BOBB 4HAGA 2VR4A 5EBWA 2YMXL 4LSSL 1ZK9A 4P23D 4HFUH 4V1DE 4PTTB 4ZXBD 2CUHA 4RMUA 5ID1A 5DD3H 1J8KA 3G9AB 2FB4H 4PJAB 3TO4A 1N59B 2VSCA 1ZT1B 5E2TH 4Q9BA 4O5LL 1C12A 5IHUH 4JFHE 5SX4I 4PRNA 3DIFB 5F3BA 1T1YA 5HHVH 4A6YA 3U7YL 1S7QB 1GC1L 4JPIB 4Y4FA 5KG9B 1Y6KR 4Q2ZB 4FFYL 2C1PA 3RWCB 1RZGA 4RGNB 2IQAB 4H25B 1JPTH 4HGMA 4TTDC 5HYJD 5E00B 1IAIL 2AABH 1WWCA 1G6RH 3W9EA 2M26A 4HWEL 1B0GA 4FG6D 3TBTB 4FZ8H 5KS9E 5DMJB 1DANT 2GTZA 4F8TA 4ZFOA 1EA9C 2HT2D 2YR3A 1IZKA 3IJHB 1SVZA 1LE5B 1EO5A 5GHWH 5IB5A 4NCC2 4XBPB 2P8MA 4XB7A 3WHXA 5JXAL 2XIDA 2AQ2A 1UQSB 2EDLA 2XN9D 3ARBD 3Q1SL 3LDBC 5DJZB 4N9OB 4YFLF 1RD6A 4NKMA 4UIMB 1CG9A 3LRSA 1OARL 2A0LC 3EGSB 4PP2B 1U8HA 4BFEA 3C9NB 1JZ6A 4I0PC 3M8OH 4LEOB 1RIVL 5J0BA 4PRPE 4B0MM 1LO3L 2AJZA 3QI9C 5JW4R 1DN2A 1BOGA 3OZ9L 5F6IC 1BBJA 4ZG1A 2JF1A 1JHKH 2XQBL 5DK0B 1ZLUH 3VXTA 1QFWM 2R69L 1C1EH 4BQ6A 4XVTL 3NACH 2YUWA 4NBYB 1LO4L 4RBPH 1NCBH 3QG7L 4PS4L 5INCA 2FJHB 3TN0B 3KPLA 5BMFL 2FIKB 4TNWK 4NO2B 3AREA 1RK1A 3T4AB 4GXUN 3B9VA 4FXGA 4EVNA 1A2YA 1CD1A 2F54B 1SJHB 3EDJA 5I1EL 1FJ1A 3OB0H 5J8OA 4FTVD 3EFFA 5DEZA 1DR9A 1R5WB 1JN6A 1TVBB 2EEAA 4PLJD 4Y19E 4JY5L 4YHKL 1WLHA 4EUPA 2DQCL 3L5WB 3MRRB 5E7BA 2FH6A 2YRPA 1JGEB 3PWVA 4OLUL 3OQ3B 3P4MA 2ATKA 4HKBA 4JR9H 4ZAKB 5F70A 1E6OL 2DLFL 2C3HA 5FUOL 2C7UB 3BP6B 5I19L 3RGVA 1FFPA 2F5BL 12E8H 3NZ8A 4CADA 2AVGA 2CPCA 4ODHH 3KLHC 1W0VA 4HIIA 5I75C 1WFTA 1A7RH 4MQTB 2BNRA 3Q3GB 2VE6B 4LLYB 2BSTA 4GAFB 1K8DB 2J2ZA 4HSQA 3KHOA 4NO3A 3K4ZA 2V9QA 2AXGA 1OGAB 3GMOA 2PO6A 3NVQA 3LQAC 4PJIA 2I60H 1K5NB 2DQTL 4KVCL 3OXRB 1NGZB 5F7DB 5EG6C 3LV3A 3OGCB 1B2WH 3QAZC 2GITA 1NCAH 2IGFL 5T3XH 3RIFK 5HVHC 5DGQA 5CIPB 5GIRA 4JO3H 3OAYK 5I16B 2NNAB 3SJVB 4IIQB 4HS3B 4N0FB 4WFFD 4ZD3L 5I76B 3WEXA 4W4NA 1RJZA 3EO9L 1F4YH 25C8H 3V2AR 5F1NB 4HUMB 1UXSA 1QLRB 1EBPA 4OF5A 1FSKB 5EC1A 4JM2D 3HPJB 1LK2B 3P9WB 5KVEL 1GPOH 5HPMB 3PQYD 4JFFB 1YJDL 4I77H 3D9AH 1ZAGA 2IG2L 1QSFE 1BLNA 4S1SH 3SDDD 4A2MA 1P6AB 4FQHB 3QQ9D 3HB3C 1MCNA 4WHTA 4NUGL 3MRBA 5EIQA 5I1GH 1H3PL 5BVJB 1YYMH 2CXKA 1J8HD 1KTDB 1KXQE 4FS0A 3MOAL 2ADFL 4G42A 5I71C 1G7HB 4Z78A 4KGJA 2D7TH 2JJTA 1DUYB 5KSUA 2GT9B 5DUML 3U0TA 3ABZA 2QSQA 3LZFL 1OT1A 3WMSA 1AO7D 3H7BA 4KU1A 4YHZL 3CFEB 1D9KC 3DETC 3VD5A 5IBTH 4NRZA 4FQJH 3P0YL 4X7CC 2DYPB 1L7TL 3DVNB 3E6FA 3OF6A 3SDXF 1OTUC 1UJ3A 4G3YL 3O45B 2EECA 2WBKA 3WUWA 4XP4H 2AK4E 4PV9A 1J87A 4L4TA 1YEJL 3VFPA 2WWKO 4GUPB 3K8MA 4UIKH 2HVKB 2VZ1A 3RIAK 5FDWA 5GGUA 1CXIA 4ETQB 4X0KA 2EDDA 2EYTA 2Y6SC 3MLTB 1SY6A 1VFOA 3S3PA 1NAKH