3NAPB

Structure of triatoma virus (trv)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
247
structure length
247
Chain Sequence
KQMNVNSSQDTTFEQRSQEKVQAGEINESIEFRNQITTFVHDNPIITEQLIGDSPQPSGDVRSVSDARTHSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIREKLSGFTSFSASTVFHIQVNAHPFQCGRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPHVQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystallographic structure of Triatoma Virus (TrV) highlights the Dicistroviridae and Picornaviridae family differences
rcsb
molecule tags Virus
molecule keywords Capsid protein
total genus 50
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3napB00
4WM8C 5BNNA 3NAPB 1K5MC 2HWF2 4IV3B 1VAKA 1EV12 2RS52 1RHI3 2HWB3 3JD71 1QJX1 2WS93 1R083 3VBOB 1AR63 1HRI3 1NY71 4CEWB 3LOBA 1RUH3 4N43A 5AC91 2WFF1 1MQTA 2RS31 3VBFA 5DDJ2 2RMU3 4CDWC 1BMV2 4RQPC 1POV1 1RUH1 1A6CA 1RUI1 3VDDB 1TME3 2RS33 4RFT0 1QJZA 1AYN3 1VBC2 4CEYA 1VRH1 1RUD2 1AR91 1TME1 3VDDC 2HWF3 5CFDC 1TMF3 4YVWA 3VBOA 4Z92B 4GB33 1RUF3 4CDWB 1RUE1 5K0UB 4JGZC 1R093 1QJY2 4PDWA 5ABJC 1HX6A 5D8AA 2HWC1 5K0UA 2RS51 4CDUA 5C8CC 3VBHA 1MEC3 2RM23 1C8M2 1AR72 1NG0A 3J8F3 1H8TC 5J96B 4FTEA 1MEC1 2RM21 1QJY3 1RMU1 1AR62 1PGL1 1D4M2 1ZBE1 3IDEA 4YVWB 1HXS1 2R043 4QPGA 3TN92 2VQ0A 4Q4W1 1VBA2 1HRV1 1ZBA1 1V9U3 5AC92 1ND3C 4Q4W3 1HRV3 5BNNB 1RHI1 1AL22 1PGW2 1RUC3 4YVSC 2BFUL 1HRI1 4QPIC 2IZWA 4CEWA 4Q4W2 1OOPA 1R092 1CD3G 4QPGB 1F8VA 3TN91 5K0UC 3JD73 2HWB1 2FZ2A 1QJX3 5JZGB 1RUI3 2RR12 1NCQB 2FZ1A 4N53B 2RS12 1V9U2 1VRH3 5AC93 4RR3B 2HWB2 5BNPA 1HXS2 2BUKA 4CEYB 1RUJ1 5CFCB 4GB31 1RUH2 3VBUA 4RS5A 1RUG1 3DPRA 5A33B 1PO12 5CFCC 2RS53 1NY72 3VBRB 1VBE2 1VB2A 1BEV2 4YVWC 1R082 1QJX2 1RUD1 4IV1B 3CJIB 4CDQA 1K5MA 3ZFFC 1QJY1 1VBB2 1PO21 2ZTNA 4Q4X1 4RR3A 1RUE2 3CJIA 2HWC3 1RUF2 2HWD3 2R041 1R1A3 1TME2 1PO23 1H8TA 2RS32 2Y26A 1PVC3 4QPIB 1NA1B 4RQPA 1RMU3 2PLV3 1RUC1 1OPOA 2WZR3 4RQPB 5DDJ1 1FMD3 1EAH3 4NWWA 5C9AB 1ZBA3 1ND3A 2WZR1 1OHFA 4GH4B 5A32B 2QQPA 5L7OB 2HWD2 4JGZA 3M8LA 4GB32 1NOVA 4GH4C 1FMD2 1VBE3 5L7OA 4RHV2 3S6PA 1CJDA 5BNOA 1OOPC 1AR61 1RMU2 1WCDJ 1RUJ3 4PDWB 1MEC2 2RM22 4N43C 1W39A 4WM7C 2MEV2 4WM8B 1BBT1 4RS5B 5C9AC 1R1A2 1POV3 3DPRB 2R072 1EV11 3FBMA 1Z7S2 1AYM3 1FOD3 1SMVA 2RS13 1RHI2 1RUG3 4IV1A 5CFDA 4YVSB 2DF7A 2XBO1 4JGYC 1AR92 1ND2B 1X33A 4GMP0 3JB4C 5GKAC 1VBB3 1X36A 4CDUC 5C8CA 4FTSA 1PVC1 4CEWC 3VBHC 3J8F2 2X5IA 4GH4A 2HWE3 2BFUS 5A32A 1RVF1 5L7OC 1NA1A 4BCUA 2WFF2 1B35C 2WLPA 5BNOC 4RHV3 1AR83 1ZBE3 1VB4A 2HWC2 4QPGC 5BNPC 4AEDB 2R061 5C4WB 4JGYB 1ND2C 1NCQC 1PIV2 1IHMA 4Q4V2 1ASJ2 1FPN3 4GMP3 1D4M3 1GFF2 4IV3A 1VBE1 1QQP1 3HAGA 2X5IB 5ACA2 3JBG1 1AL21 1QJU3 2TBVA 1AL23 1PVC2 1HRV2 3CJIC 1RUI2 4WM8A 3TN93 1VBC3 1POV0 1ZBE2 1F2NA 2WS91 1EV13 1R081 3VBHB 3VBUB 3ZFFB 1ASJ1 1AYM1 1FOD1 1NCRC 3JBG2 3JD72 4Q4X2 2BBVA 2WFF3 1BBT3 4N53C 2RMU1 4CDXA 3VBUC 4CDWA 5ACA3 2PLV2 1C8M3 1PO13 1B35B 3ZFEA 1E57A 1MQTB 1NCQA 3VBFB 5C8CB 1AYN1 4IV3C 3VBSA 4JGYA 4CEYC 2MEV1 3VDDA 4CDQC 1TMF1 2BPA2 1RUD3 1AYN2 3ZFFA 4RHV1 1RUE3 1R091 5BNNC 5JZGA 1VBD1 4N43B 2HWD1 2X5IC 4AEDC 4JGZB 1COV3 2HWE1 2R063 1NA1C 1RVF3 5FMOL 3ZFGA 1B35A 1BEV1 1VBD3 2R073 3ZFEB 1DDLA 5C9AA 1MQTC 3VBFC 4Q4V1 1AR81 2PLV1 2HWE2 1BEV3 2R071 3VBSB 3JBG3 2WS92 1QJU1 1Z7S1 1HRI2 4N53A 4WM7B 4CDXC 5BNPB 3VBRA 1PGW1 1V9U1 1Z7S3 4Y5Z0 1NCRB 1TMF2 1PGL2 4CDXB 1VBC1 5A33A 2RR11 3NAPC 1M06G 5BNOB 4CDUB 3VBOC 1EAH2 3VBSC 1RVF2 4YVSA 5J98B 2RR13 1QJU2 1PIV1 1H8TB 1RB8G 5ABJB 1AR73 2RMU2 2WZR2 1AL0G 4WM7A 3JB8A 5ACA1 1C8M1 1AUYA 1HQNA 1PIV3 1PO11 3ZFGC 1NCRA 4EJRA 1ASJ3 4FSJA 1ND2A 3ZFGB 2MEV3 1ND3B 4IV1C 2RS11 2XBO3 1BBT2 3VBRC 5C4WA 2R042 1RUF1 5CFCA 4LLFA 4SBVA 1OOPB 1QQP2 1VBB1 4Q4Y2 4QPIA 1BMV1 5D8AC 1PO22 1AR93 5JZGC 2HWF1 2R062 4Q4X3 2WWSA 4AEDA 2ZZQA 4RR3C 1AR82 1AYM2 1COV1 1FOD2 4NWVA 1R1A1 1VBA3 3ZXAC 1K5MB 1RUG2 1VRH2 4Q4Y3 1ZBA2 5FMOS 1VBA1 4Q4V3 1C8NA 1RUC2 3J8F1 5CFDB 4Y4YA 2ZAHA 4Q4Y1 4FTBA 3ZFEC 1VBD2 5FOJB 1RUJ2 1FPN1 4GMP1 1D4M1 1QQP3 4RS5C 5DDJ3 1FMD1 3DPRC 1EAH1 2XPJA 2GSYA 4CDQB 5D8AB 1AR71 1HXS3 5C4WC 3NAPA 1FPN2 2GH8A 2XBO2 4PDWC 5ABJA 1COV2 5LK7B
chains in the Genus database with same CATH superfamily
1URXA 3WG4A 4L97A 4OHWA 1IG3A 5BNNA 1ALYA 2JDKA 2EXJA 2JE9A 1MZ6A 1YQ5A 3WNKA 4BJ0A 1DYOA 2VCMA 4JHZA 2NYYA 2WS93 4FPKA 3BUCA 1LOGA 1R083 1RGSA 4M00A 5FY5A 4CP2A 1AR63 1HRI3 1L3JA 1OC1A 4IXLA 3UESA 4A44A 5C5TA 1DHKB 4N43A 4IEWA 2J1UA 3SC7X 5FBZA 1AF9A 1AXYA 4YARA 1MVQA 5FZ4A 1QXJA 2JWPA 2RMU3 1XQNA 3C7HA 5EWSA 5A7WB 3NJXA 1ZRRA 3N9NA 1QDCA 1RJ7A 4A41A 2WT1A 1RUH1 2EIBA 1QEXA 1A6CA 4P5HA 2BWAA 1W06A 3VDDB 1TME3 3LIGA 2AH2A 3BCWA 3OBTA 4MGKE 1NE4A 5FYVA 1OQEA 3ROUA 3CKHA 3HWJA 1YC61 4RFT0 5H9SA 1YIPA 2D97A 1DQ6A 4RGAA 1NAEA 4LORA 1CN1A 3MF6A 2R7EB 1ENQA 4QB1A 3UJOA 5FZ7A 2HEWF 2XWBB 5CFDC 5DZFA 4BQ1A 1CIWA 1HLCA 2DU0A 4MLOA 4TLFA 4Z92B 1GLHA 1RUF3 4CDWB 3ALQA 1F35A 5FWJA 2QQJA 4JGZC 3I2OA 2XWJB 2DU1A 3HQRA 4LITA 4PDWA 4EYUA 1UOFA 1HX6A 5FP7A 4XBNA 5FJHA 3H0OA 2A3XA 4XFAA 3OSDA 1IS6A 2A6ZA 3O5SA 3VBHA 3U75A 3WP6A 2XJSA 3VZKA 1C8M2 4WVMA 1H8TC 2QQOA 5J96B 2Y6KA 4BQWA 1MEC1 2RM21 3ILNA 1D7PM 4Q1PA 4LO8A 3AP6A 1UZ0A 1D4M2 1JI6A 1V00A 1E5SA 5A3OA 4QPWA 1SACA 4DXZA 4GXLA 2JIGA 5FYCA 5FP3A 2R043 2VQ0A 3PJYA 5FYMA 5LBBA 1MACA 5T54A 1W8ZA 5K9YA 1O8PA 1R1ZA 2CY6A 3N3HA 4OUMA 2KA3A 5CADA 1NQJA 3ZMOA 4AHWA 2EIEA 1GANA 3PIGA 4DXSA 3DKWA 4EN7B 3M3OA 1I5ZA 1EUTA 1UY1A 1V6JA 1ZZCA 3NNFA 1R64A 2WRAA 3FC0A 5LBFA 1RUC3 3I3DA 2A5ZA 2DVDA 4YVSC 5GZDA 3SEEA 3VD3A 2D6OX 3OY8B 2R0HA 3VLBB 5J36A 4B4QA 1UQXA 2VAUA 2VR4A 3O1OA 4XJUA 4JZRA 1GWLA 3AKTA 3TNQA 3VL9A 3K3NA 1SLLA 4CCKA 3SCGA 3T2QA 2WUHA 1HDKA 2QZ2A 3NJVA 5A6ZA 1R092 5IK4A 2ZGPA 3JD73 1QJX3 1UNBA 4JVAA 5HCAA 3FX3A 4FP2A 1YXWA 2GH2A 3UYJA 3BIWE 1MS8A 3IIIA 3QH7A 1KDKA 3ES1A 2FZ1A 2RS12 5D2AA 2OZ6A 2JG8A 3H1YA 1HB3A 4RR3B 2HWB2 3Q8EA 5I0SA 3IMMA 1VR3A 1DIWA 4CEYB 5A6YA 1RUJ1 3VDAA 4GULA 3WNXA 5CFCB 3Q8CA 1UY0A 1UMHA 4AF9A 1YUDA 4UW6A 5F1RA 4RS5A 3W5MA 2DVBA 5A33B 2YBPA 1A8MA 4XMIA 1UXXX 1ONAA 2GP3A 1LOCA 4Q0PA 1APNA 2UWAA 2Y8KA 1PO12 1X50A 4MV2A 5CFCC 3DCQA 3OTFA 4Z2WA 1O3RA 1AXKA 4D69A 3MLJA 3GCWA 1VBE2 1VJ2A 3IDAA 4QKBA 5AVAA 4Q2FA 1MS5A 2PHWA 4XDQA 1V6LA 4WVMB 4LBKA 4HONA 1QOSA 3MW3A 1OLMA 2XKPA 2Y6JA 2ZA9A 4Q4X1 4XYXA 2YYOA 4UT5A 2ETEA 4XURA 4ZPIA 2UY8A 5LK5A 1BVVA 4CYDA 1LCLA 4R4ZA 1JYCA 2WA4A 2HWD3 3ZLIA 2C26A 5B4NA 4LEJA 3ZPOA 4NRMA 4B4RA 2FDIA 2CAVA 2Y26A 4UI9L 5GLUA 4GJYA 4NPMA 4DMIA 5DQ0A 5T50A 4LQRA 3BI3A 2D6KA 3TAYA 1NA1B 2C0ZA 3THPA 1UKRA 3ORJA 4RQPA 3O1UA 2ZKNA 4A4AA 3BOPA 3ZN6B 2GC2A 2PLV3 4GKXA 5FKBA 1RUC1 2XJPA 3WW3A 4CE8A 3IAPA 4Z2AA 1V70A 5IHRA 4RQPB 5DDJ1 4HPKA 4DB5A 1O4ZA 4IGOA 1W6PB 4LHLA 5FY8A 4NWWA 3WG3A 4XAEA 2CGOA 2QVSB 1IPKA 4OMCA 1E5HA 1OLRA 2ATFA 2ZAAA 1OBNA 1OA4A 5A3WA 1E5IA 4MGQA 2W92A 2E31A 2YC4A 2ZOEB 2HWD2 4GB32 1UY2A 4IW3A 4Y22B 2DCYA 3WDWA 5DAVA 4XILA 2W46A 1DGRA 4RGGA 1VMFA 3S6PA 3VHRA 1FV3A 4O65A 1CJDA 1W8WA 4OHVA 5BNOA 1OOPC 4KWKA 4PDWB 1JU4A 1MEC2 2RM22 2P34A 3IDBB 3LB9A 1S4CA 3AYCA 3NV3A 4OUSA 1W39A 4QD2A 5F2SA 3U07A 2JX9A 1GQGA 2D43A 1XSRA 4FQ4A 3BTAA 1BBT1 3IN9A 2AUYA 4RS5B 4XAAA 1WD4A 2NM1A 3DPRB 4KMQA 4XFHA 3T2TA 3POBA 4K8FA 3Q9OA 5FZ6A 3K3OA 4JDOA 1UPSA 4V2VA 5KXEA 2OXBA 1EV11 4JRLA 1GNHA 1VP6A 2V4VA 2VMEA 3GBWA 4LA2A 3AMNA 2VMHA 3ACIA 3MFAA 4XF1A 3NKTA 1JYVA 1AYM3 1FOD3 4IGQA 4Q0UA 4XQDA 4NIHA 1L7LA 4TSVA 1CONA 1RHI2 2RS13 2DYCA 2G1MA 2DF7A 2XBO1 4OCTA 3PUSA 5BXXA 1ULGA 1US2A 1AR92 1W2AX 1PNGA 1W04A 5CBLA 4QHZA 5H9RA 1H2LA 1NUKA 2Q30A 2YZ4A 1V0AA 2W47A 2H6BA 4OZXA 5A3NA 1OVSA 3T1LA 5GKAC 4CXWA 4RL7A 4LT5A 1X36A 1FV2A 5BNQA 5T5OA 4UW4A 5C8CA 3ZXKA 1DBNA 4AI2A 3J7LA 1YYNA 3HQUA 3PNAA 2F6BA 1PM4A 1GBGA 2BV4A 2VZ3A 2EXKA 2MNGA 2FHRA 3NJYA 2D5FA 1GKBA 1QWRA 2WFF2 3D3AA 1B35C 1LECA 5FZ3A 2Q1ZB 1NLRA 4RD7A 5BNOC 2PQSA 4JC1A 3OGSA 2VZQA 4ZS3A 1BZWA 3GYDA 4GD4A 4R9AA 4AXOA 1ZBE3 3D4KA 1T6BX 4GKYA 1VB4A 2CDOA 4Y1VA 1DQ5A 5FP9A 3S7IA 5C71A 4TLGA 4PIYA 3O7OA 1ZNPA 4XDOA 4XXPA 4BLJA 3PTRB 5FZKA 5JOWA 3DEMA 2JDZA 5LZ6A 1NE6A 1UU5A 1PIV2 4OI4A 1IHMA 3G6JB 4AW7A 1GYKA 5FZ9A 1ASJ2 3BKZA 3TBDA 1D4M3 1AJKA 2GP5A 2MHFA 2ZS6B 3GCXA 1VBE1 1TG7A 4GMP3 4IV3A 5I0DA 5L19A 3ST7A 1V6NA 1RUNA 4XJ9A 5ACA2 1ZRIA 4LNVA 4QHBA 2GN7A 1AL21 2VZRA 4AI0A 3U0ZA 3AP5A 5BUVA 3IM0A 3PL0A 1C57A 2E7QA 3MIDA 3AZYA 4B8EA 2D7FA 2CGNA 2TBVA 1AL23 3AFGA 4DPNA 1MZEA 1DGLA 1UXZA 2YV8A 4FQZA 3OPWA 4K1YA 2A73B 3VUOA 5FLJA 2XJVA 5LA2A 1VBC3 1POV0 1GQHA 3FZ3A 4E2SA 1CAXB 3N35A 3WF2A 3K4DA 3DL3A 2WJSA 3MBWA 3MLLA 3WQ0A 1W9TA 3ZXJA 3VBUB 1F31A 3KQ4B 2O8QA 3WCRA 3JBG2 4PJYA 2CHHA 3K51A 5FZHA 1QGLA 2K0GA 3PUAA 4EN8B 1BBT3 2X29A 2FDJA 4L8QA 4M01A 4N53C 3RZHA 1CESA 2A1XA 2AC1A 2GALA 2GC1A 3FFQA 4YNIA 3VBUC 1DZRA 5FYTA 1DGRN 2E53A 5KBFA 2VZ1A 1HQLA 4R8HA 5A70A 3AMPA 2ID4A 2BJSA 5JXHA 3WG2A 1LHOA 4XJ8A 4HK9A 3ZKUA 1E57A 2YB7A 3N9PA 5CNAA 4E8CA 4IEOA 5GZFA 3T2PA 2YUEA 2Y0IA 3RS6A 4AK3A 3B9CA 2C9KA 1DP0A 4IV3C 3PVEA 1MZ5A 1NZCA 1WA6X 2V73A 4CEYC 1L7RA 2RDQA 3VDDA 1PK6B 5FZ1A 4ZZ5A 3ZFFA 3J7MA 1RXGA 4BQ4A 4P9JA 3ZIXA 4MGIE 4Y5TA 2OA2A 1DZTA 4YSFA 1V6IA 1Z78A 3K2OA 4M3CB 2EICA 2X5IC 3CHXA 3IAQA 2O8OA 1SG3A 3WUDA 4FOWA 4BDVB 1RVF3 5C5UA 2BZDA 4WVWA 5GJ6A 3VD5A 1BEV1 4NRPA 5C3SA 1O6UA 4ARYA 2JB4A 3O0XA 1JYXA 4FAGA 2XUEA 5HCBA 2HH9A 1BLZA 2D98A 2JB8A 5JSRA 5LCWL 3B7MA 4GWNA 1W6NA 1DG6A 1OQDA 1W6MB 4XZUG 5EV7A 2CAUA 4OI2A 5G05L 5H9PA 1Q8SA 2R071 2JD9A 3SLIA 3J4UH 2WS92 4IEQA 2BNOA 4IE6A 4FO9A 4FOVA 3RGBA 5A6XA 4N53A 3HIFA 4QGMA 5DAPA 4TZDA 1CZSA 2G9FA 5CVRA 4DUVA 5BNPB 4AGVA 4I30A 1PGW1 1UCXA 1JUHA 1Z7S3 3ZIWA 5DUUA 2FD8A 4C8DA 2AEYA 3KT1A 5LEJA 4OQ8A 2GZWA 3C7GA 2HKXA 4XACA 1ENRA 4MZUA 4QB6A 1C4RA 1UZYA 5FYZA 1LGCA 2V4AA 4CDUB 5JR2A 1ZX5A 3VBOC 1EAH2 3NQHA 1Q43A 1RVF2 3EB7A 3M7AA 1O4TA 3USUA 3M70A 4IEPA 1GP5A 3FHAA 1YI7A 2V5YA 2SBAA 3WQ7A 4FPEA 1EP0A 1PZ8A 3X29B 3QLQA 1SQ4A 5ABJB 3WQBA 2KXLA 2WZR2 3K48A 3ELNA 4WM7A 3OBRA 3RJ2X 4X8NA 1AUYA 1PO11 4LHSA 2VU9A 2F4PA 4K6BA 1ASJ3 2Z4FA 3AKSA 4JTOA 2W52A 1GZWB 1W9WA 3P3PA 1W9YA 4PLNA 4COZA 1ZM1A 4J6GA 4A7ZA 4O9EA 4YW3A 3WVJA 1TVGA 4IV1C 4RGKA 4D3WA 3WW4A 2RS11 2LTNA 1HB1A 1BQPA 2E33A 2R0FA 2VNGA 4LTAA 1QNWA 4Y5SA 1BBT2 1JZ4A 3DGTA 2FDFA 2WZ8A 3GZAA 3RNSA 1W2TA 1UYZA 4KGQA 2R042 4M4PA 4AAPA 1K12A 1RUF1 2VXRA 5FDBA 5JIUA 5C33A 4DIQA 1FATA 1POQA 3GM8A 4SBVA 1KRIA 2J1VA 1OOPB 2WAAA 5FZAA 3WR0A 5F32A 2ZKLA 5GZEA 1KQRA 4Y1YA 3B00A 4Q4Y2 3ZVXA 4L99A 3RZMA 5FLHA 4WBBA 3WUCA 5FY9A 2EXHA 3H8UA 5K8SA 3B5LB 4Q0VA 1OMIA 5JZGC 5FRAA 3E5UA 1QKQA 1S2KA 2AGSA 2W39A 4ASLA 1O8SA 3A21A 1U0AA 4FP3A 4INDA 5EZWA 5FK7A 5JAXA 4UWDA 3HN3A 4I3GA 1LOEA 3ZXAC 3MZHA 1CIYA 4Q4Y3 4E2QA 4WV8A 3W20A 1QF3A 1JU3A 3CJXA 2LUWA 5FMOS 4CP0A 4XPVA 2O1QA 3KHBA 3ZYJB 4AAXA 2W87A 4E9KA 1RUC2 1SBEA 2XJRA 3J8F1 5FP8A 3WF1A 3HT1A 4Q4Y1 3ZOIA 4A7KA 3ZFEC 1YFUA 3WNPA 1US3A 4Z82A 4QAWA 5DDJ3 2OPWA 3WY6A 3LSEA 2JDNA 1EAH1 5A80A 1DGWA 2GMMA 4JQTA 3WSOA 5GZGA 4CDQB 1WCKA 1ENSA 5D8AB 3ZN6A 5A7WA 3I49A 1PX4A 4LKSA 3NAPA 1KXGA 2JICA 1SLCA 5ABJA 4MGSA 1COV2 1DLCA 5FKCA 2P6HA 4P08A 3WX5A 1OT5A 4RFRB 4KH9A 3WDXA 5FYBA 3KV4A 4WM8C 4BQ5A 1K5MC 2WR9A 3QBQA 4IV3B 1U5ZA 4AVTA 1EV12 1REEA 1XYPA 1JYTA 1OKOA 3Q8FA 3ZSKA 3T3YA 1TNFA 2ZGLA 4Q8KA 1Q8OA 3NWKA 3SISA 2WNEA 2WO2A 4CEWB 5CIRA 1RUH3 3ZXFA 4E4ZA 2BWCA 4IDZA 5AC91 1MQTA 1ZRDA 3VBFA 4XC9A 2IXKA 5FLIA 4CDWC 3CZUA 3OBAA 3THTA 4AI9A 2BW8A 4YRDA 3LA2A 1BMV2 1POV1 3CL1A 2WNUB 2E63A 2I74A 2K2SA 4I09A 3ITQA 4LO5B 4QWNA 4Q8LA 4UFJA 2YBSA 1GZCA 2QNKA 3CBNA 4NPRA 1RINA 1XC6A 2QBXA 3MUY1 2Q8CA 3O0VA 1TME1 5CG8A 1VALA 1RXFA 1TMF3 1FNZA 3FLRA 3P5BA 1AX1A 4B1MA 4COVA 1KITA 1OLME 2XOMA 5KC6A 5ABJC 2A70A 2Y6GA 3HJRA 4N7UA 1CGPA 5D8AA 2B45X 3NNMA 2RS51 5K0UA 3NRUA 4CDUA 5FJKA 2QJVA 4AEKA 3VKFC 4AFDA 1MVEA 5KHGA 4XOGA 2JDHA 1I6XA 4I0AA 3SXWA 3WLUA 3T4HB 1GOFA 3J8F3 1Z0HA 3ON7A 1GOGA 2CYFA 1VRBA 2ZHLA 3VZJA 4FCAA 4DEQA 4CUGA 3O1MA 4R9CA 4Y1ZA 3VGIA 4XUPA 2FDKA 4MXWA 4ES9A 3AJYA 2QFEA 3OGGA 4QMAA 2ZX4A 4M3CA 4OHYA 4YVWB 1C5IA 2NZ9A 2Z42A 4C90A 5LRRA 3TN92 2XVLA 3N9LA 1IPSA 4ZXEA 4D0QA 1VBA2 4MHRA 4PQ9A 4YG3A 1N1SA 3QD6A 5T5JA 1C3HA 1HB4A 2ZX1A 3KB5A 1ZBA1 3PVNA 1SLBA 1WGPA 3AKQA 3I4IA 1Y9GA 1GZWA 2DURA 3CMGA 3K77A 4MHUA 4XQWA 1JTZX 3D0JA 2ZZJA 4Q4W3 1UY3A 5KWRA 2A7AA 3N36A 5FZLA 1AL22 1KD7A 3LA7A 1D0GA 4CPBA 5GM0A 1XU2A 4XBQA 2VZUA 4P5YA 2VZPA 3SKVA 4IEZA 2I2SA 3TNPB 1H9WA 4QPIC 3OGJA 1H9PA 1J58A 5JXGA 1LR5A 2ZGNA 3PTYA 5FZBA 5C6CA 2IZWA 4CEWA 3D82A 4Q5OA 3O1SA 2CSGA 1H4HA 4QXCA 2WWUA 5F6KA 1OOPA 4QPGB 1CD3G 2DFCA 3E97A 1WLCA 2VD7A 2XVKA 2HWB1 1PM7A 2AYHA 3I2KA 3T08A 5K0UC 2FZ2A 5JZGB 1BK0A 2RR12 4ZU7A 1NCQB 2V5DA 2Z79A 2XQRA 3GZEA 1W8OA 5FZIA 4CCCA 4W50A 2TUNA 4XUQA 4DO0A 4Z8BA 4NHYA 4JKKA 1KS4A 3I59A 5BNPA 1HXS2 1VE0A 4YW2A 4DINB 4AHYA 1OXCA 4C1XA 3PUHA 3V0BA 3KV9A 3BU7A 2PFWA 2GDFA 3JUUA 2J1SA 2ZEXA 3KF5A 4MOAA 4EN9B 1SFNA 4RSUA 2C9AA 3RZZA 3KQRA 1CZVA 1DQ4A 1QXPA 2BVBA 3KD4A 3MIHA 4LKDA 3WHUA 1AJOA 2VO5A 4DEVA 3VBRB 5C3PA 3M1HA 2VTXA 3AVRA 4N9HA 3ZYHA 4YVWC 4PI2A 3TB0A 2D6MA 3ACGA 3E6CC 2W9XA 1JZ2A 1QJX2 1RUD1 3TRSB 1NKGA 3CJIB 2AR6A 2OVUA 4CDQA 4DOUA 2JD4A 3PMEA 4UFMA 2VQAA 4KNCA 3NKGA 3EHKA 1QJY1 1VBB2 1GQPA 1PO21 1FYUA 3PDQA 5FPLA 2JXAA 1RUE2 5JXIA 5FY0A 1S0FA 1NLSA 3CJIA 3I3EA 2HWC3 1RUF2 3OCPA 1BCXA 1QNYA 2W2IA 4BWOA 5LY2A 1NYWA 2Y38A 1R1A3 2W0XA 3I3BA 4HMZA 2VMGA 3MFCA 1PMJX 3NNJA 2ERFA 2RS32 1PVXA 4QX3A 4RN5A 4FPGA 4MGYE 2WQZC 2YGMA 4MGZE 4QPIB 4ZU5A 2XL9A 3DKQA 1SBDA 3DXTA 3H7YA 2XH6A 4QDQA 4XCAA 1XNDA 1ZZ9A 1OPOA 3ETQA 1QDOA 1LGNA 3GALA 3ZYGA 4QXHA 2R32A 2GMEA 1EAH3 2OW4A 3AP7A 5GLTA 4AOCA 1LJ7A 4QQPA 3POGA 3UKVA 1ZZ6A 2ORZA 3AM2A 3B94A 3ILRA 2WDBA 1ND3A 1S0CA 1OHFA 3OUJA 4GH4B 5IK7A 3LIHA 1N47A 5A32B 4UF0B 1KS5A 1DLLA 3EQEA 3R4DB 5FZMA 4DZGA 5L7OB 5JIAA 4H2AA 3M8LA 2P5BA 3MIEA 4L92A 5L36A 1G8WA 4JQRA 5GZCA 4GH4C 4AGGA 3EJKA 4G3YC 3RDIA 2HJIA 4YW7A 4UFHA 1UX6A 4U2AA 1BYHA 2WSVA 2WIIB 2VVFA 1RMU2 2PAKA 1JZ3A 1RUJ3 4RA0A 4N43C 3HNBM 3AP4A 5JUVA 4YW1A 1LGBA 4CU6A 2Y0OA 2ZGSA 2JDYA 4KQ7A 4KL1A 4QX2A 5F3GA 5CKQA 1ZRFA 4UW5A 2MEV2 4WM8B 4U36A 4COWA 5A7NA 4QX1A 3EBRA 4QHOA 5C9AC 1POV3 1DF0A 3GZUC 3MO4A 1AXZA 4OMDA 3N7KA 5L9RA 1PGSA 3GDBA 4PF1A 3U37A 1WMFA 2JDPA 4QXKA 3POYA 4OVEA 4Y22A 4C0HA 4YW5A 5JI9A 1SPPB 2VCBA 2CTVA 2JKBA 3DXUA 3O1RA 5EIYB 2J1AA 4XW3A 3PJQA 3N4MA 4LBQA 3KZ4C 5CFDA 1XPWA 2VUCA 4YM1A 2B46X 5GLZA 3POWA 3H3ZA 1OKQA 1W2NA 1X33A 1XE7A 4KBBA 3OGVA 1OD3A 4GMP0 3H8XA 1XSQA 5I0UA 2WO3A 4FTSA 3VBHC 4B4PA 2XXZA 2FDHA 2A75A 3J8F2 2X5IA 4GH4A 4DRRA 1RVF1 3P1IA 3I2JA 5HBAA 5JMCA 3HD8B 5CU1A 3UKNA 5HV0A 1JZ5A 1LOBA 3VZOA 5IAXA 2D6PA 4W6WA 3HNMA 2AREA 1VMJA 4XJAA 2VQUA 1WUVA 4UXAA 1DQ0A 4NHKA 5K7PA 2J1RA 1JHNA 2D6LX 1AR83 2JG9C 4SLIA 1MS1A 1GICA 1OA3A 2XHKA 4D7SA 5C8WA 1CAUB 2P2KA 2OYZA 4QM9A 2AACA 1XNBA 5IT6A 4Y26A 3WV6A 4B29A 2C6SA 1J3PA 4O61A 5C4WB 1OD5A 1UOJA 3VB9A 5HCHA 1ND2C 5ERLA 1FT9A 1ULPA 2QQKA 2UYBA 3E5QA 5IVEA 1OF4A 3PHMA 3K75B 3HT2A 3OOXA 1LU2A 2D93A 4NMIA 4Z1VA 2I45A 3WDUA 2ORXA 4XTMA 5DZEA 2BOJA 5FPBA 3DN7A 5LB6A 3RFRA 4AFCA 3MW2A 2VJXA 3A22A 4IQPA 1ULEA 1ZZ8A 2DUPA 4L0PA 3AMHA 3UK9A 3VDBA 5LY1A 1UIJA 3OB8A 3ACHA 3AZWA 5FPZA 4BHPA 4CTEA 3FLPA 4YG6A 2B42B 1UWWA 3HR9A 1UN1A 2OT7A 1W8UA 2XVGA 2B8MA 4BIFA 1ZBE2 3WNMA 3AXEA 4WVZA 1EV13 4LO4B 2PHDA 4L9BA 3AMMA 4BMBA 3M3CA 4NRQA 1YFXA 4TN7A 3RPQA 3ZFFB 1H6YA 1ASJ1 1AYM1 1FOD1 2JG8C 2VZTA 3CNAA 4A45A 1H2MA 4S2DA 3VV1A 4LA3A 2D6NA 2ZHMA 4Q4X2 4WZFA 2QQIA 1QOTA 2EIGA 5F5AA 2WQ4A 2E9QA 2PHUA 4IE4A 3BPZA 4OI1A 2ZGOA 2GAUA 4CDXA 2X05A 1YFYA 2A6YA 5DAQA 3AL6A 4JTNA 5DUWA 1C8M3 4K1ZA 1PO13 3FFZA 3KS7A 3HN1A 3RMXA 3OPTA 3DUIA 4D94A 4OHXA 3VBFB 2VMFA 1SEFA 4ZXKA 2XL7A 1JYNA 5AVPA 4FFGA 4EWEA 1AYN1 3PUIA 5BV6A 2E32A 5G04L 1YQ8A 1GP4A 1WCUA 4JGYA 2ZHNA 2MEV1 2YPDA 5FUPA 1RUD3 3PU8A 1AYN2 2VECA 4GWJA 2FCTA 5FZDA 3SH3A 3H9AA 1RUE3 1UZWA 4QM8A 3WW2A 1BVP1 4CU7A 1G86A 5BNNC 3LD8A 1LOAA 1AVBA 5JZGA 4PLOA 2NP0A 3MHZA 2D5HA 4HSLA 1WZXA 2R16A 5FMOL 4CCDA 1NA1C 2GU9A 2KR2A 3ZXEA 3URFA 3ZFGA 1JYWA 2R073 1MS3A 3IWZA 1HIXA 1DDLA 1O3SA 2JDUA 1O5UA 5DG2A 3MW4A 5ISLA 1XNAA 1W3VA 4E4DX 4CCEA 1H4GA 4MSVA 1BEV3 4LUMA 4C91A 2RV9A 2YROA 4W4ZA 5A1AA 1QJU1 5FREA 4LKFA 2K9ZA 2ZJCA 1HRI2 4A6OA 1GZ9A 2P4EA 2PXJA 2EXIA 4CDXC 2VGDA 3BVCA 5I0TA 5FPAA 1W8NA 4COYA 3VBRA 5CAZA 1S2EA 2MPFA 3LDBA 3I2FA 2BGOA 3UT0A 4YZ2A 3ZSEA 2BEOA 1JBCA 4PLMA 1U5XA 4Y4RA 4EWDA 1XNCA 2HEYF 1G9BA 1PGL2 1IKPA 1W0OA 2WZEA 2RR11 3NAPC 1YJLA 3FMGA 4YM2A 3ZN4A 1M06G 2VC9A 3AYEA 5J48A 2OX0A 1PNFA 3D5OA 3GNEA 4YZ4A 3ZXDA 2H0VA 1K5JA 3Q8AA 4M0NA 3M3IA 4HVQA 4GWIA 1UD1A 3RG0A 4E8DA 4P9IA 3U78A 4XIOA 3AC0A 3R6SA 3VD7A 4B7EA 1QJU2 4YW6A 1RB8G 3ZSLA 2DVFA 4AI3A 2WABA 4HSJA 1N1VA 4LULA 3JB8A 1U5YA 1X9TA 2PHLA 4AQTA 4XJZA 1C8M1 1HQNA 1VAMA 4V1PA 3T0AA 3VKLA 4F8AA 1YRZA 2PHTA 3A4UA 4OZOA 3ZFGC 4CU8A 1RIRA 2ZGKA 1Y7BA 3LKJA 3RI9A 2D3SA 2W5FA 4EJRA 2PAMA 1YWKA 3GHMA 1QH7A 2RDNA 1Q56A 3TEYA 4HVOA 3J9SA 1N1YA 3KGLA 3A23A 1UYXA 5IJRA 3ZXLA 5IFTA 1JZ8A 4FSJA 4TTGA 1UKGA 1MS0A 2VM9A 3NW4A 1TNRA 1VAVA 2Y64A 3IBMA 1ND3B 2OUJA 5LA1A 4J1WA 4URAA 1GWKA 2XBO3 3A0KA 4HOOA 5EP9A 3RMYA 4DUWA 4DNYA 3B02A 3VBRC 4BQXA 2JENA 3PUQA 1J59A 4BOWA 2P3JA 2HLEA 3ZDVA 2BNNA 1TQ5A 2WKKA 3LOIA 5F39A 1W0PA 5IVCA 5JDBA 3AFKA 3U4SA 1QQP2 4LPLA 1H1MA 5CISA 5IVYA 4B3NA 1A78A 3I2GA 5FXXA 1G7YA 5D8AC 1HV1A 1PO22 1JYIA 4XUTA 4AVCA 4D8MA 2HWF1 4ZKTB 1DZQA 2VL4A 3U11A 4HZFA 2YHJA 5D1IA 3MV11 4RR3C 1JH5A 1A3KA 1AX2A 3KV5A 4NWVA 1R1A1 4CRQA 2CNAA 3VZLA 1RUG2 2J1EA 4ZONA 1VRH2 2X10A 3QOPA 5DXDA 1JMUB 3KGZA 2SLIA 1GR3A 2WAOA 3KVBA 4NAOA 2LS6A 3ZO0B 1VBA1 4A2UA 2YC2A 3J7NA 2AENA 3H3LA 3CEWA 2ZGUA 1RUJ2 2CWSA 1QQP3 4RS5C 1GP6A 1FMD1 2ARAA 4IETA 5FMDA 3RZLA 4V2WA 1LTEA 2Y6LA 1DCSA 2XPJA 2JKXA 2A6XA 3MDPA 1AR71 2ZX2A 3DYMA 3OPZA 5FYSA 3UGFA 1FPN2 3PLQA 2GC0A 2XBO2 4JKMA 5CB7A 4CCOA 1O7FA 2VOXA 4CZSA 3MPPG 4IE5A 3QCWA 1F9KA 4NIGA 4BM8A 2WT0A 2DV9A 1KEXA 2ZGMA 2RS52 2HWB3 5T5PA 1QJX1 2JECA 3L9JT 3OYWB 3T09A 3BB6A 3MYXA 3NO8A 3VBOB 3WP3A 4F7ZA 1EPWA 1NY71 4Q0QA 4NOTA 2A6VA 3OYWA 2WZPP 3POEA 5FO9B 2G19A 5A1FA 1G9AA 2WFF1 5DG1A 2XB6C 2YPJA 4L2NA 5DDJ2 4A42A 1CAWA 4BZ4A 1OA2A 2VOVA 4RQPC 4D6QA 5F7UA 5LATA 1MS4A 2VTFA 1JOBA 2QCSB 3CQOA 4UW3A 5ANNA 3TWIA 5IATA 4AZZA 4G9SB 2B4KA 4QB2A 5JXJA 3POJA 3J7HA 1GNYA 2PMWB 1LEDA 3W9AA 1VBC2 2GNDA 1N1TA 4CEYA 3UKTA 3VDDC 2DTYA 3LA3A 2HWF3 4LR4A 4XXAA 2VCCA 1UU4A 3H50A 3QH6A 4YVWA 3UGHA 1YNAA 4PHZA 3KVAA 5DZGA 4AQ2A 3CLPA 4P9LA 1HN1A 4NHMA 1PK6C 1MS9A 4B1LA 1R093 1QJY2 2ET1A 4XFIA 1CZTA 1S0IA 4CP9B 2PYTA 1KDMA 2B7YA 2HWC1 5FK8A 1OUXA 4TXWA 3HEIA 4AEMA 2YDEA 4QDSA 3WQ1A 1G6NA 3LWCA 3HQXA 3T4VA 4HFSA 4R52A 4WZCA 2A6WA 5FPVA 3OD4A 1KJLA 1H1IA 2PTMA 3KT4A 1I1EA 4EN6B 4Z07A 4FTEA 2P6CA 5F3CA 1K42A 1QJY3 3ILFA 1RMU1 1PMIA 4FAHA 1PGL1 2N7GA 2DCKA 2VOKA 5F9TA 1ZBE1 2VMIA 1UMIA 4MG2A 2E26A 3IDEA 4S2GA 2IXIA 2PELA 4C0BA 1HXS1 4LIUA 4MH0E 4QPGA 2AZ5A 2ZHKA 5HXMA 5J7MA 1ULOA 4QKNA 2OKXA 3LPFA 2BYVE 1V9U3 3POFA 4ORFA 2LROA 4YGEA 2ZEWA 5T52A 2NQYA 1UZZA 2PA7A 5CEHA 3ZX7A 2XJTA 1ND3C 1ZZBA 5EYYA 5BNNB 3FWEA 1RHI1 4IEXA 1W05A 2VBDA 3AYAA 4QGNA 4ET7A 3A7QA 5LBCA 1HJGA 2BFUL 4QU2A 3ECQA 3WP4A 1XE8A 4JAAA 1JW6A 1GV9A 4HKWA 4E4SA 3JCIA 1ZVFA 2QQNA 3IDCB 1PK6A 1DGWX 2R1BA 4L11A 4COUA 4PT6A 1SZBA 5JVVA 1NZIA 2BGPA 3MI8A 2VUJA 5FY4A 4YZ3A 1LENA 3CZJA 3OBZA 1F8VA 1WBFA 2BBAA 1I9RA 3R4SA 3TN91 5C7GA 3VL8A 2R30A 3RQ0A 1RUI3 3BGAA 2X53S 1OI6A 5FZ0A 3VZMA 3LFMA 1VIWB 4YFZA 3T0DA 1SLAA 1SCSA 3AP9A 5FBJA 3ZYPA 3WNLA 4KBZA 4PQQA 2DFBA 3LPGA 4FXKB 5AC93 1VRH3 3GXUA 5L73A 4ZS2A 1YIFA 3NV1A 2VZOA 2VZVA 1UYPA 2VMDA 3D8CA 4W6YA 3UJQA 1J1LA 2WNVB 2ZX3A 4HG6B 4E27A 4O9GA 3KV6A 5DUVA 4NIIA 3DPRA 3ACLA 1W3XA 4AFBA 2RS53 2EALA 1P8JA 1NY72 4M4RA 5FPXA 1VB2A 3I8TA 3LQCA 1ZRCA 2ZX0A 1R082 1S0DA 2ZMLA 3EYPA 3RI8A 2RDRA 3NSTA 4FT8A 1LB2A 4I3PA 5LWBA 4BK4A 4Y20B 3ABZA 1LU1A 2XLGA 5T5LA 4YZ1A 2J7MA 2ZGTA 1XE0A 2EIDA 1SDDB 4LHKA 3KLSA 2R041 4I0BA 1HQWA 4ES8A 3OY8A 4XMAA 4BISA 4D7YA 1N3QA 1PO23 3LEIA 1UZVA 5KR7A 1WA4A 2BRTA 1UPIA 4FI9A 4XF9A 5CKNA 5J1XA 3O1VA 2W68A 5LA0A 4XVHA 2ZBJA 3MV01 1JS9A 4AHXA 1UY4A 5HPOA 1FMD3 1YQ6A 1SLIA 2VPVA 5C9AB 4LK6A 3RZJA 1MZFA 4META 2WNOA 4FFIA 1QJFA 5FO8B 5IYYA 4EV0A 3HBKA 4BYYA 2QQPA 1OH3A 1WCQA 4QT6A 1RL3A 4JGZA 4LKEA 3KCXA 1JZ6A 3I3QA 3DYPA 1SBFA 3LGRA 4CCLA 1NOVA 5M0TA 2D40A 4F3JA 5C3OA 5KHKA 1FMD2 3T0BA 1VBE3 3ZSJA 2I07B 3GJBA 1QOOA 3H1MA 3JU9A 3OF1A 1L7QA 3HPNA 4LXLA 4YW4A 3FBYA 1ZYBA 2D44A 5A7QA 1EUUA 3UGGA 1D4VB 2DCZA 5B4XA 2A71A 1AR61 5A3TA 3I54A 4DY5A 1CX4A 4IE0A 4AFMA 2CL2A 4X8PA 1ULFA 3AYDA 1YEWA 2E51A 1IPJA 2VVDA 4O7XA 1OFNA 3H1WA 3QACA 4Y20A 5EFUA 3MLKA 3BYWA 2QQLA 3ME2A 5A3PA 3V0AB 1UOGA 4Y1UA 2VNOA 2V09A 3GHNA 3LEMA 5JCTA 3JZVA 4JDMA 4NJ4A 4XUNA 1O91A 2YFZA 2R072 3AJZA 3HOBA 5JR7B 4AWDA 1WLDA 1AZDA 3FBMA 2IXLA 3VHNA 4QQ2A 5KXBA 1ODNA 2NMOA 3I2IA 4MO3M 4TYSA 4IERA 2WWJA 4IEYA 4LLOA 5FUNA 4YVSB 4HANA 3INAA 3K46A 4OYUA 1YI9A 3I2HA 4GWMA 4JGYC 3NL1A 4ITCA 1ND2B 4AVBA 1LODA 4FOYA 4HL0A 4H7MA 5JWPA 3T1MA 4MUVA 4LBNA 1F4HA 4BE3A 4D6SA 3CF6E 5FMBA 1VBB3 5FFOC 4CDUC 3W5NA 4P02B 3V56A 4JX0A 4FPYA 4KWJA 4A3ZA 2GC3A 5D21A 3OG2A 3OGRA 4KU8A 4G4FA 4ZHNA 1NA1A 2DBNA 1QJEA 1RITA 2Q8EA 3SKJE 3B01A 5FR3A 5HI0A 1CPNA 2WLPA 4QQOA 4JV4A 5CG9A 1SPPA 4RHV3 1A8DA 1KFXL 1BKZA 3PVOA 4JDNA 3WF0A 4W6XA 1WBLA 2BOIA 5LBEA 5FPUA 4FXGB 4ATFA 2HWC2 5DMYA 4R9DA 1PX3A 3C2UA 4CVUA 1DFQA 1NXMA 1W28A 1J1TA 2WT2A 3ZM8A 4YZ5A 4H14A 5FQ0B 2K46A 4IEVA 4AHZA 3M3QA 1W6MA 4Q4V2 2JE8A 1XYNA 2WNUA 1FPN3 5T3NA 4NIAA 1N3OA 1GFF2 3RWNA 5FOBB 2PAEA 3HAGA 2X5IB 4DY3A 1LHVA 3N9MA 1NXD1 1RYYA 4HN0A 4GAZA 1IGOA 3FLTA 3JBG1 3AB0A 1CQ9A 1QJU3 1O3TA 1TEIA 1W9FA 5C3QA 1IS5A 4Y33A 3AKRA 5DAXA 5EPAA 1IQAA 4FFFA 1JOJA 4Q0SA 1GOHA 1PMHX 3PURA 4K3UA 1LAJA 5FYYA 1PVC2 1HRV2 2E7AA 4NPLA 2LW8A 1QHDA 3JQWA 2ZACA 4PBOA 1ULCA 2BDRA 1CX1A 4YM3A 2IC1A 4FVVA 4YGCA 5DPNA 3SNMA 1T6GC 4WVVA 2WS91 5APAA 1WWYA 4AVSA 4BLIA 3B9IA 2Y60A 2RHPA 3V0BB 2ARBA 4NUBA 4I01A 4XCBA 1BK1A 4AL9A 2WFF3 3I3MA 2BBVA 1K3IA 1XBFA 2XGXA 2UWCA 5BPXA 2RMU1 4BMEA 4Q1RA 3IPVB 1F5FA 1V6KA 1W8TA 1WMDA 2PLV2 1B35B 3ZFEA 5J37A 2P1BA 5F5CA 2P17A 5CYYA 1HV0A 1GU3A 3IPVA 4HKOA 3HNYM 5FO7B 2JJ6A 4AR2A 5C8CB 2JG8B 3D0SA 4YFWA 3VBSA 4NHLA 2XUMA 3RWKX 4BQ3A 4CDQC 1TMF1 2VMCA 2DBIA 3SEPA 2VH9A 2XQXA 3GF6A 3MIBA 1ZZ7A 2FDGA 1R091 1REFA 3WHTA 1M4WA 1OVPA 1FX5A 3KCCA 3VHPA 3H8RA 4BU2A 5BY5A 2HWD1 4KI5M 4JGZB 3WD5A 1DQ1A 1QIQA 2WO7A 4AGRA 4BH9A 1UF2C 2R063 4QXBA 5FV3A 3W58A 1W6NB 2EVXA 3MGUA 2ZMKA 1GZTA 1VBD3 1ST8A 1IKQA 2CWMA 3POIA 3R05A 3HVDA 4W8JA 5ANQA 1MQTC 3VBFC 1NX9A 4Q4V1 2PLV1 2HWE2 3JQXA 3UNPA 2GMPA 1F4AA 1CAXA 3JBG3 2WO1A 4AYUA 1OFSA 5F5QA 4F83A 4UF0A 4DXRA 5FXVA 1DU3D 2DTWA 4NHXA 4N90A 4ZZ8A 3GGLA 2HEVF 4KG8A 4MVTA 5B2GB 4Y5Z0 3DF0A 3MUZ1 4QKFA 5FXWA 2ILMA 1TMF2 2HBUA 2YU2A 4QX5A 2BQPA 2NLRA 3JXSA 3N7LA 5I8SA 2JIJA 2VOWA 2YC0A 4H7LA 1Q8QA 1HN0A 3VBSC 4BXFA 1IZ3A 1LESA 2ZABA 4YVSA 4ISRA 1MR5A 4QDRA 4LE4A 4GJZA 1YFWA 4HVRA 2QDNA 4NN0A 3AZXA 3GJAA 4X6RB 1PIV1 4HKLA 3C3VA 1S0EA 1AR73 3AVSA 1X8EA 1AL0G 1FAYA 2IXCA 5ACA1 2VG9A 2B5HA 1J83A 1LKNA 5L9VA 1NCRA 3G7DA 1Y4WA 2C4XA 3NMBA 5TSWA 2DDUA 4CUCA 3ZXGA 2QQVA 2BGCA 4X6QB 2MEV3 2H6CA 2UURA 2LRPA 3AXDA 3H3UA 3THCA 1SHWB 3USSA 4Q26A 3S30A 4UFKA 1RC6A 3T2OA 2YU1A 2WFPA 3ASIA 1ODMA 3ZSMA 3ZR6A 2IVJA 4PIZA 4BXSV 3WDVA 2B9VA 5FZFA 5CFCA 3MIGA 3POSA 2CV6A 5FZCA 1VBB1 5I8YA 3OUHA 2YBKA 2OQ7A 3RSJA 4QPIA 1O59A 3DECA 1GSLA 2OQ6A 4Q4X3 2WWSA 4AEDA 1W8FA 5E89A 5EJ1B 2DUOA 4GZ9A 1H30A 3I59B 5EYXA 4URTA 1D2SA 1S0BA 2JG9A 2O14A 2VUAA 4LMFA 4LE3A 1BHGA 1JN2P 1XNTA 4HETA 1S1AA 2VBBA 3BODA 3IZOA 2GNBA 1O3QA 1W6OB 2ARXA 1ZBA2 2XKOA 2ZPXA 2EAKA 4UAPA 3LAGA 3T30A 2R1DA 1KJRA 4UYBA 3ETPA 4EROA 4Q4V3 1XOYA 2C24A 2Q1FA 1C8NA 1Y9MA 2VOTA 1LRHA 3OEAA 3O1TA 4Y4YA 4PIXA 5LA9A 1FPN1 2XLAA 5GLWA 3IKWA 5A7OA 4P9GA 3LDKA 3A0NA 2D3PA 2FBEA 4NIDA 2IVIB 3RJRA 1LHUA 1HXS3 2W1WA 5JPNB 4DRVA 3DYOA 4LBQB 5FAXA 1JZ7A 4KWLA 1IS3A 2WC2A 5LK7B 1SFPA 5FQ0A 2Q8DA 1UW8A 2J22A 1X9PA 3NAPB 4HN1A 3RYRA 3WCSA 2HWF2 1VAKA 3KT7A 5LEKA 2XJQA 3KCYA 1RHI3 1XYOA 3JD71 3P6BA 2GNTA 3O0WA 4LO6B 4N9IA 1G9CA 4NROA 2EAAA 3W21A 2XDVA 4AI1A 2WNVC 2VE1A 3UETA 3LOBA 4Q27A 5CA6A 3GZTB 1SCRA 2RS31 4CP9A 4I2OA 2DVGA 2ADEA 5L9BA 2Q0AA 1UMZA 4EE2A 4OLLA 1BXHA 2NPIA 1W99A 3VD9A 4IE7A 2FQPA 4KG0A 5JPMB 1EPZA 1RUI1 4XEZA 2GN3A 2RS33 3ZN5A 4HBNA 2ZGQA 2C5DA 3ZYRA 5FY7A 1WKYA 1QJZA 4LBQD 5HCFA 4YGDA 1W6OA 1AYN3 1OLQA 5HXVA 5DAWA 1VRH1 1RUD2 1AR91 2VNVA 5FXZA 4CA9A 4GA9A 4YG0A 1WMEA 3OD0A 4QQHA 3VBOA 4BQYA 2RVAA 4GB33 5KHIA 2VUDA 1RUE1 5K0UB 2BNMA 2A3YA 5LASA 3W59A 4UBHA 2Y33A 3LSDA 1S0JA 4P9YA 1VPHA 2FCVA 3ZPYA 4BPZA 1E5RA 3SITA 5C8CC 3KWVA 3LFIA 3OEBA 4IL7A 3C8XA 4UBGA 4E4HA 5JSOA 1MEC3 2Q1MA 2RM23 2W3JA 3ZYFA 3TEZA 2JDMA 1AR72 1NG0A 3USUB 2OIIA 3E6BA 3HBZA 2B9UA 4QX7A 4R4XA 4NR1A 5FZGA 1XRUA 2W91A 2WYFA 1O5LA 3GBGA 1GMMA 4KU7A 3ZR5A 4BA6A 3LF7A 2PQQA 1AR62 3K4AA 5EJ3A 3LEGA 2RJLA 3BN6A 2IXHA 4QX0A 1V6OA 4JRAA 1W0NA 3ENRA 4HT1T 4MXWB 4Q4W1 1U5IA 1HRV1 3RVHA 2A3WA 2QDRA 4AQSA 3H42B 4P9WA 3V64A 4N8MA 5AC92 3EMRA 1QXRA 4XTPA 4XUOA 2NMNA 2VW0A 4JCKA 3AZZA 1HRV3 4RYDA 3ZMNA 1PGW2 3NV2A 1Y43B 1G9DA 1CWPA 4Y1XA 4XE9A 2JEMA 4XDPA 5F2WA 3FHQA 2F17A 5FCCA 4DXTA 3SHRA 4CP1A 1HRI1 2R6QA 1WLTA 3OJBA 4K7JA 4CXYA 3I2DA 2PHRA 4QKDA 5AFBA 1XU1A 2XG3A 5KHHA 2IWGB 4XFFA 4AVVA 1OH4A 3BTZA 5DABA 2OZJA 4Q4W2 3C7OA 1ACCA 2W1QA 4UFIA 4ISQA 5JSPA 4XIKA 5FP4A 4ZY9A 4YWAA 2WN2A 4LO7A 4XFGA 3M2MA 4N53B 3VZNA 4MGTA 1V9U2 3VKMA 4I02A 1GNZA 2Z2SB 5C70A 2XMLA 3AL5A 4YLZA 2BUKA 2JG9B 4S2FA 5FYIA 5KC5A 3RZKA 3WT3A 2TNFA 4GB31 1RUH2 3VBUA 2F4LA 1XJAA 1RUG1 4CU9A 2DCJA 4LJHA 1OSGA 2Q5TA 3WZ1A 1J3RA 3EO6A 2ZEZA 2WBKA 1JHJA 1DQ2A 2E7TA 1C28A 1W2OA 3C7EA 3SCHA 1BEV2 2WN3A 4LBMA 3CO2A 1WMXA 2IXJA 2WYSA 3WP5A 4I0WB 4IV1B 4BQ2A 3WNNA 2WA3A 1J3QA 1UOBA 1K5MA 2VVEA 3CU7A 3B93A 5IVFA 3BU0A 3ZFFC 2FCUA 1SFYA 2G4IA 3ES4A 5C3RA 5FMCA 3BTXA 2ZTNA 4RR3A 4EWAA 2LALA 5HV4A 4XJWA 3S0MA 5F37A 3U10A 1NQDA 2QE3A 5JOXA 3VDCA 2QUOA 4FPHA 3U4XA 3AK0A 1TME2 3AX4A 1H8TA 3TOJA 2P37A 4H55A 1Q5OA 2YXSA 1LHNA 3WEZA 1WW6A 1PVC3 1UAIA 5A3MA 2BVVA 2YFUA 4OULA 3AMQA 3KHCA 1QMJA 1RMU3 2BTVC 3MEPA 5FUIA 1QU0A 3SMHA 4Y24A 2IUWA 5IVVA 1H2NA 3VKNA 2W95A 2P3IA 2HYKA 2WZR3 3B69A 3C7FA 4QU1A 4FOQA 2WNUC 1X7NA 3O1PA 3WDTA 1ZBA3 3S5QA 3H8OA 4OI0A 4N7IA 4YM0A 1DYPA 1IG0A 2WZR1 1JODA 1UU6A 1YJKA 3E1F1 1WD3A 4PI0A 5A3LA 5SV5A 1ZA4A 3B3QE 3I97A 3M4FA 2VY0A 3E6DA 4ATEA 1J84A 4OQ9A 4Y3OA 1OPMA 3FUOA 5JMOA 5IK8A 3PIJA 1WW7A 4NVPA 5L7OA 4RHV2 4XF4A 4PCRA 1CAUA 1PZ9A 1YHFA 1RUOA 3WXPA 1WCDJ 1IOAA 4YYOA 3SH5A 5AFEA 5IK5A 1W9SA 4M3CF 2RG4A 4WM7C 4PBPA 4LUKA 2YMZA 3N9QA 5E88A 3I7DA 1R1A2 1UO9A 5DUXA 5EJZB 2AEZA 4QX8A 4UOJA 3S57A 2VTXJ 1YQCA 2EA7A 2WLQA 4MADA 4D7TA 4J25A 4NE9A 1KFUL 1Z7S2 1AHSA 2G9ZA 3UV9A 5IAVA 1XXNA 2P3YA 2VW2A 3KMHA 2HYXA 1SMVA 5K4LA 3RRDA 3V65A 2VW1A 4IV1A 4A6SA 1RUG3 3NV4A 4KWUA 2ZEYA 3LEKA 5F3EA 4A7YA 2XR4A 1LHWA 4CCNA 5IVBA 1SLTA 5FYUA 5FZEA 1EYBA 2IFRA 3EXUA 3NJZA 2QTWB 2Z5WA 5BYNA 1H0BA 3JB4C 4ARXA 3J26N 2X09A 4XBLA 5F6LB 2NN8A 1NLQA 2YY1A 1PVC1 4CEWC 2CGPA 1NT0A 3V0AA 2ADDA 1YO8A 4ASKA 4FBFA 2HWE3 2BFUS 5FZOA 5A32A 5E1RA 3THDA 5I93A 4P9XA 2ENRA 2LM3A 3F2ZA 5L7OC 4BCUA 5GALA 4HK8A 1LNSA 3PMSA 4MXVA 4XHBA 1UIKA 4CCJA 1PZ7A 1RTVA 4HLTA 3MIFA 3NNLA 4QGLA 4DFSA 5E6HA 3M3EA 1I5PA 3K4ZA 4CCMA 4QPGC 2OPKA 2W08A 5BNPC 4AEDB 4OHZA 5KHJA 5LW9A 2Y6FA 2R061 4JGYB 4P14A 3S5AA 4QPYA 4GIQA 4BB3A 4D6RA 1NCQC 4ZU4A 4A3XA 5I8TA 3RZGA 3TEXA 1S0GA 4PF5A 1EY2A 2QQMA 5IFPA 1W90A 2CDPA 1QQP1 4K40A 4DUXA 2XLFA 4GQ7A 2V72A 4XFCA 2D3RA 2L9LA 1KGYA 4EZHA 2GNMA 2ZXQA 1STMA 5F5IA 3WINE 4CPBD 2BP6A 3DV8A 3S7EA 2W94A 1CAVA 3FJSA 3TEWA 5A7PA 3NVCA 4B7KA 1C1LA 1CAWB 3CJIC 1RUI2 1WW5A 1JXNA 1W2UA 4WM8A 3TN93 4XF0A 4LBOA 4LK7A 3MF9A 5SV8A 4LHNA 4C1WA 1F2NA 2ARCA 5CZKA 2DWRA 2Y6HA 3IB3A 1R081 3IIAA 1XNKA 4M3CE 3LZZA 5DN2A 2ZGRA 3VBHB 1NCRC 3IMNA 4YPJA 3BIEA 1D2QA 5IUQA 1LEMA 4AEJA 3JD72 3WF4A 5A3UA 1SDWA 3NNGA 1S55A 4CDWA 2VQTA 3WF3A 1LULA 2FMYA 2DVAA 5ACA3 1JOPA 2UYAA 2PHXA 4AFAA 4XFBA 2WINB 1NCQA 1MQTB 1QY4A 3MPBA 2OUHA 3O14A 5A6QA 4BK5A 2DCTA 5A7SA 1K45A 1G9FA 3OUIA 4TWTA 4J1XA 4FPFA 2VXJA 2YG0A 5GLVA 4AI8A 2J1TA 2BPA2 2Q8OA 1YQ2A 1CR7A 2VZSA 4OUEA 3SQOA 1FI2A 3WG1A 4RHV1 1I3HA 1X82A 1UYYA 2IFWA 1OF3A 4AG4A 2RJKA 4CXXA 4EQVA 2KM2A 2Z69A 4CSWA 2BU9A 2JDAA 5J09A 1VBD1 2RE9A 3AKPA 3GBFA 4N43B 2DUQA 4XHXA 4AEDC 3TYJA 2WL1A 3N7JA 1COV3 1WW4A 2HWE1 2UWBA 3BPSA 3F95A 1O4YA 3Q8BA 4K9SA 4LOSA 4IUGA 1OURA 1B35A 1HKDA 3ZFEB 3D6EA 1ZREA 2X8KA 5JLVA 1TZOA 5I91A 3APBA 4LIVA 2UU8A 2VNRA 5FIXA 5C9AA 1YCIA 2RDSA 2QKDA 4IEUA 5IW0A 1AR81 3RYPA 3VBSB 1S2BA 3L2HA 5JOYA 4R9BA 5EXOA 1N3PA 1Z7S1 2O0OA 3ATGA 2OS2A 2QQWA 4WM7B 5KXCA 4XQ4A 2J42A 5J3UA 3FHIB 3CIHA 1C5HA 1JUIA 4P00B 2RJ2A 1V9U1 1CJPA 4JHTA 1CAVB 1NCRB 3SH4A 1CVNA 1IQDC 3R0RA 3KM5A 4NAMA 4ASMB 2E6VA 4CDXB 3ZDSA 3E5XA 2W1UA 1VBC1 4IESA 4XETA 5EQUA 5A33A 5BNOB 5FYHA 3ACFA 4UFLA 4FPLA 1AX0A 1QH6A 2VULA 1WLWA 1H8VA 1TE1B 3LE0A 4NO4A 3L2YA 3VKOA 1HW5A 1HB2A 1CPMA 3KSCA 4IGPA 2EF6A 4XZPA 5J98B 1A34A 2RR13 1GWMA 1U12A 1D0HA 3FL7A 1MPXA 1W03A 3MICA 1H8TB 2JE7A 4LBJA 4K8RB 2R49A 1GUIA 3WW1A 2RMU2 4DS0A 1H6XA 5E16A 2WSUA 2WNVA 2YGLA 1IS4A 1X8MA 2PHFA 1LOFA 2ES3A 2PN5A 4K21A 3N7MA 3WNOA 1F5JA 1PIV3 3IT8A 4MYEA 5LRSA 4LBLA 4XF3A 4FPOB 3ZYBA 2B39A 2VBPA 2Y34A 3P3NA 1ULDA 2Q4SA 3CDZB 3LDRA 4YGBA 1ND2A 1WCSA 3ZFGB 1PHMA 2XJUA 3LCPA 4Q29A 4AE2A 3U1XA 1W6QA 4AVAA 1H2KA 3FE5A 4GALA 1Y3TA 2WQ8A 5IVJA 1ZA7A 5C4WA 1Q8VA 2FMDA 3WDYA 1VLNA 2H0BA 1HJFA 4HPKB 4XABA 1W6QB 5FZ8A 5H9QA 2VCAA 5T55A 5F3IA 2C1FA 4S2HA 1BJQA 3KF3A 4MX3A 4LLFA 3N9OA 3ZYIB 4OFGA 2ZMNA 5CKMA 5FWEA 1B09A 5E8AA 2TEPA 1W8HA 1T2XA 4M0HA 4EZ4A 4W65A 5IWFA 1ENXA 1BMV1 4K20A 1AR93 3O12A 4LOTA 2R062 2ET7A 3PVBB 5FTTC 1C1FA 2ZZQA 4H3WA 5JI7A 1REDA 1H1AA 4AQ6A 1AR82 1UL9A 4ONUA 1AYM2 1COV1 1FOD2 4DQAA 1VBA3 1W6PA 3HMYA 1K5MB 1FXZA 3BALA 4CUAA 4E2GA 4EN0A 1LOFC 4FPJA 3FUQA 2G9GA 2P3KA 2UY9A 4HXCA 1XB9A 5FY1A 3FN9A 1Q3EA 5I0RA 3VN4A 1F15A 2KD7A 5FZOB 3ZKYA 5F8PA 4KGGA 1FNYA 2XHNA 5CFDB 2ZAHA 3PU3A 4FTBA 4CUBA 3SCFA 5A1LA 5FOJB 1VBD2 3BTYA 3H7JA 1D4M1 1V6MA 2XONA 4GMP1 1Q8PA 3U14A 1YLLA 1OUSA 1OQ1A 2BERA 3DPRC 1DYKA 2ZCWA 5JOZA 1RJ8A 3R4UA 2GSYA 2HBTA 4FPCA 4QQLA 2W1SA 3BOWA 2CU5A 3WOGA 3AZVA 2QZ3A 3VD4A 4FFHA 1UX7A 5EHDA 5C4WC 3VHOA 2GH8A 1VMHA 3RYKA 5KXDA 4JKLA 4PDWC 3UL2A 1Y9QA 4BIOA 2QQUA
chains in the Genus database with same CATH topology
1URXA 3WG4A 4L97A 4OHWA 5BNNA 1ALYA 2JE9A 2EXJA 1MZ6A 2NYYA 2WS93 4FPKA 1LOGA 1R083 1RGSA 4M00A 4CP2A 1AR63 1HRI3 1L3JA 4IXLA 1DHKB 4N43A 4IEWA 5FBZA 1AF9A 1AXYA 4YARA 1MVQA 1QXJA 5EWSA 2RMU3 1XQNA 1ZRRA 1QDCA 1RJ7A 2WT1A 1RUH1 1A6CA 4P5HA 2BWAA 3VDDB 1TME3 2AH2A 3BCWA 3OBTA 4MGKE 1NE4A 1OQEA 3ROUA 4RFT0 3HWJA 5H9SA 1YIPA 2D97A 1DQ6A 4RGAA 1CN1A 3MF6A 1ENQA 3UJOA 2HEWF 2XWBB 5CFDC 5DZFA 4BQ1A 1CIWA 1HLCA 2DU0A 4MLOA 4TLFA 4Z92B 1GLHA 1RUF3 4CDWB 3ALQA 4JGZC 2XWJB 2DU1A 4PDWA 1HX6A 4XBNA 3H0OA 2A3XA 4XFAA 1IS6A 2A6ZA 3O5SA 3VBHA 3WP6A 2XJSA 3VZKA 1C8M2 4WVMA 1H8TC 5J96B 1MEC1 2RM21 3ILNA 4Q1PA 4LO8A 3AP6A 1D4M2 1V00A 1SACA 4DXZA 4GXLA 2R043 2VQ0A 3PJYA 5T54A 1MACA 5K9YA 1R1ZA 2CY6A 3N3HA 4OUMA 2KA3A 5CADA 1NQJA 3ZMOA 4AHWA 4EN7B 1GANA 3DKWA 3M3OA 1I5ZA 1V6JA 1ZZCA 3FC0A 1RUC3 2A5ZA 2DVDA 4YVSC 5GZDA 2D6OX 3OY8B 2R0HA 3VLBB 5J36A 4B4QA 4XJUA 3TNQA 3AKTA 3VL9A 1SLLA 3SCGA 1HDKA 2QZ2A 1R092 5IK4A 2ZGPA 3JD73 1QJX3 4JVAA 5HCAA 3FX3A 4FP2A 1YXWA 2GH2A 3BIWE 1MS8A 3QH7A 1KDKA 3ES1A 2FZ1A 2RS12 2OZ6A 2JG8A 3H1YA 4RR3B 2HWB2 5I0SA 1VR3A 1DIWA 4CEYB 1RUJ1 4GULA 3WNXA 5CFCB 5F1RA 4AF9A 1YUDA 4UW6A 4RS5A 2DVBA 5A33B 4XMIA 1A8MA 1ONAA 1LOCA 4Q0PA 1APNA 2UWAA 1PO12 1X50A 4MV2A 5CFCC 3OTFA 4Z2WA 1O3RA 1AXKA 4D69A 3MLJA 5AVAA 1VBE2 1VJ2A 4Q2FA 1MS5A 2PHWA 4XDQA 1V6LA 4WVMB 4LBKA 1QOSA 3MW3A 2XKPA 2ZA9A 4Q4X1 4XYXA 2YYOA 5LK5A 2ETEA 2UY8A 1BVVA 4CYDA 1LCLA 4R4ZA 1JYCA 2WA4A 2HWD3 4LEJA 4B4RA 2CAVA 2Y26A 5GLUA 4DMIA 5T50A 2D6KA 3TAYA 1NA1B 2C0ZA 3THPA 1UKRA 4RQPA 2ZKNA 3BOPA 3ZN6B 2GC2A 2PLV3 4GKXA 1RUC1 2XJPA 3WW3A 1V70A 4RQPB 5DDJ1 4HPKA 4DB5A 1O4ZA 1W6PB 4LHLA 3WG3A 4NWWA 2CGOA 2QVSB 1IPKA 1OLRA 2ATFA 2ZAAA 1OA4A 2ZOEB 2HWD2 4GB32 4Y22B 2DCYA 3WDWA 4XILA 1DGRA 4RGGA 3S6PA 3VHRA 1FV3A 1CJDA 4OHVA 5BNOA 1OOPC 4KWKA 4PDWB 1MEC2 2RM22 3IDBB 2P34A 3LB9A 3NV3A 3AYCA 4OUSA 4QD2A 1W39A 3U07A 2JX9A 1GQGA 2D43A 4FQ4A 3BTAA 1BBT1 3IN9A 2AUYA 4RS5B 1WD4A 2NM1A 3DPRB 4XFHA 3T2TA 4K8FA 3Q9OA 4JDOA 1UPSA 5KXEA 1EV11 4JRLA 1GNHA 1VP6A 3GBWA 4LA2A 4XF1A 3AMNA 2VMHA 3MFAA 3NKTA 1AYM3 1FOD3 4Q0UA 4XQDA 4TSVA 1CONA 1RHI2 2RS13 2DYCA 2DF7A 2XBO1 5BXXA 1ULGA 1AR92 1PNGA 5CBLA 5H9RA 1H2LA 2Q30A 2YZ4A 2H6BA 4OZXA 4LT5A 3T1LA 5GKAC 4RL7A 1X36A 1FV2A 5BNQA 5T5OA 4UW4A 5C8CA 3ZXKA 1DBNA 4AI2A 1YYNA 3PNAA 2F6BA 1GBGA 2EXKA 2MNGA 2FHRA 2D5FA 1GKBA 1QWRA 2WFF2 1B35C 1LECA 2Q1ZB 1NLRA 4RD7A 5BNOC 4JC1A 4AXOA 1BZWA 3GYDA 4R9AA 1ZBE3 3D4KA 4Y1VA 4GKYA 1VB4A 3S7IA 1DQ5A 4PIYA 3O7OA 1ZNPA 4XXPA 4BLJA 5JOWA 2JDZA 1NE6A 1UU5A 1PIV2 4OI4A 1IHMA 3G6JB 4AW7A 1GYKA 1ASJ2 3TBDA 1D4M3 1AJKA 2MHFA 4GMP3 2ZS6B 4IV3A 1VBE1 5L19A 3ST7A 1V6NA 1RUNA 4XJ9A 5ACA2 4LNVA 4QHBA 2GN7A 1AL21 3U0ZA 4AI0A 3AP5A 5BUVA 3IM0A 1C57A 2E7QA 3MIDA 3AZYA 4B8EA 2D7FA 2CGNA 2TBVA 1AL23 3AFGA 4DPNA 1MZEA 1DGLA 2YV8A 4FQZA 4K1YA 2A73B 3VUOA 5FLJA 2XJVA 1VBC3 1POV0 1GQHA 3FZ3A 4E2SA 1CAXB 3N35A 3DL3A 2WJSA 3MLLA 3WQ0A 3ZXJA 3VBUB 1F31A 2O8QA 3WCRA 3JBG2 4PJYA 3K51A 1QGLA 2K0GA 4EN8B 1BBT3 2X29A 4L8QA 4M01A 4N53C 1CESA 3FFQA 4YNIA 2GALA 2GC1A 3VBUC 1DZRA 1DGRN 2E53A 5KBFA 1HQLA 4R8HA 3AMPA 3WG2A 1LHOA 4XJ8A 4HK9A 1E57A 5CNAA 4IEOA 5GZFA 2YUEA 2Y0IA 3RS6A 4AK3A 3B9CA 4IV3C 3PVEA 1MZ5A 1NZCA 2V73A 4CEYC 3VDDA 1PK6B 3ZFFA 4P9JA 3ZIXA 4MGIE 2OA2A 1DZTA 4YSFA 1V6IA 1Z78A 4M3CB 2X5IC 2O8OA 3WUDA 4FOWA 1RVF3 4WVWA 5GJ6A 1BEV1 3O0XA 4FAGA 5HCBA 5JSRA 2D98A 3B7MA 4GWNA 1W6NA 1DG6A 1OQDA 1W6MB 5EV7A 2CAUA 4OI2A 5H9PA 1Q8SA 2R071 3SLIA 3J4UH 2WS92 4IEQA 2BNOA 4FO9A 4FOVA 4N53A 3HIFA 4QGMA 4TZDA 2G9FA 5CVRA 5BNPB 4AGVA 4I30A 1PGW1 1UCXA 1JUHA 1Z7S3 3ZIWA 5DUUA 3KT1A 5LEJA 2GZWA 2HKXA 1ENRA 4MZUA 1C4RA 1UZYA 1LGCA 4CDUB 1ZX5A 3VBOC 1EAH2 1Q43A 1RVF2 3M7AA 1O4TA 3USUA 3M70A 4IEPA 1YI7A 2V5YA 2SBAA 3WQ7A 4FPEA 1EP0A 1PZ8A 3X29B 3QLQA 1SQ4A 5ABJB 2KXLA 2WZR2 3K48A 3ELNA 4WM7A 3OBRA 3RJ2X 4X8NA 1AUYA 1PO11 2VU9A 2F4PA 4K6BA 1ASJ3 3AKSA 4JTOA 2W52A 1GZWB 3P3PA 4PLNA 4COZA 1ZM1A 4J6GA 4A7ZA 4O9EA 4YW3A 3WVJA 4IV1C 4D3WA 3WW4A 2RS11 2LTNA 1BQPA 2R0FA 2VNGA 4LTAA 1QNWA 1BBT2 3DGTA 3GZAA 3RNSA 4KGQA 2R042 1RUF1 2VXRA 5FDBA 5JIUA 5C33A 1FATA 4SBVA 1KRIA 1OOPB 3WR0A 2ZKLA 5GZEA 1KQRA 4Y1YA 3B00A 4Q4Y2 3ZVXA 4L99A 5FLHA 4WBBA 3WUCA 2EXHA 3H8UA 5K8SA 3B5LB 4Q0VA 1OMIA 5JZGC 5FRAA 3E5UA 1QKQA 1S2KA 2AGSA 2W39A 4ASLA 1U0AA 4FP3A 4INDA 5EZWA 5JAXA 4I3GA 1LOEA 3ZXAC 3MZHA 4Q4Y3 4E2QA 4WV8A 3CJXA 1QF3A 2LUWA 5FMOS 4CP0A 4XPVA 2O1QA 3ZYJB 4E9KA 1RUC2 1SBEA 2XJRA 3J8F1 3HT1A 4Q4Y1 4A7KA 3ZFEC 1YFUA 4Z82A 5DDJ3 3WY6A 3LSEA 1EAH1 1DGWA 2GMMA 5GZGA 4CDQB 1WCKA 1ENSA 5D8AB 3ZN6A 3NAPA 1KXGA 2JICA 1SLCA 5ABJA 1COV2 3WX5A 4KH9A 3WDXA 4WM8C 1K5MC 3QBQA 4IV3B 1U5ZA 4AVTA 1EV12 1REEA 1XYPA 3ZSKA 1TNFA 2ZGLA 4Q8KA 1Q8OA 3NWKA 3SISA 2WNEA 4CEWB 5CIRA 1RUH3 3ZXFA 4E4ZA 2BWCA 5AC91 1MQTA 1ZRDA 3VBFA 2IXKA 5FLIA 4CDWC 1BMV2 3THTA 2BW8A 4YRDA 3LA2A 1POV1 3CL1A 2WNUB 2E63A 2I74A 2K2SA 4I09A 4LO5B 4Q8LA 1GZCA 2QNKA 4NPRA 1RINA 3O0VA 1TME1 5CG8A 1VALA 1TMF3 1FNZA 3FLRA 1AX1A 4COVA 1KITA 5KC6A 5ABJC 2A70A 4N7UA 1CGPA 5D8AA 2B45X 5K0UA 2RS51 4CDUA 2QJVA 4AEKA 3VKFC 4AFDA 1MVEA 5KHGA 4XOGA 1I6XA 4I0AA 3SXWA 3WLUA 3J8F3 1Z0HA 2CYFA 2ZHLA 3VZJA 4FCAA 4R9CA 4Y1ZA 3VGIA 4MXWA 4ES9A 3AJYA 2QFEA 3OGGA 4QMAA 2ZX4A 4M3CA 4OHYA 4YVWB 1C5IA 2NZ9A 2Z42A 4C90A 5LRRA 3TN92 2XVLA 1VBA2 4YG3A 4PQ9A 1N1SA 3QD6A 5T5JA 1C3HA 2ZX1A 3KB5A 1ZBA1 3PVNA 1SLBA 1WGPA 3AKQA 3I4IA 4XQWA 1GZWA 2DURA 1JTZX 3D0JA 2ZZJA 4Q4W3 5KWRA 2A7AA 3N36A 1AL22 1KD7A 3LA7A 1D0GA 5GM0A 1XU2A 4XBQA 4IEZA 2I2SA 3TNPB 1H9WA 4QPIC 3OGJA 1H9PA 1J58A 1LR5A 2ZGNA 3PTYA 5C6CA 2IZWA 4CEWA 3D82A 1H4HA 5F6KA 1OOPA 4QPGB 1CD3G 2DFCA 3E97A 1WLCA 5K0UC 2XVKA 2HWB1 1PM7A 2AYHA 2FZ2A 5JZGB 2RR12 4ZU7A 1NCQB 2Z79A 2TUNA 4Z8BA 1KS4A 3I59A 5BNPA 1HXS2 4YW2A 4DINB 4AHYA 4C1XA 3V0BA 3BU7A 2PFWA 2GDFA 3JUUA 4EN9B 1SFNA 4RSUA 2C9AA 3RZZA 3KQRA 1DQ4A 1QXPA 2BVBA 3KD4A 3MIHA 3WHUA 1AJOA 3VBRB 3M1HA 4N9HA 4YVWC 3TB0A 2D6MA 3E6CC 1QJX2 1RUD1 3TRSB 3CJIB 2AR6A 2OVUA 4CDQA 4DOUA 2JD4A 3PMEA 2VQAA 4KNCA 3NKGA 3EHKA 1QJY1 1VBB2 1PO21 1FYUA 2JXAA 1RUE2 1S0FA 1NLSA 3CJIA 2HWC3 1RUF2 3OCPA 1BCXA 1QNYA 4BWOA 1NYWA 2Y38A 1R1A3 2W0XA 4HMZA 2VMGA 3MFCA 2ERFA 2RS32 1PVXA 4FPGA 4MGYE 2WQZC 2YGMA 4MGZE 4QPIB 4ZU5A 2XL9A 1SBDA 3H7YA 2XH6A 1XNDA 1ZZ9A 1OPOA 3ETQA 1QDOA 1LGNA 3GALA 3ZYGA 2R32A 2GMEA 1EAH3 2OW4A 3AP7A 5GLTA 1LJ7A 4QQPA 3UKVA 1ZZ6A 3AM2A 3B94A 3ILRA 1ND3A 1S0CA 1OHFA 4GH4B 5IK7A 1N47A 5A32B 1KS5A 1DLLA 3EQEA 3R4DB 4DZGA 5L7OB 5JIAA 3M8LA 3MIEA 4L92A 5L36A 1G8WA 4JQRA 5GZCA 4GH4C 4AGGA 3EJKA 4G3YC 3RDIA 2HJIA 1UX6A 4U2AA 1BYHA 2WSVA 2WIIB 2VVFA 1RMU2 2PAKA 1RUJ3 4RA0A 4N43C 3AP4A 4YW1A 1LGBA 2Y0OA 2ZGSA 4KQ7A 1ZRFA 4KL1A 4UW5A 2MEV2 4WM8B 4U36A 4COWA 3EBRA 5C9AC 1POV3 1DF0A 3GZUC 1AXZA 3N7KA 1PGSA 1WMFA 4QXKA 3POYA 4OVEA 4Y22A 4C0HA 4YW5A 5JI9A 2CTVA 2JKBA 4XW3A 3PJQA 3N4MA 4LBQA 3KZ4C 5CFDA 4YM1A 2B46X 5GLZA 3POWA 3H3ZA 1OKQA 1X33A 1XE7A 4KBBA 4GMP0 5I0UA 4FTSA 3VBHC 4B4PA 2A75A 3J8F2 2X5IA 4GH4A 4DRRA 1RVF1 5JMCA 5HBAA 3HD8B 5CU1A 3UKNA 1LOBA 3VZOA 2D6PA 4W6WA 2AREA 4XJAA 4UXAA 1WUVA 1DQ0A 4NHKA 5K7PA 1JHNA 2D6LX 1AR83 2JG9C 4SLIA 1MS1A 1GICA 1OA3A 2XHKA 4D7SA 5C8WA 1CAUB 2P2KA 2OYZA 4QM9A 5IT6A 1XNBA 4Y26A 3WV6A 4B29A 1J3PA 5C4WB 1OD5A 1ND2C 1FT9A 3E5QA 2UYBA 3PHMA 3HT2A 1LU2A 2D93A 4Z1VA 2I45A 3WDUA 4XTMA 5DZEA 3DN7A 4AFCA 3MW2A 4IQPA 3UK9A 1ULEA 1ZZ8A 2DUPA 3AMHA 1UIJA 3AZWA 5FPZA 4BHPA 4CTEA 3FLPA 4YG6A 2B42B 3HR9A 1UN1A 2XVGA 2B8MA 4BIFA 1ZBE2 3AXEA 4WVZA 1EV13 4LO4B 2PHDA 4L9BA 3AMMA 4BMBA 3M3CA 1YFXA 3RPQA 3ZFFB 1ASJ1 1AYM1 1FOD1 2JG8C 3CNAA 1H2MA 4S2DA 3VV1A 4LA3A 2D6NA 2ZHMA 4Q4X2 4WZFA 1QOTA 2EIGA 2WQ4A 2E9QA 2PHUA 4OI1A 3BPZA 4CDXA 2ZGOA 2GAUA 1YFYA 2A6YA 4JTNA 5DUWA 1C8M3 4K1ZA 1PO13 3FFZA 3KS7A 3HN1A 3RMXA 3DUIA 4D94A 4OHXA 3VBFB 1SEFA 4ZXKA 2XL7A 5AVPA 4EWEA 1AYN1 5BV6A 4JGYA 2ZHNA 2MEV1 1RUD3 1AYN2 2VECA 3SH3A 3H9AA 1RUE3 4QM8A 3WW2A 1BVP1 1G86A 5BNNC 1LOAA 1AVBA 5JZGA 4PLOA 2NP0A 2D5HA 4HSLA 2R16A 5FMOL 1NA1C 2GU9A 3ZXEA 3URFA 3ZFGA 2R073 1MS3A 3IWZA 1HIXA 1DDLA 1O3SA 1O5UA 5DG2A 3MW4A 4E4DX 1H4GA 4MSVA 1BEV3 4LUMA 4C91A 2YROA 1QJU1 5FREA 2K9ZA 2ZJCA 1HRI2 1GZ9A 2EXIA 4CDXC 2VGDA 5I0TA 4COYA 3VBRA 5CAZA 2MPFA 4YZ2A 3ZSEA 2BEOA 1JBCA 4PLMA 1U5XA 4EWDA 1XNCA 2HEYF 1G9BA 1PGL2 1IKPA 1W0OA 2RR11 3NAPC 1YJLA 3FMGA 4YM2A 3ZN4A 1M06G 3AYEA 5J48A 3D5OA 1PNFA 3GNEA 4YZ4A 3ZXDA 2H0VA 4M0NA 3M3IA 4HVQA 1UD1A 3RG0A 4P9IA 4XIOA 3R6SA 4B7EA 1QJU2 1RB8G 3ZSLA 2DVFA 4AI3A 4HSJA 1N1VA 4LULA 3JB8A 1U5YA 2PHLA 4AQTA 4XJZA 1C8M1 1HQNA 1VAMA 4V1PA 3VKLA 4F8AA 1YRZA 2PHTA 3A4UA 3ZFGC 1RIRA 2ZGKA 1Y7BA 3LKJA 3RI9A 2D3SA 4EJRA 2PAMA 1YWKA 3GHMA 1QH7A 1Q56A 4HVOA 3J9SA 1N1YA 3KGLA 3ZXLA 4FSJA 1UKGA 1MS0A 3NW4A 1TNRA 1VAVA 3IBMA 1ND3B 2OUJA 4J1WA 2XBO3 3A0KA 3RMYA 4DNYA 3B02A 3VBRC 2JENA 1J59A 4BOWA 2P3JA 5KC5A 2BNNA 1TQ5A 2WKKA 3LOIA 1W0PA 5JDBA 3AFKA 1QQP2 1H1MA 4B3NA 1A78A 1G7YA 5D8AC 1HV1A 1PO22 1JYIA 4AVCA 2HWF1 4ZKTB 1DZQA 3U11A 4HZFA 2YHJA 5D1IA 4RR3C 1JH5A 1A3KA 1AX2A 4NWVA 1R1A1 4CRQA 2CNAA 3VZLA 1RUG2 1VRH2 3QOPA 5DXDA 3KGZA 2SLIA 1GR3A 3ZO0B 1VBA1 4A2UA 2AENA 3CEWA 2ZGUA 1RUJ2 2CWSA 1QQP3 4RS5C 1FMD1 4IETA 1LTEA 2XPJA 2A6XA 3MDPA 1AR71 2ZX2A 3OPZA 1FPN2 3PLQA 2GC0A 2XBO2 5CB7A 1O7FA 2VOXA 4CZSA 3MPPG 3QCWA 1F9KA 4BM8A 2WT0A 2DV9A 2ZGMA 2RS52 2HWB3 5T5PA 1QJX1 2JECA 3L9JT 3OYWB 3BB6A 3MYXA 3NO8A 3VBOB 3WP3A 4F7ZA 1EPWA 1NY71 4Q0QA 4NOTA 2A6VA 3OYWA 2WZPP 5FO9B 1G9AA 2WFF1 5DG1A 2XB6C 2YPJA 4L2NA 5DDJ2 1CAWA 4BZ4A 1OA2A 2VOVA 4RQPC 1MS4A 4UW3A 2QCSB 3TWIA 4G9SB 1LEDA 3W9AA 1VBC2 2GNDA 1N1TA 4CEYA 3UKTA 3VDDC 2DTYA 3LA3A 2HWF3 4LR4A 4XXAA 3H50A 1UU4A 3QH6A 4YVWA 1YNAA 5DZGA 3CLPA 4P9LA 4NHMA 1PK6C 1MS9A 1R093 1QJY2 2ET1A 4XFIA 1S0IA 2PYTA 1KDMA 2B7YA 2HWC1 4AEMA 2YDEA 3WQ1A 1G6NA 3LWCA 3HQXA 4HFSA 4R52A 4WZCA 2A6WA 3OD4A 1KJLA 1H1IA 2PTMA 3KT4A 1I1EA 4EN6B 4Z07A 4FTEA 1QJY3 3ILFA 1RMU1 1PMIA 4FAHA 1PGL1 2N7GA 2DCKA 2VOKA 5F9TA 1ZBE1 2VMIA 3IDEA 4S2GA 2IXIA 2PELA 4C0BA 1HXS1 4MH0E 4QPGA 2AZ5A 2ZHKA 5J7MA 2BYVE 1V9U3 4ORFA 4YGEA 5T52A 2NQYA 1UZZA 2PA7A 3ZX7A 2XJTA 1ND3C 1ZZBA 5EYYA 5BNNB 3FWEA 1RHI1 4IEXA 3AYAA 4QGNA 2BFUL 4QU2A 3ECQA 3WP4A 1XE8A 4JAAA 1JW6A 1GV9A 4HKWA 4E4SA 3JCIA 1ZVFA 3IDCB 1PK6A 1DGWX 2R1BA 4L11A 4COUA 5JVVA 3MI8A 2VUJA 4YZ3A 1LENA 1F8VA 1WBFA 3R4SA 1I9RA 3TN91 3VL8A 2R30A 3RQ0A 1RUI3 3VZMA 2X53S 1OI6A 4YFZA 1VIWB 1SLAA 1SCSA 3AP9A 3ZYPA 2DFBA 4FXKB 5AC93 1VRH3 5L73A 1YIFA 3NV1A 4W6YA 3D8CA