3NAPB

Structure of triatoma virus (trv)
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
247
structure length
247
Chain Sequence
b'KQMNVNSSQDTTFEQRSQEKVQAGEINESIEFRNQITTFVHDNPIITEQLIGDSPQPSGDVRSVSDARTHSIIDFLERPQFIGSFLWNTSDIENKEIFSLKLPDALMSPMIREKLSGFTSFSASTVFHIQVNAHPFQCGRLVLAAVPVPDILPLHRLNMLSFDVSNVITLPHVQLDISKETEVLLKIPYVSPFVQYDLVTKFTPWAAFLAHVYAPLNTPSAASLQVNVFAHFEDIKLGFPTSAIVAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein
publication title The crystallographic structure of Triatoma Virus (TrV) highlights the Dicistroviridae and Picornaviridae family differences
rcsb
molecule tags Virus
total genus 50
structure length 247
sequence length 247
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00073 Rhv picornavirus capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.20 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3napB00
4CDWB 2WFF1 1QJU1 1C8NA 4AEDA 3J8F2 4Q4V1 1C8M3 3JD72 1ND3C 5D8AA 2RS12 4FSJA 1R082 1QJX3 2RR13 2HWE3 1NCRA 2VQ0A 4N43B 1VBA3 1OOPA 1TMF1 1VRH3 5J96B 4RHV3 4PDWB 5C4WB 2RMU3 3M8LA 1HX6A 1H8TA 4CDXB 5J98B 4QPIA 4CDUC 1QJY1 3TN91 5AC92 3VBHB 2HWB1 2XBO1 4RR3B 1QQP1 1RUD1 4IV1B 1FMD3 2RR11 1V9U3 2HWC1 1RHI2 1K5MB 3TN92 3ZFEB 2PLV3 1ZBE2 4CEYC 4CEYA 1ZBA2 1FOD3 5L7OB 1PO21 2R063 1VRH1 2WZR3 5C8CB 1PGL2 4FTBA 1HRI3 1F2NA 1D4M2 1TME2 4WM7B 2RM23 5A33B 1AR73 5DDJ2 2GH8A 4RS5C 4RS5A 1RUF1 4RQPC 4Q4Y3 4NWVA 4RQPA 3VBSB 2XPJA 1VBC1 5ABJC 5K0UC 2BBVA 1VBB3 4N53C 4N53A 1PO11 1EAH1 1HRV2 1COV1 1AL23 1B35C 4CEWB 5BNNC 2QQPA 5BNNA 1RUJ3 1VBE3 1NA1C 3VBUC 1NA1A 1AYM1 2R061 3VBUA 3ZFFC 1FPN2 1RUE2 3ZFFA 1F8VA 1MEC1 3ZFGB 1WCDJ 5C9AC 4GB33 1RUC1 1NCQC 3VBOC 1NCQA 1OPOA 5CFCC 2R073 5BNPA 5CFCA 1GFF2 1RUI1 4CDQA 1R091 1PVC1 2MEV2 4YVSC 4YVSA 1AYM2 3J8F3 2RS32 1HXS2 4Q4X1 4WM8C 2RS13 4QPGC 4WM8A 4QPGA 1AYN1 1POV1 2R041 2X5IB 4YVWA 3LOBA 1PVC2 1RUH3 5BNOB 5CFDC 4Q4X2 5CFDA 1R1A1 3DPRB 1BEV2 2R042 3S6PA 2HWD1 1VBD3 4AEDC 4CDUB 1HQNA 5D8AC 1AL0G 4GMP3 2RS51 2WS91 2ZAHA 4IV3A 1EV13 3JB8A 1E57A 1RMU2 1NCRC 5A32B 3VBRB 1Z7S1 4JGZB 1RUG2 4BCUA 1RHI3 2WFF2 2ZZQA 1MQTC 1QJU2 4NWWA 1MQTA 1OOPC 1ZBE3 4Z92B 4Q4W3 4Q4V2 1ZBA3 3VBFC 3VBFA 4SBVA 1H8TC 1RUH1 1AR93 4QPIC 1D4M3 1TME3 5ACA3 2BUKA 3JBG1 4LLFA 1RVF3 1X36A 1TMF2 4Y4YA 5DDJ3 1C8M1 4GMP1 1PIV3 1NY71 1QJX1 1AR83 1QJY2 2HWE1 4JGYB 4CDWC 4CDWA 1BBT3 5ABJB 5JZGB 5K0UB 1HRV3 2HWB2 1VBA1 1RB8G 4RHV1 1B35B 2XBO2 1QQP2 1RUD2 2RMU1 3ZXAC 2IZWA 2RR12 1FPN3 2HWC2 1RUE3 1X33A 4N43C 4N43A 2HWF3 4RFT0 5C9AB 1PO22 4PDWC 5C4WC 1RVF1 4PDWA 1VBA2 1ASJ3 5C4WA 2FZ2A 1VRH2 5FMOL 5FMOS 3VBOB 1AR63 2RMU2 2MEV3 4CDXC 4CDXA 1HXS3 1FMD1 1CJDA 1V9U1 2PLV1 3VBHA 1A6CA 1RUF2 1VB4A 3IDEA 1ND2B 1FOD1 3CJIB 4RR3C 4RR3A 2WZR1 1VBC2 4IV1A 4GH4B 2BPA2 1K5MC 1CD3G 1HRI1 1K5MA 3ZFEC 3ZFEA 3NAPB 1V9U2 1PO12 1EAH2 1NG0A 1COV2 1BEV3 2RM21 2PLV2 1POV0 5BNPC 1AR71 5L7OC 5L7OA 4CDQC 3VDDB 2R062 5C8CA 1ASJ1 4Q4Y1 1MEC2 3JD73 4AEDB 1R083 4WM7C 5D8AB 1ND3B 4WM7A 1VB2A 5A33A 4YVWC 1RUC2 2Y26A 1VBB1 1PGW1 1AR72 1RUG3 1NCRB 1RUI2 2ZTNA 2WFF3 1QJU3 1AL21 1R092 3VBSC 3VBSA 1RUJ1 1VBE1 4Q4V3 3JB4C 1AYN2 1BMV1 1H8TB 2DF7A 1PGW2 4CEWC 4GB31 4CEWA 2GSYA 2R071 5AC93 4Y5Z0 1TMF3 1RUJ2 3ZFGC 4IV3C 3ZFGA 1R1A2 3J8F1 3JD71 2BFUL 2BFUS 2RS11 1QJY3 3TN93 2HWD2 2HWB3 4CEYB 2RS52 2WS92 2WWSA 2XBO3 1Z7S2 1ND3A 1QQP3 1RUD3 4GMP0 2X5IC 3HAGA 2X5IA 2HWC3 2FZ1A 1VBD1 1PO23 5BNOC 5AC91 5BNOA 1RUH2 4RS5B 3DPRC 3DPRA 4RQPB 1EV11 5LK7B 3JBG2 4FTEA 1RHI1 4CDUA 1VBD2 4N53B 1ZBE1 4Q4W1 1OHFA 1RUF3 1C8M2 1ZBA1 5BNNB 1NY72 1QJX2 3VBRC 5A32A 4JGZC 1EV12 3VBRA 2HWE2 4JGZA 1NA1B 1VBC3 3VBUB 1PGL1 1AR91 3ZFFB 1PO13 1D4M1 1EAH3 1TME1 1COV3 5ACA1 1AUYA 4EJRA 4Q4W2 1NCQB 1DDLA 4RHV2 5BNPB 5CFCB 5DDJ1 4CDQB 1AYM3 5GKAC 2RS33 1MEC3 4YVSB 1PIV1 1AR92 1AR81 4WM8B 4QPGB 3VBHC 1RUC3 5ACA2 1RVF2 1BBT1 4YVWB 1HRV1 1RUI3 1R093 1PVC3 4IV1C 1PIV2 2WLPA 4Q4X3 1FMD2 4JGYC 1AR82 4JGYA 1FPN1 1RUE1 5CFDB 1AYN3 1POV3 2R043 5ABJA 5JZGC 5JZGA 5K0UA 1BBT2 1FOD2 2HWF1 1SMVA 5C8CC 1B35A 2WZR2 1AR61 1HRI2 2MEV1 1R1A3 2RS31 1RMU3 1M06G 4IV3B 2RM22 1HXS1 5C9AA 2HWD3 1W39A 2HWF2 3VBOA 1MQTB 1ASJ2 4Q4Y2 1OOPB 1AR62 2RS53 2WS93 3VBFB 1Z7S3 1VBB2 5FOJB 4FTSA 4QPIB 1BEV1 1AL22 1ND2C 3CJIC 1ND2A 1IHMA 3CJIA 1VBE2 1VAKA 2TBVA 4GH4C 4GH4A 1BMV2 3NAPC 1QJZA 3NAPA 1R081 4GB32 1RMU1 3FBMA 3JBG3 3VDDC 3VDDA 2R072 1RUG1 1NOVA
chains in the Genus database with same CATH superfamily
4WVZA 4P5YA 3A23A 1QJU1 4PLMA 4YG6A 1C8NA 4GJZA 4XABA 1WMEA 3WLUA 4UF0A 1W9YA 2OS2A 2ENRA 3ZKYA 2XQXA 2K0GA 4NPLA 4Y1YA 1ND3C 2CAUA 1AF9A 5D8AA 1ULFA 3E5UA 3NV1A 5FIXA 1QJX3 5FLJA 4EZ4A 5FQ0A 2FDJA 1C3HA 4AFAA 5LBBA 3ON7A 2ARAA 4D7TA 3BU0A 1OQ1A 2WC2A 4XFIA 1NCRA 1OQEA 2Z69A 3ZSMA 3W21A 4F3JA 4MV2A 3H8RA 1FNZA 1RTVA 3LPGA 5CA6A 1GMMA 2FDFA 2Y38A 1NT0A 1VBA3 1QF3A 3P1IA 1TMF1 2CHHA 3T4VA 4RHV3 4MGKE 3E1F1 4PIYA 3OPWA 4MHRA 2RMU3 4XBLA 4YGDA 4XIOA 2QQVA 1E5HA 5IAXA 1V6LA 3IM0A 3OY8B 2IVIB 1S2BA 3N9QA 2BVBA 4QPIA 3RVHA 1V6MA 1QJY1 2XR4A 4CDUC 3MIEA 1RJ8A 2WIIB 1LODA 3NNJA 4W4ZA 5A7WA 2VBBA 3T08A 3VBHB 4IEXA 1ENRA 1T6BX 2JXAA 5BXXA 3NJXA 3W58A 4TZDA 1LGNA 1JUHA 3VGIA 1B09A 4WV8A 4DRRA 1J58A 4WVMA 1T2XA 1NXMA 1RUD1 4IV1B 3ROUA 2EXIA 2ZGNA 4INDA 1RHI2 3ZM8A 1K5MB 4XVHA 3ZX7A 3ES1A 5A7QA 3E6BA 2JDMA 3HEIA 3K77A 1RGSA 3ZPYA 4CEYC 2EALA 4CEYA 2QQNA 1ZBA2 5HXVA 5SV5A 3OBRA 1YO8A 3MF6A 1TNFA 1DLCA 1XYNA 2BGCA 4CE8A 1LB2A 3PNAA 1GQPA 1LOFC 4HK8A 1VRH1 5FK7A 1LOFA 2VH9A 4UWDA 1H1MA 4J25A 4QU2A 3AYCA 5FZ3A 3J26N 1PGL2 4XJUA 4FTBA 3POBA 5HV0A 1SACA 3AXDA 4DMIA 4HETA 4WM7B 3LDBA 3DCQA 1AR73 2O14A 3MHZA 1VMFA 2E7QA 1FI2A 4HMZA 5JMCA 4RN5A 1IS3A 4RQPC 5JR2A 4RQPA 2X09A 2R1DA 4NRMA 4YGEA 2E7AA 4TSVA 4BOWA 5FZAA 1WMFA 2FMYA 3USUB 1HB4A 1DBNA 5K0UC 1O6UA 3V0AB 4IW3A 1EAH1 1HRV2 1COV1 3N9OA 4A7YA 1AL23 4AVAA 4CEWB 5FZOA 3ZIWA 3LIHA 2B5HA 2OPKA 3BYWA 1W8WA 5CAZA 2JWPA 1KEXA 2VZOA 4N7IA 2P17A 5DZFA 3VBUC 3VBUA 4QQPA 1O8PA 2E9QA 3VKFC 1MEC1 5IVFA 3THDA 5HCHA 4AHZA 2BU9A 4LE3A 1YQCA 5DUWA 3JQXA 2Y8KA 3AX4A 4DFSA 4GB33 2AREA 1SDWA 2SLIA 3WDXA 1SLCA 1NCQC 1UY3A 2CNAA 2H6BA 1NCQA 2V5YA 2ZX4A 3M3OA 4OZXA 3QD6A 2R073 3PL0A 4HKWA 4Q29A 4QX2A 1GFF2 5TSWA 5CFCA 2B4KA 4BK4A 3I2KA 1R091 3LSDA 4QX0A 4UFKA 1IG0A 1XPWA 1AYM2 1YRZA 2RS32 3JCIA 4LOTA 2AC1A 4DZGA 1HXS2 1U5IA 3HMYA 3I3DA 3EYPA 3E6DA 2AH2A 3GZAA 4WM8A 1JU4A 4WM8C 5F2WA 4BISA 1AYN1 1POV1 1CAUA 1UAIA 4B4RA 4YVWA 1ZZ8A 2VZRA 4O65A 4QQOA 1PGSA 1H6XA 5HPOA 1IPJA 1J83A 1SLAA 1W8TA 3LOBA 2YC2A 1Q8VA 5DZGA 3T0BA 2UWBA 4HL0A 3H3ZA 2CGPA 4LO5B 1QWRA 5C7GA 1OH3A 3BODA 4UW5A 4A6OA 4AI8A 3FHIB 3IT8A 4TWTA 3RZMA 1BEV2 5A3LA 5GM0A 3LAGA 2R042 3S6PA 4ES9A 4OUSA 3EMRA 4K8RB 5GZEA 4BWOA 4Q0VA 2ZEWA 1VBD3 5KC5A 3KLSA 2QQOA 2VXJA 4LORA 4NOTA 1HN0A 4CDUB 1U12A 5C33A 4K8FA 4GIQA 2RS51 3KF3A 1CIWA 1DQ6A 2BGPA 5LY2A 2GN3A 2Q1ZB 2ZAHA 4IV3A 3ZXDA 2ARBA 1HW5A 1KS4A 1LCLA 1PHMA 2YG0A 3JB8A 1E57A 4NR1A 1F4AA 3RZZA 2D93A 3SKVA 5LRSA 4JGZB 1OUXA 4BCUA 5FPVA 3WNMA 4I30A 1RHI3 2XMLA 5CVRA 1QJU2 4ZPIA 5T54A 1OOPC 2CSGA 3LKJA 4XUNA 4AW7A 2Y6GA 2RE9A 3ACHA 1ZBA3 4YG3A 1NLQA 2VECA 1LHVA 3GXUA 2QUOA 2LW8A 1UY0A 2AYHA 1TQ5A 2VE1A 3QBQA 3H8XA 1GNYA 4JZRA 1RUH1 1SBEA 3SH3A 2B9VA 3D4KA 3UKNA 3LFMA 5F37A 2HLEA 3R4SA 4AGGA 2BUKA 4CP9A 1X36A 2FD8A 1XNDA 2YC0A 1TMF2 2RHPA 3NV3A 4AFMA 4AVSA 4L97A 1N47A 4YM3A 4IE7A 1BQPA 1SHWB 3ZN4A 5JUVA 2NZ9A 1PIV3 3OG2A 1NY71 5T5PA 3SCGA 4IXLA 4Y1VA 1DYPA 2NMOA 1QJY2 2HWE1 2W1QA 4LBQA 3W5MA 2R1BA 3MPPG 5CG8A 4HKOA 4HXCA 1G9CA 4XCAA 2MHFA 2ZGLA 5K0UB 1HRV3 3OGVA 3WNXA 2VTXA 3B01A 3WCSA 2ZX2A 2JDZA 2QJVA 3ACIA 5JOWA 2ZGPA 4D6SA 1JTZX 1RUD2 4XAEA 2OT7A 3ZFEC 4AL9A 4ZU4A 2NLRA 1X33A 5K4LA 4N43C 4IGPA 1W0OA 4N43A 3L2YA 5FLIA 2FDIA 2WO1A 2QZ3A 1GICA 2HWF3 4RFT0 4DXRA 1RVF1 1UOFA 4XFGA 1GU3A 3LCPA 4KU7A 2XL9A 1CESA 1H8VA 1VRH2 1VJ2A 4XBNA 1JU3A 1W3VA 3GALA 4YM0A 3MF9A 2K46A 3RZJA 1SCSA 3APBA 1HXS3 1UXZA 3RPQA 5KXBA 4CUAA 4IEWA 1KDMA 1V9U1 5GLVA 4JDMA 3ETQA 3QH7A 2ZEZA 2OUJA 3H1MA 5GLTA 1QIQA 3ILRA 3NKGA 1JOBA 1RITA 2LS6A 2UWAA 3PMEA 2ZHLA 4KMQA 3SH5A 3I7DA 1OSGA 1UNBA 4P9WA 5FYTA 2WZR1 1V6IA 2XXZA 2O1QA 4YZ1A 2BOIA 3M1HA 5JPMB 3MDPA 2P3IA 1X9PA 1ZREA 4XCBA 1EAH2 1COV2 1BEV3 2PLV2 5BNPC 1NX9A 2OUHA 3CMGA 5L7OC 4IL7A 3NNGA 2D5FA 3WSOA 5L7OA 1PX3A 1XQNA 4A2UA 3KV9A 3LZZA 5CNAA 1ASJ1 2DWRA 3RGBA 1MEC2 4FPJA 2PHTA 2AR6A 2Y34A 2GALA 5FPZA 3J7NA 1UOBA 4KQ7A 4YW2A 5FP7A 4XPVA 4A3ZA 2GP5A 5JPNB 1DQ1A 1UMZA 1VBB1 4AEJA 3S0MA 4LEJA 1NLRA 1OA4A 1UZVA 3AMNA 2VTXJ 1QJU3 1J3QA 4QKFA 1R092 1GKBA 4QKNA 2XVLA 2A71A 1VBE1 4RFRB 3KZ4C 3N7JA 4PHZA 2ZEXA 5EJZB 3NMBA 3UGFA 1S0BA 1AYN2 1BMV1 1OLME 4KG8A 1WLTA 4QU1A 2OZJA 2XJTA 3DYMA 4KNCA 2PQSA 3G7DA 4IEQA 3ORJA 3IN9A 3NRUA 3N36A 1TMF3 2E53A 1UX7A 3IIAA 1US3A 1YXWA 3RYKA 3NNFA 4QHZA 3JD71 2BFUS 3EQEA 4FPGA 1QDOA 4MH0E 3O0XA 3ZYGA 2A5ZA 4XJ9A 1DZQA 4MZUA 5IYYA 3QLQA 1QJY3 2VULA 3H3LA 4W65A 1ZZBA 5IATA 4Y20A 5DAVA 3RNSA 5FJHA 4AQ6A 1KFXL 3M70A 1OA3A 2WNUC 2W5FA 3DXTA 5M0TA 2RS52 2WO7A 3AM2A 1KDKA 3IZOA 4LKSA 5AFEA 3OTFA 4XETA 1Y3TA 1HB3A 3O7OA 2W87A 2YPJA 1RUD3 4GMP0 1WCQA 3HNBM 3WINE 1YC61 4HPKA 2DTWA 1S0JA 1EP0A 5B2GB 5KR7A 5FUNA 2TEPA 3FHAA 3OBAA 2F4PA 3EJKA 2FZ1A 2FMDA 5FMCA 3I3EA 5FUIA 3BTYA 3T1MA 4FFHA 4YARA 3HOBA 1RUH2 2JJ6A 3O5SA 3R6SA 1YNAA 3KT1A 2JG8C 1BKZA 2JG8A 1OF4A 2FBEA 4Q0QA 2GC2A 2Y60A 3U75A 4V1PA 4AHYA 1KJRA 1VMHA 4YW3A 4FTEA 5A7NA 4FXKB 3CIHA 4N53B 1HQWA 1UOGA 1H1AA 1JOPA 5T5OA 4NIDA 5I93A 1H1IA 2JDNA 5A3NA 1JODA 1QGLA 5BNNB 4IQPA 4HOOA 4QHOA 4CVUA 1NY72 1VIWB 4CU8A 3QACA 4L9BA 1Z0HA 2A6WA 1EV12 1DHKB 3BPZA 2HWE2 1JS9A 3Q8FA 5CBLA 1G9AA 3M7AA 3UETA 4CCOA 2GN7A 2VNOA 4P9LA 3IPVB 2ZPXA 1TME1 1EAH3 3N7MA 1COV3 5JIAA 5F3IA 3VB9A 3RFRA 2WN3A 2IXKA 4Y1XA 1AUYA 3FWEA 4J6GA 4KWUA 3ZYJB 5BNPB 4IEYA 4AGVA 2GH2A 4QMAA 4MGZE 1Y9QA 2VNGA 3E6CC 3DXUA 1MEC3 5E88A 3MIHA 3SHRA 1FT9A 3SEPA 4GJYA 2W9XA 3WT3A 2LALA 1AR81 1U5XA 1CAXB 1HJGA 3KV5A 3IDAA 4GULA 4K3UA 4LBMA 5ANNA 1W6NB 3T0DA 5E89A 4FXGB 4A42A 3ZXGA 2PA7A 5LEKA 5AVAA 1RVF2 1H2NA 1EUUA 3BN6A 4GA9A 3S30A 4IESA 2G1MA 1R093 4G3YC 2QQLA 2JB4A 5GALA 2GC0A 4AK3A 1OH4A 3H42B 4AAPA 2NP0A 3OOXA 2GZWA 5AVPA 3ZXLA 4JGYC 1WLDA 4JGYA 4ATEA 1ZRFA 5CFDB 1AYN3 1POV3 2W52A 3AP5A 4XXAA 1LHUA 5JZGC 3SITA 5JZGA 1E5RA 3CJXA 1GZWA 4C0HA 2D6OX 3HNMA 4XJZA 4P00B 3VDCA 5C8CC 5EHDA 4F8AA 3O14A 4R4XA 2WWJA 4LITA 2WZR2 3THPA 4E4ZA 5FPAA 2EAAA 2WYSA 3KT7A 4BU2A 4DY5A 4WZCA 1RMU3 2Q4SA 5DZEA 1LEDA 1K5JA 1W8HA 2Y6FA 3OD4A 1BK0A 5LBCA 5HBAA 1W2TA 1W2NA 2PAMA 5C9AA 2DCTA 1DZTA 4XF9A 4LNVA 3D3AA 4CRQA 4CCKA 3H1WA 4XFBA 1ASJ2 4BK5A 5JAXA 3SCFA 1AR62 2RS53 4KBZA 3GJAA 2XHKA 1NE4A 2WNUB 1O5LA 4QPWA 4ZU7A 1URXA 5JSPA 5JR7B 2VUAA 1VBB2 4D94A 2ZGMA 3UGHA 4W6YA 3T30A 3A0NA 1UY4A 1TG7A 4NHXA 4NO4A 3VZLA 1LHOA 1J1TA 1ND2C 4C90A 2HEWF 1DQ0A 1ND2A 1OD5A 1XB9A 3CJIA 2LTNA 1VBE2 3CJIC 5HCAA 1W6QA 4AFBA 3PU3A 4LO4B 2C4XA 5LBEA 4AVVA 1BMV2 1SLTA 4PLOA 1WMDA 2RG4A 2LUWA 1QJZA 4H14A 2OYZA 1W04A 4FT8A 2R30A 4XF1A 2XGXA 5FXWA 1UCXA 5DXDA 2JIJA 4YW7A 5A3OA 1VAVA 3B7MA 2TNFA 2WINB 1RUG1 1MS4A 4Q26A 4CDWB 2WFF1 4FOWA 1YFWA 4DS0A 2VZTA 4LHKA 4NIIA 2ZKNA 4LT5A 4LMFA 5FYVA 1UQXA 2GC3A 3I59B 4NE9A 2R32A 2F6BA 3JD72 4B1LA 1GP5A 2QQKA 4E4HA 2RR13 1BVP1 4UI9L 1NZCA 1OD3A 2HWE3 5JIUA 4E8CA 3FUQA 3HN1A 3U0ZA 2BJSA 3AZYA 2VQ0A 3ZSJA 3DEMA 3O1OA 1W9FA 3ZR6A 1VPHA 3ZMOA 3Q8AA 4PDWB 5C4WB 5CKQA 4HVRA 4SLIA 4DUVA 1FV2A 1JYCA 1YFXA 4OUEA 4AG4A 1IQAA 4NAOA 3ZMNA 2PHRA 3P3PA 2FDKA 1H8TA 5JVVA 4CDXB 5EPAA 4JV4A 4W6XA 4RGKA 3BUCA 2VMCA 4L2NA 4JRLA 4WBBA 2OX0A 3POJA 1W8OA 5L19A 3OPZA 5LASA 1XC6A 5FYCA 3LDKA 2HKXA 5DG1A 3SISA 4Q1PA 4M01A 5A3WA 4XF0A 5CFCC 4JKMA 3KQRA 4CCMA 4XDOA 4EQVA 2YFZA 3PDQA 4M0NA 2ARXA 1O8SA 2XBO1 3T2QA 3OJBA 4HVOA 4RR3B 5A3MA 4OQ9A 1RJ7A 1YQ2A 3AJYA 1V9U3 4QX8A 5CU1A 5FFOC 3ZXEA 2B9UA 4B8EA 5FO8B 2UU8A 5FY7A 3ZFEB 1SLIA 3PVEA 3MLJA 2UURA 4XQ4A 3E5QA 1S55A 1A78A 1PMIA 1F35A 2BBAA 1CVNA 2EIGA 3RZHA 2DTYA 2R063 4LKDA 2Q8EA 2WZR3 5C8CB 3DKWA 1RUNA 5FYYA 1OKOA 4LHLA 1FV3A 1TME2 2WT2A 5I0TA 4P08A 3WP5A 2BZDA 1CAVB 3FUOA 3M3QA 4PIXA 5F39A 5A33B 1BK1A 4QQHA 4M0HA 1IS6A 3TEXA 1SCRA 1CR7A 2ZABA 4N9HA 1D7PM 2C0ZA 2VZ1A 2GH8A 2YYOA 2YBPA 4HONA 3IAPA 4Q5OA 4RS5C 4V2WA 4D8MA 4RS5A 1RUF1 3H8UA 1ZM1A 4XAAA 3VBSB 3S57A 1DYOA 2DUOA 3VHNA 1NUKA 3B00A 3AKRA 5D1IA 1VBC1 1Y43B 3UNPA 1VBB3 1DZRA 3I2JA 1UIJA 2WA3A 5LWBA 1D2SA 4QB1A 1B35C 5AFBA 2NM1A 3KHCA 5FV3A 5E6HA 1VBE3 2A6XA 4ZHNA 1MVEA 3HN3A 2ZHMA 4BIOA 1NA1C 1YQ5A 2C26A 1NA1A 1AYM1 1OFSA 2PHDA 2X8KA 3I3BA 1F8VA 3ZFGB 1OLQA 1G86A 1IOAA 2YBSA 1ZZ6A 5JXGA 2XJPA 1OPOA 5IW0A 2XDVA 3SCHA 3A4UA 1RUI1 3I2GA 1GNHA 2HH9A 1EY2A 5G05L 4CDQA 2BVVA 2CL2A 3PU8A 4YVSC 1DG6A 3ILNA 4B7KA 4YVSA 5IVBA 1S0FA 3AZXA 4L92A 2V09A 2ZEYA 3H9AA 4FP3A 1Y9GA 4NHMA 4BH9A 4QPGC 2ZX0A 4NPRA 5F6LB 4QPGA 1A3KA 1VALA 2EIBA 1NKGA 1UZYA 3VKLA 2BGOA 2R041 2W95A 4AE2A 3SKJE 1W05A 2VCBA 4I0BA 2D44A 2J1UA 1QY4A 2JKBA 4NIHA 3GZTB 1ENSA 3EXUA 1XNBA 3HBZA 1JZ2A 5E1RA 5FZ0A 1P8JA 1W8UA 5BNOB 1QXPA 4QX1A 5DAQA 4Q4X2 2UYBA 3UJOA 5FZ6A 1K42A 1O3RA 3KCCA 4JRAA 1HB1A 1L7LA 3CQOA 4UFIA 4OYUA 2XHNA 3LEGA 1W6MA 1W8FA 3T09A 2W92A 5F3EA 1HQNA 3R4DB 2TUNA 1UKRA 2ZGRA 1AL0G 1VAMA 3BVCA 5D8AC 2RVAA 1UMIA 2WS91 3BU7A 3ZSEA 1K45A 5JSRA 1O91A 1NCRC 1XNCA 5IUQA 1Z7S1 5FK8A 4MXWA 1RUG2 4M00A 3THTA 3UJQA 2WFF2 2ZZQA 3B3QE 4NWWA 1WW4A 4LA2A 1J3PA 2ILMA 3LSEA 5FYMA 4Z92B 3NNLA 4P5HA 3I3MA 3HR9A 3VD5A 4FPHA 4YG0A 2YZ4A 1W0NA 2EXJA 3IBMA 1O3TA 3UV9A 3N7KA 3VBFC 2JECA 2HEVF 3VBFA 3WNLA 1LOCA 4SBVA 4QPIC 4CUBA 3TOJA 2VGDA 2DCKA 1G9DA 1RXGA 2RDRA 2JDPA 1ZX5A 2NMNA 3GF6A 3PUSA 1TME3 2V72A 4FFGA 4LOSA 3WQ0A 3E5XA 4BMBA 2VMEA 3JBG1 4LLFA 3WG4A 4NHYA 5LBFA 1XSRA 2Y33A 4LKEA 1Q3EA 5FBJA 1JBCA 3W59A 5IVYA 2Y6LA 1LR5A 1FYUA 2B39A 4UBHA 2J42A 4JVAA 4BQ2A 2D6MA 2V5DA 4UW6A 4GMP1 1TNRA 1W3XA 2XUMA 1ZRIA 4GWJA 2JIGA 1SLBA 1AR83 3P5BA 2W0XA 2DVGA 4LA3A 1DFQA 2ETEA 5H9PA 3KV4A 5FY8A 2VZPA 1REFA 4QKDA 3W20A 4D6RA 3LA7A 1B35B 2XBO2 2KR2A 3PTYA 2Q1FA 2D7FA 4JX0A 5FP8A 1BLZA 4LO6B 3NW4A 3WQBA 1ZZ9A 2IZWA 3ZXAC 5KXCA 1XYOA 2DUQA 3OGGA 5GLWA 4U36A 3EHKA 3J7MA 4LE4A 1N1TA 5FUPA 1T6GC 4RGGA 3AVRA 3T1LA 5KXEA 1MS3A 3KWVA 1YUDA 4C0BA 1JYVA 1L3JA 1SPPB 3AMMA 2WYFA 5KBFA 3VZOA 1ALYA 4CU9A 5FMOS 3H7JA 4UAPA 3WDWA 4XZPA 2E33A 4BE3A 3MPBA 4B29A 4A44A 4FQZA 1GQGA 3WF4A 1FMD1 3AZVA 5J1XA 4NVPA 2A6YA 2PLV1 2W08A 2VVFA 4MXVA 1A6CA 2VMHA 3POSA 1FAYA 2WN2A 2BWAA 1RUF2 2DUPA 2X29A 3AXEA 5APAA 5LA9A 3ZXFA 1YJLA 4EYUA 2UWCA 3ETPA 2JG9B 3WP4A 1MZ6A 2KM2A 3MV11 3C7OA 3TBDA 2E32A 3AP4A 1VBC2 4Z82A 2AEZA 2ZXQA 2WLQA 5FKBA 3T2OA 5FPXA 1HRI1 1O4YA 4AEMA 2B42B 1H4GA 2J1TA 2QCSB 2Z2SB 1A34A 2EA7A 3ZXKA 2A73B 5I0UA 3F95A 3D82A 1HLCA 1LESA 1CQ9A 2DVFA 3FHQA 3BI3A 4FPFA 4AI2A 2RDQA 4UF0B 1TVGA 3C7GA 4NIGA 4XDPA 5DUUA 2XVGA 5JLVA 2N7GA 5D8AB 4MUVA 1ND3B 4J1XA 1VB2A 5FQ0B 2PHFA 2BNOA 3TB0A 3ZOIA 4YVWC 3L2HA 1LECA 3AP6A 4BQ4A 1ULDA 2H0VA 2IUWA 1DQ5A 2W1UA 1DGRA 1RUG3 1NCRB 1RUI2 2DFBA 2WFF3 4Q27A 5J48A 2XLAA 1W03A 2XG3A 1QOOA 3I2DA 4GWNA 3PLQA 1YCIA 4BQ5A 1J84A 3KS7A 3JB4C 4QPYA 5E8AA 5IVCA 4BMEA 1NQJA 2W91A 4EE2A 2VUJA 4YW4A 2FQPA 1QNYA 3IMMA 4XILA 2DF7A 3AL6A 4ES8A 1PGW2 5IK5A 4E2SA 1DQ2A 4E4SA 1ZRCA 1WUVA 3IWZA 5KXDA 1UOJA 4I0WB 3LA2A 1QEXA 3VD4A 3B5LB 1WMXA 4Y5Z0 4FFFA 4ATFA 1G9BA 3UK9A 1LGBA 1RUJ2 2YGLA 4AAXA 2QTWB 1JHJA 5A7WB 1U5ZA 4YW1A 3FFZA 4IV3C 5FXZA 1LKNA 4XW3A 3BIWE 3J8F1 3R05A 4BQYA 4GKXA 2BFUL 3SMHA 2RS11 2QQWA 3U10A 4O9GA 4WVMB 5EWSA 3MFCA 3N9PA 4IE5A 5FMDA 1IPKA 2VCAA 2A3WA 2P37A 2WR9A 2X05A 4AZZA 4RSUA 5FOBB 3AKPA 4JQTA 1DU3D 4QX5A 4GWIA 3MIBA 1N1VA 4IEOA 2WS92 4CEYB 1YJKA 2JEMA 2XBO3 3ZYPA 4OHWA 4JKLA 1Z7S2 4MLOA 5A1FA 5JXIA 1IPSA 5JWPA 1OF3A 2X5IC 2X5IA 3ACLA 4GXLA 4AI3A 5EP9A 2D6KA 2VZUA 2I74A 3K3OA 3PTRB 2BNMA 4QM9A 4Z1VA 4COYA 5AC91 1H2LA 1G7YA 3WG3A 3D5OA 2UYAA 2VVEA 2ZMLA 3DPRC 3HQRA 3DPRA 4RQPB 4B4QA 1EV11 3LGRA 4QDQA 2J1EA 5FDBA 5LK7B 2DYCA 2P34A 3HQXA 3JBG2 1TE1B 2A6ZA 4COWA 4JKKA 1ZYBA 3RYPA 2IXLA 5FY4A 2P2KA 3MFAA 5FYHA 1YFYA 2ZAAA 3O1VA 1ZBE1 3AJZA 5A3TA 4DY3A 1OHFA 1RUF3 5FZOB 2EF6A 4ZY9A 3SEEA 3AMPA 2BW8A 3I3QA 2G19A 4OHVA 4XFFA 5DPNA 4YW5A 3VBRC 4N8MA 3VBRA 5A32A 2E7TA 1CGPA 1VBC3 3VBUB 4X8PA 1S2KA 2WNVA 3K48A 4CZSA 1LULA 2VD7A 3GM8A 1D4M1 3AZWA 2VL4A 3OGRA 3MO4A 3NNMA 4PQQA 2E6VA 2ZOEB 1H2KA 2BEOA 1DDLA 4Q4W2 1JN2P 1NCQB 1X82A 3ES4A 2J1AA 4M3CF 1Q5OA 4ET7A 5CFCB 3ZYFA 1JYTA 5DDJ1 2IFWA 1LU1A 1AYM3 2RS33 5A80A 1KXGA 1PK6C 3K51A 1PK6A 3DYOA 1I3HA 1AR92 2BV4A 5FPBA 1GANA 3MIFA 1O3SA 4WM8B 1O4ZA 2C6SA 3OCPA 1MS5A 1OLRA 4CPBA 4CXXA 3ZYRA 4OI4A 5ACA2 1OVSA 5JCTA 1CAUB 3C7EA 4CCJA 2WBKA 4YVWB 3CKHA 1RUI3 2OA2A 4C1XA 3AYEA 2XJUA 1SZBA 5FZCA 4JTNA 3G6JB 5BPXA 1XE7A 3SXWA 2DBIA 1J59A 2WLPA 1FMD2 3MIGA 4LO8A 2ZGSA 5EYXA 3WDYA 1FPN1 5T52A 1RUE1 1CZSA 2BP6A 4RYDA 2VMFA 3TEYA 4QKBA 2R043 5KHHA 5ABJA 2GU9A 1M4WA 3OGSA 1BBT2 2W1WA 1C4RA 1XNTA 2RV9A 3KQ4B 4WVVA 4EWEA 1LOAA 2XWBB 1SMVA 5EZWA 5FY5A 3RYRA 3BALA 2DCJA 5C8WA 4XEZA 3ZN6A 4R9DA 1AR61 4DUXA 2A6VA 1GZ9A 1HRI2 2CYFA 2QE3A 2K2SA 4NJ4A 1CZTA 1FX5A 4PI0A 4DO0A 5C5UA 4NN0A 1M06G 4P9GA 4IV3B 2XJVA 4OI0A 1XNKA 3VV1A 1ZA4A 5FCCA 1H0BA 4S2DA 1G6NA 4P02B 5HCBA 4E2QA 5CEHA 4OI2A 5C70A 3KB5A 1W39A 3NJYA 3VBOA 1PMHX 3S7IA 1OURA 2VOKA 5IWFA 4N7UA 3THCA 3GBGA 3PMSA 1OOPB 2ZGOA 3LWCA 4PLNA 1XJAA 2WS93 2WUHA 3EBRA 4CP1A 1WCKA 2DU0A 5FZBA 3WDTA 1GQHA 2QQJA 2PYTA 2VU9A 5HCFA 1Z7S3 4R4ZA 4FI9A 4Y24A 4DNYA 2WAOA 5FOJB 3VUOA 1W6PA 4DINB 3BIEA 3LB9A 4FTSA 2QNKA 4JDNA 1X8EA 4L99A 5CZKA 2YROA 1QXRA 4BB3A 4CP9B 1GWMA 1IHMA 4KI5M 4LLOA 4XMIA 3QH6A 4MYEA 2EIDA 1H6YA 4GH4C 4GH4A 3NWKA 3WY6A 4QXHA 3GHMA 1XOYA 2XQRA 3NAPC 4PBOA 4PIZA 1E5SA 3NAPA 2VY0A 4TYSA 2A7AA 1JYNA 1CAWA 4TLFA 1ODMA 2CGOA 4LQRA 5DAXA 1YFUA 3FBMA 3BTAA 3JBG3 3VDDC 1DF0A 4XOGA 3VDDA 2RDNA 5A6XA 1V6KA 4KG0A 1O59A 1DGWA 1YYNA 1J1LA 2O8QA 3GBFA 2BYVE 4OVEA 2J1SA 5FXVA 1UD1A 3IMNA 3PUQA 5LATA 4LPLA 2Y0OA 3U07A 3WD5A 4Y5TA 3WEZA 3J8F2 4AEDA 2GNMA 3KCYA 3KGZA 1AVBA 3N9NA 4JC1A 4ZXEA 1W6OA 2RS12 4OMCA 3VHPA 3NSTA 1R082 3D8CA 4DIQA 1XU2A 1ZRRA 5KWRA 2UY9A 1ST8A 2XB6C 2Q30A 1BYHA 3GZUC 5IVVA 4LBLA 1REEA 5F7UA 4N9IA 4H3WA 4HSJA 4QM8A 4AF9A 3N7LA 2D98A 3SNMA 4FBFA 3HT2A 4N43B 5IT6A 4Y22A 1CX4A 2PXJA 2PFWA 1W8NA 3WW3A 4E8DA 5HV4A 5KC6A 1VRH3 5J96B 1YQ6A 4XHBA 2FDGA 2B46X 1XNAA 5T50A 3I2OA 1NXD1 2D6LX 4YYOA 2V4VA 2VO5A 3I49A 1PVXA 4O7XA 4Y4RA 2ADDA 1GLHA 5I91A 4XHXA 5J98B 5JXHA 4FPEA 1ZA7A 1W9TA 2WQZC 1MZEA 3J7HA 1PZ9A 2ID4A 4LJHA 1WW7A 5AC92 4KWJA 5IFPA 3AMHA 1WW6A 2HWB1 1W06A 3AMQA 5F9TA 3WF0A 3AKSA 2E31A 4HN0A 5LA1A 1MS9A 1QQP1 4UYBA 1FMD3 4LBNA 5IAVA 2HWC1 4QB2A 5DABA 3MW2A 3TN92 2PLV3 1QOTA 3ZIXA 1X7NA 3B02A 4H7LA 5CKNA 1ZBE2 5I8TA 2AENA 3ACGA 4JHZA 4NHLA 5F5AA 1D0HA 3OGJA 5L7OB 4PQ9A 1PO21 1WBLA 2A3XA 1US2A 3W5NA 1DGRN 2VMDA 2VNVA 4M3CE 1HRI3 1F2NA 4PT6A 1D4M2 3A21A 5DUVA 2QZ2A 2IXCA 3CBNA 1WLWA 4LK6A 3T2TA 4PJYA 1S1AA 4K20A 4LUKA 2IC1A 1AJKA 3OYWA 3Q9OA 3GCXA 5DDJ2 4NIAA 5EYYA 4G9SB 1QH7A 5L73A 3KCXA 1JMUB 3JZVA 4YW6A 5T3NA 2D3RA 3M3EA 2VC9A 4XDQA 2XPJA 2NYYA 1W8ZA 1BXHA 2P6HA 1DGLA 2ERFA 2BBVA 2BTVC 1PO11 1V6OA 1XYPA 1EPZA 3CNAA 2XONA 3WZ1A 2EXKA 1UW8A 3ZFFC 1FPN2 2QVSB 1RUE2 3ZFFA 4CCNA 4YSFA 2K9ZA 1OI6A 2LRPA 2YY1A 5CB7A 3O1RA 3J4UH 3MICA 5C9AC 2MNGA 4YGBA 1S2EA 1S0GA 3POFA 4BQ3A 3VHRA 4Y20B 4LBQD 4EN8B 5LY1A 4Q2FA 3WF3A 1QJEA 5FXXA 2OPWA 3ME2A 1OQDA 4HZFA 1WCSA 4UW3A 5F3GA 2O8OA 3J8F3 3PUIA 1BVVA 2P6CA 4XFHA 4COUA 5JOZA 1UU6A 1X50A 2P3JA 3LF7A 4Q4X1 3LQCA 2RS13 3WW2A 3ZN5A 3ZYIB 5FZLA 3NL1A 2P5BA 3WHUA 3ENRA 1OMIA 4CTEA 4YZ3A 4HPKB 2JE9A 1DLLA 2E26A 2ET1A 2Y6KA 3LPFA 4G4FA 5C3OA 1PVC2 4FFIA 3TNPB 3C7FA 3N35A 1RUH3 1YIFA 1AX0A 4MOAA 4YM1A 3H50A 2H6CA 3POYA 1R1A1 4KGQA 4QQLA 1JI6A 3WG2A 3LE0A 3OB8A 2JG8B 4OCTA 3HIFA 3V0BA 3B94A 5A1LA 5FR3A 2ORXA 3V65A 4MGTA 2HWD1 1S0DA 4XTPA 4IUGA 4JCKA 3GYDA 4W50A 4XC9A 4E4DX 4UOJA 3OEAA 3M3IA 4TXWA 3OUHA 3FX3A 1F5FA 5BY5A 3U1XA 3QCWA 1ULCA 4CU7A 5A3PA 1EV13 1ZZ7A 4I0AA 3UL2A 3HBKA 5JXJA 1DGWX 4AVTA 2CAVA 3BB6A 3CU7A 3BKZA 4BPZA 3ZSKA 1MQTC 1MQTA 1JZ4A 3NQHA 1CX1A 1ZBE3 3KF5A 4M3CA 1QHDA 4OQ8A 1JZ6A 1IS5A 2VG9A 3R4UA 4IERA 1H8TC 3CHXA 2WZPP 1PNFA 3VN4A 3ZPOA 5GZDA 1UX6A 2VOWA 4ZZ5A 1IGOA 3CZJA 2Z42A 1OUSA 1D4M3 3H0OA 4MG2A 1WBFA 2WQ8A 3OBZA 3WNNA 4Z2AA 5L9VA 1RVF3 3IB3A 2JENA 4HG6B 4ISRA 2HBTA 4A7KA 4DPNA 5DDJ3 3D0JA 4Q0SA 1S0IA 3BTZA 5FPLA 3LOIA 4OLLA 4QX3A 1C8M1 4EN9B 1XU1A 1BHGA 2WSVA 2CDOA 2VOXA 1H9PA 2GAUA 2EVXA 2Y0IA 4Q8LA 3O0WA 4JGYB 3ACFA 4XQDA 4BDVB 2W46A 4FVVA 4AQTA 1VR3A 4Y1UA 3OEBA 5BNQA 5JZGB 1GZWB 2HWB2 2P4EA 4FP2A 5G04L 2P3YA 3H8OA 3S5AA 4E2GA 3KT4A 4IEZA 4X6QB 5H9SA 5A1AA 1RB8G 1GOFA 4IDZA 3IDCB 1QQP2 2P1BA 1C1LA 1UKGA 3ITQA 2XL7A 4CSWA 2ZMKA 5KHGA 1FPN3 1IS4A 1LU2A 1RUE3 1W0PA 2HWC2 2IXIA 1NQDA 4ZS3A 4BXFA 1JZ7A 3WDUA 1YWKA 1N1YA 4K7JA 3V64A 3FZ3A 2HYXA 5C3QA 5FZIA 2R49A 5C9AB 5DN2A 3FN9A 1PO22 5F3CA 5JSOA 3RZKA 4LBOA 2RDSA 1VBA2 1ASJ3 3C3VA 3HQUA 3PIGA 1KQRA 3GNEA 5FMOL 3ZKUA 4D69A 2ZGQA 4R9AA 1APNA 1AR63 1UL9A 2A70A 1EYBA 4XXPA 3T3YA 2RMU2 3OY8A 3PURA 4BIFA 4BZ4A 2VUDA 3BPSA 1D0GA 4UW4A 2KA3A 4ASMB 1SQ4A 3VKNA 2PHUA 3CL1A 4A7ZA 2PN5A 2Y6JA 3I2HA 2DVDA 2VQTA 2D5HA 4AR2A 2JE8A 3RMYA 3VBHA 2NQYA 5T5JA 1C5IA 2ZGUA 3DGTA 4GQ7A 3RJ2X 5FLHA 1MS8A 1ODNA 1MACA 1HKDA 1VB4A 4YZ4A 1LJ7A 3IDEA 1ND2B 1GP6A 1FOD1 3CJIB 3NJZA 5FZDA 1W6QB 2GMEA 3VZKA 3MEPA 3NKTA 1HQLA 1MVQA 4IV1A 4DEVA 4YFZA 5ISLA 2BPA2 1K5MC 4R52A 1K5MA 1NZIA 4IE0A 3BOPA 5IJRA 5KHIA 1PO12 3VD3A 4QGMA 2RM21 4XJWA 4GKYA 4FPOB 3O1UA 2QQIA 3U14A 1SEFA 2DURA 4CDQC 2UY8A 1PX4A 3AYDA 3BTXA 4NMIA 1KFUL 4XYXA 1CONA 4P14A 4IE4A 4Q4Y1 4UXAA 3JD73 1UZWA 2PELA 4QX7A 3O1SA 2JDKA 3NV4A 2WNEA 1SFNA 2AZ5A 1AHSA 4WM7C 1OVPA 3FLTA 4WM7A 2R16A 4A3XA 4HK9A 4BLIA 4PCRA 1CJPA 3OUJA 1PGW1 1Q8PA 1AR72 1QKQA 3C7HA 1UYZA 3KM5A 1OA2A 3POEA 1QMJA 4AVBA 4ASKA 4KWLA 3VHOA 1UPSA 4CYDA 3ZYBA 1RUJ1 4UT5A 2Z4FA 4S2FA 1GBGA 1N3OA 2WQ4A 4JDOA 3O1MA 1QNWA 2QDRA 3B9CA 2ARCA 3USUA 5JI7A 1I6XA 3DN7A 5B4XA 3V0AA 1GNZA 5FYIA 2MPFA 1H8TB 3PIJA 4CEWC 3HPNA 4CXYA 2ZGKA 4CEWA 1WD4A 3QOPA 4YZ2A 2XJRA 4FAHA 3IDBB 1ZRDA 1V0AA 3FFQA 2WJSA 2YB7A 1GZTA 2VZQA 2ZA9A 4B7EA 4BHPA 1R1A2 4LXLA 2PMWB 1HIXA 2GC1A 3INAA 2Q5TA 2D6PA 3UKVA 1QH6A 1L7QA 4NROA 2D3SA 4H2AA 1XRUA 2HWD2 5L9BA 3HVDA 3RS6A 1ACCA 4XUQA 1NAEA 1JUIA 2EICA 2JKXA 5K7PA 1WZXA 1GWKA 2XJQA 1W2OA 2HWB3 3RI8A 4BYYA 4XUTA 4LO7A 2L9LA 1Q8QA 2EAKA 2Y6HA 2JX9A 1XE0A 3RRDA 2WL1A 2WWSA 5E16A 1ND3A 5CYYA 1QQP3 5EJ3A 1Y7BA 3HAGA 4OI1A 2Q8DA 1WWYA 2HWC3 3M4FA 5CADA 4MHUA 3VD9A 4ARXA 1X9TA 1X8MA 1BJQA 2FHRA 3AZZA 5DQ0A 1SBDA 3WP6A 1LHNA 3U37A 3H1YA 3AK0A 5FWJA 1PO23 5CG9A 5I0SA 1AXKA 5CIRA 2X53S 3KVBA 4MX3A 5LZ6A 1ZZCA 4GALA 4RS5B 5J37A 1QU0A 2C5DA 1AX1A 4HT1T 4B3NA 5C6CA 3UT0A 2ZS6B 2OQ6A 3AYAA 1UU5A 3IKWA 4M4PA 3RZGA 5DUXA 2I07B 3K46A 1TZOA 4CDUA 1VBD2 4XFCA 3MUZ1 4URAA 5J36A 1RINA 1U0AA 4Q4W1 4QAWA 5J7MA 1C8M2 2VM9A 2ZBJA 1F5JA 4QQ2A 1VRBA 4JGZC 4YLZA 4A6SA 2XVKA 4JGZA 1NA1B 4K1ZA 4F83A 3OSDA 3FC0A 1AR91 3L9JT 3U4SA 1V00A 5F6KA 2RJ2A 3ZSLA 1KD7A 1PO13 5ACA1 1Q8SA 5FRAA 1NLSA 4HBNA 3DKQA 1JHNA 5IFTA 1PM4A 5DAWA 3DF0A 2WDBA 4XBQA 2VNRA 2PAEA 1MR5A 3UGGA 2XOMA 3PVNA 4CDQB 5GKAC 4E27A 1GP4A 5GZGA 4YVSB 4UFJA 2VTFA 2GP3A 2VPVA 4LIUA 2GNBA 1PZ8A 5FZKA 3RI9A 4LIVA 4GAZA 4QPGB 5F5CA 2XKOA 3WF2A 3VZMA 4D3WA 4XUPA 2J22A 1BBT1 2BQPA 5IVJA 2OXBA 4META 1V6JA 4XURA 1YLLA 3O0VA 3WV6A 3TEZA 2IVJA 2RJLA 1W9SA 5FP9A 2PHXA 3URFA 1O5UA 1PIV2 2VCCA 4Q4X3 4Y1ZA 1YEWA 4Y5SA 3IAQA 2DDUA 2AUYA 1S4CA 4C8DA 5K0UA 1YHFA 2D43A 5JOYA 4QWNA 1CPNA 1DCSA 4M4RA 3R0RA 1FOD2 5C71A 3U4XA 1DYKA 1W6MB 1JOJA 4JAAA 1UY1A 3NV2A 1UU4A 2MEV1 1JYWA 4U2AA 1R1A3 4LHNA 4IE6A 3OF1A 2NN8A 2RM22 1G9FA 2BNNA 5FZ8A 2VZSA 4TTGA 4CCCA 1U5YA 3DYPA 4Y26A 1JZ3A 2VMIA 4MXWB 4JQRA 2HWD3 3WF1A 2HWF2 5EIYB 1OC1A 2DFCA 3ZR5A 3ECQA 4AFDA 1GOHA 3C2UA 4Q4Y2 4XE9A 5EQUA 2W1SA 2VZVA 2VUCA 4OULA 3RMXA 4XQWA 4IEVA 4EN6B 5C5TA 1H2MA 2OZ6A 3VBFB 5A3UA 3N3HA 4QT6A 2ZX3A 4NRQA 3J9SA 4YRDA 1LEMA 1SDDB 5FWEA 4KBBA 4QPIB 5IHRA 2VAUA 4O61A 3GDBA 5F2SA 5FAXA 3ASIA 4MADA 2H0BA 2JDHA 4LK7A 1JZ8A 4YM2A 2WZEA 3H3UA 2TBVA 4OHYA 1ONAA 5C3SA 3WVJA 4IGOA 4ZXKA 1OXCA 1WA4A 2CU5A 2GNDA 4FPCA 5KHJA 3ELNA 5FO7B 1R081 4PI2A 5FZEA 4OHZA 3MW4A 2QQUA 3TNQA 3RWNA 2IXHA 5GJ6A 1RMU1 2E51A 1F15A 2QDNA 1A8MA 4I09A 4FOYA 1Q8OA 4NAMA 4C91A 2VR4A 1CWPA 1JH5A 4S2GA 3WG1A 3OBTA 4MVTA 2ZCWA 3BCWA 3TWIA 4Q4V1 1GZCA 1C8M3 1VP6A 1SLLA 4FQ4A 4KGGA 4FSJA 4EROA 3WR0A 4D0QA 4OMDA 1N3QA 4LR4A 4LHSA 5F5QA 4IEPA 4CCDA 4AHWA 3I2IA 4L11A 5IK4A 1C1FA 4QHBA 1YI7A 5A7PA 4Z2WA 2GNTA 4L8QA 2JDYA 3ZVXA 2I45A 5KHKA 3K2OA 1SFPA 4FCAA 3BOWA 1OOPA 2YHJA 4WZFA 1O3QA 2W47A 3ZDSA 5A6QA 5C3PA 2YBKA 2NPIA 3N9LA 3RQ0A 3M8LA 1HX6A 1AX2A 4K40A 4X6RB 1PNGA 1IG3A 1C28A 5L9RA 2JDUA 3TN91 2QQMA 4TLGA 1ULPA 1WCUA 1HN1A 2D3PA 3WQ7A 3IIIA 4KH9A 3J7LA 2XWJB 5LB6A 3RDIA 3CDZB 3VKMA 5LW9A 3A7QA 4LKFA 1N3PA 3UYJA 4YGCA 3PVOA 1MS1A 4Z8BA 2WNVC 3KV6A 4CU6A 2RR11 5BYNA 2W39A 4N90A 3M3CA 1LGCA 3JQWA 3V56A 2QFEA 4DOUA 4JTOA 4RD7A 5IK7A 3OD0A 2C1FA 3MW3A 1QJFA 1FOD3 3ALQA 5LEJA 3WUCA 4PBPA 4FPKA 5EFUA 2VW2A 1AZDA 1ENXA 4R8HA 2WSUA 2G9GA 3WOGA 5GZCA 5F1RA 2ZJCA 5FTTC 5I0DA 3PVBB 4MGIE 2DVAA 3LEMA 4D7SA 2JD4A 2RM23 2JICA 2C24A 2O0OA 3T2PA 2CDPA 3MGUA 3WHTA 1BCXA 1GYKA 3KVAA 2PAKA 4K9SA 4A4AA 3WXPA 4LTAA 3GHNA 2XH6A 4IEUA 4XJAA 2YUEA 4YNIA 5FZFA 1A8DA 4Q4Y3 4NWVA 4Q0UA 3VL8A 1LAJA 4V2VA 4Y3OA 1JYIA 5FYUA 4BXSV 3NJVA 5ABJC 3POGA 4HSLA 3KMHA 5BV6A 3MLKA 3GGLA 4N53C 4XF4A 3JU9A 3HD8B 4N53A 2YU2A 4I02A 1UYPA 2VW0A 4HKLA 3VZJA 1ULGA 5BNNC 2QQPA 4D7YA 5BNNA 2FCTA 3LIGA 3RWKX 5FBZA 4ZU5A 2OKXA 1RUJ3 4E9KA 1PM7A 1C5HA 2AACA 4IGQA 2R061 4LBKA 2PHLA 1EPWA 2WRAA 1WCDJ 2YMZA 1CIYA 1DQ4A 2VOVA 1R64A 3FLPA 3IPVA 1CZVA 1REDA 3GZEA 1K12A 4HFSA 1RL3A 1RUC1 4QD2A 5D2AA 3VBOC 4ZKTB 3U78A 1J3RA 1GWLA 5BNPA 3X29B 1YQ8A 4DRVA 1AXZA 3UESA 2R6QA 1PVC1 2MEV2 4FOQA 2VQUA 4LULA 2YV8A 1TEIA 2ET7A 4EV0A 1D4VB 4OZOA 1CAXA 1UMHA 1F31A 3K3NA 1W6NA 3ATGA 1UYXA 3KHBA 3CZUA 2QKDA 4F7ZA 5LRRA 3M2MA 4YPJA 2X5IB 4CP2A 2SBAA 4XMAA 3MYXA 3WNPA 3P3NA 3AKQA 3AKTA 4FOVA 1OKQA 5FYSA 4CUGA 4HVQA 2YPDA 4AVCA 4RA0A 1JYXA 1HV1A 5GZFA 4K1YA 3CO2A 4EWDA 2RJKA 1QOSA 5CFDC 5CFDA 1RUOA 2XUEA 2ZKLA 2ORZA 3K75B 2J7MA 3DPRB 4Q1RA 4BQXA 2X10A 4LBQB 3OUIA 4I3GA 4EN7B 3HJRA 3FL7A 4QDRA 2PTMA 3S5QA 5EV7A 2WNOA 3B93A 3ZO0B 4AEDC 5FZ1A 1KRIA 2VVDA 3I97A 5T5LA 1KJLA 5FPUA 2CTVA 2VZ3A 4GMP3 2R0FA 1NYWA 4W8JA 1JW6A 3H7YA 3MLLA 4BJ0A 5FY1A 5J3UA 2HYKA 2AGSA 1STMA 5GLUA 5SV8A 4CUCA 1POQA 1RMU2 5A32B 1XE8A 3NO8A 5LA2A 1H30A 3VBRB 2WKKA 2C9AA 2F4LA 4NUBA 2BWCA 4ORFA 2WNVB 1EUTA 5ANQA 4CCEA 3F2ZA 1DIWA 1WGPA 4Q4W3 5BUVA 1WA6X 4Q4V2 4H7MA 2BRTA 4P9IA 1ZNPA 1S0EA 2WNUA 3SLIA 4DB5A 5FZHA 1GR3A 2IWGB 3AFGA 2JDAA 5JI9A 4PF1A 1AR93 2CY6A 1PK6B 1W9WA 2ES3A 3AB0A 3FJSA 4K21A 5FP4A 5FZ7A 1W90A 2D40A 5ACA3 2D6NA 1LOGA 2WWUA 4AI0A 2B8MA 4K6BA 4Y4YA 2WT0A 2B45X 5A7OA 1O4TA 3I4IA 4AQSA 3LD8A 2ZHKA 3WNOA 4FAGA 4AI1A 3UKTA 1QJX1 1YIPA 3LFIA 4EZHA 1XBFA 3DL3A 4FO9A 2OQ7A 4FPLA 3LA3A 1PZ7A 4CDWC 4CDWA 1KS5A 3AL5A 4A45A 1BBT3 3JUUA 5ABJB 1R1ZA 4GWMA 3VD7A 3ZXJA 1AJOA 3NVCA 4B4PA 3I59A 2VMGA 4XACA 1GUIA 1VBA1 4I01A 4P9YA 5I8YA 2I2SA 2WA4A 4RHV1 2E63A 2EXHA 5DG2A 4OUMA 4CXWA 2RMU1 3PHMA 4UFMA 1FATA 1MZFA 2RR12 3ILFA 5F5IA 3ZN6B 2G4IA 4DQAA 3ABZA 3MUY1 3SC7X 5FZ4A 1OPMA 4A41A 4H55A 2VCMA 4C1WA 2DVBA 3DECA 4BA6A 4KL1A 4PDWC 4EN0A 4HN1A 2B7YA 1CN1A 4PDWA 5C4WA 3VKOA 5C4WC 2FZ2A 3VBOB 4O9EA 3A22A 1WLCA 4YFWA 2MEV3 2WZ8A 5GLZA 4CDXC 4CDXA 1W99A 4ZS2A 3KGLA 1Q43A 4OFGA 4QXKA 5DAPA 4DXSA 4YZ5A 3MIDA 3S7EA 1UXXX 3E97A 5CISA 4BQ1A 5I0RA 3POIA 5L36A 1CJDA 5LA0A 1QXJA 1W2AX 5T55A 3MI8A 1UO9A 1W6PB 4L0PA 3T4HB 2XJSA 1L7RA 4LUMA 5IVEA 4QXCA 2VXRA 2VQAA 4I3PA 1OLMA 2Z79A 4ITCA 1MS0A 4RR3C 4AFCA 5A6ZA 4RR3A 5LK5A 3TRSB 2IFRA 1F4HA 1LHWA 2G9ZA 1UZ0A 2BDRA 1CD3G 4GH4B 2HBUA 4GZ9A 4ONUA 3PJQA 4TN7A 3HT1A 3NAPB 2V73A 1V9U2 3LEIA 4UFHA 3U11A 1NG0A 2A75A 1CAWB 2DCZA 5J09A 2GMPA 1POV0 4BM8A 1AR71 4MGYE 5FKCA 5I8SA 3DV8A 3VDDB 4XIKA 2C9KA 2PHWA 4P9JA 2W3JA 2YXSA 3VL9A 4ASLA 1I5PA 1JXNA 1GSLA 2R062 2XKPA 4XUOA 5C8CA 5ERLA 5JOXA 4AEDB 4Q8KA 2VBDA 4XTMA 3WDVA 1R083 4LBJA 5A70A 1W6OB 1ULOA 4ISQA 1RIRA 1W2UA 1CAVA 5A33A 3OPTA 2W94A 2YC4A 1RUC2 3I8TA 2Y26A 4R9CA 3AC0A 5F32A 5FYBA 1VLNA 4AHXA 3PJYA 2VW1A 4AXOA 2ZTNA 1AL21 4B1MA 3O1PA 3VBSC 3VBSA 3VDAA 1LTEA 4Y22B 4DEQA 4Q4V3 3TEWA 1H4HA 4QGLA 5LCWL 3MBWA 3VLBB 2FCVA 2IXJA 5FZ9A 2LM3A 5FY9A 2CV6A 2WO2A 2DCYA 5C3RA 4QB6A 3JXSA 4XF3A 4GB31 5H9QA 2FCUA 1HJFA 2GSYA 4UBGA 4QGNA 2R071 5AC93 4CPBD 4Q0PA 3Q8EA 3GJBA 3FLRA 2W2IA 3ZFGC 4MGQA 3ZFGA 1HV0A 1UN1A 5H9RA 4AI9A 2YU1A 4ARYA 1I5ZA 4GD4A 1LRHA 2WFPA 5IK8A 1H9WA 3ZYHA 4COZA 3AVSA 1LOBA 2VBPA 3WW1A 3TN93 3MV01 3PUAA 4RL7A 5EXOA 3TYJA 3CF6E 4OHXA 4I2OA 4KWKA 2XLGA 3K4DA 4PF5A 1V6NA 3HNYM 2P3KA 1XXNA 3B9IA 3Q8BA 5FO9B 5JDBA 3CEWA 4Z07A 1DP0A 1ZVFA 4IETA 2QBXA 1UF2C 2GDFA 4XJ8A 3KD4A 3C8XA 4BQWA 1UPIA 1N1SA 3ZFEA 5FYZA 4NRPA 3WNKA 3POWA 1VBD1 1KITA 1QDCA 1OFNA 3OYWB 2PQQA 5BNOC 5BNOA 2DU1A 4KU8A 2HEYF 1F9KA 1V70A 2DBNA 2CWSA 1GOGA 3FE5A 3HWJA 1WD3A 2D97A 2ZZJA 3D0SA 3RJRA 5FREA 1IZ3A 4J1WA 4ZZ8A 3N4MA 5K8SA 1RHI1 1GV9A 1Z78A 3CLPA 1HDKA 2A1XA 5FMBA 2JE7A 3FMGA 1D2QA 1ZBA1 3WCRA 2Z5WA 3AFKA 4DXTA 1QJX2 3P6BA 1S0CA 3A0KA 1C57A 3LEKA 2JB8A 1PGL1 1VMJA 1LENA 1FXZA 1I9RA 3ZFFB 2OW4A 4AWDA 5A6YA 3AP9A 5D21A 1VE0A 1Y4WA 1WKYA 3BGAA 1UWWA 4HANA 4WVWA 2JD9A 4EJRA 4RHV2 4X8NA 3I2FA 3N9MA 2EIEA 2FDHA 2ZHNA 4NHKA 1LOEA 5HI0A 5JMOA 1O7FA 1PIV1 2DV9A 4QDSA 3WX5A 3ZLIA 1LNSA 1AXYA 2YDEA 3K4ZA 5FZGA 5B4NA 4R9BA 3GCWA 3VBHC 2OIIA 1RUC3 1W28A 2Q0AA 1K3IA 3FBYA 4W6WA 3WP3A 1OBNA 2R7EB 2Q1MA 2HJIA 1KGYA 2AEYA 1IQDC 2V4AA 5FJKA 3W9AA 1HRV1 1RYYA 1UYYA 1UY2A 2BERA 3ST7A 1SG3A 1PVC3 2WAAA 4IV1C 1HB2A 4AQ2A 3PUHA 1NE6A 3KSCA 1AR82 3O12A 2R0HA 4UFLA 3ZDVA 2ATFA 1FNYA 2Y64A 2ADEA 4AEKA 1IKPA 2J1VA 2F17A 3RSJA 3D6EA 2VOTA 3V0BB 2HWF1 4HLTA 5K9YA 1B35A 3LDRA 4DXZA 1RXFA 1SBFA 3Q8CA 2XLFA 1YI9A 4MGSA 2KD7A 2W68A 1Q56A 4Y33A 5FP3A 1I1EA 2J1RA 4COVA 1MZ5A 1ULEA 2RS31 3EO6A 2G9FA 4D6QA 1HXS1 1Y9MA 1ENQA 4YWAA 3O1TA 2OVUA 1XSQA 5F8PA 1SPPA 4MSVA 3T0AA 5HXMA 2A3YA 3I54A 1MQTB 2KXLA 4ZONA 3WW4A 3SH4A 2Q8OA 4M3CB 4JHTA 4CA9A 1G8WA 1UIKA 2ZX1A 1UZZA 4XFAA 2GMMA 4QXBA 3WUDA 4RGAA 3B69A 2BOJA 4CP0A 5FY0A 2CGNA 3SQOA 3TAYA 3USSA 4BLJA 1JZ5A 1MPXA 1BEV1 1AL22 1IKQA 1BZWA 2WT1A 3EB7A 2ZGTA 4EWAA 1E5IA 2JG9C 2YGMA 4AOCA 2CWMA 2JG9A 2WO3A 2Q8CA 3WQ1A 4AYUA 4CCLA 1VAKA 2LROA 2ZACA 4XZUG 4FPYA 5CKMA 1PMJX 3VZNA 3VDBA 2ZMNA 1CPMA 3MZHA 4S2HA 1OT5A 3RG0A 5EJ1B 4MO3M 4DUWA 3DUIA 4P9XA 2VJXA 3GBWA 4GB32 2YFUA 4URTA 4AGRA 3K4AA 1SFYA 4NPMA 2WABA 5FZMA 1WW5A 1RC6A 2R072 3AP7A 3RZLA 5DMYA 5A7SA 1NOVA
chains in the Genus database with same CATH topology
4WVZA 4YG6A 4PLMA 1QJU1 1C8NA 1WMEA 3WLUA 2ENRA 2K0GA 4Q8KA 4Y1YA 1ND3C 2CAUA 1AF9A 5D8AA 1ULFA 3E5UA 3NV1A 5FLJA 1QJX3 5FQ0A 1C3HA 4AFAA 4D7TA 1OQ1A 2WC2A 4XFIA 1NCRA 1OQEA 2Z69A 3ZSMA 4F3JA 4MV2A 1FNZA 1RTVA 5CA6A 2Y38A 1VBA3 1QF3A 1TMF1 4RHV3 4MGKE 4PIYA 4XBLA 2RMU3 4YGDA 4XIOA 1V6LA 3IM0A 3OY8B 1S2BA 2BVBA 4QPIA 1V6MA 1QJY1 4CDUC 3MIEA 1RJ8A 2WIIB 1LODA 3VBHB 4IEXA 1ENRA 2JXAA 5BXXA 3W58A 4TZDA 1LGNA 1JUHA 3VGIA 1B09A 4WV8A 4DRRA 1J58A 4WVMA 1NXMA 1RUD1 4IV1B 3ROUA 2EXIA 2ZGNA 4INDA 1RHI2 1K5MB 3ZX7A 3ES1A 3E6BA 1RGSA 3ZPYA 4CEYC 2EALA 4CEYA 1ZBA2 5HXVA 5SV5A 3OBRA 1YO8A 3MF6A 1TNFA 1XYNA 2BGCA 1LB2A 3PNAA 4HK8A 1LOFC 1VRH1 1LOFA 2VH9A 1H1MA 4QU2A 1PGL2 3AYCA 4FTBA 3J26N 4XJUA 1SACA 3AXDA 4DMIA 4HETA 4WM7B 1AR73 2E7QA 1FI2A 4HMZA 5JMCA 1IS3A 4RQPC 4RQPA 2R1DA 4YGEA 2E7AA 4TSVA 4BOWA 1WMFA 2FMYA 3USUB 5K0UC 1DBNA 3V0AB 1EAH1 1HRV2 1COV1 4A7YA 1AL23 4AVAA 4CEWB 3ZIWA 2B5HA 2OPKA 5CAZA 4N7IA 2P17A 5DZFA 3VBUC 3VBUA 4QQPA 2E9QA 3VKFC 1MEC1 4AHZA 4LE3A 5DUWA 3JQXA 3AX4A 4DFSA 4GB33 2AREA 1SDWA 2SLIA 3WDXA 1SLCA 1NCQC 2CNAA 2H6BA 4OZXA 1NCQA 2V5YA 2ZX4A 3M3OA 4Q29A 3QD6A 2R073 4HKWA 5E16A 5CFCA 5CFCC 1GFF2 5TSWA 1R091 3LSDA 1AYM2 1YRZA 2RS32 3JCIA 4DZGA 1HXS2 1U5IA 3HMYA 4WM8C 3E6DA 2AH2A 3GZAA 4WM8A 1AYN1 1POV1 1CAUA 1UAIA 4B4RA 4YVWA 1ZZ8A 4QQOA 1PGSA 1IPJA 1SLAA 3LOBA 5DZGA 1Q8VA 2UWBA 4HL0A 3H3ZA 2CGPA 4LO5B 1QWRA 4UW5A 3BODA 4AI8A 3FHIB 3IT8A 4TWTA 1BEV2 5A3LA 5GM0A 3LAGA 2R042 3S6PA 4ES9A 4OUSA 5GZEA 4BWOA 4Q0VA 1VBD3 5KC5A 3KLSA 4NOTA 4CDUB 1U12A 5C33A 4K8FA 4GIQA 2RS51 1CIWA 1DQ6A 2GN3A 2Q1ZB 2ZAHA 4IV3A 3ZXDA 2ARBA 1HW5A 1KS4A 1LCLA 1PHMA 3JB8A 4NR1A 1E57A 5LRSA 3RZZA 2D93A 4JGZB 4BCUA 4I30A 1RHI3 5CVRA 1QJU2 5T54A 1OOPC 3LKJA 4AW7A 2RE9A 4YG3A 1ZBA3 2VECA 1LHVA 2QUOA 2AYHA 1TQ5A 3QBQA 1RUH1 1SBEA 3SH3A 3D4KA 3UKNA 3R4SA 4AGGA 2BUKA 1X36A 1XNDA 2YC0A 1TMF2 2RHPA 3NV3A 4AFMA 4AVSA 4L97A 1N47A 4YM3A 1BQPA 3ZN4A 2NZ9A 1PIV3 5T5PA 1NY71 3SCGA 4IXLA 4Y1VA 1DYPA 2NMOA 1QJY2 2HWE1 4LBQA 2R1BA 3MPPG 5CG8A 4HKOA 1G9CA 2MHFA 2ZGLA 5K0UB 1HRV3 3WNXA 3B01A 3WCSA 2ZX2A 2JDZA 2QJVA 5JOWA 2ZGPA 1JTZX 1RUD2 4ZU4A 2NLRA 1X33A 4N43C 1W0OA 4N43A 3L2YA 5FLIA 2QZ3A 1GICA 2HWF3 4RFT0 1RVF1 4XFGA 3LCPA 4KU7A 2XL9A 1CESA 1H8VA 1VRH2 1VJ2A 4XBNA 3GALA 4YM0A 3MF9A 1SCSA 3APBA 1HXS3 3RPQA 5KXBA 4IEWA 1KDMA 1V9U1 5GLVA 4JDMA 3ETQA 3QH7A 2OUJA 3H1MA 5GLTA 3ILRA 3NKGA 1RITA 2UWAA 3PMEA 2ZHLA 3SH5A 3I7DA 1OSGA 4P9WA 2WZR1 1V6IA 4YZ1A 2O1QA 3M1HA 5JPMB 3MDPA 2P3IA 1ZREA 1EAH2 1COV2 1BEV3 2PLV2 5BNPC 2OUHA 5L7OC 4IL7A 2D5FA 5L7OA 1XQNA 4A2UA 3LZZA 5CNAA 1ASJ1 2DWRA 1MEC2 4FPJA 2PHTA 2AR6A 2GALA 5FPZA 4YW2A 4KQ7A 4XPVA 1DQ1A 1UMZA 1VBB1 4AEJA 3S0MA 4LEJA 1NLRA 1OA4A 3AMNA 1QJU3 1J3QA 1R092 1GKBA 2XVLA 2A71A 1VBE1 3KZ4C 3N7JA 1S0BA 1AYN2 1BMV1 4KG8A 1WLTA 2OZJA 2XJTA 4KNCA 3G7DA 4IEQA 3IN9A 3N36A 1TMF3 2E53A 3IIAA 1YXWA 3RYKA 3JD71 2BFUS 3EQEA 4FPGA 1QDOA 4MH0E 3O0XA 3ZYGA 2A5ZA 4XJ9A 1DZQA 4MZUA 3QLQA 1QJY3 2VULA 4W65A 1ZZBA 4Y20A 3RNSA 4AQ6A 1KFXL 3M70A 1OA3A 2WNUC 2RS52 3AM2A 1KDKA 5AFEA 3OTFA 4XETA 1Y3TA 3O7OA 2YPJA 1RUD3 4GMP0 3WINE 4HPKA 2DTWA 1S0JA 1EP0A 5B2GB 2TEPA 2F4PA 3EJKA 2FZ1A 2FMDA 3T1MA 4YARA 1RUH2 2JJ6A 3O5SA 3R6SA 1YNAA 3KT1A 2JG8C 1BKZA 2JG8A 4Q0QA 2FBEA 2GC2A 4V1PA 4AHYA 1KJRA 4YW3A 4FTEA 4FXKB 4N53B 1HQWA 1H1AA 5T5OA 5I93A 1H1IA 1QGLA 5BNNB 4IQPA 1NY72 1VIWB 3QACA 4L9BA 1Z0HA 2A6WA 1EV12 1DHKB 3BPZA 2HWE2 5CBLA 1G9AA 3M7AA 2GN7A 2VNOA 4P9LA 3IPVB 2ZPXA 1TME1 1EAH3 3N7MA 1COV3 5JIAA 2IXKA 4Y1XA 1AUYA 3FWEA 4J6GA 3ZYJB 5BNPB 4IEYA 4AGVA 2GH2A 4QMAA 4MGZE 1Y9QA 2VNGA 3E6CC 1MEC3 5E88A 3MIHA 3SHRA 1FT9A 3WT3A 2LALA 1AR81 1U5XA 1CAXB 4GULA 4K3UA 4LBMA 1W6NB 5E89A 4FXGB 3ZXGA 2PA7A 5LEKA 5AVAA 1RVF2 1H2NA 4GA9A 3S30A 4IESA 1R093 4G3YC 5GALA 2GC0A 4AK3A 2NP0A 2GZWA 5AVPA 3ZXLA 4JGYC 1WLDA 4JGYA 4ATEA 1ZRFA 5CFDB 1AYN3 1POV3 2W52A 3AP5A 4XXAA 1LHUA 5JZGC 3SITA 5JZGA 3CJXA 4C0HA 1GZWA 2D6OX 4XJZA 5C8CC 4F8AA 3O14A 4R4XA 2WZR2 3THPA 4E4ZA 2EAAA 3KT7A 4DY5A 4WZCA 1RMU3 2Q4SA 5DZEA 1LEDA 3OD4A 5HBAA 2PAMA 5C9AA 2DCTA 1DZTA 4XF9A 4LNVA 4CRQA 3H1WA 4XFBA 1ASJ2 5JAXA 3SCFA 1AR62 2RS53 2XHKA 1NE4A 2WNUB 1O5LA 4ZU7A 1URXA 5JSPA 5JR7B 2VUAA 1VBB2 4D94A 2ZGMA 4W6YA 3A0NA 4NO4A 3VZLA 1LHOA 1J1TA 1ND2C 4C90A 1DQ0A 1ND2A 1OD5A 2HEWF 3CJIA 3CJIC 2LTNA 1VBE2 5HCAA 1W6QA 4AFBA 4LO4B 4AVVA 1BMV2 1SLTA 4PLOA 1WMDA 2LUWA 1QJZA 4H14A 2OYZA 4FT8A 2R30A 4XF1A 2XGXA 1UCXA 5DXDA 1VAVA 3B7MA 2TNFA 2WINB 1RUG1 1MS4A 4Q26A 4CDWB 2WFF1 4FOWA 1YFWA 4DS0A 4LHKA 4LT5A 2ZKNA 3I59B 2GC3A 2R32A 2F6BA 3JD72 2RR13 1BVP1 1NZCA 2HWE3 5JIUA 3FUQA 3HN1A 3U0ZA 3AZYA 2VQ0A 3ZSJA 3ZMOA 4PDWB 5C4WB 4HVRA 4SLIA 1FV2A 1JYCA 1YFXA 4AG4A 1IQAA 3ZMNA 2PHRA 3P3PA 1H8TA 5JVVA 4CDXB 4JV4A 4W6XA 4L2NA 4JRLA 4WBBA 5L19A 3OPZA 5DG1A 2HKXA 3SISA 4Q1PA 4M01A 4XF0A 3KQRA 4M0NA 2ARXA 2XBO1 3OJBA 4HVOA 4RR3B 5A3MA 1RJ7A 5FFOC 3AJYA 1V9U3 3ZXEA 5CU1A 4B8EA 5FO8B 2B9UA 2UU8A 3ZFEB 1SLIA 3PVEA 3MLJA 2UURA 4XQ4A 3E5QA 1S55A 1A78A 1PMIA 1CVNA 2EIGA 2DTYA 2R063 2WZR3 5C8CB 3DKWA 1RUNA 4LHLA 1FV3A 1TME2 2WT2A 5I0TA 3WP5A 1CAVB 3FUOA 3M3QA 4PIXA 5A33B 1BK1A 4QQHA 4M0HA 1IS6A 1SCRA 1CR7A 2ZABA 4N9HA 2C0ZA 2YYOA 2GH8A 4RS5C 4RS5A 1RUF1 3H8UA 1ZM1A 3VBSB 2DUOA 3VHNA 3B00A 3AKRA 5D1IA 1VBC1 1Y43B 1VBB3 1DZRA 1UIJA 2WA3A 1D2SA 5AFBA 1B35C 2NM1A 1VBE3 2A6XA 1MVEA 4BIOA 2ZHMA 1NA1C 1NA1A 1AYM1 1OFSA 2PHDA 2X8KA 1F8VA 3ZFGB 1OLQA 1G86A 1IOAA 1ZZ6A 2XJPA 1OPOA 3SCHA 3A4UA 1RUI1 1GNHA 4CDQA 1EY2A 2BVVA 2CL2A 4B7KA 4YVSC 1DG6A 3ILNA 4YVSA 1S0FA 3AZXA 4L92A 2V09A 4FP3A 3H9AA 4NHMA 5JPNB 4BH9A 4QPGC 2ZX0A 4NPRA 5F6LB 4QPGA 1A3KA 1VALA 1UZYA 3VKLA 2R041 4AE2A 4I0BA 2D44A 1QY4A 2JKBA 3GZTB 1ENSA 3EXUA 1XNBA 3HBZA 5E1RA 5BNOB 1QXPA 4Q4X2 2UYBA 3UJOA 3KCCA 4JRAA 1W6MA 1HQNA 3R4DB 2TUNA 1UKRA 2ZGRA 1AL0G 1VAMA 5D8AC 2WS91 3BU7A 3ZSEA 5JSRA 1O91A 1NCRC 1XNCA 5IUQA 1Z7S1 4MXWA 1RUG2 4M00A 3THTA 3UJQA 2WFF2 2ZZQA 3B3QE 4NWWA 1WW4A 4LA2A 1J3PA 2ILMA 3LSEA 4Z92B 4P5HA 3HR9A 4FPHA 4YG0A 2YZ4A 2EXJA 3IBMA 1O3TA 3UV9A 3N7KA 3VBFC 2JECA 2HEVF 3VBFA 1LOCA 4SBVA 4QPIC 3TOJA 2VGDA 2DCKA 1G9DA 1ZX5A 2NMNA 3GF6A 1TME3 4BMBA 3WQ0A 3E5XA 3JBG1 4LLFA 3WG4A 1Q3EA 1JBCA 3W59A 1LR5A 1FYUA 2B39A 4UBHA 4JVAA 2D6MA 4UW6A 4GMP1 1TNRA 2XUMA 1SLBA 1AR83 2W0XA 2DVGA 4LA3A 1DFQA 2ETEA 1REFA 3LA7A 1B35B 2XBO2 3PTYA 2D7FA 4LO6B 3NW4A 3ZXAC 1ZZ9A 2IZWA 5KXCA 1XYOA 2DUQA 3OGGA 5GLWA 4U36A 3EHKA 4LE4A 1N1TA 1T6GC 4RGGA 3T1LA 5KXEA 1MS3A 1YUDA 4C0BA 1L3JA 3AMMA 5KBFA 3VZOA 1ALYA 5FMOS 3H7JA 3WDWA 4XZPA 4BE3A 3MPBA 4B29A 4FQZA 1GQGA 1FMD1 3AZVA 4NVPA 2A6YA 2PLV1 2W08A 2VVFA 4MXVA 1A6CA 2VMHA 3POSA 1FAYA 2BWAA 1RUF2 2DUPA 2X29A 3AXEA 3ZXFA 1YJLA 2UWCA 2JG9B 3WP4A 1MZ6A 2KM2A 3TBDA 3AP4A 1VBC2 4Z82A 2WLQA 5FPXA 1HRI1 1O4YA 4AEMA 2B42B 1H4GA 2QCSB 2Z2SB 2EA7A 3ZXKA 2A73B 5I0UA 3D82A 1HLCA 1LESA 1CQ9A 2DVFA 4FPFA 4AI2A 5DUUA 2XVGA 5JLVA 2N7GA 5D8AB 4MUVA 1ND3B 4J1XA 1VB2A 5FQ0B 2PHFA 2BNOA 3TB0A 4YVWC 3L2HA 1LECA 3AP6A 1ULDA 2H0VA 1DQ5A 1DGRA 1RUG3 1NCRB 1RUI2 2DFBA 2WFF3 4Q27A 5J48A 2XLAA 2XG3A 4GWNA 1QOOA 3I2DA 3PLQA 1YCIA 3KS7A 3JB4C 4QPYA 5E8AA 4BMEA 1NQJA 2VUJA 4YW4A 2FQPA 1QNYA 4XILA 2DF7A 4ES8A 1PGW2 5IK5A 4E2SA 1DQ2A 4E4SA 1ZRCA 1WUVA 3IWZA 5KXDA 4I0WB 3LA2A 3B5LB 4Y5Z0 4ATFA 1G9BA 3UK9A 1LGBA 1RUJ2 2YGLA 1U5ZA 4YW1A 3FFZA 4IV3C 1LKNA 4XW3A 3BIWE 3J8F1 3R05A 4GKXA 2BFUL 3SMHA 2RS11 3U10A 4O9GA 4WVMB 5EWSA 3MFCA 1IPKA 2A3WA 2P37A 4RSUA 5FOBB 3AKPA 1DU3D 4QX5A 3MIBA 1N1VA 4IEOA 2WS92 4CEYB 1YJKA 2JEMA 2XBO3 3ZYPA 4OHWA 4MLOA 1Z7S2 5JWPA 2X5IC 2X5IA 3ACLA 4GXLA 4AI3A 2D6KA 2I74A 2BNMA 4QM9A 4Z1VA 4COYA 5AC91 1H2LA 1G7YA 3WG3A 3D5OA 2UYAA 2VVEA 2ZMLA 3DPRC 3DPRA 4RQPB 4B4QA 1EV11 3LGRA 5FDBA 5LK7B 2DYCA 2P34A 3HQXA 3JBG2 1TE1B 2A6ZA 4COWA 1ZYBA 3RYPA 2IXLA 2P2KA 3MFAA 1YFYA 2ZAAA 1ZBE1 3AJZA 4DY3A 1OHFA 1RUF3 2EF6A 3AMPA 2BW8A 4OHVA 4XFFA 4YW5A 3VBRC 3VBRA 5A32A 1CGPA 2E7TA 1VBC3 3VBUB 4X8PA 1S2KA 2WNVA 3K48A 4CZSA 1LULA 1D4M1 3AZWA 2E6VA 2ZOEB 1H2KA 2BEOA 1DDLA 4Q4W2 1JN2P 1NCQB 1X82A 3ES4A 4M3CF 1Q5OA 5CFCB 5DDJ1 2IFWA 1LU1A 1AYM3 2RS33 1KXGA 1PK6C 3K51A 1PK6A 1I3HA 1AR92 1GANA 3MIFA 1O3SA 4WM8B 1O4ZA 3OCPA 1MS5A 1OLRA 5ACA2 3ZYRA 4OI4A 5JCTA 1CAUB 4YVWB 1RUI3 2OA2A 4C1XA 3AYEA 2XJUA 4JTNA 3G6JB 5BPXA 1XE7A 3SXWA 1J59A 2WLPA 1FMD2 3MIGA 4LO8A 2ZGSA 5EYXA 3WDYA 1FPN1 5T52A 1RUE1 2R043 5KHHA 5ABJA 2GU9A 1M4WA 4WVVA 1BBT2 1C4RA 4EWEA 1LOAA 2XWBB 1SMVA 5EZWA 3RYRA 3BALA 2DCJA 5C8WA 4XEZA 3ZN6A 4R9DA 1AR61 2A6VA 1GZ9A 1HRI2 2CYFA 2QE3A 2K2SA 1FX5A 4NN0A 1M06G 4P9GA 4IV3B 2XJVA 4OI0A 1XNKA 3VV1A 1ZA4A 5FCCA 1H0BA 4S2DA 1G6NA 5HCBA 4E2QA 4OI2A 3KB5A 1W39A 3VBOA 3S7IA 2VOKA 4N7UA 3GBGA 3PMSA 1OOPB 2ZGOA 3LWCA 4PLNA 2WS93 3EBRA 4CP1A 1WCKA 2DU0A 3WDTA 1GQHA 2PYTA 2VU9A 5HCFA 1Z7S3 4R4ZA 4Y24A 4DNYA 5FOJB 4FTSA 3VUOA 1W6PA 4DINB 3LB9A 2QNKA 4JDNA 1X8EA 4L99A 2YROA 1QXRA 1IHMA 4LLOA 4XMIA 3QH6A 4MYEA 4GH4C 4GH4A 3NWKA 3WY6A 3GHMA 3NAPC 4PIZA 4PBOA 4TYSA 3NAPA 2VY0A 2A7AA 1CAWA 4TLFA 2CGOA 1YFUA 3FBMA 3BTAA 3JBG3 3VDDC 1DF0A 4XOGA 3VDDA 1V6KA 4KG0A 1J1LA 1DGWA 1YYNA 2O8QA 4OVEA 3GBFA 2BYVE 5H9PA 1UD1A 3IMNA 2Y0OA 3U07A 3WD5A 4AEDA 3J8F2 2GNMA 3KCYA 3KGZA 1AVBA 4JC1A 1W6OA 2RS12 3VHPA 3NSTA 1R082 3D8CA 1XU2A 1ZRRA 5KWRA 2UY9A 2XB6C 2Q30A 1BYHA 3GZUC 4LBLA 1REEA 4N9IA 4H3WA 4HSJA 4QM8A 4AF9A 3N7LA 2D98A 3SNMA 4FBFA 3HT2A 4N43B 5IT6A 4Y22A 1CX4A 2PFWA 3WW3A 5KC6A 1VRH3 5J96B 4XHBA 2B46X 5T50A 1NXD1 2D6LX 4YYOA 1PVXA 1GLHA 5I91A 4XHXA 5J98B 4FPEA 2WQZC 1MZEA 1PZ9A 1WW7A 5AC92 4KWJA 3AMHA 1WW6A 2HWB1 3AMQA 5F9TA 3AKSA 4HN0A 1MS9A 1QQP1 1FMD3 4LBNA 2HWC1 3MW2A 3TN92 2PLV3 1QOTA 3ZIXA 1X7NA 3B02A 4H7LA 5I8TA 1ZBE2 2AENA 4NHLA 1D0HA 3OGJA 5L7OB 4PQ9A 1PO21 1WBLA 2A3XA 1DGRN 4M3CE 1HRI3 1F2NA 1D4M2 5DUVA 2QZ2A 2IXCA 1WLWA 3T2TA 4PJYA 1S1AA 4K20A 4LUKA 2IC1A 1AJKA 3OYWA 3Q9OA 5DDJ2 5EYYA 4G9SB 1QH7A 5L73A 3KCXA 3JZVA 5T3NA 2D3RA 3M3EA 2XPJA 4XDQA 2NYYA 1BXHA 1DGLA 2ERFA 2BBVA 2BTVC 1PO11 1V6OA 1XYPA 1EPZA 3CNAA 3WZ1A 2EXKA 1UW8A 3ZFFC 1FPN2 2QVSB 1RUE2 3ZFFA 4YSFA 2K9ZA 1OI6A 2YY1A 5CB7A 3J4UH 3MICA 5C9AC 2MNGA 4YGBA 1S0GA 3VHRA 4Y20B 4LBQD 4EN8B 4Q2FA 3ME2A 1OQDA 4HZFA 1WCSA 4UW3A 2O8OA 3J8F3 1BVVA 4XFHA 4COUA 5JOZA 1UU6A 1X50A 2P3JA 4Q4X1 2RS13 3WW2A 3ZN5A 3ZYIB 3NL1A 3WHUA 3ENRA 1OMIA 4CTEA 4YZ3A 4HPKB 2JE9A 1DLLA 2ET1A 4G4FA 1PVC2 3TNPB 3N35A 1RUH3 1YIFA 1AX0A 4YM1A 3H50A 2H6CA 3POYA 1R1A1 4KGQA 4QQLA 3WG2A 2JG8B 3HIFA 3V0BA 3B94A 3V65A 2HWD1 1S0DA