3NAPA

Structure of triatoma virus (trv)
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
264
structure length
264
Chain Sequence
VGFASAGTRDIRSSYVEGKFIPQDITGMSRNHELDEQPSQECIGERILSFSELIKRNSWRYVSDEKSLIYPAYAFDNPAAMYTAADKLPVWTLTPRSGFPTLLTSIGAMYAFYRGGIRLKIVPGVADQPKPLVEVALFTMQDQGYIIKANDYSTDFCSSNIYENFVTKGIAEVQTPYYSRVNTSVVSAPVLYNAGNISPLMPNVMYKITSNSSNILLGHSAADDFRFGFLLGAPLAISATALRDNFTGSSATVSLPTFSNFYLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystallographic structure of Triatoma Virus (TrV) highlights the Dicistroviridae and Picornaviridae family differences
rcsb
molecule tags Virus
molecule keywords Capsid protein
total genus 52
structure length 264
sequence length 264
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08762 CRPV_capsid CRPV capsid protein like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3napA00
1K5MC 3JB4C 1C8NA 1OOPA 2RS51 1QJY3 3VBOC 5FOJB 3VBRB 4Q4V3 5L7OB 4WM7A 1X36A 2RS31 3NAPA 1HX6A 5D8AB 2QQPA 1HRV3 1K5MA 1AL23 4RQPC 1MQTC 3VBOA 1RVF3 4QPIB 1HQNA 1RUH2 4WM7C 4CEWC 3NAPC 2R043 4Q4W3 1ND2B 1PGL2 4YVWA 4RQPA 4JGZB 1ZBA3 3VBUB 4CEYB 1NCRC 3S6PA 4SBVA 1RUH3 1RVF1 3VBUC 1AYM3 1QJX3 1DDLA 5CFDA 2WFF2 2HWC3 4RS5A 3VBFA 1BBT2 2HWE2 2HWD1 1VBC3 2HWF1 1FOD3 5CFCA 3JB8A 4RHV1 1AR61 1VB2A 1PVC3 1EAH2 4QPGB 4GMP0 4RS5C 1HXS1 3VBFC 1A6CA 3JBG1 4GB33 4CDXB 1AR63 1FOD2 1VBC1 1PGW1 1VBE1 1QJU2 1QQP2 2R072 2WS91 2RR12 3DPRB 3ZFEB 5K0UB 1RUI2 4CDQA 2HWC2 5BNNC 2WFF3 1H8TA 1RUC1 4AEDA 1VRH2 5BNPA 1AYN3 5CFCB 2WS93 3CJIC 3NAPB 5JZGA 2X5IB 1VBA1 1MQTB 1RUI3 2FZ2A 5A33A 1PO13 1VBD2 1ZBE3 2R042 5L7OC 1ZBA2 1W39A 1MEC3 2RM22 1RUD3 1TMF1 1M06G 1R1A1 3VBHB 1EV11 1MEC1 1COV1 1IHMA 4Q4X1 1ZBE1 2RMU2 3JD72 4IV1B 2RM21 2ZTNA 2WWSA 4FTEA 4N53A 5ABJC 3IDEA 4YVSC 1COV3 1B35A 1R1A3 1RMU2 1EV13 1ASJ3 1Z7S3 5C4WB 2RM23 4WM8B 2HWB3 1V9U2 1B35C 1VRH1 1RUJ1 4JGYA 1QJZA 4FTBA 4RR3A 5C8CB 2PLV2 1PO22 4Y4YA 1QJY1 2WS92 1NY71 1NY72 1PGW2 1R081 1PO21 4WM8A 4RR3C 1AL21 5J96B 1FPN3 5C8CC 4N43C 1RUJ2 1RUE2 1FMD1 4GMP3 4Q4W1 4WM8C 4RHV2 2HWD2 4CDWC 4YVSB 1GFF2 1V9U3 3ZFFC 1RHI3 1FPN1 5K0UA 1QQP3 5ABJB 1NCQB 3VBSA 2BPA2 1ASJ2 2RMU1 1AR91 5BNOA 1D4M3 4Q4X2 1COV2 3ZFFA 2RS33 1Z7S2 3VDDA 4IV3B 4IV3C 1EV12 1C8M1 1AR73 5FMOL 1C8M2 5ACA2 1R1A2 3VBSC 4PDWC 2RMU3 2HWE3 1BBT3 1VBB3 2BFUS 1AL0G 1VBA2 4CDWB 5DDJ1 4Z92B 1OHFA 2X5IC 4Q4W2 1FMD3 5C9AA 4N43B 1RUE1 4CDUB 5D8AA 1RUC2 4BCUA 5GKAC 2RS52 2RR11 1R082 2HWF3 1RUC3 1QQP1 1ND3B 4YVWB 1VBE2 1FOD1 1VAKA 5C4WA 3JBG3 3ZFGA 2WZR2 4LLFA 3VBFB 1OOPC 1AR62 4FTSA 1QJU3 5C4WC 5DDJ2 3JD73 5ACA3 1RMU1 3ZFGC 1BBT1 2HWE1 2ZAHA 1AR82 1EAH3 4IV1C 3JD71 4Q4X3 1F2NA 5DDJ3 4YVWC 5ACA1 1NG0A 1RUF1 1RUE3 2Y26A 1Z7S1 4EJRA 1TMF2 1AR92 1ASJ1 1NCRB 4GH4B 1PIV3 1VRH3 1BEV1 4WM7B 1MQTA 2IZWA 3VBUA 1FPN2 3M8LA 1BMV1 1RUJ3 4CEWA 1RUF3 5CFDB 2WLPA 2MEV3 3J8F3 5CFDC 4QPIC 3VBRA 1CD3G 5BNPB 1RB8G 4RQPB 2HWB2 1NCRA 1FMD2 5CFCC 1BEV3 4QPIA 1AL22 1SMVA 2PLV3 3VBRC 3ZFEC 1RUI1 4PDWB 2R071 3LOBA 5A32A 1HRV2 3DPRC 1QJY2 4CDXC 2PLV1 3ZFEA 3JBG2 2FZ1A 1HXS2 1V9U1 3DPRA 3TN91 1AR72 1WCDJ 4CDXA 4RS5B 5A32B 5AC93 2BFUL 2HWF2 5BNPC 1RUD2 3CJIA 4RFT0 1R083 4NWWA 3TN93 1R092 1RUG2 1POV3 3J8F1 2BBVA 1ZBE2 4JGZA 1MEC2 1CJDA 1ND3C 4GMP1 4CDQC 1VBD3 1RVF2 5BNNA 1POV0 1TME3 1H8TC 4AEDC 2MEV2 3ZXAC 4JGZC 1NOVA 1VBB2 1RHI1 1AYN2 5C9AB 1ZBA1 5JZGC 1ND3A 2R041 1AR93 1VBD1 1PVC1 1ND2C 1RUH1 1PO23 5FMOS 4CEWB 4N53C 5ABJA 4YVSA 5L7OA 1C8M3 2DF7A 1OOPB 1ND2A 1PVC2 1OPOA 4Q4V1 2HWC1 1RHI2 1VBB1 4GB32 1K5MB 1NA1A 4JGYC 3VBHC 4RHV3 2ZZQA 3FBMA 1QJU1 2HWD3 1VBC2 1POV1 1D4M1 3J8F2 1NCQC 1NA1C 3VBHA 1R091 4Q4Y2 4Y5Z0 4CDUC 1TME1 1EAH1 1AYM2 1QJX2 1VBE3 2XPJA 1PIV2 4N43A 4GH4A 1RUD1 1NCQA 2R063 1AYM1 1QJX1 1TME2 2WFF1 4CDUA 1R093 1NA1B 2RS11 4CDWA 4GH4C 4RR3B 5K0UC 1RMU3 3VBSB 2R061 1HXS3 4QPGA 5AC92 5BNOC 5C8CA 1VBA3 3VDDC 4GB31 5J98B 2RR13 4FSJA 4Q4V2 1PO11 1PGL1 1F8VA 4QPGC 2HWB1 3ZFFB 4N53B 3ZFGB 3HAGA 2BUKA 1HRI3 1BMV2 2RS32 5JZGB 1BEV2 1AUYA 1PO12 5LK7B 2X5IA 4IV3A 1AYN1 4CEYA 5C9AC 5BNOB 2RS53 4PDWA 2MEV1 1HRI1 2XBO3 3VDDB 4CDQB 5AC91 1X33A 2R062 1RUF2 1H8TB 4AEDB 5A33B 2RS13 4CEYC 2GSYA 2XBO1 1RUG1 2RS12 1TMF3 1E57A 1AR81 1B35B 2R073 2TBVA 4Q4Y3 5D8AC 1RUG3 1PIV1 3CJIB 2GH8A 1AR71 3TN92 4Q4Y1 2WZR1 3VBOB 5BNNB 1VB4A 2XBO2 1AR83 1D4M2 4NWVA 4IV1A 4JGYB 2WZR3 1HRV1 1HRI2 2VQ0A
chains in the Genus database with same CATH superfamily
4L97A 4CCMA 1K5MC 2JE8A 2ZX1A 1ZM1A 2RS51 4XMAA 4NPMA 3VBRB 3S5AA 4EN8B 1JU4A 1MS4A 2GU9A 2QQUA 2YBPA 3I59B 4RSUA 4YZ4A 1HX6A 2A3WA 5D8AB 2W47A 1WCKA 1HRV3 1HN0A 3I2DA 1YQ5A 3IPVA 5FYMA 1W6NA 2VH9A 3B93A 1EPZA 1RVF3 2DUOA 3OGVA 1LOEA 5FV3A 4QAWA 5KHGA 4FQ4A 1A34A 2XDVA 4LKDA 1ZNPA 1YFWA 2R043 3B9IA 5JUVA 1ND2B 3DECA 4CPBD 5T55A 3W20A 1GZWA 4MOAA 2CDPA 4JGZB 3PJYA 3CLPA 2A3YA 5EJ3A 1NLRA 1S0EA 4CEYB 3TBDA 5KXEA 2XMLA 1OKOA 3PJQA 3NKGA 1LNSA 2P5BA 1LRHA 4K8FA 2P3IA 4LHSA 4EV0A 3H8RA 5F3IA 2HEVF 4OI0A 2P6CA 3OGGA 3UJQA 2F4PA 3JQWA 5FZ4A 4DY5A 4GZ9A 3OGRA 2P2KA 3AZWA 4R4ZA 3AP6A 2LS6A 1QKQA 1SFNA 3WOGA 4AHWA 4SLIA 1OI6A 1H2KA 2B5HA 2HWD1 2ZACA 3NNFA 2ZKNA 1IKPA 2ENRA 3S5QA 4CU8A 1U0AA 5CFCA 4RHV1 1IQDC 1QNWA 1C57A 4Y4RA 1AR61 4XFIA 3Q8EA 4WVMB 4LO4B 5FWEA 4CCJA 2PTMA 3ETPA 3VBFC 1A6CA 5A7WB 1H4GA 3LE0A 2DURA 2XUEA 2QQVA 4CDXB 5J3UA 1L7RA 3QH6A 3MI8A 3M1HA 4ZPIA 2WWJA 3AZYA 1QJU2 1LODA 4NIHA 3ZN6B 1OLMA 5FP9A 3SH3A 1O4ZA 1GU3A 3NQHA 4AAXA 1RUI2 2Z42A 2HWC2 3MW2A 3SITA 2A5ZA 4LBNA 1VRH2 2WN2A 4MYEA 2WFPA 1BXHA 4XFBA 2Y34A 3CJIC 5T5JA 4N7IA 4UBGA 4COVA 1GYKA 1C5IA 1W2AX 2VBBA 5M0TA 3ES1A 1VBA1 3LEKA 1MQTB 1RUI3 2ARXA 4E8DA 3KV5A 2WYSA 4XCBA 5DZGA 3AMHA 1WLWA 1F5FA 2AACA 3LB9A 2QQKA 2VW2A 5A33A 5T5LA 3WSOA 2A1XA 1AZDA 1PK6C 1SZBA 4K20A 1NXD1 1C28A 2ES3A 2J1VA 2RDQA 3EO6A 3LA2A 5IW0A 1ENXA 5ANQA 3F95A 1EYBA 4FPJA 1L7QA 3VL9A 1M06G 2X09A 3RZGA 1R1A1 4R4XA 3TWIA 3APBA 1EV11 5JSOA 3GZAA 1MEC1 4GJYA 3BTAA 1OT5A 3MIHA 3PTYA 4NAMA 4NIAA 2RM21 2ZTNA 3FJSA 4JQRA 2BV4A 3UJOA 1LGNA 1N3QA 2HLEA 5JWPA 4OHVA 1EUUA 3IDEA 3K3OA 1N1YA 2AH2A 1DFQA 3FZ3A 4YVSC 1KS5A 1YI9A 3SXWA 4NIGA 4Q1RA 1R1A3 5LK5A 1RMU2 1EV13 4HSJA 4KI5M 2JJ6A 4MUVA 2Y8KA 1QY4A 5FBZA 1UY1A 4FSJA 4CPBA 1UU5A 3AVRA 3SEPA 3GBGA 4QX0A 5C4WB 2RM23 3CJXA 3EYPA 4LUKA 4LA3A 1H6YA 2V4VA 2HWB3 3IZOA 5A1LA 1V6IA 2QKDA 3MF6A 1QJZA 3AL5A 4JGYA 4YW6A 4CP0A 1U5YA 2QQNA 3LA3A 4QGLA 2OQ6A 4RR3A 1HIXA 3GXUA 5C8CB 3BIEA 4BQYA 4NPLA 1EY2A 2RJ2A 3MIBA 5FRAA 2DDUA 2ZMNA 1NY72 1PGW2 1MZ6A 2W1WA 4QD2A 4QQ2A 2B46X 2J7MA 3NKTA 3H1MA 3U78A 3J26N 1I9RA 1XE0A 2XKPA 1XOYA 4MO3M 1REDA 1AL21 1JN2P 2VY0A 2W1UA 2ZOEB 4HVRA 1XQNA 5DAQA 3WW1A 4DINB 4F3JA 5C8CC 4TLFA 3ST7A 5LRSA 4MHRA 5JLVA 4UFJA 5LA0A 1WW6A 4Q4W1 4WM8C 2WNVA 5H9SA 1OQEA 4ARXA 4EZHA 4GAZA 3AZXA 4RHV2 4BB3A 2PAKA 3UNPA 3QCWA 1J1LA 2OIIA 1WCSA 2B9UA 1UQXA 1GFF2 2HEYF 4M3CE 5CKQA 1UXXX 2Y6HA 4UFMA 1RHI3 1A8MA 2NLRA 3FC0A 3LKJA 4Y1YA 3P1IA 2VOWA 2F4LA 3ZDSA 4O9EA 2BPA2 1ASJ2 4K21A 1ZRIA 2RMU1 5IVFA 4O61A 1D2SA 3BU7A 1QXJA 3AP5A 4Q4X2 5BNOA 5FZCA 1COV2 2YC0A 3I97A 3ZFFA 1ZRFA 3UV9A 4IV3B 3M3CA 1EV12 3N7KA 1C8M2 5EJZB 1LKNA 1CAVA 4XJAA 4XAAA 5FUPA 3VD3A 1MS5A 3KWVA 5FZAA 1DQ5A 1YC61 4JKMA 2ZGKA 4YGBA 4FBFA 1KEXA 4FPLA 1FX5A 2BRTA 1YIPA 2D44A 2JG8C 3B69A 4WZCA 5A6XA 1JXNA 3RFRA 4CTEA 4CDWB 1DLCA 5DDJ1 3U4XA 5E1RA 2A71A 1ZZBA 5C9AA 1NT0A 3V65A 1RUE1 4CDUB 4XW3A 1JU3A 3D3AA 1PX3A 1XNCA 3ZPYA 3C7EA 5GKAC 1W28A 3IDCB 3DCQA 3NV4A 4AI8A 1G9CA 4CP9A 5KXBA 1E5RA 4U36A 1VBE2 5CZKA 1ZREA 3PNAA 1U5XA 3HNBM 4XEZA 2YDEA 3AKRA 2VMDA 5C4WA 4WVVA 1K5JA 3ME2A 3VHNA 3ZFGA 4RA0A 1ACCA 5L36A 3I4IA 1W6PA 2WQZC 2FMYA 4JKKA 2Y64A 4OHYA 3JZVA 4JZRA 3KF3A 4CCDA 3WDVA 1X50A 5FZOB 1E5HA 1BBT1 1OQ1A 2WAAA 1WMFA 3UETA 5DQ0A 2DUPA 4RN5A 5CU1A 2D3RA 3MZHA 4Y3OA 5E89A 4WZFA 4BOWA 4NMIA 5DUUA 4XQDA 2OX0A 1JYNA 2E7TA 4IV1C 4B8EA 4AFMA 4HN1A 3P3NA 2Y6FA 3E1F1 4Q4X3 5E88A 3TAYA 5LA2A 1ZRCA 1X8MA 1UYZA 1Q5OA 2E26A 1O8PA 3P3PA 2C9KA 3OBTA 2OUJA 3LIHA 5CG8A 1RUF1 2C24A 3HN3A 3PU3A 3LZZA 4PHZA 1H1IA 4LJHA 4LXLA 1QJFA 4A7ZA 4EJRA 2BQPA 5EYYA 2GP5A 5FYTA 1JUHA 3I2OA 1OQDA 4GKYA 5FZLA 1G9FA 3POSA 1UMZA 3VD5A 2DFCA 3WW3A 4F8AA 2VC9A 2D6MA 1BEV1 2VZTA 1TQ5A 3TEZA 5DAPA 5F6KA 3I59A 2Z4FA 3MF9A 3ZSLA 1QH7A 1RUF3 3J8F3 2MEV3 1QDOA 3WQ0A 3VBRA 5FFOC 1XB9A 3I3MA 2GP3A 5BNPB 4YM3A 3CF6E 2HWB2 2XXZA 1NCRA 3VHRA 4PCRA 4P14A 2WJSA 1BEV3 4PIZA 3WCRA 5F3EA 3ZXKA 5BNQA 3H1YA 3LCPA 1AL22 1SMVA 3VBRC 4JV4A 4HMZA 1GP6A 5F5AA 2CV6A 3HD8B 1CAWA 4H3WA 4JC1A 1US2A 3L2HA 4IDZA 3WEZA 1G9BA 3BI3A 4Q0PA 5FY9A 3ILFA 1TEIA 4L92A 3A23A 1LB2A 2BVVA 1QJY2 3BALA 5GZFA 4BE3A 2PLV1 4WVMA 2GN7A 3GZUC 4KG0A 5FXWA 5GM0A 2Q8EA 5IFPA 4H7MA 3ZO0B 2FZ1A 3H0OA 3ZLIA 4Z2WA 5BUVA 2WINB 3KT1A 1AR72 3KCYA 1CVNA 4CDXA 1O3RA 2XJRA 3PUHA 1UKGA 4J1WA 3PURA 2D6PA 5DUWA 3CJIA 5T3NA 3R4UA 5C70A 3WHUA 4LBQD 4NHLA 1UXZA 3VZJA 5F9TA 4KL1A 4YW2A 2ORXA 1R083 3JU9A 4KGGA 3O14A 4CCCA 1J59A 2P3KA 1V6NA 1MVQA 1OLRA 2VXRA 4UFLA 1WMEA 4Y20A 4LNVA 3J8F1 3I3QA 2XVGA 2J1EA 3AYDA 4BA6A 2BBVA 4P9IA 1TE1B 4K7JA 1CJDA 3S57A 4GMP1 2JDYA 3KVAA 4HFSA 3TOJA 5BNNA 1YFUA 3WG3A 4AOCA 1CAXA 2W39A 3PMSA 3ZXAC 1NOVA 1S0DA 2DUQA 3T4HB 5HPOA 3R6SA 4FOWA 4XILA 2QFEA 5DN2A 5JZGC 2J22A 3T30A 1QH6A 1XYNA 2DU1A 4Q0SA 5F2WA 3T2QA 4AFBA 3RYKA 3SH4A 3MDPA 1ZYBA 5FMOS 4FVVA 4N53C 4CEWB 3RYRA 5LEKA 3OCPA 1W0OA 4AI0A 3POEA 4OI4A 1YQ2A 1CESA 1YUDA 1LHNA 1QMJA 2ZBJA 1UZWA 4XURA 5L7OA 3RZHA 4MGYE 2D7FA 2IUWA 1OOPB 4K8RB 1ND2A 4S2DA 4BK5A 2E33A 5L9BA 1SDDB 2W1QA 3IPVB 4I02A 1W0PA 3LD8A 4COUA 4ZHNA 4IEPA 4YM1A 3ZR6A 4OZXA 3RS6A 5FZ6A 5GLTA 1NA1A 1I3HA 1G7YA 4RHV3 1JHNA 3MYXA 3MFCA 3OG2A 4AQ6A 1LTEA 1W8TA 2VMFA 1C1FA 3K4AA 4YZ5A 1PK6B 1D0GA 1I5PA 5KXDA 3M7AA 1AX0A 1W6OA 3U75A 1HB2A 1TME1 1AYM2 1VBE3 2JDAA 1PIV2 3ACGA 1CAWB 2JKBA 1H0BA 2XB6C 4R9AA 4LA2A 4S2GA 2Y60A 1WMXA 2D3SA 3VL8A 3VDAA 2J1RA 3O1TA 3DXTA 1QIQA 1WD4A 3E5XA 5JCTA 1QJX1 3KSCA 3THPA 1LEDA 2WFF1 1MACA 2Y0OA 3QD6A 4OI2A 2FD8A 4I09A 1R093 5KHHA 1NA1B 5AVPA 3WG2A 1OVPA 1X9TA 1NX9A 5JDBA 1W0NA 4RR3B 1OA2A 3ZVXA 1K12A 3AM2A 4Q26A 4ZU7A 3WX5A 2BNMA 4NOTA 5G04L 4F83A 1JYTA 1YJKA 4XDQA 3POBA 4EN7B 4PQQA 4AI2A 5DG1A 1EP0A 3RI9A 3ZMNA 5AC92 5D2AA 5C8CA 2YROA 1UYYA 2W2IA 3HBZA 3VDDC 3R0RA 2VE1A 1OUXA 5J98B 3KHCA 2H0VA 2RR13 1F8VA 4ZS3A 1BVVA 3WINE 4B3NA 3WDTA 4CE8A 4GXLA 1WGPA 5IK8A 3NJYA 1OD5A 1GUIA 2Q30A 1KJLA 3LEIA 1OKQA 1LU1A 3ZFGB 3ZSMA 1GMMA 3OOXA 1DZQA 5IK4A 1SCSA 2G9ZA 3HAGA 2VBDA 1SG3A 4L11A 5JSPA 1BMV2 1HRI3 4XFGA 1UNBA 2RS32 1NUKA 1A8DA 5JZGB 1ODMA 2YPJA 4H14A 2D43A 4K3UA 2DCTA 1YEWA 4LO7A 4CEYA 2B4KA 5IYYA 2BWCA 5ANNA 1CGPA 3WW2A 3VDDB 1U5IA 1XNDA 2WBKA 5AC91 2FDFA 1QU0A 3MPBA 2R062 1WA6X 2VNRA 1H8TB 4AEDB 5A33B 4BQ2A 1YFXA 3NWKA 3V0AB 3MGUA 4MZUA 2W46A 3MUZ1 4LKFA 2XBO1 2OS2A 2EXKA 4I2OA 1UIJA 5LW9A 2GN3A 1DLLA 2VNVA 2YXSA 3OD4A 5D8AC 4GJZA 4E8CA 1RITA 1S0CA 2DCJA 4BU2A 3LFMA 3EB7A 3ZN4A 1AR71 4A2UA 4Q4Y1 3USSA 2WZR1 2XBO2 1PMHX 3BPSA 4M00A 4QDSA 4I0AA 5KR7A 5FKBA 2GC3A 4XUOA 3GALA 4IEUA 2PHFA 1ZZCA 3CIHA 5LA9A 4AI3A 2C6SA 3H7YA 3NNLA 4GA9A 4IEQA 5EHDA 3ZYHA 4AWDA 2VQ0A 1TG7A 1RC6A 1PZ9A 4WV8A 5F39A 1C8NA 4MGKE 4YZ3A 3UGHA 4Y1VA 5FYHA 4B29A 5FOJB 2NMOA 1W03A 3T0DA 2XLGA 2A6XA 4WM7A 1X36A 4Z82A 4B4RA 3CBNA 2XKOA 2ZEWA 3WG1A 5F37A 5JXHA 3UKNA 1K5MA 2EXJA 1AL23 2GDFA 4RQPC 3LSEA 3MO4A 1MQTC 1ULOA 5F8PA 1W9YA 2YMZA 1AJKA 5FYBA 2VZQA 5I0RA 3C8XA 3NAPC 1XSQA 4XPVA 5FZMA 3RJRA 2WA4A 4FOVA 3QACA 4YVWA 4CU9A 5JIUA 2EXIA 1ZBA3 3VBUB 2IFWA 2WR9A 3A21A 1NCRC 4L2NA 1O4YA 2D5FA 5SV5A 3S6PA 3O0XA 2JDKA 3VV1A 3T2TA 2O8OA 1Q8OA 1RUH3 2XJPA 5DABA 5A3LA 2ZA9A 2DCKA 2GMEA 4MLOA 1F5JA 3VBUC 2QNKA 3VKNA 1AYM3 4TSVA 2GMPA 1DDLA 2DV9A 1LOBA 5F5QA 1HLCA 5CFDA 3LPFA 1X8EA 3ZYPA 1D0HA 2HWC3 3R4SA 4GIQA 4RS5A 1CZSA 1UD1A 4MVTA 4I3GA 3FN9A 3ATGA 5KC6A 1A78A 2E9QA 5E8AA 1VBC3 1ZRDA 1FOD3 4LBQB 2IXHA 3K48A 3WP4A 3WF4A 1ONAA 4QHZA 4QPGB 4NRQA 3USUA 2P3JA 2VUCA 1QXPA 3NSTA 5IAXA 1PMJX 1UF2C 2NPIA 1HXS1 3OBZA 3PIGA 2E53A 3MIFA 1OF4A 1O59A 4AGGA 4GB33 1G9DA 3M3QA 5BY5A 3VKLA 1FOD2 2XWBB 1VBC1 1OBNA 1GWKA 1WW4A 3BCWA 3UGGA 5LEJA 1BK1A 1QQP2 2CSGA 1Z0HA 2H6CA 1XYOA 2WS91 2H0BA 2RR12 5K0UB 4GULA 1LOGA 2DVAA 3PU8A 4YM2A 1W8UA 1H8TA 3RPQA 4AEDA 2DFBA 4QM8A 4COYA 4NRPA 3KM5A 2QE3A 3VD9A 5F5CA 1O3QA 4LBLA 1Q8SA 4NO4A 4YGCA 4TN7A 2ZX4A 4KWJA 1MS3A 4UBHA 2W92A 5L9RA 2QQIA 1JZ4A 5EJ1B 2JG9A 5FPVA 3RMYA 3C7FA 1VMJA 4M3CB 3QOPA 1G86A 5FMDA 1Y3TA 3IB3A 4OHWA 1LOCA 3NJZA 4ZU4A 5JIAA 4BQ1A 5ISLA 1LULA 1GICA 3EHKA 1VBD2 5C3SA 1SLCA 3PUIA 4PI0A 4MGTA 5L7OC 3ZXDA 2JG9C 2Y0IA 2JIGA 1MEC3 3EBRA 4OUSA 1H4HA 3VUOA 4FOQA 3MPPG 5CYYA 3WQ1A 3U14A 5DUVA 4A3XA 2A6YA 4XUPA 4DEQA 4J6GA 5AFEA 4XQ4A 1DBNA 2R0FA 4KGQA 3T09A 4I0WB 2GMMA 5FXXA 3Q8BA 3I54A 4MV2A 2YGLA 2WRAA 3AYAA 4W6XA 4Q4X1 1W6MA 2BYVE 2RMU2 3MLJA 2NZ9A 1RUOA 3GCWA 3M3EA 4NN0A 4D7SA 1SPPA 2AEYA 1DU3D 1RXGA 1V6LA 4I3PA 1CPNA 2CWMA 3N9LA 4Q8KA 4YYOA 3E97A 3WUDA 3POGA 5D1IA 2WO1A 2K9ZA 2YV8A 1YLLA 3DKWA 2VCAA 3ZM8A 4NHKA 2PN5A 2QBXA 3OTFA 4Q2FA 2ZEZA 3Q8FA 4FFHA 4OCTA 2WO7A 4BK4A 1HJGA 1VRH1 1RUJ1 1OMIA 1I1EA 2BOIA 4H7LA 4HSLA 1RGSA 1V6OA 4FTBA 1YRZA 2QQLA 5IK5A 1AXYA 3BVCA 3PVNA 2PLV2 2Y38A 4GD4A 2WZEA 4IE4A 4QKNA 5FY8A 4CU7A 1QJY1 1C4RA 3KB5A 4M0HA 4OI1A 4Z1VA 1KDKA 3OB8A 3MEPA 3RG0A 4D0QA 3KVBA 4QX3A 1SEFA 4WM8A 3POJA 4UWDA 4DPNA 1M4WA 2GNDA 4D94A 5HI0A 5J96B 1C3HA 2WAOA 2Z69A 3VKFC 4N43C 1RUJ2 2CDOA 4QQHA 3M70A 1RUE2 4AGVA 1H2MA 4WBBA 1N3PA 2V72A 2E6VA 3RZMA 4NRMA 4XJWA 3H3ZA 4TYSA 1YQ8A 4Q5OA 3RZLA 5HV4A 3FUOA 2RJKA 1HQLA 2VTXA 2J1SA 3AVSA 5I0TA 4YVSB 4QXCA 4CDWC 4QX1A 5CADA 5L19A 1PNGA 5K0UA 2DVBA 2VMCA 1IZ3A 3L2YA 3NJVA 4NJ4A 2VL4A 4DZGA 5ABJB 5FO9B 3I2HA 4PJYA 1XNBA 2VUAA 1HDKA 2WO2A 2WNVB 2VZ3A 5FPBA 1D4M3 4ZY9A 3WNOA 4OVEA 4X8NA 2Y6KA 4B7EA 2EIBA 2WQ4A 5FMOL 1AR73 1LCLA 3K51A 4B1MA 1CAUA 1R1A2 1Y43B 3AC0A 4ATFA 3VBSC 3ELNA 4PDWC 1DYKA 2RMU3 1LESA 3N9MA 5FZ8A 2VZSA 1H1MA 3CO2A 4RFRB 2HWE3 3LF7A 5J09A 3WNXA 4DY3A 4BZ4A 5FPLA 5B2GB 4DXTA 3CDZB 1WCUA 5JAXA 2WT1A 3T08A 2V5DA 3CQOA 4LBKA 2ZXQA 3ECQA 5T5OA 5BV6A 1OHFA 4Z92B 2CHHA 2FHRA 4BDVB 2QQWA 3N36A 2WT2A 1FMD3 3FE5A 1T2XA 4AI9A 1R1ZA 1GWMA 2Q8CA 5GJ6A 2J1AA 4E4HA 4L8QA 3AZZA 1PNFA 2VUDA 3X29B 1NLQA 2Z5WA 4I30A 5A7OA 1IG0A 1F31A 3PVEA 5A3UA 4QDRA 1RUC3 3EMRA 3UGFA 2J42A 3NNJA 1QQP1 2IVJA 2J1TA 1V00A 4YVWB 4X6QB 4HK9A 1ZA4A 5A7PA 3GDBA 2VULA 1KITA 3ZMOA 1JYVA 3SH5A 2FDGA 2QJVA 4MX3A 1SCRA 3JBG3 4ARYA 2JB4A 2JICA 2V09A 4LLFA 4K6BA 5JI7A 2TUNA 1S0GA 5I0SA 2UU8A 4LPLA 4P02B 1IOAA 3GBWA 5LRRA 1QJU3 1VE0A 1IKQA 2O14A 3JD73 4DXRA 5ACA3 2YC2A 2W5FA 2HWE1 4QXKA 3SLIA 3ZFGC 4BXSV 4CCOA 4EN9B 2WL1A 1S0BA 2MNGA 2XR4A 5FJHA 4B4QA 4DO0A 2ZAHA 4UAPA 3FHQA 3B02A 1AR82 3OUHA 1J3RA 1UY3A 4ZZ8A 4A45A 5FZEA 1IQAA 5DUXA 2PHTA 1GOFA 3RWNA 4BQ4A 2X8KA 5C8WA 5DXDA 4BMBA 2LTNA 5C6CA 4YZ2A 1PGSA 1NG0A 5FPUA 5KWRA 1Z7S1 2RVAA 5KBFA 3WZ1A 4XF9A 5KHJA 2P6HA 1GNZA 4EWDA 1REFA 2EA7A 4CUCA 1TMF2 4XXPA 1OPMA 4CUBA 4A3ZA 1NCRB 2ARCA 4E4DX 5I8YA 2JX9A 1DG6A 2JDZA 5IVEA 5FZ7A 2IZWA 3VBUA 2I2SA 3CL1A 3ITQA 1OC1A 3M8LA 3OY8B 5A80A 5JXJA 1JBCA 5JOZA 1BMV1 2YGMA 3ACLA 4CEWA 1JZ8A 4XFFA 5B4XA 3ACIA 2LM3A 2A6VA 1UZZA 2WLPA 3P5BA 2C0ZA 4QPIC 5IT6A 5JPNB 4P5HA 4MGQA 4BQ3A 3LAGA 1RB8G 4PBPA 2BJSA 2EIGA 2YPDA 2ZX0A 3MFAA 3WNPA 4IGPA 4JCKA 3WNLA 5A3PA 5LWBA 1L7LA 1V70A 5IVYA 2ORZA 5FUIA 3ZFEC 1DGRA 2WWUA 3HT1A 3WQBA 1UKRA 2EF6A 5FYCA 1CPMA 5F32A 5GLWA 4HONA 2ARBA 4TTGA 2GZWA 2R071 5A32A 1HRV2 4TZDA 4ORFA 4OQ8A 1H1AA 3ZYGA 4LBQA 5A6YA 1SBDA 1VPHA 4HL0A 1A3KA 3HMYA 3I2IA 1AX1A 2R16A 5GLUA 4YNIA 5LBEA 3LEMA 4QB6A 3KMHA 3DPRA 3B01A 2YFUA 4QX2A 2C1FA 3PVBB 2ZGQA 3WUCA 3B94A 4FFIA 4R9BA 1FYUA 4Z2AA 2CL2A 4IUGA 3VZOA 2HWF2 2GAUA 4CUGA 2RDSA 5LY2A 3ZSEA 1JYCA 3J4UH 1K3IA 2RE9A 3T2PA 1H9WA 4NPRA 2VXJA 3LOIA 2QZ2A 1UW8A 3VDCA 4XHXA 1RINA 1F35A 1W6NB 1RUG2 2FDJA 2P17A 5IJRA 1GBGA 4NHYA 1WCQA 4JGZA 4FFFA 4OHXA 3O0VA 3HN1A 4MH0E 5FPZA 4PLNA 5IVBA 2IWGB 1UO9A 2YU1A 1OF3A 4CDQC 1B09A 3I3DA 4QM9A 5I91A 2G4IA 4MGIE 1QEXA 1H8TC 5HCFA 4AEDC 5LY1A 3A0KA 3BIWE 4QXHA 2GNMA 2VNOA 1VBB2 3B9CA 1RHI1 5C9AB 1UZVA 1ND3A 4LEJA 2R041 1AR93 2Q0AA 4AVVA 2ZJCA 5CKMA 1RUH1 5A3NA 4LULA 3H3LA 4DOUA 5ABJA 2UYAA 3FFZA 4YVSA 1DQ2A 3OGJA 4A4AA 5GZCA 2KD7A 1DQ1A 2PHXA 4P9GA 4Y5SA 4NUBA 1PVC2 5C3RA 1HB3A 1OPOA 5JR2A 4XDPA 1HQWA 1NE6A 2FCUA 3ILNA 3VLBB 1G9AA 1YXWA 1W99A 3DYPA 1DZTA 1PM4A 2IC1A 3VBHC 3OUIA 4JDNA 1JHJA 4CYDA 3FBMA 3V64A 1QJU1 4FPKA 4MGSA 2PFWA 4YWAA 4EN0A 4QU1A 1POV1 2YB7A 2Q4SA 1W6MB 5A3MA 3I2GA 4EN6B 4CXXA 3M4FA 1GR3A 1NCQC 2TEPA 1OFNA 2X05A 3K4ZA 3NVCA 2DVDA 2OYZA 2DBIA 3CEWA 1XE8A 4IEWA 4LBMA 2BGPA 1CN1A 1H9PA 1UU6A 1RUD1 1NCQA 4OMDA 3S7IA 3WF2A 4IXLA 4Y22A 3BGAA 5I8TA 4DIQA 2GNBA 3POFA 3P6BA 5A7NA 1TME2 3LDKA 3EQEA 5FREA 2CGPA 3CMGA 4E9KA 2RS11 3B7MA 4UFHA 4GH4C 2XL9A 3J9SA 5FY4A 5K0UC 4AHXA 1TZOA 5H9QA 2P3YA 3GZEA 2C9AA 1XBFA 3H1WA 2CAVA 3WP5A 2EALA 4CA9A 5FBJA 3VBSB 5C3OA 4HVOA 1HXS3 2V73A 1DF0A 4JVAA 4IQPA 1Z78A 1NAEA 1MVEA 1VBA3 2BOJA 3HVDA 1PVXA 4LUMA 1KQRA 1E5SA 3MW4A 2F17A 4GB31 4K40A 4JRAA 3RRDA 2WNVC 4XBLA 2QTWB 3TEXA 5FZDA 1MZFA 4I0BA 2VOVA 3URFA 4M4PA 4LKSA 4LO8A 4HLTA 2UURA 3MICA 2HWB1 3CZJA 1N1SA 2X10A 2RDRA 4HT1T 3RGBA 1UX6A 3J7HA 4BH9A 4FFGA 1PMIA 2OZ6A 4C1WA 1XJAA 1QXRA 5FP3A 5JVVA 1W6QA 2BUKA 3C3VA 2NN8A 4C8DA 4HK8A 2JDNA 1MZ5A 1PO12 3BKZA 2VTFA 4KBZA 4DXZA 1CAUB 4CP9B 1VAMA 2HJIA 2XOMA 3HPNA 4KU7A 1X33A 3WDWA 2D97A 1Q8PA 5LB6A 3BYWA 4C0BA 1RJ7A 3OSDA 3WDXA 2ZGRA 2BERA 1JS9A 4PLOA 5EYXA 5K4LA 2UWAA 3K2OA 3UT0A 2VG9A 3MUY1 2DTYA 2WNOA 5I8SA 3ZN6A 2A75A 3WVJA 3ZYBA 4JTNA 1E57A 1AR81 1SLIA 2VW0A 2WN3A 3JCIA 2R073 1CZTA 2IXJA 5FLHA 1Y9GA 4P9YA 1X7NA 5JMCA 2QQJA 3DYMA 5DZFA 1PIV1 3ZSJA 3CJIB 3FFQA 3AJZA 1LENA 4GWJA 5C5UA 3TN92 3VBOB 4ASMB 5BNNB 1VB4A 3OPTA 3LQCA 1AR83 2R30A 1D4M2 4XABA 3GGLA 3M3IA 2VBPA 2VZRA 5LBCA 3SCFA 4TLGA 4IV1A 3RZKA 3NW4A 1CWPA 2DCZA 2WZR3 4ZU5A 1HRV1 4DUXA 2FCTA 3E5UA 4X6RB 4AQ2A 3TNPB 5APAA 3ZXJA 3UESA 5FWJA 1RJ8A 1US3A 2WZPP 3T2OA 1HV0A 1OOPA 3FWEA 1QJY3 1STMA 2BW8A 5IVJA 4IL7A 4Q4V3 5L7OB 1YQ6A 3IT8A 2RS31 4Z07A 4UW5A 4AW7A 5C3PA 3IAPA 3M3OA 2QQPA 4XE9A 3H8UA 2H6BA 3VBOA 2ILMA 3BTYA 4FP3A 1N3OA 2UYBA 1FATA 3AP7A 4Q0UA 2XJQA 4WM7C 1VP6A 3I2JA 4TXWA 1UYPA 2Z79A 1PGL2 1SFPA 1N1VA 1OFSA 5JOYA 3ZXLA 2O1QA 2RJLA 1W6OB 5FJKA 1DGLA 4SBVA 2CWSA 1RVF1 1UU4A 5K7PA 1ZZ8A 1E5IA 3FMGA 5FZKA 3MIDA 3LDRA 2VZPA 3UL2A 3ZYRA 2XHNA 3PLQA 5C33A 2MPFA 3KLSA 5EXOA 2XGXA 1GKBA 3N9NA 1JW6A 2Q8DA 3VBFA 4FCAA 1BBT2 2CAUA 2D6OX 2V5YA 2HWF1 1WLDA 4ONUA 4XIKA 3JB8A 2VMHA 1S1AA 2QVSB 3LDBA 4FXKB 4AZZA 2GC1A 1NE4A 3RVHA 2I74A 2PHLA 4GMP0 1JUIA 4RS5C 2HH9A 2WT0A 3PTRB 4CP1A 1IS5A 4QPWA 2B45X 1C1LA 4MGZE 2ZHLA 3D5OA 4CCLA 4ET7A 5FK7A 1HN1A 1V6MA 1VBE1 4V1PA 2NM1A 1MZEA 2R072 2XJSA 2OXBA 3AFGA 3DPRB 4KU8A 3T3YA 1CAXB 2VPVA 3INAA 2Q8OA 4YLZA 3KV6A 1ZZ9A 4CDQA 2OT7A 5BNNC 3GHNA 1ZRRA 2WFF3 3B00A 4FPYA 1F15A 1RUC1 3NV3A 5BNPA 3KHBA 2BZDA 2ZAAA 2EICA 3W9AA 5CFCB 1W3VA 2WS93 1LOAA 4D6RA 4D8MA 1XRUA 1Q43A 3NAPB 3IIIA 4RGAA 5D21A 1Y9QA 4YFZA 2D6NA 2UWBA 5JZGA 3SKJE 3LSDA 5EQUA 2X5IB 2G9GA 3FLRA 4Y1UA 4YW5A 4QX7A 5T52A 3I2FA 5GLZA 4QDQA 2O8QA 4JDMA 1PO13 4BJ0A 1ZBE3 2R042 1UYXA 1ENSA 5A3OA 4YARA 2IXIA 2D3PA 1RUD3 4BMEA 4HVQA 1T6GC 5F7UA 2VM9A 3L9JT 5HCAA 3K75B 3FBYA 3BOWA 3GM8A 4ISQA 4EZ4A 2DU0A 3WHTA 5CB7A 4LKEA 1PK6A 3O1PA 3OGSA 2GALA 4HN0A 1OURA 4DRRA 1J3QA 3Q8CA 1C5HA 2WC2A 3G7DA 2WZ8A 3MHZA 1ZBE1 4IV1B 3JD72 1SBFA 3RZZA 4CCNA 2WWSA 4D69A 4UXAA 4QKBA 1DCSA 5FYIA 1W3XA 5ABJC 3UKVA 3R4DB 4JRLA 1BYHA 1COV3 1B35A 5A7SA 1RUNA 3WV6A 1Y7BA 2ZHKA 1ASJ3 4IEVA 4R52A 2GC2A 1ZZ6A 1XYPA 3Q8AA 4KWLA 4XFAA 4YFWA 3AXEA 2Y33A 3D8CA 4WM8B 4Y24A 3ZXGA 1B35C 3POWA 4QPYA 5LATA 2WQ8A 3J7NA 4G4FA 3GBFA 3WDUA 2VTXJ 4G9SB 2JKXA 4R9DA 4DQAA 4CCKA 1SLLA 3THDA 2YYOA 1PO22 1W04A 1H6XA 2R49A 3WP3A 1V6JA 3RJ2X 4N9IA 4XBNA 3KCCA 1PO21 5IFTA 3LEGA 4QB2A 5EPAA 3ABZA 2NQYA 3T0BA 2K0GA 4LITA 1W8FA 4W6WA 4YZ1A 3AXDA 2K2SA 1WLTA 4N9HA 1BJQA 1OLQA 1SFYA 4OULA 5A7WA 1S0FA 1HV1A 5GZEA 4AHYA 2C4XA 4AYUA 1GQGA 1VALA 3GHMA 5FYZA 4BPZA 3AYEA 3B5LB 3WDYA 3BU0A 4E4ZA 1KDMA 3CHXA 3GJBA 1V9U3 3ZFFC 1FT9A 3AMQA 4NROA 1AHSA 2JWPA 1NCQB 3IDAA 3NV2A 5HCHA 1WW7A 3VBSA 1KS4A 3ZPOA 4K9SA 5GALA 3DGTA 5FTTC 4N8MA 4D7YA 2VMEA 1TNFA 2LRPA 1Z7S2 3VDDA 3WNMA 4IV3C 4YW4A 3RWKX 1DQ0A 4IE5A 3HNMA 2JG8A 4DUWA 2VR4A 1UN1A 5C5TA 2Q1ZB 1QF3A 4FPHA 4HPKB 3WF1A 1BBT3 5A1FA 4LHNA 2AENA 2XWJB 2P4EA 4M4RA 2R6QA 1AL0G 3AZVA 3WLUA 3BPZA 4ZXEA 2C5DA 1G8WA 1VR3A 5CAZA 4M3CF 1W2UA 3PUQA 4NHXA 4JX0A 1VBA2 1UOBA 1O5UA 3CU7A 4LR4A 1ENQA 2X5IC 4NIDA 4Q0VA 2VD7A 4Q4W2 3TEWA 1AXZA 1S2EA 2RDNA 5D8AA 2PMWB 3FHAA 1LGBA 5DAWA 3VKOA 2YBKA 2E31A 1ODNA 5J37A 3VGIA 1QOSA 2VCBA 2RR11 3WT3A 2HWF3 1DYPA 3OPZA 2E7AA 4GALA 1DIWA 1GZWB 5CNAA 4OMCA 2KR2A 2DBNA 1FOD1 1VAKA 4AF9A 3S7EA 5EV7A 4BXFA 1CIWA 3RYPA 4PQ9A 3TRSB 3C7GA 5IAVA 4E4SA 2VVDA 1R64A 2WZR2 4YG6A 1DGWA 2JEMA 3U07A 5A7QA 3VBFB 1AF9A 1GANA 1OOPC 4IGQA 2PHUA 5DDJ2 4Y26A 3ZYIB 2BGOA 5FZ1A 3ZOIA 3W59A 2OA2A 5FOBB 1GNYA 1QDCA 4W6YA 1EAH3 2W08A 3OBRA 4NE9A 3ZXFA 1DQ4A 3ZX7A 4D6SA 3V0BA 3JD71 1GNHA 2PAMA 2V4AA 3AMNA 3DF0A 5DDJ3 5C71A 2JIJA 3VHOA 2Y6GA 3A22A 3B3QE 2WNEA 1HB4A 1RUE3 2Y26A 5J1XA 5I0UA 3AKTA 2TNFA 3GYDA 4YPJA 1DHKB 4P08A 4XXAA 1KGYA 3TB0A 4C91A 2G1MA 2FMDA 4OUMA 4L0PA 2JE7A 4NIIA 4GH4B 1RXFA 3OPWA 2CNAA 5JR7B 3GF6A 1MQTA 1W2OA 4A41A 3MLKA 1FPN2 2VQAA 4IE0A 4P9XA 1RUJ3 3WF3A 5CFDB 3KQRA 3RZJA 3QH7A 4LHLA 1OLME 2DWRA 3N7LA 3H50A 2B9VA 2PHRA 4XZPA 4A6OA 4ASKA 2ZGTA 3O1UA 3SNMA 1O3SA 1IGOA 1ULCA 1JTZX 2GNTA 1J83A 5AVAA 3RI8A 4FAGA 1HJFA 5JMOA 4BLIA 1YHFA 1GQPA 1RUI1 2R1BA 3OYWB 3UKTA 2F6BA 4LQRA 3BODA 4E2QA 1W8WA 3E6BA 3FLPA 4XF0A 1UPSA 3O0WA 1UCXA 4CDXC 1AXKA 4RD7A 3ZFEA 4MHUA 2A6WA 3V56A 3G6JB 3ZYFA 4HXCA 5HCBA 4K1ZA 3HQRA 2PXJA 3D0SA 4P9LA 5T5PA 1FV3A 1HXS2 2NYYA 5FR3A 3IBMA 1WCDJ 1GV9A 1UY2A 1FXZA 1O5LA 1XXNA 3PDQA 5A32B 4N7UA 4ZKTB 5AC93 3ZIWA 5IVVA 3K3NA 3J7LA 1I5ZA 5BNPC 1RUD2 1VMFA 2P34A 4J25A 4MG2A 1KJRA 1VAVA 3J7MA 1NQJA 2CGNA 2IXCA 1O3TA 3IN9A 2C26A 1FNYA 2N7GA 1F4AA 1JZ5A 2WNUA 1R092 1ZBE2 4XJZA 2Q1FA 1JODA 4UW6A 4Q0QA 4E2GA 4FPEA 1ND3C 4XAEA 5FZBA 2P37A 2JE9A 1TME3 4XC9A 2WNUC 4PIXA 3ASIA 1FNZA 4JGZC 2FDIA 2ZGPA 2OKXA 1QHDA 4GKXA 5FZ0A 1AYN2 4Q27A 4AQSA 1F9KA 4P00B 3GJAA 1VBD1 1PVC1 1SPPB 5CA6A 3FHIB 4HKLA 1S55A 1W90A 3OY8A 1CQ9A 1PO23 4XUQA 1S2KA 2BP6A 2KM2A 2XQXA 1LJ7A 4YGEA 5T50A 3RNSA 3VKMA 1IPKA 3PHMA 1C8M3 3KV9A 3V0AA 3HBKA 2DF7A 5JPMB 2YFZA 4HETA 3U11A 1VBB1 3ZSKA 1D7PM 2VCMA 2ET1A 4DFSA 2HKXA 5A3WA 4LOSA 2ZZQA 2BWAA 2QQMA 1H2NA 2D93A 2AEZA 2JDPA 4XACA 4OHZA 2CYFA 4PT6A 1UOFA 1W2NA 1SLBA 1XC6A 2VZ1A 3PUAA 2BTVC 1W2TA 3A7QA 1NA1C 5EFUA 1JOPA 1R091 3E6CC 1BQPA 2VMIA 4X8PA 4DRVA 5IHRA 4LIUA 4Y5Z0 2FBEA 3BUCA 4QX8A 1JZ2A 4CDUC 5IK7A 5ERLA 5FCCA 5F3CA 2E32A 1QJX2 1LHWA 3O5SA 4HANA 2ZGNA 4AK3A 4QKDA 2IXLA 3N4MA 4GH4A 1VLNA 4LE3A 1SDWA 1X82A 4UI9L 3EXUA 2G9FA 3HQXA 4GWMA 3I49A 1YJLA 2VNGA 1AYM1 2XUMA 4Y33A 5B4NA 3LPGA 3PMEA 3N9OA 4R8HA 3SC7X 2XHKA 4CDUA 1J1TA 4XYXA 5EWSA 2KXLA 4UF0B 3HNYM 4CDWA 4IEYA 3AFKA 3VZMA 3UYJA 3QBQA 1UOJA 2A7AA 2WO3A 2ZX2A 4RGKA 3RDIA 1UX7A 5LCWL 4XTPA 2VQUA 5A1AA 4EE2A 3IIAA 3VZNA 1NQDA 1XE7A 3T0AA 1JYIA 3MIEA 4LK6A 1VIWB 4KG8A 3O1MA 3MIGA 5FZ3A 5CG9A 4G3YC 4LMFA 4URTA 3O1SA 1OH3A 4AEJA 1PGL1 1ZVFA 3NO8A 2XL7A 1U5ZA 1UZYA 5LZ6A 1HW5A 2ZX3A 4KH9A 1KFUL 4KWUA 2ZEYA 4IGOA 1DGWX 3ZFFB 3O12A 4CVUA 4N53B 2E7QA 5CIRA 2XVLA 1O8SA 3KGZA 4BQXA 2JD4A 5AFBA 2HYKA 1O7FA 2ZMKA 4NAOA 2RG4A 5G05L 1ST8A 4UT5A 4YG0A 1CONA 2L9LA 1BEV2 5LK7B 1ZA7A 2X5IA 4IV3A 1AYN1 1BKZA 4XFHA 1O6UA 3LFIA 4DUVA 5C9AC 2WSVA 1MS8A 3SMHA 2W1SA 5BNOB 2CY6A 2MEV1 4PDWA 1JMUB 1SACA 1OSGA 1RUF2 4Y20B 4YGDA 1TVGA 4COWA 2DVGA 1ULPA 4D7TA 4CEYC 3WXPA 2YY1A 2A6ZA 2HEWF 2GC0A 4IETA 4WVWA 3SISA 1RUG1 4GWIA 1SQ4A 4XHBA 1TMF3 5F5IA 1B35B 1LR5A 5F6LB 1GZ9A 1ZX5A 1Q8VA 5DG2A 1LHOA 3I3EA 5HV0A 2P1BA 4EWAA 2G19A 4UW4A 1UPIA 1YFYA 1Q56A 3O1OA 3AMPA 1ENRA 4LO6B 2ET7A 3THTA 5A70A 3W58A 2X53S 5LA1A 1O4TA 2ADEA 3IAQA 2PAEA 2Q5TA 3AX4A 3VZKA 3H9AA 4NWVA 4UFKA 4FI9A 1UAIA 1JI6A 4QX5A 4AVAA 4A42A 2WA3A 1IPSA 5A3TA 4XFCA 5F2SA 2QQOA 4JAAA 4JGYB 4QQPA 2W95A 3LIGA 1ULEA 1JZ7A 3K77A 1W06A 3JB4C 4HKWA 1G6NA 3TNQA 1YCIA 1H30A 3VBOC 4E27A 2PQSA 3BB6A 5C3QA 4CXWA 1QGLA 5GZDA 3PUSA 2JXAA 2ZHMA 3NAPA 3K4DA 4W65A 5FUNA 4LK7A 2BNOA 1IG3A 4OQ9A 4P5YA 5IVCA 2EIEA 3KV4A 1AVBA 4QPIB 1HQNA 1RUH2 3TEYA 3HOBA 4LHKA 4CEWC 2AC1A 5LBBA 3MLLA 1K45A 2HYXA 5JOWA 3KF5A 1KXGA 4Q4W3 3VB9A 5FXVA 4AFAA 4RQPA 1GWLA 2UY8A 3H42B 4A7YA 2WLQA 2ZGOA 4ZXKA 4Q1PA 1W05A 4XQWA 2EIDA 1SHWB 2WNUB 5L73A 2AYHA 2HBTA 3FL7A 2BBAA 4UW3A 3E6DA 5HXMA 5FY7A 4H2AA 1QJX3 2D40A 4L9BA 5DPNA 2ERFA 3ZDVA 1BZWA 3N35A 3C2UA 3OJBA 4EWEA 2QZ3A 1RIRA 2WFF2 4P9WA 5BPXA 3T1MA 3OYWA 2YUEA 3MV11 1H8VA 2HWE2 3C7HA 4HZFA 3ZKUA 3ZR5A 2NP0A 1ULFA 4JQTA 2VCCA 3ORJA 1REEA 3MW3A 1VB2A 3ES4A 4HBNA 1PVC3 1EAH2 2Z2SB 3EJKA 3FLTA 1Y4WA 3NRUA 1MPXA 4PF5A 5DAVA 5FZGA 3TYJA 3N3HA 2GH2A 4DXSA 2XJVA 3VD4A 5H9RA 4AVSA 3A4UA 3JBG1 3WP6A 2FCVA 4XTMA 2PHDA 4MSVA 4XETA 1AR63 2QCSB 1LOFA 4YW7A 4QWNA 4CSWA 4L99A 1S4CA 1W9FA 3E5QA 3U37A 1PGW1 2VVFA 1OA3A 5GZGA 2XH6A 2YG0A 1WUVA 4O7XA 4ITCA 4CCEA 3FX3A 1OVSA 3ZFEB 2FDHA 5IWFA 3WY6A 4JDOA 1UIKA 1LOFC 2NMNA 1GLHA 4IEXA 4J1XA 2B7YA 3ILRA 3ACHA 4LBOA 1DQ6A 5FO7B 2ZGSA 3D0JA 1AYN3 3ZYJB 2UWCA 1YI7A 4FP2A 1SLAA 2A3XA 4XOGA 2DYCA 2FZ2A 1H2LA 4KWKA 5FY5A 1UOGA 1W6QB 5K8SA 4XDOA 1EPWA 5FLIA 5H9PA 1GZCA 1WA4A 1ZBA2 3U10A 4W50A 4ZONA 1W39A 2PA7A 3LGRA 2RM22 1LECA 1LEMA 1TMF1 4FT8A 2VOTA 1WWYA 2HBUA 1LHVA 5FY1A 3LA7A 1KD7A 2OPKA 4BIOA 3GCXA 3HIFA 4MXWA 2XLAA 3VBHB 3V0BB 3IDBB 5KC5A 1D4VB 3ALQA 2ZHNA 1UY0A 1COV1 1CAVB 1IHMA 2CTVA 2K46A 2XG3A 4GWNA 5FPAA 5FQ0A 4BHPA 4CXYA 1K42A 4XBQA 4S2HA 4FTEA 3AKQA 2ZABA 4LOTA 4N53A 4RYDA 4TWTA 4XJ9A 2A73B 1MS0A 1MS9A 2AREA 4JTOA 5I93A 4QGMA 4NVPA 1CX1A 2QDRA 2ZCWA 3GNEA 3SEEA 4AQTA 4HKOA 4IE7A 1RYYA 1IS3A 2B39A 1Z7S3 2YBSA 5FDBA 4HOOA 4XVHA 4DS0A 4QMAA 1V9U2 5CEHA 1LAJA 1WD3A 3VHPA 1T6BX 4KQ7A 5FLJA 4ZS2A 1PX4A 4Y4YA 5K9YA 4OYUA 2WS92 1CX4A 3KQ4B 1NY71 2VMGA 2VVEA 4AE2A 4O65A 4A7KA 3DUIA 4PI2A 4Y22B 1R081 2RHPA 3AL6A 2BVBA 1QOTA 4RR3C 1WBFA 1WLCA 2CGOA 3PVOA 1FPN3 3ON7A 4XF4A 4IE6A 1URXA 4AVCA 4FO9A 1FMD1 3DL3A 4QXBA 1PZ8A 4GMP3 5FK8A 4RL7A 1KFXL 4XF1A 2ZPXA 4WVZA 2HWD2 3ACFA 5DMYA 1FPN1 4BQWA 1QQP3 1DGRN 2JG8B 4LLOA 5FAXA 4ZZ5A 4AAPA 2OW4A 4D3WA 3U1XA 4CUAA 2R0HA 1DZRA 2R7EB 2ZGLA 1TNRA 3DV8A 1AR91 3ETQA 3POYA 1JYXA 5FZHA 2B8MA 4LORA 2RS33 3WR0A 2VOXA 5EIYB 1P8JA 1C8M1 3HJRA 5FP8A 5ACA2 4AFDA 4NHMA 4M3CA 4Y5TA 1LU2A 5KHKA 2A70A 3AP4A 3SKVA 3POIA 1YWKA 3BOPA 1QWRA 2W3JA 1IPJA 1VBB3 2BFUS 2VZUA 3HT2A 4QB1A 5FZFA 3W5NA 1NZCA 2JG9B 1JYWA 1CJPA 5FKCA 2LROA 1J84A 3VZLA 1WBLA 2WIIB 4P9JA 1RTVA 5KHIA 4IESA 4BQ5A 2OPWA 1N1TA 3QLQA 4FPCA 3O1RA 4META 4XCAA 1PZ7A 4W4ZA 4N43B 4OUEA 4YSFA 1RUC2 2VUJA 4OZOA 4BCUA 4XF3A 1XU2A 2RS52 1W8ZA 2YU2A 3AKPA 1NXMA 3U4SA 4DMIA 1UZ0A 1UMHA 3MBWA 3Q9OA 4KBBA 4CRQA 5IATA 4FXGB 3IM0A 3HR9A 4E2SA 1R082 4AI1A 4M01A 1ND3B 1I6XA 2D5HA 3LWCA 3UK9A 1LHUA 5FZIA 2JB8A 2XQRA 3KT7A 5FZOA 4RGGA 5C7GA 4V2VA 1SBEA 2VZOA 1O91A 4OFGA 4UYBA 4XJUA 4XMIA 3W21A 2FQPA 3T1LA 3I2KA 1NKGA 1XU1A 4LTAA 3WQ7A 3ZKYA 4C0HA 1WW5A 2JDMA 5HXVA 2IVIB 2ID4A 1AR62 2WUHA 4FTSA 5C4WC 1YYNA 4XIOA 1V6KA 2PQQA 3BTZA 1QNYA 1RMU1 1YQCA 4AR2A 1V0AA 4AGRA 4W8JA 5FO8B 4QHBA 1JZ3A 4MADA 1LGCA 1WZXA 3NMBA 4GQ7A 2LALA 4I01A 2DVFA 3JUUA 2ZMLA 1F2NA 4QQOA 3SQOA 3SCHA 4OLLA 4NR1A 2AZ5A 1GSLA 2VECA 2AUYA 4YVWC 4AVTA 5ACA1 4UF0A 4BLJA 4CU6A 4EYUA 3M2MA 1UWWA 4O9GA 2ATFA 3RQ0A 2VOKA 3PL0A 2YC4A 2OZJA 4JHZA 1AR92 4UOJA 1ASJ1 5JXGA 2WSUA 4M0NA 4BYYA 1BVP1 3D6EA 1PIV3 3H8OA 1VRH3 1F4HA 2KA3A 4WM7B 1IS4A 3OUJA 5T54A 3RSJA 3OD0A 4IEOA 1Q3EA 4FOYA 1MS1A 4DB5A 1NZIA 3H3UA 5FIXA 5CFDC 1GZTA 4BWOA 1CD3G 1S0IA 4AXOA 1ULDA 4K1YA 1W9WA 3DEMA 4YM0A 4AG4A 4RQPB 4AEMA 2ADDA 3KS7A 5A6QA 1FMD2 1MR5A 4INDA 5CFCC 4XZUG 2EAKA 5CISA 1OA4A 3I7DA 1PM7A 4QPIA 1OXCA 1OUSA 2PLV3 3O7OA 2OVUA 4FAHA 4PDWB 1JZ6A 4XUTA 4XUNA 4AVBA 2WABA 2O0OA 1GOGA 4COZA 3LOBA 3DPRC 2Y6JA 1W8NA 2W87A 3ZN5A 5FQ0B 2EXHA 3USUB 5FP4A 3H7JA 2JECA 2VGDA 2FDKA 4FPOB 3T4VA 3JBG2 1XNKA 4MXWB 5LBFA 1J3PA 3CNAA 4KNCA 1V9U1 2W68A 3TN91 1APNA 1SLTA 2OQ7A 3KT4A 2JENA 2R1DA 2IFRA 4RS5B 4A44A 3W5MA 1GP4A 2BNNA 5EP9A 2BFUL 1CR7A 2PYTA 2W91A 4ASLA 4DEVA 4RFT0 4V2WA 4LBJA 3HQUA 4C90A 3WG4A 1QJEA 4Q29A 1JOJA 1X9PA 1OD3A 4NWWA 4AHZA 1NYWA 3NV1A 4KMQA 3NNMA 1POV3 3IMMA 4PBOA 3TN93 3OF1A 3BN6A 1JH5A 2DTWA 2QDNA 3AYCA 3CZUA 2WKKA 1CZVA 1NLSA 1MEC2 1S2BA 5JXIA 4HPKA 4IW3A 1VBD3 1RVF2 5FP7A 5TSWA 1POV0 2XJUA 2ZS6B 3VD7A 2MEV2 4ES8A 4URAA 2AGSA 5JSRA 2B42B 2LW8A 3DYOA 4LO5B 5FYVA 3HWJA 1XNAA 3CKHA 3IKWA 1ZBA1 3HEIA 4HG6B 4QU2A 1BCXA 4AL9A 2EVXA 3KCXA 4IEZA 1YIFA 1ALYA 3NL1A 1ND2C 5JOXA 1U12A 2D6LX 3IWZA 3NJXA 1BLZA 4FPFA 4A6SA 3SCGA 2ZGUA 4F7ZA 3IMNA 5E16A 4H55A 5A6ZA 1HB1A 4LE4A 5FYSA 1WMDA 3OBAA 2BU9A 2VZVA 3AKSA 3KD4A 4Q4V1 1ZZ7A 5L9VA 2HWC1 1RHI2 3DXUA 1GOHA 4BM8A 3AB0A 1RL3A 2ZGMA 4BIFA 4GB32 2UY9A 1K5MB 1ULGA 4JGYC 2E63A 5KXCA 3KZ4C 3ZXEA 4D6QA 1Q8QA 3JXSA 2HWD3 1VBC2 2WYFA 4Y1ZA 5IUQA 4XJ8A 3C7OA 3VDBA 3DN7A 5FYUA 2SBAA 2ARAA 1UL9A 1D4M1 3D82A 3J8F2 4YG3A 3N9QA 2YHJA 4QHOA 3VBHA 2W0XA 1BHGA 3AK0A 4Q4Y2 4R9CA 1VMHA 1EAH1 1W6PB 3KGLA 2VQTA 4ISRA 4Y1XA 2XPJA 3NNGA 4N43A 2QUOA 2BEOA 3N9PA 3WD5A 2WDBA 3I8TA 2CU5A 1JOBA 2R063 4AEKA 1YNAA 5J36A 5E6HA 4YW3A 2YZ4A 3O1VA 4DNYA 1PHMA 4ATEA 5CBLA 1BK0A 2VAUA 5HBAA 1AX2A 5FZ9A 2VU9A 2OUHA 5J7MA 3MV01 3GZTB 3SHRA 2PELA 1DP0A 2BGCA 3AMMA 4S2FA 2D6KA 2XVKA 4QKFA 4N90A 2Y6LA 1RMU3 2BDRA 3A0NA 2R061 3FUQA 5DZEA 4AFCA 5BYNA 4QPGA 5GLVA 5BNOC 4PIYA 1XSRA 2SLIA 1YO8A 2MHFA 2ZEXA 4C1XA 3AP9A 3ZIXA 1XNTA 1D2QA 1S0JA 1AJOA 2DCYA 1PO11 4Q4V2 4QQLA 5BXXA 3WCSA 1HKDA 4EROA 1EUTA 1Y9MA 2ZKLA 2J1UA 4QPGC 2VJXA 2D98A 2JDHA 1W9SA 4CP2A 4BISA 4JHTA 4B7KA 1W8HA 2RV9A 3BTXA 1CIYA 3S0MA 2AR6A 4FQZA 4LIVA 2I07B 3K46A 4PF1A 4YRDA 5FXZA 1AUYA 4LT5A 3N7MA 3RMXA 4ES9A 5JI9A 2XLFA 3PIJA 4Q8LA 3THCA 2LUWA 2RS53 5FY0A 1GP5A 3U0ZA 1HRI1 1L3JA 2XBO3 4CDQB 2XJTA 2ZZJA 3WF0A 1W8OA 4QGNA 3JQXA 1N47A 2RS13 2JDUA 3R05A 4U2AA 3WNNA 4B1LA 5CVRA 2GSYA 2JD9A 3AJYA 4PLMA 4EQVA 3H8XA 1VRBA 1QOOA 3VN4A 3F2ZA 2RS12 5SV8A 5J48A 1W9TA 2ETEA 3ENRA 3N7JA 5LASA 2I45A 2VW1A 3WW4A 2EAAA 1UMIA 1VJ2A 1XPWA 2VO5A 3OEBA 2TBVA 5FMCA 4Q4Y3 2W94A 5I0DA 4IERA 4UFIA 3OEAA 1FV2A 2X29A 5EZWA 1RUG3 1WKYA 4QT6A 1FAYA 5F1RA 5FPXA 2Q1MA 1KRIA 5CKNA 5FYYA 2GH8A 3S30A 3D4KA 5DAXA 4JKLA 3WNKA 2PHWA 3DKQA 4YW1A 1OH4A 2IXKA 2W52A 2E51A 1GQHA 2R32A 4B4PA 1DYOA 1FI2A 1IS6A 3I3BA 4FPGA 1UY4A 2W9XA 1J58A 1POQA 2XONA 4Z8BA 4MXVA 5F3GA 1HRI2 3ROUA 4CZSA 5FMBA
chains in the Genus database with same CATH topology
4L97A 1K5MC 2ZX1A 1ZM1A 2RS51 4XMAA 3VBRB 4EN8B 1MS4A 2GU9A 3I59B 4RSUA 4YZ4A 1HX6A 2A3WA 5D8AB 1WCKA 1HRV3 3I2DA 3IPVA 1W6NA 2VH9A 3B93A 1EPZA 1RVF3 2DUOA 1LOEA 5KHGA 4FQ4A 1ZNPA 1YFWA 2R043 3B9IA 1ND2B 5T55A 1GZWA 4JGZB 3PJYA 3CLPA 2A3YA 5EJ3A 1NLRA 1S0EA 4CEYB 3TBDA 5KXEA 3PJQA 3NKGA 1LRHA 4K8FA 2P3IA 4EV0A 2HEVF 4OI0A 3OGGA 3UJQA 2F4PA 3JQWA 4DY5A 2P2KA 3AZWA 4R4ZA 3AP6A 1QKQA 1SFNA 3WOGA 4AHWA 4SLIA 1OI6A 1H2KA 2B5HA 2HWD1 2ZACA 2ZKNA 1IKPA 2ENRA 1U0AA 5CFCA 4RHV1 1QNWA 1C57A 1AR61 4XFIA 4WVMB 4LO4B 2PTMA 3VBFC 1A6CA 1H4GA 2DURA 4CDXB 5J3UA 3QH6A 3MI8A 3M1HA 3AZYA 1QJU2 1LODA 3ZN6B 3SH3A 1O4ZA 1RUI2 2Z42A 2HWC2 3MW2A 3SITA 2A5ZA 4LBNA 1VRH2 4MYEA 2WFPA 1BXHA 4XFBA 3CJIC 5T5JA 4N7IA 4UBGA 4COVA 1GYKA 1C5IA 3ES1A 1VBA1 1MQTB 1RUI3 2ARXA 5DZGA 3AMHA 1WLWA 1F5FA 3LB9A 5A33A 2VW2A 5T5LA 1AZDA 1PK6C 4K20A 1NXD1 1C28A 2ES3A 3EO6A 3LA2A 1ENXA 1EYBA 4FPJA 3VL9A 1M06G 1R1A1 4R4XA 3TWIA 3APBA 1EV11 5JSOA 3GZAA 1MEC1 3BTAA 3MIHA 3PTYA 2RM21 2ZTNA 3FJSA 4JQRA 3UJOA 1LGNA 1N3QA 5JWPA 4OHVA 3IDEA 1N1YA 2AH2A 1DFQA 3FZ3A 4YVSC 1KS5A 1YI9A 3SXWA 4Q1RA 1R1A3 5LK5A 1RMU2 1EV13 4HSJA 2JJ6A 4MUVA 1QY4A 5FBZA 1UU5A 3GBGA 5C4WB 2RM23 3CJXA 4LUKA 4LA3A 2HWB3 1V6IA 2QKDA 3MF6A 1QJZA 4JGYA 4CP0A 1U5YA 3LA3A 4QGLA 4RR3A 5C8CB 1HIXA 1EY2A 5FRAA 3MIBA 2ZMNA 1NY72 1PGW2 1MZ6A 4QD2A 4QQ2A 2B46X 3NKTA 3H1MA 3J26N 1I9RA 2XKPA 1REDA 2ZOEB 1AL21 1JN2P 2VY0A 4HVRA 4DINB 1XQNA 3WW1A 4F3JA 5C8CC 4TLFA 3ST7A 5LRSA 5JLVA 1WW6A 4Q4W1 4WM8C 2WNVA 5H9SA 1OQEA 4RHV2 3AZXA 2PAKA 3QCWA 1J1LA 2OIIA 1WCSA 2B9UA 2HEYF 1GFF2 4M3CE 4Y1YA 2NLRA 1RHI3 1A8MA 3FC0A 3LKJA 2VOWA 3ZDSA 4O9EA 2BPA2 1ASJ2 4K21A 2RMU1 1D2SA 3BU7A 1QXJA 3AP5A 4Q4X2 5BNOA 1COV2 2YC0A 3ZFFA 1ZRFA 3UV9A 4IV3B 3M3CA 1EV12 3N7KA 1C8M2 1LKNA 1CAVA 4XJAA 1MS5A 1DQ5A 2ZGKA 4YGBA 4FBFA 4FPLA 1FX5A 1YIPA 2D44A 2JG8C 3B69A 4WZCA 1JXNA 4CTEA 4CDWB 5DDJ1 3U4XA 5E1RA 2A71A 1ZZBA 5C9AA 3V65A 1RUE1 4CDUB 4XW3A 1XNCA 3ZPYA 5GKAC 3IDCB 3NV4A 4AI8A 1G9CA 5KXBA 4U36A 1VBE2 1ZREA 3PNAA 1U5XA 4XEZA 2YDEA 3AKRA 5C4WA 4WVVA 3ME2A 3VHNA 3ZFGA 4RA0A 5L36A 3I4IA 1W6PA 2WQZC 2FMYA 4OHYA 3JZVA 3WDVA 1X50A 1BBT1 1OQ1A 1WMFA 3MZHA 2DUPA 5CU1A 2D3RA 5E89A 4WZFA 4BOWA 5DUUA 4XQDA 2E7TA 4IV1C 4B8EA 4AFMA 4HN1A 3P3NA 5E88A 4Q4X3 3TAYA 1ZRCA 1X8MA 1Q5OA 3P3PA 3OBTA 2OUJA 5CG8A 1RUF1 3LZZA 1H1IA 4EJRA 4A7ZA 2BQPA 5EYYA 1JUHA 1OQDA 4GKYA 1G9FA 3POSA 1UMZA 3WW3A 2DFCA 4F8AA 2D6MA 1BEV1 1TQ5A 5F6KA 3I59A 3MF9A 3ZSLA 1QH7A 1RUF3 3J8F3 1QDOA 2MEV3 3WQ0A 3VBRA 5FFOC 5BNPB 4YM3A 3CF6E 2HWB2 1NCRA 3VHRA 4PCRA 4P14A 2WJSA 1BEV3 4PIZA 3WCRA 3ZXKA 5BNQA 3H1YA 3LCPA 1AL22 1SMVA 3VBRC 4JV4A 4HMZA 2CV6A 3HD8B 1CAWA 4H3WA 4JC1A 3L2HA 1G9BA 4Q0PA 3ILFA 1TEIA 4L92A 1LB2A 2BVVA 1QJY2 3BALA 5GZFA 4BE3A 2PLV1 4WVMA 2GN7A 3GZUC 4KG0A 5GM0A 4H7MA 3ZO0B 2FZ1A 3H0OA 4Z2WA 5BUVA 2WINB 3KT1A 1AR72 3KCYA 1CVNA 4CDXA 1O3RA 2XJRA 1UKGA 4J1WA 2D6PA 5DUWA 3CJIA 5T3NA 3R4UA 3WHUA 4LBQD 4NHLA 3VZJA 5F9TA 4KL1A 4YW2A 1R083 3JU9A 4KGGA 3O14A 1J59A 2P3KA 1MVQA 1OLRA 1V6NA 2VXRA 1WMEA 4Y20A 4LNVA 3J8F1 2XVGA 3AYDA 4BA6A 2BBVA 4P9IA 1TE1B 4K7JA 1CJDA 4GMP1 4HFSA 3TOJA 5BNNA 1YFUA 3WG3A 1CAXA 2W39A 3PMSA 3ZXAC 1NOVA 1S0DA 2DUQA 3R6SA 4FOWA 4XILA 2QFEA 5JZGC 1QH6A 1XYNA 2DU1A 4Q0SA 4AFBA 3RYKA 3SH4A 3MDPA 1ZYBA 5FMOS 4FVVA 4N53C 4CEWB 3RYRA 5LEKA 3OCPA 1W0OA 4AI0A 4OI4A 1CESA 1YUDA 1LHNA 1QMJA 2ZBJA 5L7OA 4MGYE 2D7FA 1OOPB 4S2DA 1ND2A 3IPVB 4I02A 1W0PA 4COUA 4IEPA 4YM1A 4OZXA 3RS6A 5GLTA 1NA1A 1I3HA 1G7YA 4RHV3 1JHNA 3MYXA 3MFCA 4AQ6A 1LTEA 1C1FA 4YZ5A 1PK6B 1D0GA 5KXDA 3M7AA 1AX0A 1W6OA 1TME1 1AYM2 1VBE3 1PIV2 1CAWB 2JKBA 1H0BA 2XB6C 4R9AA 4LA2A 4S2GA 3VL8A 2D3SA 1WD4A 3E5XA 5JCTA 1QJX1 3KSCA 3THPA 1LEDA 2WFF1 1MACA 2Y0OA 3QD6A 4OI2A 4I09A 1R093 5KHHA 1NA1B 5AVPA 3WG2A 5JDBA 4RR3B 1OA2A 3ZVXA 3AM2A 4Q26A 4ZU7A 3WX5A 2BNMA 4NOTA 4F83A 1YJKA 4XDQA 4EN7B 4AI2A 5DG1A 1EP0A 3RI9A 3ZMNA 5AC92 5C8CA 2YROA 3VDDC 3HBZA 3R0RA 5J98B 2H0VA 2RR13 1F8VA 1BVVA 3WINE 4B3NA 3WDTA 4GXLA 1WGPA 5IK8A 1OD5A 2Q30A 1KJLA 3ZSMA 1OKQA 1LU1A 3ZFGB 5IK4A 1DZQA 1SCSA 3HAGA 4L11A 5JSPA 1BMV2 1HRI3 4XFGA 2RS32 1A8DA 5JZGB 2YPJA 4H14A 2D43A 4K3UA 2DCTA 4LO7A 4CEYA 2BWCA 1CGPA 3WW2A 3VDDB 1U5IA 1XNDA 5AC91 1QU0A 3MPBA 2R062 2VNRA 1H8TB 4AEDB 5A33B 1YFXA 3NWKA 3V0AB 3MGUA 4MZUA 2XBO1 2EXKA 4I2OA 1UIJA 2GN3A 1DLLA 2YXSA 3OD4A 5D8AC 1RITA 1S0CA 2DCJA 3ZN4A 1AR71 4A2UA 4Q4Y1 3USSA 2WZR1 2XBO2 4M00A 4I0AA 2GC3A 3GALA 4IEUA 2PHFA 1ZZCA 4AI3A 3H7YA 4GA9A 4IEQA 4AWDA 2VQ0A 1RC6A 1PZ9A 4WV8A 1C8NA 4MGKE 4YZ3A 4Y1VA 4B29A 5FOJB 2NMOA 2XLGA 2A6XA 4WM7A 1X36A 4Z82A 4B4RA 2XKOA 3WG1A 3UKNA 1K5MA 2EXJA 1AL23 2GDFA 4RQPC 3LSEA 1MQTC 2YMZA 1AJKA 5I0RA 4XPVA 3NAPC 3RJRA 2WA4A 4FOVA 3QACA 4YVWA 5JIUA 2EXIA 1ZBA3 3VBUB 2IFWA 1NCRC 4L2NA 1O4YA 2D5FA 5SV5A 3S6PA 3O0XA 3VV1A 3T2TA 2O8OA 1Q8OA 1RUH3 2XJPA 5A3LA 2ZA9A 2DCKA 2GMEA 4MLOA 1F5JA 3VBUC 2QNKA 3VKNA 1AYM3 4TSVA 2GMPA 1DDLA 2DV9A 1LOBA 5F5QA 1HLCA 5CFDA 3ZYPA 1X8EA 1D0HA 2HWC3 3R4SA 4GIQA 4RS5A 1UD1A 4MVTA 4I3GA 3ATGA 5KC6A 1A78A 2E9QA 5E8AA 1VBC3 1ZRDA 1FOD3 4LBQB 2IXHA 3K48A 3WP4A 1ONAA 4QPGB 3USUA 2P3JA 1QXPA 3NSTA 1UF2C 2NPIA 1HXS1 2E53A 3MIFA 4AGGA 4GB33 1G9DA 3M3QA 5BY5A 3VKLA 1FOD2 2XWBB 1VBC1 1WW4A 3BCWA 5LEJA 1BK1A 1QQP2 1Z0HA 2H6CA 1XYOA 2WS91 2H0BA 2RR12 5K0UB 4GULA 1LOGA 2DVAA 4YM2A 3RPQA 1H8TA 4AEDA 2DFBA 4QM8A 4COYA 3KM5A 2QE3A 1O3QA 4LBLA 1Q8SA 4NO4A 4YGCA 2ZX4A 4KWJA 1MS3A 4UBHA 2JG9A 3RMYA 4M3CB 3QOPA 1G86A 1Y3TA 4OHWA 1LOCA 3NJZA 4ZU4A 5JIAA 4BQ1A 1LULA 1GICA 3EHKA 1VBD2 1SLCA 5L7OC 3ZXDA 2JG9C 2Y0IA 1MEC3 4OUSA 3EBRA 1H4HA 3VUOA 4FOQA 3MPPG 3WQ1A 5DUVA 4A3XA 2A6YA 4J6GA 5AFEA 4XQ4A 1DBNA 2R0FA 4KGQA 4I0WB 2GMMA 4MV2A 3I54A 2YGLA 3AYAA 4W6XA 4Q4X1 1W6MA 2BYVE 2RMU2 3MLJA 2NZ9A 1RUOA 3M3EA 4NN0A 4D7SA 1DU3D 1V6LA 4I3PA 1CPNA 2CWMA 4Q8KA 4YYOA 3E97A 3WUDA 5D1IA 2YV8A 2K9ZA 1YLLA 3DKWA 4NHKA 2PN5A 3OTFA 4Q2FA 1VRH1 1RUJ1 1OMIA 1I1EA 4H7LA 4HSLA 1RGSA 1V6OA 4FTBA 1YRZA 5IK5A 1AXYA 3PVNA 2PLV2 2Y38A 1QJY1 1C4RA 3KB5A 4M0HA 4OI1A 4Z1VA 1KDKA 3MEPA 3RG0A 1SEFA 4WM8A 4DPNA 1M4WA 2GNDA 4D94A 5HI0A 5J96B 1C3HA 2Z69A 3VKFC 4N43C 1RUJ2 4QQHA 3M70A 1RUE2 4AGVA 1H2MA 4WBBA 1N3PA 2E6VA 4XJWA 3H3ZA 4TYSA 3FUOA 2RJKA 1HQLA 5L19A 5I0TA 4CDWC 4YVSB 5CADA 1PNGA 5K0UA 2DVBA 3L2YA 1IZ3A 5ABJB 5FO9B 4DZGA 4PJYA 1XNBA 2VUAA 1HDKA 2WNVB 1D4M3 4OVEA 4X8NA 4B7EA 2WQ4A 5FMOL 1LCLA 1AR73 3K51A 1CAUA 1R1A2 1Y43B 4ATFA 3VBSC 3ELNA 4PDWC 1DYKA 2RMU3 1LESA 1H1MA 3CO2A 2HWE3 5J09A 3WNXA 4DY3A 4BZ4A 5B2GB 5JAXA 2WT1A 4LBKA 3ECQA 5T5OA 5BV6A 1OHFA 4Z92B 2FHRA 3N36A 2WT2A 1FMD3 3FE5A 1R1ZA 5GJ6A 4L8QA 3AZZA 1PNFA 3X29B 2Z5WA 4I30A 1F31A 3PVEA 1RUC3 1QQP1 1V00A 4YVWB 4X6QB 4HK9A 1ZA4A 2VULA 1KITA 3ZMOA 3SH5A 2QJVA 4MX3A 1SCRA 3JBG3 2JICA 2V09A 4LLFA 4K6BA 5JI7A 2TUNA 1S0GA 5I0SA 2UU8A 1IOAA 3GBWA 5LRRA 1QJU3 1IKQA 3JD73 5ACA3 3SLIA 4QXKA 2HWE1 3ZFGC 4EN9B 2WL1A 1S0BA 2MNGA 4B4QA 2ZAHA 3B02A 1AR82 1J3RA 1IQAA 5DUXA 2PHTA 3RWNA 2X8KA 5C8WA 5DXDA 4BMBA 2LTNA 5C6CA 4YZ2A 1PGSA 1NG0A 1Z7S1 5KBFA 3WZ1A 4XF9A 5KHJA 4EWDA 1GNZA 1REFA 2EA7A 1TMF2 4XXPA 1OPMA 1NCRB 4E4DX 5I8YA 2JX9A 1DG6A 2JDZA 2IZWA 3VBUA 2I2SA 3CL1A 3M8LA 3OY8B 1JBCA 5JOZA 1BMV1 2YGMA 3ACLA 4CEWA 4XFFA 2LM3A 2A6VA 1UZZA 2WLPA 4QPIC 2C0ZA 5IT6A 5JPNB 4P5HA 3LAGA 1RB8G 4PBPA 2EIGA 2ZX0A 3MFAA 4JCKA 1V70A 3ZFEC 1DGRA 3HT1A 1UKRA 2EF6A 5GLWA 1CPMA 2ARBA 4TZDA 2GZWA 2R071 5A32A 1HRV2 4ORFA 1H1AA 3ZYGA 4LBQA 1SBDA 4HL0A 1A3KA 3HMYA 1AX1A 2R16A 5GLUA 4YNIA 3KMHA 3DPRA 3B01A 2C1FA 3PVBB 2ZGQA 3WUCA 3B94A 4R9BA 1FYUA 2CL2A 3VZOA 2HWF2 2GAUA 3ZSEA 1JYCA 3J4UH 2RE9A 1H9WA 4NPRA 3LOIA 2QZ2A 1UW8A 4XHXA 1RINA 1W6NB 1RUG2 2P17A 1GBGA 4JGZA 4OHXA 3O0VA 3HN1A 4MH0E 5FPZA 4PLNA 2IWGB 4CDQC 1B09A 4QM9A 5I91A 2G4IA 4MGIE 5HCFA 1H8TC 4AEDC 3A0KA 3BIWE 2GNMA 2VNOA 1VBB2 3B9CA 1RHI1 5C9AB 4LEJA 1ND3A 2R041 1AR93 2Q0AA 4AVVA 2ZJCA 1RUH1 4LULA 4DOUA 5ABJA 2UYAA 3FFZA 4YVSA 1DQ2A 3OGJA 5GZCA 1DQ1A 2PHXA 4P9GA 1PVC2 1OPOA 1HQWA 1NE6A 3ILNA 3VLBB 1G9AA 1YXWA 1DZTA 3VBHC 2IC1A 4JDNA 4CYDA 3FBMA 3V64A 1QJU1 4FPKA 2PFWA 4EN0A 1POV1 5A3MA 2Q4SA 1W6MB 4EN6B 3M4FA 1GR3A 1NCQC 2TEPA 1OFNA 3NVCA 2DVDA 2OYZA 3CEWA 1XE8A 4IEWA 4LBMA 1CN1A 1H9PA 1UU6A 1RUD1 1NCQA 3S7IA 4IXLA 4Y22A 5I8TA 2GNBA 1TME2 5FREA 3EQEA 2CGPA 4E9KA 2RS11 3B7MA 4GH4C 2XL9A 3J9SA 5K0UC 4AHXA 5H9QA 2C9AA 3H1WA 2CAVA 3WP5A 2EALA 3VBSB 4HVOA 1HXS3 2V73A 1DF0A 4JVAA 4IQPA 1Z78A 1MVEA 1VBA3 4LUMA 4QQOA 1PVXA 3RRDA 1KQRA 4DS0A 3MW4A 4K40A 4GB31 4DXZA 4JRAA 2WNVC 4XBLA 1MZFA 4I0BA 2VOVA 3URFA 4LO8A 4HLTA 2UURA 3MICA 2HWB1 1N1SA 4HT1T 1UX6A 4BH9A 1PMIA 2OZ6A 4C1WA 1QXRA 5JVVA 1W6QA 2BUKA 3C3VA 2NN8A 4HK8A 1MZ5A 1PO12 1CAUB 1VAMA 2HJIA 4KU7A 1X33A 3WDWA 2D97A 1Q8PA 4C0BA 1RJ7A 3WDXA 2ZGRA 4PLOA 5EYXA 2UWAA 2VG9A 5I8SA 2DTYA 3ZN6A 2A75A 3WVJA 4JTNA 1E57A 1AR81 1SLIA 2VW0A 3JCIA 2R073 2IXJA 5FLHA 4P9YA 1X7NA 5JMCA 5DZFA 3ZSJA 1PIV1 3CJIB 3FFQA 3AJZA 1LENA 3TN92 3VBOB 4ASMB 5BNNB 1VB4A 1AR83 2R30A 1D4M2 3M3IA 3SCFA 4IV1A 3NW4A 2DCZA 2WZR3 4ZU5A 1HRV1 3E5UA 4X6RB 4AQ2A 3TNPB 3ZXJA 1RJ8A 2WZPP 1HV0A 1OOPA 3FWEA 1QJY3 2BW8A 4IL7A 4Q4V3 5L7OB 3IT8A 2RS31 4Z07A 4UW5A 4AW7A 3M3OA 2QQPA 4XE9A 3H8UA 2H6BA 3VBOA 2ILMA 4FP3A 1N3OA 2UYBA 1FATA 3AP7A 4Q0UA 2XJQA 4WM7C 1VP6A 2Z79A 1PGL2 1N1VA 1OFSA 5JOYA 3ZXLA 2O1QA 2RJLA 1W6OB 1DGLA 4SBVA 2CWSA 1RVF1 1UU4A 5K7PA 1ZZ8A 3FMGA 3MIDA 3UL2A 3ZYRA 3PLQA 5C33A 2MPFA 3KLSA 5EXOA 2XGXA 1GKBA 3VBFA 1JW6A 4FCAA 1BBT2 2CAUA 2D6OX 2V5YA 2HWF1 1WLDA 4ONUA 4XIKA 3JB8A 2VMHA 1S1AA 2QVSB 4FXKB 2GC1A 1NE4A 2I74A 2PHLA 4GMP0 1JUIA 4RS5C 2WT0A 4CP1A 1IS5A 2B45X 1C1LA 4MGZE 2ZHLA 3D5OA 1V6MA 1VBE1 4V1PA 2NM1A 1MZEA 2R072 2XJSA 3AFGA 3DPRB 4KU8A 1CAXB 2VPVA 3INAA 2Q8OA 4YLZA 1ZZ9A 4CDQA 5BNNC 3GHNA 1ZRRA 2WFF3 3B00A 4FPYA 1RUC1 3NV3A 5BNPA 2ZAAA 3W9AA 5CFCB 2WS93 1LOAA 1XRUA 1Q43A 3NAPB 4RGAA 1Y9QA 4YFZA 2D6NA 2UWBA 5JZGA 3LSDA 2X5IB 2G9GA 3FLRA 4Y1UA 4YW5A 5T52A 5GLZA 2O8QA 4JDMA 1PO13 1ZBE3 2R042 1ENSA 4YARA 2IXIA 2D3PA 1RUD3 4BMEA 4HVQA 1T6GC 3L9JT 5HCAA 3FBYA 3BOWA 4ISQA 2DU0A 3WHTA 5CB7A 1PK6A 4HN0A 2GALA 4DRRA 1J3QA 1C5HA 2WC2A 3G7DA 1ZBE1 4IV1B 3JD72 1SBFA 3RZZA 2WWSA 4D69A 4UXAA 5ABJC 3UKVA 3R4DB 4JRLA 1BYHA 1COV3 1B35A 1RUNA 3WV6A 1Y7BA 2ZHKA 1ASJ3 4IEVA 4R52A 2GC2A 1ZZ6A 1XYPA 4KWLA 4XFAA 4YFWA 3AXEA 3D8CA 4WM8B 4Y24A 3ZXGA 1B35C 3POWA 4QPYA 4G4FA 3GBFA 3WDUA 4G9SB 4R9DA 4DQAA 1SLLA 2YYOA 1PO22 2R49A 3WP3A 1V6JA 3RJ2X 4N9IA 4XBNA 3KCCA 1PO21 2NQYA 2K0GA