3N9YC

Crystal structure of human cyp11a1 in complex with cholesterol
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
68
structure length
68
Chain Sequence
b'SLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDLAYGLTDRSRLGCQIC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cholesterol side-chain cleavage enzyme
publication title Structural basis for pregnenolone biosynthesis by the mitochondrial monooxygenase system.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase, electron transport
total genus 12
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.780 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3n9yC00
3N9YC
chains in the Genus database with same CATH superfamily
2IO3B 3AE1B 3VFKA 2WXGA 3Q3NC 2BKFA 2DBYA 4CQNA 4GDKA 2KQSA 3DVGX 2QEJC 5H92C 2R61A 3UF8A 3HVZA 4E3CA 4HDQA 1NVID 1AN8A 2WU2B 2WXLA 2FCSA 2CJOA 1WGDA 3T9LA 4FXCA 2NBWB 3URYA 2K6DB 1ZKHA 1WMHA 2QHOA 1DYQA 3UI3A 1TS4A 5FK9C 3NS8A 2DZKA 3DPDA 4YTPB 1VD2A 2KN4A 2FIDA 1PDXA 2PIAA 5L95C 2DZIA 5T8IA 5FR3A 3QX1A 2C7NB 1F77A 4FJYA 1E5WA 2L0FA 1D5XC 2N1VA 4RH6A 4GXBA 2KT7A 3AE2B 2MW5A 3GZNI 2M0AA 4ZRQA 1WZ3A 3R66C 3RYTA 3PTFC 1LFDA 4A6QA 1V2YA 2WDVB 4EZJA 3PO0A 2I2YA 1U4AA 3V6CB 3NZSA 4HKQA 2K5PA 3BINA 3DHHC 4FN2A 1J7CA 3ENEA 4RGNA 2DHZA 5E6NA 2X8XX 2K8HA 2KWUB 4BOSC 5JHBA 2KFKB 1BMLC 2Z59B 1T0RC 4AP4C 2J0MA 4WJOA 2E6XA 1FFVA 1L7YA 4MSQB 4XE0A 1IBXB 4IDIA 2M8SA 1FCCC 1E7VA 3WALA 2J0KA 3R2IA 4OVUA 2KWCA 3ZVVA 2KLGA 3M95A 3L13A 2MBOA 2GI9A 5TR5A 2XK5B 1TS5A 3RT3B 2JZ3B 4R3DA 3P63A 2AEHA 1WSPA 1MFWA 2MP2B 3RPFC 4RMAA 3PZ7A 1FXTB 1LQBA 1Q0WB 2RDBC 3ZUNA 4HCNB 3U2SC 3JSVB 3H7SA 4TUUA 1CZPA 3IBEA 3PSEB 1C4CA 2WX1A 1RFKA 3NZUA 1WZ0A 2VZKD 3WAMA 1NYQA 2N7DA 3EHVA 4A3PA 4NJ7A 4W9IA 2WXRA 4FJVB 4NAMA 3DQVA 5BMIA 1WJ6A 1MPEA 2MH7A 1I35A 3CSFA 4HPPA 1V97A 2KMAA 5GXGB 4NQKE 2HTHA 3VRAB 3VTWA 4AS1A 4A9AA 2W82A 5AUIA 2HJ8A 2KJHB 1WGHA 2R2OA 1SIJA 2ZPYA 4ZRPA 3NVZA 3ZYYX 1QOAA 4X57B 1D5MC 5D3IB 2M56B 3R8BA 2BYTA 3DHIC 5BMGA 3KYDD 2QSDA 3DBLI 2BBCA 4KVGB 3MP9A 3KYCD 5CHVC 1YMHE 3AEAB 4I6LB 1RFAA 2LZ6A 2FCMA 3W1YA 4ZRIA 2M1MA 2L00B 4MELA 4OZCA 5IKCM 3CSTA 3LDZE 2KO3A 2KHWB 3I57A 2WQYB 3Q3MC 3PRZA 2V4IB 2O6VD 1C78A 2I1KA 3ABVB 1QZEA 1G6JA 3W9CB 3V05A 4C80A 2ZCBA 2LHDA 1GPXA 5DPSA 2PW9A 4XX5A 1CK1A 1Z5SB 3P4SB 4JWUC 3KUDB 3A4SC 4PS7A 3UGBB 1I4GA 3FKYA 4EEWA 4XDCA 3NVYA 3TIXA 1V81A 2RDHA 1F1HA 4M8MA 2WYQA 2WU5B 1KLGD 3ZGZA 1J0GA 2UU7A 2KVRA 2G45B 1KRHA 4WWMA 3ZQ4A 2LXAA 2XEWA 1PGXA 4NNJB 4A20A 2GBMA 2WS3B 5CHWA 3H8HA 4PT5A 1P1AA 3WA0A 1UELA 3AMZA 1WR6E 1GG3A 1L2NA 2DNFA 3V62A 3NZ3A 4C00A 3N9YC 3RULA 4W9FA 2ASQA 1FCLA 2K3UA 3OAWA 3SR6A 4HKZE 2FCQA 1SIFA 2INDC 2LMCA 2I1JA 4WWNA 1ENFA 1UD7A 4DHJB 5BMHA 1IGCA 3SU8X 3WAOA 2MBBB 3AEEB 1UWXA 4KZ0A 4AUQC 2D3AA 5G2NA 4RM9A 2JVCA 1WY8A 4G0NB 1PYWD 1V49A 2LVPA 1TIFA 3A4RA 3MTNB 2FE8A 2GOWA 3NS1A 1ET6A 1MHHE 1BT0A 2B76B 4FA6A 1XCTL 1E8YA 5MPOA 1E10A 1TY0A 2LWPA 2WXNA 4JL9A 1FD6A 4AQ7A 1T0QC 4BBNF 1QKZA 2WXMA 3VUXA 1YJJA 3I3TB 5BO4B 1XLOA 1J7BA 4HJGE 1XLPA 1L4ZB 1XEEA 2PEAA 3AE6B 1I4RA 3ETRA 3I63C 4KDIC 3U7ZA 3A9JB 2INPE 2M19A 2QDFA 3ZXRA 3ZNZB 2CJNA 4DHZE 1JCKB 2NTTA 4FBJB 2BVCA 2EKIA 3KVFB 4USAA 3VR8B 4A3OA 3ML9A 3DBSA 3QJZA 4MJSB 2BTEA 2VRRB 4IWOA 3EUB2 1JWSD 3IT6B 5JXVA 1UGMA 2XNAC 2YEPF 1EU4A 2MA9B 1HA5A 4W9GA 3DBHI 3A1QB 1H4RA 1SE4A 1OEYA 4HXDA 4MACA 4OW0A 3SHQA 1KM7A 2BS4B 2G4DB 3QK0A 4OHJA 4ARIA 1JWUD 4W9JA 4GSWA 3AH7A 1E8XA 1N63A 4II2B 2REXA 2PMVA 4WAAA 4JX1C 2NCNA 2Y3AA 2KX0A 2N9PC 3TBLD 4KGSA 4OVVA 4WJPA 2L8JA 1A5RA 3TL5A 4DQOC 2UWQA 2YLMA 5J17A 2IDYA 4IW0A 1HTOA 3CF6E 3H6NA 2L05A 2G1EA 3V6EB 4DHZB 4K7SA 1LO5D 4FHKA 1A70A 4K7UA 2KD0A 2KTRA 4MH0E 4TQ1A 1P9DU 4ANUA 3NG0A 1HXYD 1PGBA 2WLBA 4C4VB 4ANVA 2JWUA 3APFA 2WX0A 1OTRB 1NBFC 2G4SA 5D3DA 4GDLA 4M01A 2FIFA 1MI0A 1KFYB 4MSMB 1YJ1A 3AE3B 1J7AA 2N0SB 4MGYE 5FKAC 2KWDA 2WNMA 3ZJUA 3ZNGC 3U4EG 1UF0A 1WIAA 2CU3A 2JSVX 4IM3A 2DX5B 4RNAA 2KWVB 1YX5B 3UQBA 4ICVA 3ZJVA 4F8CB 1WFYA 2VZKB 4ZRKA 2M4NA 4YSYB 4IUMB 2IO2B 4MM3B 4LNNA 3RUIB 2DYMA 2JX5A 3C0RB 3JVZX 2OOBB 3ONSA 4K1RB 2QCZA 4NAWB 1NYRA 4W9HA 1XO3A 3L16A 3NOBA 3R7RA 5IA7A 2ONQA 2LJ5A 4XYCA 1WXMA 2DYOA 1SSNA 2IPKD 2HDEA 1ZP0B 2Z0DB 3M3JA 1ESFA 1ISNA 2K22A 4BVUC 1I4HA 4NJCA 2AQ3B 5AEKB 3AU5A 2GMIC 3VUWA 1GNUA 4C7ZA 4YL8A 1J8CA 2EMTA 4E71A 2BYVE 1GB1A 1RLFA 3NRZA 2N9KA 1V86A 3BVZA 2LGIA 5HHDG 3V61A 4YSZB 2RDGA 2BT6A 3AXCA 2RPVA 4LDTB 2N1WA 2WXFA 1E7PB 2O6VB 1I4XA 2ON8A 5E6PA 2J42A 3MJWA 2RGFA 1I7HA 1PGAA 4MH8A 4AJWA 5H8YE 3W5VB 4KSKC 3IAM1 3A9KB 3RZFA 1QOBA 4LLGM 4KKJA 4JLCA 1GC7A 2JYEA 4RCOA 3UQAA 4TV3A 3EFUA 1SE3A 2DYBA 4TKNA 1TYGB 2K8BA 5HFYA 3WANA 3MHSD 1D4BA 1F52A 4K3BA 1V6EA 1D5ZC 1MVKA 2KQ4X 1GAQB 3MC9A 3PVLA 5CX3A 4PS3A 1SE9A 2KACA 1Q5WB 3DVGY 1K8RB 2G9HD 2WGSA 2WXJA 1SEBD 2XN9C 1ZE3D 1WX7A 3EC8A 5C3JB 1TZ1A 5HI1A 1RRBA 4OVZA 4HJKA 1FXAA 2BW2A 1WH3A 4K7WA 2QJLA 2AX5A 2K1FA 3RN9C 2N7EA 4TMAB 5BYSA 1TKYA 4AWJA 3Q8AA 2MWSB 5D7GA 1WXQA 4KZCA 2NTSA 2YEPB 1YD8U 5IAAC 2MX2A 4KGRA 3ZRCA 4US9A 3PLVA 2KJ6A 1QT9A 2INNE 3BYTB 3FAHA 4W9CA 2L0TA 4B95A 1Q10A 4ICUA 1S1QB 2WDQB 4N6EB 2WXOA 4LNIA 1L4DB 2KVZA 2NS5A 2IYDB 2V3PA 3SD5A 2G3QB 3H9DA 4MGZE 1FEHA 1VDVA 4C56C 1JWBD 2MBHA 1XXGA 3HUIA 3KQ4A 4LNKA 4FJZA 2NPTB 3AB5A 1HTQA 3IFWB 1YQ4B 3P4QB 3SDLC 1WJNA 4ANXA 3LJ3A 5D94A 1KH0A 3H7PA 2IGGA 4GIVA 4WWOA 1ET9A 3N1XC 4XDDA 1L0YB 2K9XA 2BS3B 4ITKA 1WYGA 2OEDA 5D6JB 4EE2A 1R4NB 3N20C 3WCQA 1WXAA 4LNFA 1H8CA 2H88B 4I6PA 3P4RB 1E7UA 3EGRA 1RAXA 4JGHB 1UWMA 4KKIA 1V9JA 3RI7C 5EE0A 2KZRA 3CWIA 3Q2AC 2N9XA 3TMPB 4YT0B 2DAFA 2Y5BB 1S3SG 2IBIB 3LXFA 2Y5PA 4EZLA 2LHEA 3KWVA 4NZLB 3MC8A 2PJHA 2EMSA 1C9FA 4FLHA 4XZ4A 3X23A 3K9OB 3V60A 3KLSX 2AWTA 2LVQA 2ZNVC 3I5JC 1OGWA 2JYTA 1FNVA 3GS2A 1ZDVA 3WIMA 3OLMD 2KNBA 1N61A 3T8MA 3TSSA 4WWPA 4ZHOA 4IWPA 2MJ3A 3VH3B 1XQQA 1QILA 2V3NA 1OEYJ 2J52A 4HCPB 2QIEB 1TT5B 3RNFC 1NDDA 3PRMB 1BUIC 2IGHA 3ZIMA 3T3NA 3TEZA 3PZDA 3VTVA 4RGTA 2X38A 3ML8A 4JWSC 1XD3B 2I38A 4HROA 2GBKA 3APCA 2D3GA 2BKRB 4RGOS 3R2TA 4GN1A 1AARA 2M17A 4MJSA 1WR1A 1GB4A 4BKSA 4WJNA 1SB3C 3OWEB 2J0JA 1AYFA 5J18A 5LXIB 1NI2A 3Q3OC 2WDTB 1WF9A 1V1PA 2J7QB 2LRWA 1YOVB 4RGMA 4MGKE 4MDKE 2KTFA 3Q8FA 4II3B 4HK2A 1V8CA 4BBNC 2KJRA 1ZXIA 2ZVOA 4MT5A 1WJUA 4CYEA 1GJZA 2JY6A 1TKEA 2L32A 4WJQA 4AOFA 2DWQA 4K81A 2JZPA 1L5PA 2ZEQA 3AE7B 3DVNV 3IVFA 4B9KA 1WRDB 4M0WA 2BS2B 2SAKA 4LJOB 3VVWB 3SEBA 2DENB 1VJKA 5KHOA 4DXGA 3EA6A 5LXHA 3ZO5B 1YQ3B 1Q1OA 3HRDD 2D11A 1RWSA 4O1NA 2V9HA 3RZWC 3J9CA 5C2TB 2O2VB 1K50A 2C5LC 5E6OA 2AYOB 2LGYA 2LGXA 2AL3A 3Q14C 2Z0EB 1L0XB 3U52E 2PE6B 1JQ4A 1T6BX 1EM7A 2BWES 3MJ5A 2D5GA 3AEBB 3FILA 2N9EB 4FADA 4A55A 3NJTA 2KDMA 4L2YA 1YN4A 1CJEA 4BFRA 1KLVA 1FO4A 3GOEA 2JT4B 4XC2A 2JF5A 2GLSA 2KMMA 5LNK1 4DBGA 3DBLB 1JROA 3EECA 3W5UB 1JWAD 5AZFA 2H89B 4ZYSA 4ZRJA 1WE7A 3RNAC 4DXAB 1T3QA 3N3KB 3DHGC 3NVWA 1E0ZA 2CR5A 1XF5L 1TGZB 1WXVA 1IPGA 2VH1A 4I6NB 3U7DA 3ZNID 3B0AA 3BVGA 1TZOA 1WGYA 2M0XA 4US8A 1PUTA 1QOFA 2IJ0A 3P2BA 2PTLA 2GRIA 1VRAB 2ICIA 3Q3JA 2LFIA 2DAJA 4WIPA 3QWZB 2J53A 3AEFB 3APDA 2HD5B 1EWYC 1E8ZA 4CHKA 2JWZA 1FMAD 2OHFA 1N6ZA 1FIQA 1C77A 2BGFA 1QOGA 3TEXA 2C60A 3V3XA 1WE6A 1T0SC 2BQQA 1UUPA 1TJEA 1V5TA 3ZJTA 4HEA1 1UGJA 3OJ4B 1WM2A 4J6IA 3PPAA 2NBVB 3B1LX 1YN5A 4RM8A 2DLBA 1CQVA 4DDID 2DZJA 4P1BC 4GMVA 5IO9A 2FAZA 4KGTA 2JPHA 2IZVB 2KDBA 1R4MB 3QA8A 2L76A 2LD9A 3S2AA 5CTRC 2D10A 4YXDB 5EE9A 1P3QU 1EF1A 3ZKJC 3AE9B 3LB8C 1L6VA 3BZDB 4EFOA 1JMLA 1JWMD 2KC1A 4KSLC 3N1YC 2ZZPB 1P7EA 1E6EB 1E90A 2R2QA 2FUG1 4DDGD 4KDLB 2ZNVB 2LRUA 1Y56A 3VDZA 3Q8EA 4A8XC 2GBJA 4YWGG 4REZA 1I4PA 4BOZB 3ZTCA 3B9JA 1ZXHA 1F2RI 4IC7B 4IOIE 1CMXB 4KIKB 3PS6A 4M02A 2YVCA 2V3SA 3KUCB 5HG2A 1LXDA 3GE3C 1OQQA 3PRPB 3R3MA 4H2AA 3W1SA 1FFUA 2PVOD 3ECIA 1YJIA 1P7FA 1K52A 4P6VF 4WH4A 4C7YA 1VZ6A 5IP4D 2KFKA 2HTME 3IHPC 4JPSA 5DPWA 3DVNU 2QC8A 1SE2A 1IBXA 4TSSA 2OJRA 3ZW3A 4JQWC 4ZHPA 5G5GA 2W9NA 1WRIA 3X0WA 2ZW1A 2IO1B 3Q3FA 1R4NI 2W3RA 2JQRB 2K39A 2XK5A 2KTRB 1UNSA 3VXWA 3KWLA 3P42A 1TY2A 3N1ZC 2NR2A 2MP2A 1F0ZA 3O65B 2L3ZA 3RD2A 1MG4A 2TSSA 2ZW0A 3JSVA 1KLUD 4GDLB 2NPTA 3HHMA 4B0MA 3AE8B 2L83A 3C8YA 1M94A 3P1MA 2CS4A 4BKSD 2C7HA 4P16A 5HKHA 4YTNB 3WAPA 1PQSA 1WXSA 2ZJDA 3HVDA 3AECB 1X1MA 3DBRB 1N5WA 1DOYA 4QAYA 2MEKA 4PYZA 3EFCA 2MJEA 1XCQL 3DDCB 3QHTA 1D6EC 2KMCA 5G5HA 3L4PA 3B2FA 2BB5A 2LEKA 1TS2A 1ROEA 1AW7A 3VAWA 3DWMA 3DWGC 4PK1A 3UINB 3BYYB 3CIRB 2KKCA 2W55A 5DPTA 2N7JA 1SJHD 3UIPB 4F7ZA 4P7IA 4RF0A 1GOZA 3MC0B 3Q69A 4IWQA 2KDIA 1EO6A 1UZXB 1L0VB 3RMKC 3IXSA 4W9KA 2KLCA 3AULA 5AUKA 2MCNB 5TSSA 2WXQA 1GC6A 5DCNA 3TCAA 3AI5A 1XLQA 4M00A 4GOCA 5KHQA 1TBEA 4F1SA 4EZKA 2W3SA 2INCC 4J3OD 2Z8LA 1C4PA 2WP9B 1DOXA 4GU2A 2IY1B 3QQ8B 1SBBB 3VRBB 1BXTA 1STEA 4GDKB 2KQ7A 3A33B 4JIOU 4ACFA 4W9EA 3GP7A 2MQJA 3LYYA 1LM8B 3BIID 4ARCA 2RPQA 4NJ6A 1FRDA 5JZEB 4B6WA 2WXIA 3TEWA 4W9DA 4E74A 4HLEA 3BVMA 4NQLB 2KOXA 3Q8BA 2LGSA 2D3CA 2QMTA 5EDSA 1WMHB 1ZW7A 3E56A 3P4PB 4AJYB 4WAFA 1J19A 2IGDA 4EOYA 1QQRA 3SFDB 3UIOB 1FM0D 1TS3A 2BF8B 3NVVA 1P0RA 4BAXA 3NY5A 3IAS1 2MSED 4G3XB 5EE3A 1MHXA 1NEKB 5CHFA 1RYJA 3BY4B 1P98A 3VH4B 3Q8CA 1HZ5A 3OG5A 4HVBA 1WGGA 2IO0B 5GMVA 3RNGC 3L54A 2BWFA 1ZPSA 5AZHA 3VQIA 1SJED 2Q5WD 3HK0A 1Y8RC 1EWCA 2RD0A 4CO7A 2JZZA 3MFGA 4PS8A 1DOIA 1ZDXA 2C9WB 1FNUA 1IP9A 1ZUD2 1R7SA 4ANWA 1JRUA 2V1YA 3N32A 3D32A 2MHJA 3AEGB 4K3CA 3AV8A 4IM2A 2AQ2B 2WXHA 1FPYA 4BKGA 1YQBA 4LCDE 3PT2B 2BYFA 1YN3A 2O2VA 4LDTD 1V5OA 3AE4B 2AL6A 3ZRFA 4HWIB 3GZNB 1ZOYB 2NMQA 4TQ0A 2OJWA 3BWUD 2EELA 3QC8B 3H1UA 4IG7B 4HRSA 2KDFB 2J4XA 3L17A 5G55A 3CMMB 3SFEB 3ZDTA 1QLBB 4DK5A 4N9F4 3BK2A 3A9JA 3M63B 1YX6B 1N60A 3HM3A 5E6JA 3AU4A 2KFJA 3H7PB 3K9PB 1WGKA 1WX8A 4MGIE 1SF0A 2B3AA 5C23A 5FR6A 5IOIA 4EUTA 2V4LA 4B0EA 2HJ1A 5I4DA 5BYRA 1WI0A 4A90A 4YTMB 1GUAB 1UBQA 4S17A 3A1QA 2QILA 2JU6X 2WXPA 2D3BA 5BYQA 2L52A 2FCNA 4XWTA 4S0RA 4RF1A 1LGRA 1VLBA 1B9RA 1KJTA 5DPRA 1NENB 2D2QA 1FRRA 4PYUA 1XT9B 4GB9A 2A5UA 3W2DA 4ASWC 1VCBA 4IM0A 1JRPA 2K8CA 2NVUI 2C7MB 1E9MA 3ALBA 1Z2MA 1HEZE 4HPMB 2RMMA 4HPLB 1EF5A 1RM6C 1R4MI 2KC2A 2PLPA 1OFFA 4FULA 3RNBC 3VR9B 4JE3B 2LXCA 1KTKA 1T5XD 3ZLZA 2L7RA 1C4AA 4LTUA 5L83A 3HM6X 3QIJA 1C76A 1D3ZA 1MJDA 4Q2JA 5EE1A 2KN5A 1OQYA 1XLNA 3RFZB 4UDUC 3W1SC 1UH6A 3PLUA 3QAQA 3E9SA 4LJPB 4L1BA 2N9LA 1C79A 4W9LA 4GGQA 4C4VA 1M4VA 1VZ8A 4EKUA 2FNJB 2DZMA 3OJ3A 1N5XA 2CHWA 1HZ6A 4NPNA 4M8NA 4L23A 5LLIA 3ZNHB 2CU1A 2N4FA 2WWZA 4WQOB 3O13A 3NHEB 1WGRA 2ZVNA 3GB1A 2FBWB 2ZPNA 3QCAA 4BKTA 5AZGA 2GB1A 3VTUA 2CHZA 3RNCC 1AWDA 1F2RC 5J2RA 1WJ4A 2AQ1B 3GE8C 1KF6B 2D07B 1E8WA 1ZGUB 1WM3A 1VZ7A 2JRIB 1UBIA 3TUOA 4MM3A 2A4ZA 3RCZA 3U30A 2UYZB 1V1PB 3DCGA 5D2MB 3L08A 1YNTE 3PV1A 4NAWA 1K53A 2KK8A 3PGEA 3VHTC 3QARA 1N62A 2K0PA 2MBQA 1DGJA 3ZDMC 3JYUA 4GLSC 2KYWA 2LGDA 3C19A 2PPHA 3IG3A 3Q6BA 4KIKA 1C3TA 3KUZA 2K25A 1MG8A 3RNEC 3N30A 2NBUA 1F9JA 2KXJA 1HE8A 4M0WB 1FXIA 2EKEC 2WXKA 4MEMA 2W54A 4P1CC 4KV2A 4DXFA 3TEYA 2LASA 2KAJA 3TJPA 1FNWA 5IN7A 4XGAB 2LJIA 4WQMA 2ZCCA 1TKGA 1V80A 1TTNA 5JH5C 2IY0B 3DOWA 2GBNA 3DBRI 4N59A 1QF6A 4KX6B 2LUEA 3ZXVA 3U8ZA 2VH2A 1SXTA 4URKA 3L10B 3PHWB 4BZAA 3NUHB 3KW5B 2CHXA 2O6VA 3FILB 1ACCA 1JALA 5C1ZA 4WURA 1WYWB 2LI5A 2Y5CA 2JUOA 3A9KA 4ZYNA 4OZBA 2XBBC 1L6UA 3BK1A 3B2GA 3R7QA 4FHJA 2PVGC 2BPSA 1SGHA 3AM9A 1I4QA 4N58A 4XWWA 4HDOA 3MHZA 2GBRA 1IYFA 1I42A 1V1OA 1KOTA 2RSUA 3ZTDA 2BB6A 1OQRA 3AN1A 4D2KA 2JXXA 1HQRD 3FC4A 3PREA 1YIWA 2MJDA 4LNOA 1C1YB 4RFBA 2LVOA 1EU3A 2CKHB 1NI3A 1EUVB 4G11A 3B08A 1VR9A 3PZ8A 1IUEA 4ZDVA 4ZOHC 4DHJD 1WWTA 2MRPA 2LUMA 2SEBD 1IGDA 3T3OA 2ACZB 2PKOA 3M62B 4DWFA 1K51A 3AE5B 2FUHB 4OZAA 3I9V1 4LK0M 2V0GA 2L1AA 2WHIA 1T0YA 3AEDB 2JRHA 2WDRB 2E3TA 2HE7A 1WX9A 1PFDA 3L0WB 3JW0X 2JXTA 1JW9D 2K6QA 4IKGA 2KDEB 3DBHB 2PE9A 2RR9A 4NY0A 1B1ZA 3KH0A 3PHXB 4G50A 2KX3A 3IT4B 5JHAA 3HIZA 3VUYA 2BYEA 2MLBA 4YSXB 2KANA 2MBEA
chains in the Genus database with same CATH topology
3Q8FA 3E56A 3P4PB 4DQOC 3AE1B 2WXGA 1ZXIA 4MT5A 2DBYA 4WAFA 2IGDA 4CQNA 1QQRA 3SFDB 2QEJC 5H92C 1FM0D 2IDYA 1TS3A 1TKEA 2L32A 3NVVA 2R61A 2DWQA 3HVZA 3IAS1 2JZPA 1L5PA 5EE3A 2G1EA 3AE7B 1NVID 1MHXA 1AN8A 4M0WA 1NEKB 2BS2B 2WU2B 2WXLA 2CJOA 1LO5D 2SAKA 1A70A 3SEBA 1RYJA 1VJKA 4DXGA 3EA6A 4TQ1A 4FXCA 3Q8CA 3URYA 1HZ5A 1YQ3B 1HXYD 1PGBA 3HRDD 2WLBA 1RWSA 1DYQA 4O1NA 3UI3A 1TS4A 2JWUA 3J9CA 5FK9C 5C2TB 1K50A 5D3DA 1ZPSA 4YTPB 3VQIA 1SJED 2KN4A 2Q5WD 1MI0A 1PDXA 2PIAA 1EWCA 1KFYB 3AE3B 1L0XB 3U52E 5T8IA 1J7AA 5FR3A 2N0SB 1JQ4A 1T6BX 1EM7A 1F77A 3MJ5A 5FKAC 2KWDA 2WNMA 3MFGA 3ZJUA 1DOIA 1ZDXA 2D5GA 3U4EG 1D5XC 3AEBB 1FNUA 3FILA 4RH6A 1ZUD2 3AE2B 2CU3A 4A55A 1R7SA 2JSVX 2M0AA 2KDMA 3AEGB 4L2YA 1YN4A 1CJEA 4ZRQA 3AV8A 4RNAA 1FO4A 2AQ2B 4A6QA 2WXHA 2WDVB 2KMMA 5LNK1 1YN3A 1JROA 3PO0A 3W5UB 3AE4B 2I2YA 3ZJVA 2VZKB 4HKQA 1JWAD 2K5PA 1ZOYB 2NMQA 2H89B 4YSYB 4TQ0A 1J7CA 4MM3B 4RGNA 3BWUD 2DYMA 2JX5A 2EELA 4ZYSA 1BMLC 4NAWB 1NYRA 4HRSA 1XO3A 2E6XA 2J4XA 1FFVA 2ONQA 4XE0A 1T3QA 1IBXB 2DYOA 4IDIA 1SSNA 1FCCC 2IPKD 3SFEB 1QLBB 2HDEA 1ZP0B 3NVWA 1E0ZA 3BK2A 3R2IA 1XF5L 1N60A 5E6JA 3BVGA 1TZOA 1ESFA 2K22A 1I4HA 4US8A 1WGKA 2GI9A 2AQ3B 4NJCA 1TS5A 1PUTA 1SF0A 4R3DA 4C7ZA 3P63A 1QOFA 2IJ0A 3RPFC 1WSPA 4B0EA 2PTLA 2GRIA 3PZ7A 1VRAB 2ICIA 5BYRA 5I4DA 4A90A 4YTMB 2LFIA 3U2SC 1GB1A 1CZPA 3NRZA 1C4CA 2N9KA 1RFKA 2QILA 4WIPA 3BVZA 2JU6X 2LGIA 5HHDG 2WXPA 4YSZB 2RDGA 2J53A 2L52A 2VZKD 3AEFB 5BYQA 1NYQA 2BT6A 4XWTA 2RPVA 4RF1A 1VLBA 2WXFA 1B9RA 1NENB 1E7PB 1EWYC 2WXRA 1FRRA 4NAMA 1FMAD 1I4XA 2ON8A 2OHFA 5BMIA 1FIQA 2J42A 1MPEA 1I7HA 2MH7A 1C77A 1PGAA 4MH8A 3W2DA 1QOGA 3TEXA 1V97A 1JRPA 5H8YE 3W5VB 3IAM1 1QOBA 4LLGM 3V3XA 4KKJA 5GXGB 1E9MA 3VRAB 4RCOA 2JYEA 4AS1A 1UUPA 1TJEA 4A9AA 2W82A 5AUIA 3ZJTA 1SE3A 1HEZE 2RMMA 4HEA1 1UGJA 1RM6C 1SIJA 2PLPA 3VR9B 1OFFA 4ZRPA 4JE3B 3NVZA 1TYGB 3ZYYX 5HFYA 1QOAA 1KTKA 1T5XD 1D4BA 1YN5A 1D5MC 1CQVA 2DLBA 2M56B 5D3IB 1C4AA 4LTUA 1D5ZC 1MVKA 2KQ4X 1GAQB 1C76A 3R8BA 2BYTA 4KGTA 4Q2JA 2KACA 5BMGA 5EE1A 2G9HD 2WXJA 2QSDA 2BBCA 1XLNA 1SEBD 3MP9A 3RFZB 4UDUC 1YMHE 2XN9C 4YXDB 1ZE3D 3AEAB 5EE9A 3E9SA 3AE9B 3LB8C 4L1BA 1L6VA 2N9LA 1C79A 3BZDB 5C3JB 1M4VA 1VZ8A 4OZCA 5HI1A 1JMLA 1JWMD 4OVZA 1N5XA 1HZ6A 1FXAA 2BW2A 3I57A 2WQYB 4L23A 1P7EA 1E6EB 2QJLA 2AX5A 2V4IB 4TMAB 1C78A 2FUG1 5BYSA 1TKYA 3O13A 3ABVB 3Q8AA 5D7GA 3GB1A 2FBWB 1WXQA 3W9CB 2NTSA 1Y56A 3V05A 2YEPB 3Q8EA 4A8XC 4C80A 4YWGG 4KGRA 2LHDA 1GPXA 2PW9A 4REZA 4US9A 1CK1A 2GB1A 1I4PA 3P4SB 3B9JA 1QT9A 1AWDA 1F2RC 1F2RI 1ZXHA 2INNE 3BYTB 3FAHA 4JWUC 4IOIE 1Q10A 2AQ1B 1I4GA 2WDQB 1KF6B 4XDCA 5HG2A 4N6EB 2WXOA 1L4DB 3NVYA 1OQQA 1VZ7A 4H2AA 3W1SA 1FFUA 2RDHA 3TUOA 2PVOD 1YJIA 2V3PA 1P7FA 1K52A 4P6VF 4WH4A 4C7YA 1VZ6A 2WU5B 1V1PB 1KLGD 1YNTE 2HTME 3ZGZA 1FEHA 1K53A 4JPSA 1VDVA 1KRHA 4WWMA 2K0PA 1N62A 4C56C 3ZQ4A 1JWBD 1DGJA 1SE2A 1IBXA 1XXGA 3HUIA 4TSSA 1PGXA 4GLSC 3KQ4A 2WS3B 3AB5A 4ZHPA 5G5GA 3H8HA 4PT5A 1WRIA 1YQ4B 3P4QB 2ZW1A 2W3RA 1KH0A 2JQRB 3AMZA 1FXIA 2IGGA 2WXKA 2W54A 1UNSA 1ET9A 4XDDA 4DXFA 2K9XA 1L0YB 3NZ3A 3KWLA 3P42A 3TEYA 1TY2A 3N9YC 2BS3B 2KAJA 1F0ZA 4ITKA 1WYGA 1FCLA 1FNWA 2K3UA 2OEDA 4EE2A 3SR6A 4HKZE 2LJIA 4WQMA 1TKGA 3WCQA 2TSSA 2LMCA 1ENFA 2ZW0A 2H88B 1KLUD 3P4RB 5BMHA 3EGRA 1IGCA 4GDLB 1UWMA 4B0MA 4KKIA 5EE0A 3AEEB 4N59A 3AE8B 2L83A 3C8YA 3P1MA 3CWIA 1UWXA 1QF6A 4KX6B 4P16A 4YT0B 4YTNB 1SXTA 3NUHB 3LXFA 2Y5PA 3HVDA 3AECB 3FILB 2LHEA 3KWVA 1ACCA 1PYWD 1N5WA 1DOYA 1JALA 2MEKA 4NZLB 2FE8A 4WURA 2Y5CA 2MJEA 3NS1A 1XCQL 1ET6A 1C9FA 1MHHE 1D6EC 2B76B 4OZBA 1L6UA 3KLSX 3BK1A 1XCTL 3B2GA 5G5HA 2PVGC 3AM9A 1I4QA 3L4PA 4N58A 4XWWA 3B2FA 5MPOA 1TY0A 3MHZA 1E10A 2BB5A 2WXNA 2LEKA 1FD6A 1TS2A 4AQ7A 1ROEA 1AW7A 1V1OA 1QKZA 3DWMA 2JYTA 3DWGC 1FNVA 3GS2A 2BB6A 1OQRA 2WXMA 3BYYB 1ZDVA 2W55A 3CIRB 1YJJA 3AN1A 4D2KA 1XLOA 1J7BA 1HQRD 3FC4A 1N61A 2N7JA 1SJHD 4HJGE 3TSSA 1XLPA 2MJDA 1L4ZB 1XEEA 3AE6B 4ZHOA 4RF0A 4RFBA 2MJ3A 1EU3A 1GOZA 3MC0B 1I4RA 3Q69A 1NI3A 3ETRA 1QILA 1VR9A 2V3NA 3U7ZA 3PZ8A 1IUEA 4ZOHC 2INPE 2M19A 2CJNA 2J52A 1L0VB 1JCKB 1WWTA 2NTTA 2QIEB 2EKIA 3IXSA 4USAA 3VR8B 2LUMA 2SEBD 1BUIC 2IGHA 1IGDA 3T3OA 2BTEA 5AUKA 5TSSA 2ACZB 2WXQA 2PKOA 3T3NA 3TEZA 1XLQA 4RGTA 1K51A 2X38A 3AE5B 3EUB2 1JWSD 4JWSC 2W3SA 3IT6B 3I9V1 4OZAA 5JXVA 4LK0M 2I38A 2V0GA 4HROA 2L1AA 4J3OD 2XNAC 2Z8LA 1C4PA 2WP9B 1DOXA 3AEDB 2YEPF 1EU4A 1HA5A 2WDRB 1SBBB 2E3TA 3VRBB 1BXTA 1STEA 1SE4A 4RGOS 4GDKB 1PFDA 3R2TA 4MACA 4OW0A 2BS4B 3GP7A 2JXTA 3LYYA 3BIID 1JW9D 4OHJA 4ARIA 1GB4A 4IKGA 4ARCA 1JWUD 3AH7A 1SB3C 1FRDA 1N63A 2WXIA 3OWEB 2PMVA 1AYFA 1B1ZA 3TEWA 4JX1C 3IT4B 2Y3AA 3BVMA 4KGSA 1V1PA 3Q8BA 4YSXB 4RGMA 2QMTA 1V8CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N9Y C; 
#chains in the Genus database with same CATH topology
 2IO3 B;  3AE1 B;  3VFK A;  2WXG A;  3Q3N C;  2BKF A;  2DBY A;  4CQN A;  4GDK A;  2KQS A;  3DVG X;  2QEJ C;  5H92 C;  2R61 A;  3UF8 A;  3HVZ A;  4E3C A;  4HDQ A;  1NVI D;  1AN8 A;  2WU2 B;  2WXL A;  2FCS A;  2CJO A;  1WGD A;  3T9L A;  4FXC A;  2NBW B;  3URY A;  2K6D B;  1ZKH A;  1WMH A;  2QHO A;  1DYQ A;  3UI3 A;  1TS4 A;  5FK9 C;  3NS8 A;  2DZK A;  3DPD A;  4YTP B;  1VD2 A;  2KN4 A;  2FID A;  1PDX A;  2PIA A;  5L95 C;  2DZI A;  5T8I A;  5FR3 A;  3QX1 A;  2C7N B;  1F77 A;  4FJY A;  1E5W A;  2L0F A;  1D5X C;  2N1V A;  4RH6 A;  4GXB A;  2KT7 A;  3AE2 B;  2MW5 A;  3GZN I;  2M0A A;  4ZRQ A;  1WZ3 A;  3R66 C;  3RYT A;  3PTF C;  1LFD A;  4A6Q A;  1V2Y A;  2WDV B;  4EZJ A;  3PO0 A;  2I2Y A;  1U4A A;  3V6C B;  3NZS A;  4HKQ A;  2K5P A;  3BIN A;  3DHH C;  4FN2 A;  1J7C A;  3ENE A;  4RGN A;  2DHZ A;  5E6N A;  2X8X X;  2K8H A;  2KWU B;  4BOS C;  5JHB A;  2KFK B;  1BML C;  2Z59 B;  1T0R C;  4AP4 C;  2J0M A;  4WJO A;  2E6X A;  1FFV A;  1L7Y A;  4MSQ B;  4XE0 A;  1IBX B;  4IDI A;  2M8S A;  1FCC C;  1E7V A;  3WAL A;  2J0K A;  3R2I A;  4OVU A;  2KWC A;  3ZVV A;  2KLG A;  3M95 A;  3L13 A;  2MBO A;  2GI9 A;  5TR5 A;  2XK5 B;  1TS5 A;  3RT3 B;  2JZ3 B;  4R3D A;  3P63 A;  2AEH A;  1WSP A;  1MFW A;  2MP2 B;  3RPF C;  4RMA A;  3PZ7 A;  1FXT B;  1LQB A;  1Q0W B;  2RDB C;  3ZUN A;  4HCN B;  3U2S C;  3JSV B;  3H7S A;  4TUU A;  1CZP A;  3IBE A;  3PSE B;  1C4C A;  2WX1 A;  1RFK A;  3NZU A;  1WZ0 A;  2VZK D;  3WAM A;  1NYQ A;  2N7D A;  3EHV A;  4A3P A;  4NJ7 A;  4W9I A;  2WXR A;  4FJV B;  4NAM A;  3DQV A;  5BMI A;  1WJ6 A;  1MPE A;  2MH7 A;  1I35 A;  3CSF A;  4HPP A;  1V97 A;  2KMA A;  5GXG B;  4NQK E;  2HTH A;  3VRA B;  3VTW A;  4AS1 A;  4A9A A;  2W82 A;  5AUI A;  2HJ8 A;  2KJH B;  1WGH A;  2R2O A;  1SIJ A;  2ZPY A;  4ZRP A;  3NVZ A;  3ZYY X;  1QOA A;  4X57 B;  1D5M C;  5D3I B;  2M56 B;  3R8B A;  2BYT A;  3DHI C;  5BMG A;  3KYD D;  2QSD A;  3DBL I;  2BBC A;  4KVG B;  3MP9 A;  3KYC D;  5CHV C;  1YMH E;  3AEA B;  4I6L B;  1RFA A;  2LZ6 A;  2FCM A;  3W1Y A;  4ZRI A;  2M1M A;  2L00 B;  4MEL A;  4OZC A;  5IKC M;  3CST A;  3LDZ E;  2KO3 A;  2KHW B;  3I57 A;  2WQY B;  3Q3M C;  3PRZ A;  2V4I B;  2O6V D;  1C78 A;  2I1K A;  3ABV B;  1QZE A;  1G6J A;  3W9C B;  3V05 A;  4C80 A;  2ZCB A;  2LHD A;  1GPX A;  5DPS A;  2PW9 A;  4XX5 A;  1CK1 A;  1Z5S B;  3P4S B;  4JWU C;  3KUD B;  3A4S C;  4PS7 A;  3UGB B;  1I4G A;  3FKY A;  4EEW A;  4XDC A;  3NVY A;  3TIX A;  1V81 A;  2RDH A;  1F1H A;  4M8M A;  2WYQ A;  2WU5 B;  1KLG D;  3ZGZ A;  1J0G A;  2UU7 A;  2KVR A;  2G45 B;  1KRH A;  4WWM A;  3ZQ4 A;  2LXA A;  2XEW A;  1PGX A;  4NNJ B;  4A20 A;  2GBM A;  2WS3 B;  5CHW A;  3H8H A;  4PT5 A;  1P1A A;  3WA0 A;  1UEL A;  3AMZ A;  1WR6 E;  1GG3 A;  1L2N A;  2DNF A;  3V62 A;  3NZ3 A;  4C00 A;  3N9Y C;  3RUL A;  4W9F A;  2ASQ A;  1FCL A;  2K3U A;  3OAW A;  3SR6 A;  4HKZ E;  2FCQ A;  1SIF A;  2IND C;  2LMC A;  2I1J A;  4WWN A;  1ENF A;  1UD7 A;  4DHJ B;  5BMH A;  1IGC A;  3SU8 X;  3WAO A;  2MBB B;  3AEE B;  1UWX A;  4KZ0 A;  4AUQ C;  2D3A A;  5G2N A;  4RM9 A;  2JVC A;  1WY8 A;  4G0N B;  1PYW D;  1V49 A;  2LVP A;  1TIF A;  3A4R A;  3MTN B;  2FE8 A;  2GOW A;  3NS1 A;  1ET6 A;  1MHH E;  1BT0 A;  2B76 B;  4FA6 A;  1XCT L;  1E8Y A;  5MPO A;  1E10 A;  1TY0 A;  2LWP A;  2WXN A;  4JL9 A;  1FD6 A;  4AQ7 A;  1T0Q C;  4BBN F;  1QKZ A;  2WXM A;  3VUX A;  1YJJ A;  3I3T B;  5BO4 B;  1XLO A;  1J7B A;  4HJG E;  1XLP A;  1L4Z B;  1XEE A;  2PEA A;  3AE6 B;  1I4R A;  3ETR A;  3I63 C;  4KDI C;  3U7Z A;  3A9J B;  2INP E;  2M19 A;  2QDF A;  3ZXR A;  3ZNZ B;  2CJN A;  4DHZ E;  1JCK B;  2NTT A;  4FBJ B;  2BVC A;  2EKI A;  3KVF B;  4USA A;  3VR8 B;  4A3O A;  3ML9 A;  3DBS A;  3QJZ A;  4MJS B;  2BTE A;  2VRR B;  4IWO A;  3EUB 2;  1JWS D;  3IT6 B;  5JXV A;  1UGM A;  2XNA C;  2YEP F;  1EU4 A;  2MA9 B;  1HA5 A;  4W9G A;  3DBH I;  3A1Q B;  1H4R A;  1SE4 A;  1OEY A;  4HXD A;  4MAC A;  4OW0 A;  3SHQ A;  1KM7 A;  2BS4 B;  2G4D B;  3QK0 A;  4OHJ A;  4ARI A;  1JWU D;  4W9J A;  4GSW A;  3AH7 A;  1E8X A;  1N63 A;  4II2 B;  2REX A;  2PMV A;  4WAA A;  4JX1 C;  2NCN A;  2Y3A A;  2KX0 A;  2N9P C;  3TBL D;  4KGS A;  4OVV A;  4WJP A;  2L8J A;  1A5R A;  3TL5 A;  4DQO C;  2UWQ A;  2YLM A;  5J17 A;  2IDY A;  4IW0 A;  1HTO A;  3CF6 E;  3H6N A;  2L05 A;  2G1E A;  3V6E B;  4DHZ B;  4K7S A;  1LO5 D;  4FHK A;  1A70 A;  4K7U A;  2KD0 A;  2KTR A;  4MH0 E;  4TQ1 A;  1P9D U;  4ANU A;  3NG0 A;  1HXY D;  1PGB A;  2WLB A;  4C4V B;  4ANV A;  2JWU A;  3APF A;  2WX0 A;  1OTR B;  1NBF C;  2G4S A;  5D3D A;  4GDL A;  4M01 A;  2FIF A;  1MI0 A;  1KFY B;  4MSM B;  1YJ1 A;  3AE3 B;  1J7A A;  2N0S B;  4MGY E;  5FKA C;  2KWD A;  2WNM A;  3ZJU A;  3ZNG C;  3U4E G;  1UF0 A;  1WIA A;  2CU3 A;  2JSV X;  4IM3 A;  2DX5 B;  4RNA A;  2KWV B;  1YX5 B;  3UQB A;  4ICV A;  3ZJV A;  4F8C B;  1WFY A;  2VZK B;  4ZRK A;  2M4N A;  4YSY B;  4IUM B;  2IO2 B;  4MM3 B;  4LNN A;  3RUI B;  2DYM A;  2JX5 A;  3C0R B;  3JVZ X;  2OOB B;  3ONS A;  4K1R B;  2QCZ A;  4NAW B;  1NYR A;  4W9H A;  1XO3 A;  3L16 A;  3NOB A;  3R7R A;  5IA7 A;  2ONQ A;  2LJ5 A;  4XYC A;  1WXM A;  2DYO A;  1SSN A;  2IPK D;  2HDE A;  1ZP0 B;  2Z0D B;  3M3J A;  1ESF A;  1ISN A;  2K22 A;  4BVU C;  1I4H A;  4NJC A;  2AQ3 B;  5AEK B;  3AU5 A;  2GMI C;  3VUW A;  1GNU A;  4C7Z A;  4YL8 A;  1J8C A;  2EMT A;  4E71 A;  2BYV E;  1GB1 A;  1RLF A;  3NRZ A;  2N9K A;  1V86 A;  3BVZ A;  2LGI A;  5HHD G;  3V61 A;  4YSZ B;  2RDG A;  2BT6 A;  3AXC A;  2RPV A;  4LDT B;  2N1W A;  2WXF A;  1E7P B;  2O6V B;  1I4X A;  2ON8 A;  5E6P A;  2J42 A;  3MJW A;  2RGF A;  1I7H A;  1PGA A;  4MH8 A;  4AJW A;  5H8Y E;  3W5V B;  4KSK C;  3IAM 1;  3A9K B;  3RZF A;  1QOB A;  4LLG M;  4KKJ A;  4JLC A;  1GC7 A;  2JYE A;  4RCO A;  3UQA A;  4TV3 A;  3EFU A;  1SE3 A;  2DYB A;  4TKN A;  1TYG B;  2K8B A;  5HFY A;  3WAN A;  3MHS D;  1D4B A;  1F52 A;  4K3B A;  1V6E A;  1D5Z C;  1MVK A;  2KQ4 X;  1GAQ B;  3MC9 A;  3PVL A;  5CX3 A;  4PS3 A;  1SE9 A;  2KAC A;  1Q5W B;  3DVG Y;  1K8R B;  2G9H D;  2WGS A;  2WXJ A;  1SEB D;  2XN9 C;  1ZE3 D;  1WX7 A;  3EC8 A;  5C3J B;  1TZ1 A;  5HI1 A;  1RRB A;  4OVZ A;  4HJK A;  1FXA A;  2BW2 A;  1WH3 A;  4K7W A;  2QJL A;  2AX5 A;  2K1F A;  3RN9 C;  2N7E A;  4TMA B;  5BYS A;  1TKY A;  4AWJ A;  3Q8A A;  2MWS B;  5D7G A;  1WXQ A;  4KZC A;  2NTS A;  2YEP B;  1YD8 U;  5IAA C;  2MX2 A;  4KGR A;  3ZRC A;  4US9 A;  3PLV A;  2KJ6 A;  1QT9 A;  2INN E;  3BYT B;  3FAH A;  4W9C A;  2L0T A;  4B95 A;  1Q10 A;  4ICU A;  1S1Q B;  2WDQ B;  4N6E B;  2WXO A;  4LNI A;  1L4D B;  2KVZ A;  2NS5 A;  2IYD B;  2V3P A;  3SD5 A;  2G3Q B;  3H9D A;  4MGZ E;  1FEH A;  1VDV A;  4C56 C;  1JWB D;  2MBH A;  1XXG A;  3HUI A;  3KQ4 A;  4LNK A;  4FJZ A;  2NPT B;  3AB5 A;  1HTQ A;  3IFW B;  1YQ4 B;  3P4Q B;  3SDL C;  1WJN A;  4ANX A;  3LJ3 A;  5D94 A;  1KH0 A;  3H7P A;  2IGG A;  4GIV A;  4WWO A;  1ET9 A;  3N1X C;  4XDD A;  1L0Y B;  2K9X A;  2BS3 B;  4ITK A;  1WYG A;  2OED A;  5D6J B;  4EE2 A;  1R4N B;  3N20 C;  3WCQ A;  1WXA A;  4LNF A;  1H8C A;  2H88 B;  4I6P A;  3P4R B;  1E7U A;  3EGR A;  1RAX A;  4JGH B;  1UWM A;  4KKI A;  1V9J A;  3RI7 C;  5EE0 A;  2KZR A;  3CWI A;  3Q2A C;  2N9X A;  3TMP B;  4YT0 B;  2DAF A;  2Y5B B;  1S3S G;  2IBI B;  3LXF A;  2Y5P A;  4EZL A;  2LHE A;  3KWV A;  4NZL B;  3MC8 A;  2PJH A;  2EMS A;  1C9F A;  4FLH A;  4XZ4 A;  3X23 A;  3K9O B;  3V60 A;  3KLS X;  2AWT A;  2LVQ A;  2ZNV C;  3I5J C;  1OGW A;  2JYT A;  1FNV A;  3GS2 A;  1ZDV A;  3WIM A;  3OLM D;  2KNB A;  1N61 A;  3T8M A;  3TSS A;  4WWP A;  4ZHO A;  4IWP A;  2MJ3 A;  3VH3 B;  1XQQ A;  1QIL A;  2V3N A;  1OEY J;  2J52 A;  4HCP B;  2QIE B;  1TT5 B;  3RNF C;  1NDD A;  3PRM B;  1BUI C;  2IGH A;  3ZIM A;  3T3N A;  3TEZ A;  3PZD A;  3VTV A;  4RGT A;  2X38 A;  3ML8 A;  4JWS C;  1XD3 B;  2I38 A;  4HRO A;  2GBK A;  3APC A;  2D3G A;  2BKR B;  4RGO S;  3R2T A;  4GN1 A;  1AAR A;  2M17 A;  4MJS A;  1WR1 A;  1GB4 A;  4BKS A;  4WJN A;  1SB3 C;  3OWE B;  2J0J A;  1AYF A;  5J18 A;  5LXI B;  1NI2 A;  3Q3O C;  2WDT B;  1WF9 A;  1V1P A;  2J7Q B;  2LRW A;  1YOV B;  4RGM A;  4MGK E;  4MDK E;  2KTF A;  3Q8F A;  4II3 B;  4HK2 A;  1V8C A;  4BBN C;  2KJR A;  1ZXI A;  2ZVO A;  4MT5 A;  1WJU A;  4CYE A;  1GJZ A;  2JY6 A;  1TKE A;  2L32 A;  4WJQ A;  4AOF A;  2DWQ A;  4K81 A;  2JZP A;  1L5P A;  2ZEQ A;  3AE7 B;  3DVN V;  3IVF A;  4B9K A;  1WRD B;  4M0W A;  2BS2 B;  2SAK A;  4LJO B;  3VVW B;  3SEB A;  2DEN B;  1VJK A;  5KHO A;  4DXG A;  3EA6 A;  5LXH A;  3ZO5 B;  1YQ3 B;  1Q1O A;  3HRD D;  2D11 A;  1RWS A;  4O1N A;  2V9H A;  3RZW C;  3J9C A;  5C2T B;  2O2V B;  1K50 A;  2C5L C;  5E6O A;  2AYO B;  2LGY A;  2LGX A;  2AL3 A;  3Q14 C;  2Z0E B;  1L0X B;  3U52 E;  2PE6 B;  1JQ4 A;  1T6B X;  1EM7 A;  2BWE S;  3MJ5 A;  2D5G A;  3AEB B;  3FIL A;  2N9E B;  4FAD A;  4A55 A;  3NJT A;  2KDM A;  4L2Y A;  1YN4 A;  1CJE A;  4BFR A;  1KLV A;  1FO4 A;  3GOE A;  2JT4 B;  4XC2 A;  2JF5 A;  2GLS A;  2KMM A;  5LNK 1;  4DBG A;  3DBL B;  1JRO A;  3EEC A;  3W5U B;  1JWA D;  5AZF A;  2H89 B;  4ZYS A;  4ZRJ A;  1WE7 A;  3RNA C;  4DXA B;  1T3Q A;  3N3K B;  3DHG C;  3NVW A;  1E0Z A;  2CR5 A;  1XF5 L;  1TGZ B;  1WXV A;  1IPG A;  2VH1 A;  4I6N B;  3U7D A;  3ZNI D;  3B0A A;  3BVG A;  1TZO A;  1WGY A;  2M0X A;  4US8 A;  1PUT A;  1QOF A;  2IJ0 A;  3P2B A;  2PTL A;  2GRI A;  1VRA B;  2ICI A;  3Q3J A;  2LFI A;  2DAJ A;  4WIP A;  3QWZ B;  2J53 A;  3AEF B;  3APD A;  2HD5 B;  1EWY C;  1E8Z A;  4CHK A;  2JWZ A;  1FMA D;  2OHF A;  1N6Z A;  1FIQ A;  1C77 A;  2BGF A;  1QOG A;  3TEX A;  2C60 A;  3V3X A;  1WE6 A;  1T0S C;  2BQQ A;  1UUP A;  1TJE A;  1V5T A;  3ZJT A;  4HEA 1;  1UGJ A;  3OJ4 B;  1WM2 A;  4J6I A;  3PPA A;  2NBV B;  3B1L X;  1YN5 A;  4RM8 A;  2DLB A;  1CQV A;  4DDI D;  2DZJ A;  4P1B C;  4GMV A;  5IO9 A;  2FAZ A;  4KGT A;  2JPH A;  2IZV B;  2KDB A;  1R4M B;  3QA8 A;  2L76 A;  2LD9 A;  3S2A A;  5CTR C;  2D10 A;  4YXD B;  5EE9 A;  1P3Q U;  1EF1 A;  3ZKJ C;  3AE9 B;  3LB8 C;  1L6V A;  3BZD B;  4EFO A;  1JML A;  1JWM D;  2KC1 A;  4KSL C;  3N1Y C;  2ZZP B;  1P7E A;  1E6E B;  1E90 A;  2R2Q A;  2FUG 1;  4DDG D;  4KDL B;  2ZNV B;  2LRU A;  1Y56 A;  3VDZ A;  3Q8E A;  4A8X C;  2GBJ A;  4YWG G;  4REZ A;  1I4P A;  4BOZ B;  3ZTC A;  3B9J A;  1ZXH A;  1F2R I;  4IC7 B;  4IOI E;  1CMX B;  4KIK B;  3PS6 A;  4M02 A;  2YVC A;  2V3S A;  3KUC B;  5HG2 A;  1LXD A;  3GE3 C;  1OQQ A;  3PRP B;  3R3M A;  4H2A A;  3W1S A;  1FFU A;  2PVO D;  3ECI A;  1YJI A;  1P7F A;  1K52 A;  4P6V F;  4WH4 A;  4C7Y A;  1VZ6 A;  5IP4 D;  2KFK A;  2HTM E;  3IHP C;  4JPS A;  5DPW A;  3DVN U;  2QC8 A;  1SE2 A;  1IBX A;  4TSS A;  2OJR A;  3ZW3 A;  4JQW C;  4ZHP A;  5G5G A;  2W9N A;  1WRI A;  3X0W A;  2ZW1 A;  2IO1 B;  3Q3F A;  1R4N I;  2W3R A;  2JQR B;  2K39 A;  2XK5 A;  2KTR B;  1UNS A;  3VXW A;  3KWL A;  3P42 A;  1TY2 A;  3N1Z C;  2NR2 A;  2MP2 A;  1F0Z A;  3O65 B;  2L3Z A;  3RD2 A;  1MG4 A;  2TSS A;  2ZW0 A;  3JSV A;  1KLU D;  4GDL B;  2NPT A;  3HHM A;  4B0M A;  3AE8 B;  2L83 A;  3C8Y A;  1M94 A;  3P1M A;  2CS4 A;  4BKS D;  2C7H A;  4P16 A;  5HKH A;  4YTN B;  3WAP A;  1PQS A;  1WXS A;  2ZJD A;  3HVD A;  3AEC B;  1X1M A;  3DBR B;  1N5W A;  1DOY A;  4QAY A;  2MEK A;  4PYZ A;  3EFC A;  2MJE A;  1XCQ L;  3DDC B;  3QHT A;  1D6E C;  2KMC A;  5G5H A;  3L4P A;  3B2F A;  2BB5 A;  2LEK A;  1TS2 A;  1ROE A;  1AW7 A;  3VAW A;  3DWM A;  3DWG C;  4PK1 A;  3UIN B;  3BYY B;  3CIR B;  2KKC A;  2W55 A;  5DPT A;  2N7J A;  1SJH D;  3UIP B;  4F7Z A;  4P7I A;  4RF0 A;  1GOZ A;  3MC0 B;  3Q69 A;  4IWQ A;  2KDI A;  1EO6 A;  1UZX B;  1L0V B;  3RMK C;  3IXS A;  4W9K A;  2KLC A;  3AUL A;  5AUK A;  2MCN B;  5TSS A;  2WXQ A;  1GC6 A;  5DCN A;  3TCA A;  3AI5 A;  1XLQ A;  4M00 A;  4GOC A;  5KHQ A;  1TBE A;  4F1S A;  4EZK A;  2W3S A;  2INC C;  4J3O D;  2Z8L A;  1C4P A;  2WP9 B;  1DOX A;  4GU2 A;  2IY1 B;  3QQ8 B;  1SBB B;  3VRB B;  1BXT A;  1STE A;  4GDK B;  2KQ7 A;  3A33 B;  4JIO U;  4ACF A;  4W9E A;  3GP7 A;  2MQJ A;  3LYY A;  1LM8 B;  3BII D;  4ARC A;  2RPQ A;  4NJ6 A;  1FRD A;  5JZE B;  4B6W A;  2WXI A;  3TEW A;  4W9D A;  4E74 A;  4HLE A;  3BVM A;  4NQL B;  2KOX A;  3Q8B A;  2LGS A;  2D3C A;  2QMT A;  5EDS A;  1WMH B;  1ZW7 A;  3E56 A;  3P4P B;  4AJY B;  4WAF A;  1J19 A;  2IGD A;  4EOY A;  1QQR A;  3SFD B;  3UIO B;  1FM0 D;  1TS3 A;  2BF8 B;  3NVV A;  1P0R A;  4BAX A;  3NY5 A;  3IAS 1;  2MSE D;  4G3X B;  5EE3 A;  1MHX A;  1NEK B;  5CHF A;  1RYJ A;  3BY4 B;  1P98 A;  3VH4 B;  3Q8C A;  1HZ5 A;  3OG5 A;  4HVB A;  1WGG A;  2IO0 B;  5GMV A;  3RNG C;  3L54 A;  2BWF A;  1ZPS A;  5AZH A;  3VQI A;  1SJE D;  2Q5W D;  3HK0 A;  1Y8R C;  1EWC A;  2RD0 A;  4CO7 A;  2JZZ A;  3MFG A;  4PS8 A;  1DOI A;  1ZDX A;  2C9W B;  1FNU A;  1IP9 A;  1ZUD 2;  1R7S A;  4ANW A;  1JRU A;  2V1Y A;  3N32 A;  3D32 A;  2MHJ A;  3AEG B;  4K3C A;  3AV8 A;  4IM2 A;  2AQ2 B;  2WXH A;  1FPY A;  4BKG A;  1YQB A;  4LCD E;  3PT2 B;  2BYF A;  1YN3 A;  2O2V A;  4LDT D;  1V5O A;  3AE4 B;  2AL6 A;  3ZRF A;  4HWI B;  3GZN B;  1ZOY B;  2NMQ A;  4TQ0 A;  2OJW A;  3BWU D;  2EEL A;  3QC8 B;  3H1U A;  4IG7 B;  4HRS A;  2KDF B;  2J4X A;  3L17 A;  5G55 A;  3CMM B;  3SFE B;  3ZDT A;  1QLB B;  4DK5 A;  4N9F 4;  3BK2 A;  3A9J A;  3M63 B;  1YX6 B;  1N60 A;  3HM3 A;  5E6J A;  3AU4 A;  2KFJ A;  3H7P B;  3K9P B;  1WGK A;  1WX8 A;  4MGI E;  1SF0 A;  2B3A A;  5C23 A;  5FR6 A;  5IOI A;  4EUT A;  2V4L A;  4B0E A;  2HJ1 A;  5I4D A;  5BYR A;  1WI0 A;  4A90 A;  4YTM B;  1GUA B;  1UBQ A;  4S17 A;  3A1Q A;  2QIL A;  2JU6 X;  2WXP A;  2D3B A;  5BYQ A;  2L52 A;  2FCN A;  4XWT A;  4S0R A;  4RF1 A;  1LGR A;  1VLB A;  1B9R A;  1KJT A;  5DPR A;  1NEN B;  2D2Q A;  1FRR A;  4PYU A;  1XT9 B;  4GB9 A;  2A5U A;  3W2D A;  4ASW C;  1VCB A;  4IM0 A;  1JRP A;  2K8C A;  2NVU I;  2C7M B;  1E9M A;  3ALB A;  1Z2M A;  1HEZ E;  4HPM B;  2RMM A;  4HPL B;  1EF5 A;  1RM6 C;  1R4M I;  2KC2 A;  2PLP A;  1OFF A;  4FUL A;  3RNB C;  3VR9 B;  4JE3 B;  2LXC A;  1KTK A;  1T5X D;  3ZLZ A;  2L7R A;  1C4A A;  4LTU A;  5L83 A;  3HM6 X;  3QIJ A;  1C76 A;  1D3Z A;  1MJD A;  4Q2J A;  5EE1 A;  2KN5 A;  1OQY A;  1XLN A;  3RFZ B;  4UDU C;  3W1S C;  1UH6 A;  3PLU A;  3QAQ A;  3E9S A;  4LJP B;  4L1B A;  2N9L A;  1C79 A;  4W9L A;  4GGQ A;  4C4V A;  1M4V A;  1VZ8 A;  4EKU A;  2FNJ B;  2DZM A;  3OJ3 A;  1N5X A;  2CHW A;  1HZ6 A;  4NPN A;  4M8N A;  4L23 A;  5LLI A;  3ZNH B;  2CU1 A;  2N4F A;  2WWZ A;  4WQO B;  3O13 A;  3NHE B;  1WGR A;  2ZVN A;  3GB1 A;  2FBW B;  2ZPN A;  3QCA A;  4BKT A;  5AZG A;  2GB1 A;  3VTU A;  2CHZ A;  3RNC C;  1AWD A;  1F2R C;  5J2R A;  1WJ4 A;  2AQ1 B;  3GE8 C;  1KF6 B;  2D07 B;  1E8W A;  1ZGU B;  1WM3 A;  1VZ7 A;  2JRI B;  1UBI A;  3TUO A;  4MM3 A;  2A4Z A;  3RCZ A;  3U30 A;  2UYZ B;  1V1P B;  3DCG A;  5D2M B;  3L08 A;  1YNT E;  3PV1 A;  4NAW A;  1K53 A;  2KK8 A;  3PGE A;  3VHT C;  3QAR A;  1N62 A;  2K0P A;  2MBQ A;  1DGJ A;  3ZDM C;  3JYU A;  4GLS C;  2KYW A;  2LGD A;  3C19 A;  2PPH A;  3IG3 A;  3Q6B A;  4KIK A;  1C3T A;  3KUZ A;  2K25 A;  1MG8 A;  3RNE C;  3N30 A;  2NBU A;  1F9J A;  2KXJ A;  1HE8 A;  4M0W B;  1FXI A;  2EKE C;  2WXK A;  4MEM A;  2W54 A;  4P1C C;  4KV2 A;  4DXF A;  3TEY A;  2LAS A;  2KAJ A;  3TJP A;  1FNW A;  5IN7 A;  4XGA B;  2LJI A;  4WQM A;  2ZCC A;  1TKG A;  1V80 A;  1TTN A;  5JH5 C;  2IY0 B;  3DOW A;  2GBN A;  3DBR I;  4N59 A;  1QF6 A;  4KX6 B;  2LUE A;  3ZXV A;  3U8Z A;  2VH2 A;  1SXT A;  4URK A;  3L10 B;  3PHW B;  4BZA A;  3NUH B;  3KW5 B;  2CHX A;  2O6V A;  3FIL B;  1ACC A;  1JAL A;  5C1Z A;  4WUR A;  1WYW B;  2LI5 A;  2Y5C A;  2JUO A;  3A9K A;  4ZYN A;  4OZB A;  2XBB C;  1L6U A;  3BK1 A;  3B2G A;  3R7Q A;  4FHJ A;  2PVG C;  2BPS A;  1SGH A;  3AM9 A;  1I4Q A;  4N58 A;  4XWW A;  4HDO A;  3MHZ A;  2GBR A;  1IYF A;  1I42 A;  1V1O A;  1KOT A;  2RSU A;  3ZTD A;  2BB6 A;  1OQR A;  3AN1 A;  4D2K A;  2JXX A;  1HQR D;  3FC4 A;  3PRE A;  1YIW A;  2MJD A;  4LNO A;  1C1Y B;  4RFB A;  2LVO A;  1EU3 A;  2CKH B;  1NI3 A;  1EUV B;  4G11 A;  3B08 A;  1VR9 A;  3PZ8 A;  1IUE A;  4ZDV A;  4ZOH C;  4DHJ D;  1WWT A;  2MRP A;  2LUM A;  2SEB D;  1IGD A;  3T3O A;  2ACZ B;  2PKO A;  3M62 B;  4DWF A;  1K51 A;  3AE5 B;  2FUH B;  4OZA A;  3I9V 1;  4LK0 M;  2V0G A;  2L1A A;  2WHI A;  1T0Y A;  3AED B;  2JRH A;  2WDR B;  2E3T A;  2HE7 A;  1WX9 A;  1PFD A;  3L0W B;  3JW0 X;  2JXT A;  1JW9 D;  2K6Q A;  4IKG A;  2KDE B;  3DBH B;  2PE9 A;  2RR9 A;  4NY0 A;  1B1Z A;  3KH0 A;  3PHX B;  4G50 A;  2KX3 A;  3IT4 B;  5JHA A;  3HIZ A;  3VUY A;  2BYE A;  2MLB A;  4YSX B;  2KAN A;  2MBE A; 
#chains in the Genus database with same CATH homology
 3Q8F A;  3E56 A;  3P4P B;  4DQO C;  3AE1 B;  2WXG A;  1ZXI A;  4MT5 A;  2DBY A;  4WAF A;  2IGD A;  4CQN A;  1QQR A;  3SFD B;  2QEJ C;  5H92 C;  1FM0 D;  2IDY A;  1TS3 A;  1TKE A;  2L32 A;  3NVV A;  2R61 A;  2DWQ A;  3HVZ A;  3IAS 1;  2JZP A;  1L5P A;  5EE3 A;  2G1E A;  3AE7 B;  1NVI D;  1MHX A;  1AN8 A;  4M0W A;  1NEK B;  2BS2 B;  2WU2 B;  2WXL A;  2CJO A;  1LO5 D;  2SAK A;  1A70 A;  3SEB A;  1RYJ A;  1VJK A;  4DXG A;  3EA6 A;  4TQ1 A;  4FXC A;  3Q8C A;  3URY A;  1HZ5 A;  1YQ3 B;  1HXY D;  1PGB A;  3HRD D;  2WLB A;  1RWS A;  1DYQ A;  4O1N A;  3UI3 A;  1TS4 A;  2JWU A;  3J9C A;  5FK9 C;  5C2T B;  1K50 A;  5D3D A;  1ZPS A;  4YTP B;  3VQI A;  1SJE D;  2KN4 A;  2Q5W D;  1MI0 A;  1PDX A;  2PIA A;  1EWC A;  1KFY B;  3AE3 B;  1L0X B;  3U52 E;  5T8I A;  1J7A A;  5FR3 A;  2N0S B;  1JQ4 A;  1T6B X;  1EM7 A;  1F77 A;  3MJ5 A;  5FKA C;  2KWD A;  2WNM A;  3MFG A;  3ZJU A;  1DOI A;  1ZDX A;  2D5G A;  3U4E G;  1D5X C;  3AEB B;  1FNU A;  3FIL A;  4RH6 A;  1ZUD 2;  3AE2 B;  2CU3 A;  4A55 A;  1R7S A;  2JSV X;  2M0A A;  2KDM A;  3AEG B;  4L2Y A;  1YN4 A;  1CJE A;  4ZRQ A;  3AV8 A;  4RNA A;  1FO4 A;  2AQ2 B;  4A6Q A;  2WXH A;  2WDV B;  2KMM A;  5LNK 1;  1YN3 A;  1JRO A;  3PO0 A;  3W5U B;  3AE4 B;  2I2Y A;  3ZJV A;  2VZK B;  4HKQ A;  1JWA D;  2K5P A;  1ZOY B;  2NMQ A;  2H89 B;  4YSY B;  4TQ0 A;  1J7C A;  4MM3 B;  4RGN A;  3BWU D;  2DYM A;  2JX5 A;  2EEL A;  4ZYS A;  1BML C;  4NAW B;  1NYR A;  4HRS A;  1XO3 A;  2E6X A;  2J4X A;  1FFV A;  2ONQ A;  4XE0 A;  1T3Q A;  1IBX B;  2DYO A;  4IDI A;  1SSN A;  1FCC C;  2IPK D;  3SFE B;  1QLB B;  2HDE A;  1ZP0 B;  3NVW A;  1E0Z A;  3BK2 A;  3R2I A;  1XF5 L;  1N60 A;  5E6J A;  3BVG A;  1TZO A;  1ESF A;  2K22 A;  1I4H A;  4US8 A;  1WGK A;  2GI9 A;  2AQ3 B;  4NJC A;  1TS5 A;  1PUT A;  1SF0 A;  4R3D A;  4C7Z A;  3P63 A;  1QOF A;  2IJ0 A;  3RPF C;  1WSP A;  4B0E A;  2PTL A;  2GRI A;  3PZ7 A;  1VRA B;  2ICI A;  5BYR A;  5I4D A;  4A90 A;  4YTM B;  2LFI A;  3U2S C;  1GB1 A;  1CZP A;  3NRZ A;  1C4C A;  2N9K A;  1RFK A;  2QIL A;  4WIP A;  3BVZ A;  2JU6 X;  2LGI A;  5HHD G;  2WXP A;  4YSZ B;  2RDG A;  2J53 A;  2L52 A;  2VZK D;  3AEF B;  5BYQ A;  1NYQ A;  2BT6 A;  4XWT A;  2RPV A;  4RF1 A;  1VLB A;  2WXF A;  1B9R A;  1NEN B;  1E7P B;  1EWY C;  2WXR A;  1FRR A;  4NAM A;  1FMA D;  1I4X A;  2ON8 A;  2OHF A;  5BMI A;  1FIQ A;  2J42 A;  1MPE A;  1I7H A;  2MH7 A;  1C77 A;  1PGA A;  4MH8 A;  3W2D A;  1QOG A;  3TEX A;  1V97 A;  1JRP A;  5H8Y E;  3W5V B;  3IAM 1;  1QOB A;  4LLG M;  3V3X A;  4KKJ A;  5GXG B;  1E9M A;  3VRA B;  4RCO A;  2JYE A;  4AS1 A;  1UUP A;  1TJE A;  4A9A A;  2W82 A;  5AUI A;  3ZJT A;  1SE3 A;  1HEZ E;  2RMM A;  4HEA 1;  1UGJ A;  1RM6 C;  1SIJ A;  2PLP A;  3VR9 B;  1OFF A;  4ZRP A;  4JE3 B;  3NVZ A;  1TYG B;  3ZYY X;  5HFY A;  1QOA A;  1KTK A;  1T5X D;  1D4B A;  1YN5 A;  1D5M C;  1CQV A;  2DLB A;  2M56 B;  5D3I B;  1C4A A;  4LTU A;  1D5Z C;  1MVK A;  2KQ4 X;  1GAQ B;  1C76 A;  3R8B A;  2BYT A;  4KGT A;  4Q2J A;  2KAC A;  5BMG A;  5EE1 A;  2G9H D;  2WXJ A;  2QSD A;  2BBC A;  1XLN A;  1SEB D;  3MP9 A;  3RFZ B;  4UDU C;  1YMH E;  2XN9 C;  4YXD B;  1ZE3 D;  3AEA B;  5EE9 A;  3E9S A;  3AE9 B;  3LB8 C;  4L1B A;  1L6V A;  2N9L A;  1C79 A;  3BZD B;  5C3J B;  1M4V A;  1VZ8 A;  4OZC A;  5HI1 A;  1JML A;  1JWM D;  4OVZ A;  1N5X A;  1HZ6 A;  1FXA A;  2BW2 A;  3I57 A;  2WQY B;  4L23 A;  1P7E A;  1E6E B;  2QJL A;  2AX5 A;  2V4I B;  4TMA B;  1C78 A;  2FUG 1;  5BYS A;  1TKY A;  3O13 A;  3ABV B;  3Q8A A;  5D7G A;  3GB1 A;  2FBW B;  1WXQ A;  3W9C B;  2NTS A;  1Y56 A;  3V05 A;  2YEP B;  3Q8E A;  4A8X C;  4C80 A;  4YWG G;  4KGR A;  2LHD A;  1GPX A;  2PW9 A;  4REZ A;  4US9 A;  1CK1 A;  2GB1 A;  1I4P A;  3P4S B;  3B9J A;  1QT9 A;  1AWD A;  1F2R C;  1F2R I;  1ZXH A;  2INN E;  3BYT B;  3FAH A;  4JWU C;  4IOI E;  1Q10 A;  2AQ1 B;  1I4G A;  2WDQ B;  1KF6 B;  4XDC A;  5HG2 A;  4N6E B;  2WXO A;  1L4D B;  3NVY A;  1OQQ A;  1VZ7 A;  4H2A A;  3W1S A;  1FFU A;  2RDH A;  3TUO A;  2PVO D;  1YJI A;  2V3P A;  1P7F A;  1K52 A;  4P6V F;  4WH4 A;  4C7Y A;  1VZ6 A;  2WU5 B;  1V1P B;  1KLG D;  1YNT E;  2HTM E;  3ZGZ A;  1FEH A;  1K53 A;  4JPS A;  1VDV A;  1KRH A;  4WWM A;  2K0P A;  1N62 A;  4C56 C;  3ZQ4 A;  1JWB D;  1DGJ A;  1SE2 A;  1IBX A;  1XXG A;  3HUI A;  4TSS A;  1PGX A;  4GLS C;  3KQ4 A;  2WS3 B;  3AB5 A;  4ZHP A;  5G5G A;  3H8H A;  4PT5 A;  1WRI A;  1YQ4 B;  3P4Q B;  2ZW1 A;  2W3R A;  1KH0 A;  2JQR B;  3AMZ A;  1FXI A;  2IGG A;  2WXK A;  2W54 A;  1UNS A;  1ET9 A;  4XDD A;  4DXF A;  2K9X A;  1L0Y B;  3NZ3 A;  3KWL A;  3P42 A;  3TEY A;  1TY2 A;  3N9Y C;  2BS3 B;  2KAJ A;  1F0Z A;  4ITK A;  1WYG A;  1FCL A;  1FNW A;  2K3U A;  2OED A;  4EE2 A;  3SR6 A;  4HKZ E;  2LJI A;  4WQM A;  1TKG A;  3WCQ A;  2TSS A;  2LMC A;  1ENF A;  2ZW0 A;  2H88 B;  1KLU D;  3P4R B;  5BMH A;  3EGR A;  1IGC A;  4GDL B;  1UWM A;  4B0M A;  4KKI A;  5EE0 A;  3AEE B;  4N59 A;  3AE8 B;  2L83 A;  3C8Y A;  3P1M A;  3CWI A;  1UWX A;  1QF6 A;  4KX6 B;  4P16 A;  4YT0 B;  4YTN B;  1SXT A;  3NUH B;  3LXF A;  2Y5P A;  3HVD A;  3AEC B;  3FIL B;  2LHE A;  3KWV A;  1ACC A;  1PYW D;  1N5W A;  1DOY A;  1JAL A;  2MEK A;  4NZL B;  2FE8 A;  4WUR A;  2Y5C A;  2MJE A;  3NS1 A;  1XCQ L;  1ET6 A;  1C9F A;  1MHH E;  1D6E C;  2B76 B;  4OZB A;  1L6U A;  3KLS X;  3BK1 A;  1XCT L;  3B2G A;  5G5H A;  2PVG C;  3AM9 A;  1I4Q A;  3L4P A;  4N58 A;  4XWW A;  3B2F A;  5MPO A;  1TY0 A;  3MHZ A;  1E10 A;  2BB5 A;  2WXN A;  2LEK A;  1FD6 A;  1TS2 A;  4AQ7 A;  1ROE A;  1AW7 A;  1V1O A;  1QKZ A;  3DWM A;  2JYT A;  3DWG C;  1FNV A;  3GS2 A;  2BB6 A;  1OQR A;  2WXM A;  3BYY B;  1ZDV A;  2W55 A;  3CIR B;  1YJJ A;  3AN1 A;  4D2K A;  1XLO A;  1J7B A;  1HQR D;  3FC4 A;  1N61 A;  2N7J A;  1SJH D;  4HJG E;  3TSS A;  1XLP A;  2MJD A;  1L4Z B;  1XEE A;  3AE6 B;  4ZHO A;  4RF0 A;  4RFB A;  2MJ3 A;  1EU3 A;  1GOZ A;  3MC0 B;  1I4R A;  3Q69 A;  1NI3 A;  3ETR A;  1QIL A;  1VR9 A;  2V3N A;  3U7Z A;  3PZ8 A;  1IUE A;  4ZOH C;  2INP E;  2M19 A;  2CJN A;  2J52 A;  1L0V B;  1JCK B;  1WWT A;  2NTT A;  2QIE B;  2EKI A;  3IXS A;  4USA A;  3VR8 B;  2LUM A;  2SEB D;  1BUI C;  2IGH A;  1IGD A;  3T3O A;  2BTE A;  5AUK A;  5TSS A;  2ACZ B;  2WXQ A;  2PKO A;  3T3N A;  3TEZ A;  1XLQ A;  4RGT A;  1K51 A;  2X38 A;  3AE5 B;  3EUB 2;  1JWS D;  4JWS C;  2W3S A;  3IT6 B;  3I9V 1;  4OZA A;  5JXV A;  4LK0 M;  2I38 A;  2V0G A;  4HRO A;  2L1A A;  4J3O D;  2XNA C;  2Z8L A;  1C4P A;  2WP9 B;  1DOX A;  3AED B;  2YEP F;  1EU4 A;  1HA5 A;  2WDR B;  1SBB B;  2E3T A;  3VRB B;  1BXT A;  1STE A;  1SE4 A;  4RGO S;  4GDK B;  1PFD A;  3R2T A;  4MAC A;  4OW0 A;  2BS4 B;  3GP7 A;  2JXT A;  3LYY A;  3BII D;  1JW9 D;  4OHJ A;  4ARI A;  1GB4 A;  4IKG A;  4ARC A;  1JWU D;  3AH7 A;  1SB3 C;  1FRD A;  1N63 A;  2WXI A;  3OWE B;  2PMV A;  1AYF A;  1B1Z A;  3TEW A;  4JX1 C;  3IT4 B;  2Y3A A;  3BVM A;  4KGS A;  1V1P A;  3Q8B A;  4YSX B;  4RGM A;  2QMT A;  1V8C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...