3NASA

The crystal structure of beta-phosphoglucomutase from bacillus subtilis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
207
Chain Sequence
b'LKAVIFDLDGVITDTAEYHFLAWKHIAEQIDIPFDRDMNERLKGISREESLESILIFGGAETKYTNAEKQELMHRKNRDYQMLISKLTPEDLLPGIGRLLCQLKNENIKIGLASSSRNAPKILRRLAIIDDFHAIVDPPDIFLTAAAMLDVSPADCAAIEDAEAGISAIKSAGMFAVGVGADLVVRQTSDLTLELLHEEWEQYRIRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-phosphoglucomutase
molecule tags Isomerase
source organism Bacillus subtilis
publication title The crystal structure of beta-phosphoglucomutase from Bacillus subtilis
rcsb
total genus 58
structure length 207
sequence length 223
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2010-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3nasA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3nasA01
3ZWKA 4UM7A 2FDRA 4UMFA 4YH1A 2YJ3A 2EAUA 3OPXA 5AIBA 4CF3A 3VAYA 4YIKA 3A1DA 1Z4IA 3WKBA 5AW4A 2ZBGA 3QLEA 4ZEWA 5AK4A 1YS9A 4BEVA 3MMZA 1NF2A 4L6AA 4L6CA 2QYHA 4Y2VA 2P9JA 3D6JA 1F5SA 5AM2A 2RAVA 3ESQA 1O03A 3I28A 4NABA 2FEAA 3SMVA 4UMEA 3S6JA 5AK6A 1IWOA 3FPBA 5AI4A 3QNMA 4HGQA 3A1EA 4OCZA 5ALZA 4XQ0A 4J2TA 1ZD4A 2B82A 3FGOA 2PR7A 3WKAA 3ZUPA 2JGAA 5AKHA 5IT4A 3AR9A 1Z5GA 2IYEA 3L0YA 3UM9A 2HSZA 4Y2UA 5AKJA 3OCYA 2FI1A 3OCUA 2IOFK 3QYPA 4YIHA 3IB6A 1RKUA 3L5KA 2HOQA 3QU9A 2HHLA 2Q4RA 3QUQA 3B9BA 1NNLA 4UU1A 5AVWA 4ZEXA 5ALUA 2HDOA 3ONNA 2X4DA 2ZOSA 2B1RA 3IJ5A 4XPZA 3QXGA 2G07A 3W5DA 2YN4A 1SU4A 3WKDA 3AR6A 5AVQA 1K1EA 1MH9A 2PKEA 3L0CA 1EK2A 4EENA 4UMDA 2VKQA 3ESRA 3ET5A 2WFAA 1RKQA 1TJ3A 3WK8A 4DW8A 2W4MA 3OCXA 4EELA 3SLRA 1RKVA 3W5AA 3WKEA 5AKGA 4DWOA 3WKCA 2CFRA 5ALOA 3AR2A 5AKLA 1QQ7A 5AI0A 3DAOA 2WF7A 2ZXEA 3U7GA 2R8ZA 1L8LA 4KN8A 1T5SA 4CF5A 5AM0A 3B8EA 3ZVLA 4Y3UA 1WR8A 3AR7A 3DDHA 1L8OA 2AGVA 2I7DA 5A3RA 2NO5A 4KX5A 1ZRNA 1L7MA 4KNWA 4O8CA 2CFSA 3FZQA 4UAUA 2JAUA 3P96A 3FVVA 3QGMA 1Y8AA 3M9LA 3TLMA 5AM3A 2JARA 4JB3A 2HI0A 1WVIA 4HGNA 3R9KA 2EATA 2YMLA 3QU2A 5AW2A 1QQ5A 1O08A 2ODAA 2WF5A 3ZVMA 2C8LA 3QX7A 4KNVA 5AVZA 2WF9A 3OCVA 3A1CA 3UMBA 3N28A 3PGLA 3E8MA 5AM1A 3WGVA 2MSNA 2B0CA 1Z4LA 4GXTA 3KD3A 3U7FB 3ZTYA 3NRJA 3EF0A 4Y2YA 4YGYA 3DNPA 4BNDA 5AI6A 3W5BA 2G06A 5AI9A 2WM8A 2JAWA 2OA0A 3NAMA 3L8FA 1U2TA 4GIBA 2NO4A 2AUTA 3NIWA 5ALLA 1ZD2P 2G1AA 3CZ4A 1ZJJA 5ALMA 2YJ5A 1Z4MA 3SF0A 5ALHA 4EZEA 1X42A 4NV0A 3AR8A 1ZOLA 3MC1A 5AM5A 3L1UA 3ET4A 2GMWA 4Y2XA 1RQLA 1PW5A 2P11A 4RETA 3RFUA 3M1YA 3HLTA 1L6RA 1AQ6A 4FFDA 4UAVA 5ALIA 5ALRA 4BYGA 3L8EA 3RF6A 4UW9A 3ZWDA 1S2OA 1Z4OA 1Q91A 4BKMA 3PGVA 1J8DA 2C9MA 2ZBFA 3EF1A 3QUCA 3N07A 2YBDA 1J97A 3U26A 3UMGA 3ZI4A 3L0BA 1YNSA 3WGUA 4FE3A 2R8XA 3NASA 4MWOA 1XPJA 3U19A 4Y2QA 3PDWA 3E84A 2C4NA 2IOFA 2MU2A 2FUEA 5A3QA 4OD0A 3KBBA 5ALGA 3B9RA 4C4TA 5ALKA 1TJ4A 3QUBA 3SKYA 2FPXA 2G08A 1RMYA 2ZBEA 2JAOA 5AIAA 2GHTA 1WZCA 1XP5A 5AW1A 5AVUA 5ALFA 1YMQA 4UM5A 5AW7A 2OYCA 5ALEA 1EK1A 4XE5A 2WHEA 5AW8A 1CQZA 3F9RA 5AESA 2Q5EA 1VJRA 2NYVA 1FEZA 3NANA 4EX6A 3KZXA 3SKXA 2I33A 1Z4KA 4DCCA 5ALSA 5ALVA 3I6BA 5AKZA 5ALNA 4C4RA 1T5TA 4NAVA 4Y2JA 3QU7A 4NWIA 4UATA 5IS2A 1Q92A 3AR4A 1N8NA 2EARA 3ZTWA 3QU5A 1Z4PX 4HGRA 3ZX5A 1T9ZA 3N5KA 2BDUA 5AW3A 3NUQA 3U7HB 2QLTA 2D2VA 4AP9A 2YMPA 3BWVA 1RLOA 1TJ5A 1JUDA 4OHFA 3KDPA 2FPWA 3R4CA 4IFTA 3U7EB 4KX3A 3HYCA 3R09A 3L8HA 3I1YA 4C4SA 5AI8A 1NRWA 4UU0A 4B6JA 3SD7A 3ZVNA 4F71A 3W5CA 4I9FA 3WK6A 4H1WA 4MUMA 1YDFA 4IG4A 3MN1A 1RLMA 1WPGA 2FPUA 4I9GA 1S8OA 1RPZA 5FP0A 5AKXA 5AW0A 4KYTA 2Q4TA 1ZD3A 3KC2A 1U7PA 4Y2SA 4JDPA 4BX3A 1Z88A 4G9BA 1QYIA 2BDEA 4FYPA 2WF6A 3L7YA 3A3YA 4HGOA 5E0OA 3J7TA 4YCNA 3WK5A 1LVHA 2P27A 5JJBA 4NFLA 1TA0A 1SWVA 1CR6A 2C8KA 5AVXA 2FUCA 2AH5A 2OM6A 2ZBDA 1N9KA 5IT0A 3L8GA 2YFYA 4Y2TA 1ZRMA 5AVVA 2YJ4A 4BEWA 1Z5UA 2BY4A 3AR3A 5AICA 2YMQA 5AW9A 5AVTA 4UARA 1TE2A 4BBJA 5A3SA 3IRUA 3QUTA 4UMVA 4QJBA 1Z4QA 2O9JA 3PCTA 3KOOA 3AR5A 5T41A 1U02A 4EX7A 1SWWA 4YCLA 5ALDA 3N1UA 3CNHA 4UASA 3DV9A 4QQFA 1RLTA 4HGPA 1QQ6A 1L7PA 2I34A 1U2SA 3FPSA 1RMTA 2HF2A 2IOHA 5ALTA 2ZG6A 2FPSA 2AMYA 4HYTA 2OBBA 4PNHA 1XVIA 2YMMA 1LTQA 2MU1A 1ZD5A 1RQNA 5AVRA 2G09A 1KYTA 3ED5A 5AK3A 3N8GA 5AHXA 2GHQA 5AKEA 2PQ0A 1RDFA 2W11A 3BA6A 4OFZA 2RBKA 2I6XA 1RMQA 2RB5A 3K1ZA 4G63A 4J03A 3U13A 3QU4A 3E58A 4YCMA 1RRCA 1VJ5A 5AW5A 2YJ6A 2GO7A 4XOUA 3I76A 5ALPA 5ALWA 5AI5A 4HAIA 1Z4JA 4CNQA 2I54A 3WK9A 2G0AA 2HX1A 2YY6A 1ZS9A 2P69A 4Y2RA 1VFPA 5AVSA 4BX2A 4EEKA 2G80A 4L57A 4Y2PA 2HF7A 1YV9A 3MPOA 3EWIA 3WK4A 3ZX4A 3WK7A 2WF8A 3FM9A 4CF4A 1Z4NA 5AKIA 3EPRA 3SHQA 4DFDA 2B8JA 2CFTA 5AKYA 3OTQA 4AS3A 1L7NA 2O2XA 5AM4A 2W43A 2CN1A 2HO4A 5AVYA 4CE6A 4BNDB 3OCZA 2I55A 1YJ5A 5AKKA 5ALQA 4F72A 1L7OA 4RESA 2FPRA 5ALXA 3L1VA 3UMCA 3E81A 1RC8A 2HEGA 4AS2A 5ALYA 5ALJA 2B8EA 2R8EA 2RARA 1QH9A 2IA5A 3ZW7A 4BX0A 4ZEVA 2R8YA 3GYGA 2B1QA 2GFHA 5AW6A 5AK5A 4E88A 2HCFA 3NALA 2DQSA 2B30A 3OCWA 2C88A 1U7OA 3ZU6A
chains in the Genus database with same CATH superfamily
4MP3A 1JFRA 5ICGA 3ZDBA 3LIIA 4MYUA 3WYFA 5KG7A 2IZOA 3JZAA 4GAEA 2C07A 5EYPA 4RTSA 2BCVA 4FCVA 2FCAA 1N5IA 4DKXA 1N5JA 3ROPA 4ZFNA 2VNKA 2ZIVB 2XYGA 5EAIA 3BS4A 3NUZA 4L8VA 4OJ6A 1DDOA 1FF9A 3O2SB 1J5PA 1IG6A 5AK4A 1KDPA 2C99A 3OZTA 4KC0A 5FLKA 3V6MA 4ZZ0A 1PK1A 1NVVR 2GKOA 4HZUB 4YDQA 3UA4A 4PFKA 4ER7A 5I7WA 4NCNA 3L6EA 4R9VA 4EUSA 2EKPA 5F3WB 2QB1A 3M5DA 3BSWA 3T7IA 2ZE7A 1NJYA 3IILA 4B47A 5J4KA 5JQWA 4AUNA 2ASLA 1TPYA 5DYYA 2DWQA 4U6NA 3P2EA 4DA6A 4WZBA 3IIMA 3BRQA 5MF6A 3JXEA 1L3TA 3N2GB 4ZT2A 4ED8A 4IIBA 4QXRA 3VR5H 3A1EA 1IIBA 2I6UA 3LL7A 3FLEA 4GXKA 4ND8B 2Q45A 4FWTA 3N76A 1K4YA 1VZ3A 1Z2CA 3KUKA 4D02A 5B3KA 1T9HA 1DCTA 4HH4A 4TUSA 3Q9UA 1VE7A 3X0DA 3M81A 5IT4A 4P93A 5I7EA 5LIRA 2FRXA 3LH5A 4E3WA 3ZD6A 2BJWA 4HB4A 1ICIA 4H4DA 3VR3D 4BVKA 3MDCA 1SVUA 2Q50A 1AKEA 3DXYA 5DSXA 4K6FA 5ECYA 4XVHA 2CFOA 5E6SA 2R3SA 1PFVA 1XXLA 2PS9A 3S44A 3O4FA 4EVIA 2VF5X 3QOXA 1CR0A 1ILEA 2B2NA 1CUSA 1WTAA 3D5QA 4YMWA 1VI2A 4DSJA 3NHAA 5DLDA 1SHLA 1CUBA 2Q5CA 3MAAC 4Q01A 2C9OA 3KYCA 4RE5A 4UFPA 3RVBA 1E1CA 4JEIA 2HHLA 2ZIXA 5MFPA 2UDPA 5F23A 1A76A 4HMPA 1GJRA 4LVUA 5HUHA 4OYHA 1KSPA 4UHBA 4US1R 4X93A 4J3NA 2FJPA 5JV5A 3DE2X 1D09A 2JEOA 4AN1A 4B80A 3PPVA 3UGTA 2ZOSA 2FMHA 1C7ZA 4AP6A 4RULA 3RFTA 3O5AA 3W5DA 1C4KA 2YN4A 5LXTF 1SU4A 2KLBA 4HZIA 2DBYA 3LF2A 4H3SA 5CVDA 4E4YA 7ICKA 2PJUA 9LDBA 1EIWA 3NM5A 3V8EA 3EX7C 1EK2A 3MGCA 3RIHA 2XT6A 3WGMA 4O1MA 1YB1A 2V9ZA 4EHJA 1PJRA 2QQFA 3WHIA 5FOQA 1SELA 3D4PA 5CX1A 4AWBA 3Q7QA 1FW6A 1GPKA 1S5LU 1Y1SA 4MV0A 4RV5A 1RAEA 2QMUA 4BJ6A 2OBNA 1RKVA 2HLHA 3LCMA 3AIKA 4IG9A 3W5AA 1OWMA 5CA0F 3QXCA 4GYKA 5LPNA 1URJA 1QUFA 2ZTVA 3EBPA 3HB1A 3L4EA 4JJGA 2NV0A 3FYUA 3VU1A 1V71A 1NBWB 1QQ7A 4C88A 2Y27A 2GXQA 2O0HA 1TZ2A 3VR4H 4BV3A 2HMTA 1IAQA 2FOIA 2BFEB 3T3MB 4R98A 1I5RA 4HI0E 3PQCA 1N56A 1MTOA 1ETHA 3G8DA 3QUSA 4FZ3A 3A0HU 3M4XA 2CXYA 3MRSA 1C0PA 2Q21A 3LTEA 4DC0A 4MW4A 3JQ7A 4JKYA 3OF2A 2GZAA 4K40A 4B82A 4BX9A 3ZWNA 4PSVA 2VTKA 4ZI5A 2FFRA 4AVYA 2G9ZA 4BNZA 3FMFA 3QK7A 4A8HA 1Z3IX 5A0LA 1SL0A 1BE0A 4UB3A 2EZ8A 2ROQA 2VF2A 5E2AA 3THWA 5EC8A 4RKRA 4NDNE 1NOJA 3WYDA 4ZGBA 1O4VA 5LA6F 5ARCA 2GLEA 4ZYZA 3WHLA 4QOGA 3GX1A 1XTBA 5CXUA 1CJUC 1KXZA 2ODAA 2YX1A 4IQ8A 4MS4A 3WLOA 3JQCA 5B1EA 4TVOA 4CG0A 2G9NA 4FPXA 4B2IA 4E94A 2W3RA 1XKQA 4IDAA 5CP8A 4AUEA 2R7LA 2WAQF 2D5LA 3GAZA 5JD5A 1FFUA 4E07A 2XB6A 5BWMA 4F93B 1WZUA 3WGVA 1KAMA 3M6MD 4ZT4A 2CDAA 2CXPA 2Z04A 5K3CA 3TI9A 2FVXA 1YZFA 1N0UA 1V45E 4F3OA 3QENA 4IAOA 3K30A 3NRJA 4OP3A 3C3XA 2C5HA 2WIKA 2BTQB 2EL9A 3E3MA 5KIAA 3KQUA 1TLFA 4OB7A 4UOZA 1BWQA 2WQZA 4B8WA 5CA1F 5KWJA 3DOHA 3JAWA 3HI6A 1DWOA 2A1TR 4EI8A 1S2LA 4DZZA 4PZZA 3QY9A 3P19A 1Y1RA 4GOXA 4LOAA 1PWZA 2Q3HA 2QT0A 1PJBA 4KDFA 2GEJA 2Q2QA 3MAJA 4RDXA 3HV0A 3HWX1 2I1WA 2GAOA 5KZMB 1WCLA 3EQ6A 1Z6QA 5J0YA 2OILA 5I4KA 5IJXA 3VVBA 3NBZC 3W2FA 8ICEA 4QZBA 2ZETA 3UAYA 2I66A 2K7FA 3OGUA 4DCJA 4C5BA 1S97A 1XA4A 4KVGA 1L5WA 1D6MA 1BPZA 1KK2A 1G4AE 1M34B 1SCAA 2ZI5A 1II9A 3L1UA 4LI3X 1IN6A 5HFNA 5AXCA 4DMHA 1CDZA 1BGVA 1SD2A 1TA9A 1Y33E 2PSSA 2Z2JA 3ZHBA 4RIEA 4GC5A 4CGYA 5LQDA 1D9FA 1FB5A 1NVTA 1QPGA 1GV1A 2O2GA 3B48A 5BYJA 2B5OA 4OL9A 5D5QA 3ETLA 4R8SA 2EX1A 2NO1A 1FP1D 1RLJA 3U39A 1G8GA 4F4FA 5KPJA 4MKRA 3HCAA 2CYAA 3ILSA 3FTDA 4PAMA 1YK1A 3BQMB 3HKZF 2X5NA 5TE9A 4YDRA 2OWOA 1NP6A 4OGGA 4OM8A 3MVEA 4XGNA 4OLBA 2LD4A 3D6MA 1AK9A 1UBKS 2D5CA 3HJGA 5FUBA 3L06A 3N07A 3U7RA 3OPMA 4BLSA 3H8JA 3PNBA 3ZI4A 2O3JA 1CRZA 2ASVA 3VR3A 3LK9A 1AKMA 2E87A 4QOSA 1JXQA 2CXQA 1XL1A 2LIVA 3HUUA 1OUMA 3R0XA 3THSA 3DW1X 4EHLA 1CY8A 1X70A 3KWJA 1HDCA 1A7AA 3CF6R 2PLAA 4H6VA 5DDYA 1VHQA 2PO5A 2AWNA 3DAHA 4RHCA 3URMA 3UWMA 4INJA 1DS6A 1LBIA 1WM1A 2O14A 1KKUA 3B9RA 5LWHA 3R9XB 4KE9A 1QIMA 5AOCA 2C8JA 2WD8A 1IMJA 1X38A 2CNNA 4UM9D 1R0BA 5BSTA 5TJ9A 1U45A 1HI9A 2ZBRA 1AKUA 1JTFA 2R8HA 1NC3A 1RCUA 2D1SA 5EP3A 3KAPA 1F8GA 1VRCA 3GVIA 4Y1RB 3AL0C 3EY9A 2WHEA 1A9XA 1P0FA 5AESA 1ENPA 3OIUA 2Q5EA 4KXWA 5CYOA 4BB0A 3AUJB 2OZLB 3B60A 4FZLA 3MFYA 5BW8A 4L76A 3TQCA 3TMYA 3ZHSA 2B7CA 3TECE 3RS2A 4BO7A 4EFDA 3LX6A 2QTRA 1K6JA 2R7AA 5FBRB 5FI3A 1SV0A 1ZUNB 5JG7A 3U7IA 4MF2A 4NAVA 5ABPA 3AKYA 3AU8A 1MJHA 2OLEA 1W5TA 3TXAA 4CMJA 1PJCA 4L15A 5DZSA 2OTCA 1OX6A 3ASZA 2PH1A 1B6GA 2G5IB 1HT0A 4YV1A 4JEHA 4E5YA 3ZD9A 4R8UA 1NW3A 4BJ5A 4TMXA 4C8LA 3ZLJA 5AW3A 4PJ0U 1ST3A 2VP3A 3PPIA 1AGNA 4C3VA 1OUQA 2E37A 2G1UA 2PH5A 4HPXB 2ETVA 4E2WA 1KRPA 8ADHA 3ED1A 5IVDA 4C4YA 2WEKA 5JS8A 4MUFA 2CXOA 4JC4A 3H8MA 4P6VF 5A4FS 2UVDA 1K2VN 1RCFA 2JKZA 4N01A 1UFQA 3FLAA 1G6OA 1GDTA 1XI2A 3B6IA 1VM6A 4YASA 4WK4B 4Q1DA 4BZPA 4PG4A 4BQPA 4D3SA 3K6RA 5K0LA 3JSAA 1XBTA 4PIVA 4J2OA 2E48A 4ZYXA 2O1WA 4FCWA 4M49A 2CLLB 4BRZA 3SS9X 3BQNB 4H1WA 1KZ7B 3K5PA 4O4LF 3HKCA 1RYBA 3KQNA 1S0UA 1WPGA 4CMIA 4EHHA 3RG8A 3AFHA 4U7HA 4RPXA 1Z2PX 4Y6GB 1YFLA 4N65A 4UHEA 2NZYA 5AP9A 1HJPA 5EJ8A 1P73A 5HR5A 2VCYA 3NEPX 4L5AA 4M1SA 4KYTA 5HHIA 1G6Q1 4QEZA 1GAEO 3TADC 2VP6A 2IBKA 4WCDA 3CKLA 3IXQA 3ZE7A 3IPXA 4QPCA 4DCUA 4PC3A 4F3RA 2ZLBA 2ORED 5L4SA 1XB2A 1W59A 5JU6A 3Q6IA 1KH2A 3IBYA 1VGVA 3KVRA 2HW8A 2RHRA 4RZ2A 1XNGA 1JX4A 3IKVA 4NZ9A 3DF7A 4XJTA 1ODSA 5SYAA 4I1UA 2OHGA 1KS9A 1G16A 4CTKA 2P27A 2R6R1 2CLEB 5DGCA 3QXJA 3NP9A 4H2DA 3SMQA 2DQNB 3SQWA 4DL2A 4QICA 4ARAA 2WJ3A 1ZOOA 4MV4A 1E4EB 4MR9A 4WLEA 2XUGA 4BPBA 1JQBA 3E4CA 3MWJA 2OM6A 4B71A 3OZSA 1YQ9A 5IUJC 5KC8A 5H2FU 1G5QA 2H1IA 4Y2TA 1VCMA 4DJJA 4BO9A 4EJMA 4YAEA 1KPHA 4EJSA 3NM6B 4ZA2A 1TZMA 1WKCA 4BJQA 2DQKA 3GRAA 1H8HA 5FWYB 4JLOA 1TLLA 4PRKA 4ZAWA 1U5AA 1J2YA 4JC0A 1DLIA 5L1MA 1WHTA 3HVKA 3NHZA 4O4LB 4Q7JB 4RA6A 2MYNA 5A4IS 4DFPA 5BV8A 3TGPA 1JG4A 1KVRA 2PZ8A 2OORC 3GUZA 3QI7A 4QG7A 1M8KA 5C1IA 3T0FA 2EQYA 2XMPA 3VSEA 1VXOA 2OQVA 4CDRA 3D4BA 6AT1A 2AFIA 2H1FA 2VWHA 2WE7A 1G9SA 2WG1A 4WW0A 3VYSB 3KPYA 4C6SA 1Z2NX 2Y1CA 3IKLA 4N5HX 2NV3A 1E6WA 1P45A 5AHWA 5FFFA 3VH3A 4DUGA 5B3JC 3TUZC 2WFLA 2VRNA 1TUIA 4RQ2A 2CLKB 2Y0BA 4RNOA 1E1KA 1K66A 1YMUA 2QAGA 3DE3X 4M9JA 1RLTA 1QQ6A 3OOEA 4PHGA 4ZHQB 4FN4A 4QIHA 1QAOA 2O8FA 1RMTA 1O94D 1ZGZA 4IJUA 2ZCJA 1XQWA 1ZVKA 4D43A 4QIWF 4DSTA 1QIGA 2PVSA 2IEAA 3KAQA 4D6XA 3I5XA 5I51A 4DR4B 2LBOA 5DXFA 4OEHA 2W7OA 4I5DA 5C5IA 4HRAA 3PUZA 3GEGA 5I4BA 1QNLA 4HKTA 2B25A 4WZAE 4B5KA 1I3CA 4MCHA 4BV8A 4PNHA 3U49A 3UV7A 2E89A 1SVOA 3WBBA 5L45A 2IDJA 4TTVA 2X8LA 2P78A 3LC1O 1B8UA 1YVRA 1OBFO 5KCZA 1XWIA 3ETDA 5FL7D 4KXUA 3HVRA 3MILA 3TZCA 1QHEA 3AESB 3N8GA 3GFPA 5AYVA 1CZUA 1HL3A 3TSOA 4AF8A 1CZOA 2GN8A 2VHYA 4B76A 1POXA 5REQB 1QRDA 2Z5FA 3GLIE 3PVZA 3ZQKA 3BA6A 3O1HB 3O2QB 2YV3A 3DFFA 5J59A 5KCMA 3EXFB 3MAGA 2BH2A 4OY3A 5DBIA 4DR1B 3PSHA 5DBGA 4KEAA 5J2IA 5CW1A 1VYTA 8ICQA 5AJTA 1MB3A 1HRKA 2XQGA 1TKCA 2V45A 3KU4A 4KMOB 4ZQEA 8MHTA 1HT3A 3BMXA 3KHSA 4XIYA 2HNBA 5FPPA 2W6ZA 3ROKA 5EJEA 3RU3A 3DFMA 4LHWA 3VGPA 3B7WA 1YR1A 3ETRA 1QZUA 1JG1A 1P7CA 4HTFB 3HN7A 3UQ2A 3LM8A 1M5TA 4Y2RA 4GZ6A 5CYGA 5JXJA 4QVGA 4B3DA 1MRSA 1YOVB 2D5BA 5SV2A 3WGTA 1PT5A 1YK0A 2E3TA 1Z82A 2HF7A 5CJ2A 1RABA 2VF4X 1O94C 4BO2A 3PR5B 3PNMA 4NU8X 5TR9A 4DB4A 1YCFA 4G97A 1NUUA 5I45A 5THKA 1NDUA 2CGEA 3E1SA 4TGLA 5K4HA 1SQSA 1V3QE 1ADGA 2QL5A 4HL6A 1RZRD 1MLDA 3VOAA 3PD1A 4MV9A 5C4GB 3MGIA 3ZC3A 4EGSA 4PRZA 1MO6A 2H4YA 3AI3A 2IE0A 3EGIA 3PQ2A 5IAJA 2O2SA 5EWMA 2AXPA 3MWEB 4CG2A 4MJ3A 4RU9A 3L01A 4YO8A 121PA 3H7IA 3IUEA 4X1KA 3ABRB 5HBRA 2OCXA 4Q5IA 3QE2A 2GBGA 3UK0A 2RG7A 7ICOA 4X1OA 5JAZA 3LKZA 5L1KA 2LI6A 2C3OA 2I55A 4GF5A 1L9XA 2C83A 1FSSA 4ZCSA 1XD2A 2Q6TA 5IAKA 4HNAB 1O9HA 4N0DA 2X4IA 3RWMB 3ER8A 2PMWB 1QV7A 4HAWA 1Q3TA 5HP4A 2Z6VA 3ORQA 2JH7A 5FQOA 3JALA 1CR4A 1M6NA 4ME6A 4BWVA 2D1YA 4MKFA 3RAEC 4QYWA 5D00A 3BSFA 3KBOA 2I8AA 1J8VA 1LI4A 3IELA 4KITB 1WLYA 1ZXXA 2L82A 2OCGA 3CRNA 3SPXA 2Y6VA 4EA8A 1UPHA 4DNOA 4Q7MB 4JJ4A 3QQPA 1WW8A 1G17A 4LYGA 4FFLA 5AQ1A 1HLFA 1VKJA 3BD7A 3QEMB 1Q8KA 2PGNA 3T61A 5CXXA 4B3FX 3CH7A 5HR7A 2VBFA 5F7ZA 1FTSA 2ZI7A 3DBHA 3TW0A 2BEWB 3RYIA 5IM4A 3STTA 1ZQQA 1IXRC 1VCOA 3LK6A 1FYDA 1RJEA 1DBSA 5JNLA 2BJHA 2PI4A 4FWIB 3PNVA 1R88A 1ZGGA 1RFGE 4A0FA 5A2QA 3PWKA 2AN9A 4QLBA 5KWSA 1BEUB 2BI8A 3S27A 3RANA 2PNJA 3T1QA 3WJ2A 5BW6B 3C5VA 5KFLA 4HBZA 1EKXA 4KU4A 4L2IA 2FZLA 5A5EA 4IOMA 2DFTA 5DOZA 1TAUA 1DIBA 1JBKA 1IQUA 1G7CA 1MO2A 2GF9A 3AFOA 3EFBA 4NJMB 2YXDA 4PSAA 3TTYA 5C5DA 5AOBA 1NF2A 4Q48A 4HYYA 3O31A 2FW1A 4BGEA 1F5SA 2HVIA 2RAVA 4URHA 2ZJ3A 4YJFB 3ZGNA 1THMA 4C06A 3EFOA 2PFKA 2ATIA 4DIBA 4OHRA 2B98A 4JI6B 3EDMA 2X8JA 3HP1A 3UKJA 4BNJA 2J3DA 1IWOA 3WU2U 1GUBA 3A7DA 5C9ZA 2BZFA 1IY9A 1J39A 2F90A 4HGQA 4EO7A 1OREA 4EUHA 4ABTA 5ALZA 3I1IA 4XQ0A 5DVZA 4G4IA 5H3HA 2W9XA 3X1DA 4DZTA 4BLTA 2CHVA 1WXQA 4MKHA 4X41A 1CUWA 4GRAA 1KDZA 2G25A 3WKAA 3WLKX 3ZUPA 1N7IA 5JBIA 3B89A 3D7MA 3HXPA 2Z2IA 2CL0X 2CV1A 5DHSA 2R4QA 4B2PA 1HF3A 4ROSA 3I4LA 4X5VA 4BIIA 4EY3A 3QPUA 2ENUA 2P6MA 1H6DA 3FPGA 5EUMA 4A3SA 4W9MC 2K87A 1SCDA 2EBWA 4LK2A 4NLGA 2NUAA 3GLIB 4XCVA 4B0PA 3GGCA 1G9XA 3CM0A 3H04A 3LYLA 3IVGA 4QUEA 2UUAB 1QSLA 2ZS8A 2A1IA 2W54A 2A57A 3H2KA 3PQ7A 3UB3A 4MHOA 3DB2A 3PUHA 4MR7B 1EJ2A 2ZRDA 3B9BA 4KLGA 4JUAA 2I2DA 3SM3A 1G1AA 3IP9A 3ZY5A 2ZWPA 1VSQA 2G28A 4IPTA 4WDQA 4ROTA 2PSEA 1VHTA 2ZJBA 1AB6A 1BWSA 2W6CX 3IQXA 4ZEXA 3UHAA 3C3KA 4Q4AA 4L5IA 1TK3A 2L18A 1G8SA 2CF5A 2XZDA 4YVFA 4RHYA 3VPAA 3HB4X 2YWGA 4BE9A 4ZC1A 4C20A 2CKDA 3FDZB 1M5RA 1GLGA 4PO1A 4NCIA 4M0LA 1E59A 1CLEA 1D2MA 5F4BA 5K2MA 7ADHA 1CEEA 3Q9SA 1M2GA 2PMZC 2ATLA 5IIKA 4E0DA 1BC5A 1HM5A 4XLTA 2GFIA 4CEIA 2AW5A 4J9VA 1IC6A 4ML3A 2QKYA 4M9UA 4FFNA 3BX1A 4K1LA 4ESOA 1BFUA 1RBYA 2FYTA 2HVHA 3C8DA 2OC4A 4GBMA 4O3FA 3IGFA 1THGA 2RDMA 2ZSJA 3E2PA 2AFHE 2ZYSA 3PNLA 4JJIA 4B9TA 1H3NA 1CUXA 1R4MB 3AJ9A 1SZJG 3GQCA 2XNSA 2FMPA 3ORYA 3EGXA 4FYHA 3TWOA 4YHHB 2OQRA 4K0RA 2FH5B 4OJNA 3PP8A 5CX4A 1JJAA 3TK1A 1TLTA 1UFOA 2QUZA 3LBIA 4N41A 1VE1A 1YQUA 2VUIB 4M0PA 1C9MA 3KHGA 2O0KA 2W2NA 1L5LA 2J0SA 1N33B 4P4SA 3V7YA 5KNDH 5CDYA 1NI4A 2W2QA 1J09A 5LQSA 4KAXA 3E9RA 3MSCA 2FPIB 4NAHA 4W9NA 4IQGA 1QO0D 4O8CA 4AFNA 5K0JA 3BQTA 1R9GA 2YJNA 3BK7A 1EFPA 5BOMA 2WY2D 4Q00A 1A9PA 2XBMA 1G291 3TQTA 3WZ2A 1GFZA 1NI4B 4MPRA 3OSUA 5AW2A 3FNGA 3COJA 4QYMA 2W8ZA 2Q5OA 4BNTA 1DG9A 3R3JA 3BN3A 2WMNB 1TO6A 2NXCA 3RTAA 2RGNA 4Y9SA 2PXXA 4BGDA 1QX4A 2VXOA 4XDHA 1A69A 3IP7A 1H22A 3QTBA 4ZVPA 1R0ZA 2B5WA 2ZWOA 3DM9B 4QDJA 5G40A 1RS0A 3OF5A 2LZ0A 4U0JA 5CA0A 4R1NA 1TCUA 5DLFA 2VK8A 5DGBA 4N5NA 3LT4A 2IODA 4IUDS 1S1CA 1XDSA 1XQ1A 2YXBA 4NZZA 3RFFA 1KVQA 1AV7A 4EG3A 4A15A 1GGHA 2XRZA 1UADA 2CE2X 3RJ9A 1CETA 4ETNA 3ZY2A 3FRIA 2YTZA 3RS9A 3UW3A 3SQIA 1QOPB 4LGCA 1H9BA 2WTBA 3I2JA 2ZIXB 1UOOA 5ITZB 1A8HA 3NHLA 2DPYA 4O3SA 3E35A 2WM8A 2QENA 2HUPA 3ITEA 4ZVLA 3UWSA 1N34B 3WFZA 3FUCA 3TLZA 2DX7A 2ZTEA 2F55A 1B26A 2CJYA 4GIBA 1ECJA 2DUWA 3KX2A 3OPQA 4ZOCA 4YRZA 1YI0A 3I92A 1ID1A 5KNBD 4FM9A 4IFEA 4I5IA 1D0VA 4MDEA 4EWLA 4D6YA 3ZCVA 1FS4A 3DJYA 4XB1A 1DRGA 3E53A 4O3RA 4IIGA 3VKWA 1K3FA 1GA1A 3V72A 5IYZF 2XYVA 4O5OA 5DNDA 3JQAB 3AGQA 4DA8A 2C28A 1PZEA 5GTDA 4BMCA 3ZY4A 3PZBA 4LISA 3NJ4A 4RTPA 4IX9A 4ZOAA 2C2MA 5JH7A 3RFUA 3ZE8A 1SIUA 1XKLA 2QL6A 5CNKA 2OPHA 1SOUA 3DEKA 1NOIA 5SYMA 3HLTA 5KNBA 1NA5A 5KWIA 2O0MA 4PG6A 1NK6A 2Z8XA 4WXHA 3WGHA 1MT0A 3NDBB 3LO8A 1A1SA 1XO0A 4M0DA 1RYHA 2DTEA 3PI6A 1XJCA 3K71B 4R1OA 2DH6A 3PDUA 5D46A 2QTCA 4G4SO 1BHSA 5LD2C 4CGZA 1PR2A 1UWCA 4EY4A 3V7JA 1VL2A 2DHDA 3L7IA 1GGJA 5DLQC 1TPZA 4U7CA 5DM4A 3SLKA 1QKKA 4G0QA 2C3MA 2NXNA 2JGFA 3E27A 4IIDA 5CURA 2FV8A 3CN9A 5G4LA 3GLTA 1ACMA 1U0NA 4ZYTA 1R12A 4P32A 1NBOA 2IF0A 4Z3KA 5HNKA 2PUWA 3PKJA 4EMTA 3D2SA 4WY5A 4YMLA 4XI9A 3H2YA 2IUEA 5IEBA 1JS1X 3GFSA 1K7FB 3HJUA 4BMPB 1KMHB 1MV8A 1E1YA 5TGZA 2G08A 2HU2A 4GMHA 1REQA 1J1IA 2R86A 2X40A 3ETCA 4AZSA 4D46A 3JTEA 1L5GB 1XP5A 1M8FA 2CLCX 2IV2X 1B42A 3IPLA 5LNK1 2PMFA 2AFHB 3AM3A 3HVUA 3PUIA 4DSOA 4J0KA 5H5JA 4Z99A 3W3AH 5HQ3A 1FU7A 4S1OA 2RD2A 1V5IA 3MM4A 2ASDA 4IXNA 4U3JA 3S1AA 1V11A 4JT2A 1ZQVA 1Z6TA 2OPBA 3PD0A 2IVZA 2JEYA 3T7CA 3GLGA 7REQB 3IIJA 1PQPA 2IYSA 4CR8A 1G3IA 3EA0A 3WLNA 1SA0A 2V5UA 4MVJD 1AXGA 1LW7A 5JALA 3V7LA 3RFXA 5KHLB 4AZ3B 1EB9A 4NWIA 4UATA 4ZJUA 2QRPA 5KBYA 1XYGA 4BKPA 3AZPA 5DT2A 2MDTA 3PVXA 2BUAA 3EGDA 2WKSA 4OGWA 4D3FA 3VU0A 3D6FA 2AXTU 4UNQA 3EBOA 4PCAA 1IPFA 4F6RA 1T9ZA 2CDBA 3KJGA 4RQBA 5IABA 1P5HA 3AHJA 3KO8A 4CM8A 2G8NA 2PK3A 2XQIA 3I12A 5EIBD 5TB5A 3T99A 1DKMA 1EDZA 3TRKA 4AZ3A 3TL3A 1ISMA 1KO5A 2BUCA 1TMKA 3GH3A 3D2QA 3AZQA 5JRZA 2Y1IA 3KDPA 4Q3AA 3LWDA 1ZSYA 3JPTA 1GL6A 2F2AB 3WI7A 1T29A 4C1NA 4YAIA 1NLYA 2A30A 1EEXB 2HBYA 2VNSA 3AUYA 3DTVA 4ZO8A 1J8FA 4RSRA 4HH3C 1JG3A 1W19A 1AKYA 3IP5A 3K0CA 1NU8A 2Q3BA 3SD7A 5EJ4A 4DKJA 1AD2A 2YZGA 3B0YA 1UKCA 4J1QA 4HMOA 5BWLA 2CZCA 5KKCA 1NZFA 2X3UA 4K88A 4D9KA 2OP0A 3R3WA 3KOYA 2KK0A 3LLMA 4TV9A 1X8JA 3B3FA 2GLTA 4N1AA 3BRWD 3D7LA 3UT5A 1LNSA 2VOJA 5EZ5A 2A19A 1S2GA 4O4JA 3WSVA 3KQKA 4R2KA 4DJAA 1DQZA 3ID6C 4N5DA 4N7JA 2ZR7A 1H2XA 4P0TA 2FXVA 5C52B 5C5EA 1KI6A 4QZ8A 3SU8A 1EZ4A 5EUQB 1DBQA 4CMAA 1U2PA 2IZ0A 2XMGA 1NYTA 1Z68A 4X71A 2GJ8A 2AXNA 2C54A 3D1JA 5BSMA 1UODA 3EZ7A 4YCNA 3L4PA 2KHVA 1KP2A 3ZWBA 1B3BA 2BP7B 2PX5A 3A0RB 5JHHB 1N2EA 3F2IA 1ADJA 1G66A 2W48A 2WT8A 4CKEB 4INPA 1ZETA 1F0NA 2NTVA 3CX6A 4JI7B 2VJKA 3RUAA 3MGGA 2XWJI 4WVLA 3J81j 1KDRA 2JEFA 2WJJA 1UMKA 2OZLA 4HWRA 5PGMA 3P1JA 4MTCA 1SUAA 2B1GA 2J7PD 3JVVA 1WABA 5DH9A 2YJ4A 1GOTA 3HGMA 3MUEA 1N5OX 2DJ5A 3NS7A 1X40A 1BQEA 1E1RD 2LM4A 1ONSA 1PL6A 1XHEA 2VA3A 2IYAA 3IOCA 4JT4A 3KG2A 2OECA 5E95A 1PT9A 3N2KB 2JHPA 3JAKB 4C22A 1KS2A 1HQYE 1LI5A 2VJMB 4Q1AA 2KS6A 2HFKA 5D2CA 2EEZA 4G2NA 3TQIA 1M74A 5FWNA 1GM5A 1YF3A 2VYCA 2R44A 1Y80A 1WCV1 1P8AA 1N5WA 1LDYA 9ICMA 1FFXB 2A3VA 1NHGA 1AUOA 1QUEA 2OAQ1 3BTOA 1PTJA 1IQPA 1PG5A 3D3WA 2VJ5A 3P0HA 5C8VA 1WZIA 1XUOA 4LWOA 1IBLB 4B7UA 3LDGA 1J0XO 1U02A 3RH4A 1PEKE 4HNRA 3A4YA 4JQYA 2WYVA 4N5LA 1IXZA 5E8RA 5CD1A 2ID8A 2PYIA 5I48A 4XTRA 1G6KA 3K5WA 3ILVA 2ZPUA 1E7QA 4XWAA 1DBPA 3IQDB 3MOGA 2Y3IA 1U2SA 3I04A 4LC9A 5CJ7A 2J3JA 3K6JA 3OIYA 4PC7A 3R5KA 3DE7X 5FRDA 4MKZA 9ICUA 3TG8A 4KNYA 4M8KA 5B37A 2JB9A 3K1RB 2HK7A 3CUTA 5FOUA 3R9WA 3AHEA 1FO4A 3QLVC 2IXGA 2X6RA 1WZEA 1XC7A 2QQ0A 3L7LA 4QQKA 4H7FA 4M53A 2QRUA 1R8JA 4DXDA 2EF1A 3I1JA 3VMFA 2YMMA 2VJ4A 1BHJA 2EZTA 3VX3A 4ZOBA 2EHDA 2F00A 2IYVA 5FJIA 4F97A 2HSEA 3VJRA 3FNEA 1NV8A 3HKBA 4I3FA 4Y1EA 3C3AA 4ON9A 2ZKIA 1K06A 2H63A 1ZEJA 4OSOA 2HMXA 1X8KA 2J5KA 1N9GA 2QE7D 1JTVA 1DKNA 4HRVA 2FRVA 3ISBA 2QV0A 5E4FA 3TE6A 3QLTA 4BQQA 4EY8A 4L74A 1Z34A 1MRNA 4NCAA 1RJDA 4FFSA 3ICEA 4LNAA 1UPXA 4IMJB 4ZT3A 3CLTD 3MJTA 4JYBA 5LZ5A 3AMZA 2B99A 2W8BA 1EXWA 4WBSA 5CK5A 5CR9A 5JR3A 3QJYA 1N32B 3I76A 3KU1A 3PLRA 2NT4A 3V8PA 4A23A 4RUCA 3RJKA 4Q7LA 3E7PA 5LC1A 1AIPA 3H18A 4LTNA 3HCDA 3BDAA 1P4RA 3RW9A 3V1MA 5KNCA 1MABA 2HAEA 3NO4A 4FYMA 4QG3A 4ZVTA 1S0MA 2COUA 4E6EA 1Y1PA 1E5QA 2W8BB 2VKTA 3CLSD 4L57A 2JEJA 4HV4A 1WCWA 1VSVA 2CXXA 3C98A 3W3ZB 1KAGA 4CG1A 1R3DA 4AN4A 1QLWA 4KUHA 3UFXA 2HMAA 1GT6A 5EJGA 3QFTA 5IXYA 2JIZA 4LCEA 1SQ6A 3S7TA 5F7XA 3RSCA 2QN2A 4O3PA 1AT1A 3WGKA 2MOKA 3EWIA 4WESB 1GKKA 2J9XB 2O8NA 1GO3F 2Q29A 3HDJA 2BBOA 2WC1A 5FHQA 1P44A 3ENQA 2G5HB 4EF4A 2QD2A 1VZ2A 4MS3B 3L3BA 3S2IA 3FGZA 1OLSB 1NQVA 2GBLC 4D81A 1GCAA 1L7NA 2JHGA 1T8WA 5HFJA 1ADYA 3X1WA 4NHEA 2HO4A 4L7VA 1KXJA 4KFUA 3JPOA 2FSGA 4ZCLA 1UWVA 5A5VA 1MVLA 4F72A 9ICEA 1ULAA 4DCOA 2ZIZA 4DLTA 1JSCA 1KO8A 2O6KA 1ZXIA 4EABA 1XJQA 5CB0A 1SH7A 4C7YA 2V9CA 2HWWA 2HY7A 2PL1A 4PHEA 2VRBA 3CJQA 4MV1A 4XYGA 1BG6A 1JKXA 1FCJA 3AHFA 4U5XA 5BORA 5JJ5A 3UMCA 4W5TA 2Q0ZX 2ISSD 3IBCA 5GV7A 2AG1A 3K9NA 4H1UA 1UA1A 1DAHA 1L7QA 4AJ9A 1AV6A 4Z8YA 4WI1A 4J16C 3JAMA 4LJXA 4TS1A 3VYRB 2V7BA 5J2TF 2X9LA 3GG9A 1XWLA 4HB2A 3WB9A 2CYBA 3AL3A 5CCBA 4RTOA 2X2FA 2I4IA 1SC1A 2C2WA 2OHJA 2OV8A 1SXJE 1O6GA 2SCUB 4ZANA 1G1MA 1G2PA 1JTEA 3OQHA 1KP9A 4ALIA 2YXPX 4RMHA 4S0XA 5C4IA 3L1HA 1QH0A 2MSWA 3DEFA 2ZJOA 3G0GA 3O0FA 5FBVB 4AXBA 1UK6A 2XXBA 2HT6A 2W70A 3UQYS 1I5EA 2PXIA 4XWTA 2X1MA 1N7HA 2BEVA 2D1FA 2FX3A 1WPXA 2ZTCA 2B9VA 4NH0A 4PLVA 4EFLA 1NY5A 4QZGA 2GSDA 2XYRA 2YJ3A 2F8MA 3NTLA 3QVXA 4H08A 1Z2DA 4RD3A 4TM7A 3C6BA 3GVPA 4BFYA 2VQEB 1MZVA 4US8A 3FPLA 4YIKA 3X2FA 4JBYA 2V7TA 3T1YB 2JL1A 1N1EA 4BDPA 2H85A 1VBNA 1X2BA 3MJEA 1BS2A 1XN1A 3AJAA 1EFTA 2EKBA 3BZWA 3PXCX 1QYDA 4XYEA 3IE0A 5FTWA 4ZEWA 2Y4NA 3L04A 1E5XA 3VJMA 2QAGB 1VB3A 4JI3B 8ICYA 1Q3VA 2JJ1A 3SF8A 3OC0A 4O8ZA 4AKGA 4F38A 4FHFA 3I28A 1W49A 1L3VA 2E9SA 2X7XA 3A04A 3E22A 3F46A 3GEPA 4EPWA 5AD1A 2CHEA 2FXIA 3AF4A 3IKJA 5DBHX 2PGLA 1QRSA 3KFLA 2PFPA 3QXHA 1IB6A 3EVBA 1GGEA 2P3QA 1P2UA 4PSDA 1E2BA 2G5PA 1E4VA 3GFTA 1TTPB 4IIUA 1XLTC 1TO1E 2KSOB 1PG0A 1T9AA 1MRZA 2NUBA 3P2MA 3CONA 2B82A 2CY0A 4KL8S 3GFKB 2UKDA 1K5DA 2M32A 2XBUA 4E22A 4PN3A 5L3VA 2OAEA 2X5XA 2OC9A 3ELDA 5CFLA 5AKHA 3AW9A 3NXSA 1YZNA 2OGTA 1DC6A 1LPMA 5REQA 1U47A 4UPVA 4YJGB 1FTWA 1OI2A 1Q57A 2NVUA 2YXNA 3HRKA 4RY8A 3RYFA 4BNUA 5I7SA 2NXWA 2UVPB 3TQSA 2UYCA 1NM5A 2Z0MA 1YDGA 4HB0A 4QUJA 2W6OA 1E0JA 1Z47A 3JYHA 3ZOZA 5K3SA 3NEJA 5KTRA 4EW6A 3DG9A 1L7EA 2IOFK 4YR3A 2Z5VA 4PPGA 2X9VA 3IMGA 1N6LA 2EJCA 3X1YA 3R3ZA 4DV3B 2P2ZA 1M1NB 2ID4A 4GC6A 3F7MA 4PNZA 1NOKA 4E5DA 1VI6A 1B6SA 1EX6A 2H3VA 1U3GA 3DP9A 4JX9A 2FSVA 5DRTA 3CR8A 5F2OA 4B7ZA 2NO7A 1Z39A 2RHCA 3WWEA 2ODEA 2BE9A 3V55A 3RC8A 2VF8A 3M0EA 5MHTA 4DLXA 4WCFA 1FNNA 4ZKEA 3RD5A 2AMJA 2O8EB 1XLWA 2KPOA 5DTEA 2NSDA 1TRHA 3QJ5A 2KMLA 2F7SA 2N46A 1GYRA 1TUBB 2R47A 4RLSA 1I2DA 4B44A 1OZGA 1MC8A 1PGJA 3FCUB 4RPHA 1JI7A 2DECA 5FX2A 5KYXB 4J0CA 3B3JA 2HPHA 3EFHA 4Z1OA 3BXZA 2G07A 2QRVB 3BMQB 5FAKA 4J76A 4K6KA 5JMOA 3PSPA 1SRQA 2C9DA 1JHPA 5L9XA 3TFRA 1PYDA 2FN8A 3IUNA 1YFJA 2OHFA 1R0KA 1ULSA 2REQB 3CVUA 1Y5MA 3ITKA 1G8YA 1P18A 4EENA 3FUUA 4WK0B 5HKKA 1I1QB 3MD9A 2WT9A 2ZAOA 2XKBA 4X95A 4PS1A 5EIFA 5EIWA 4PCVA 4B6QA 4B3IA 3VHLB 2W4MA 4F4ZA 1S2DA 4LMPA 2VQ6A 5LBIA 1A2KC 1NIPA 4DTCA 3G0HA 1KI3A 2PSHA 4QO7A 2Z6QA 2CLHB 4OP2A 3IBGA 2BGWA 4QD3A 4AUKA 3SKVA 1FMCA 2PX2A 3EK2A 3P32A 1BA3A 1H8EA 3AB7A 2QXYA 2PS3A 6REQA 3OLYA 2Q3MA 4HYEA 4K9OA 4M1QA 2YXLA 5DTQA 2JBHA 2BBSA 2ZSUA 3MIZA 5EHNA 4EM6A 3KYDA 4RSGA 3DAOA 2VFAA 4F4YA 2XW6A 4TL6A 5ERXA 3VR4A 2GDJA 1G4HA 4OBXA 5I9BA 5T4HA 3MGBA 1WJGA 3IR7A 1ZJWA 3HHPA 3CKMA 4HOYA 3IOEA 4PEVA 4FI3C 3IT1A 3ISCA 4ZYLA 3UENA 1CUGA 3DBLA 4Y3UA 5TC4A 3JZDA 3T5TA 4WH0A 1VJDA 3F3SA 2G4LA 5KFFA 1RWNA 2QX8A 1MB9A 4KNWA 3CZPA 1J0DA 3OM9A 4ND2A 5HWSA 3SQOA 1R64A 5IN4A 3EDRA 2JAUA 1X1EA 3TRFA 5KX5F 1J20A 1G5RA 3C1TA 3RTCA 3M6WA 3OZRA 4GLJA 3EZFA 1ZQAA 5TMPA 4MNTA 1HX7A 1C7JA 2HI0A 5J4HA 4ILKA 4QIWC 4NM1A 2BKXA 4DV6B 1XSNA 1Q1ZA 2RGRA 4C7OB 2C82A 1T9CA 3WIBA 2D0OB 4URXR 1JH9A 4UOQA 2VPPA 1SKUA 4J90A 3BCRA 1SKRA 2BHSA 4JV2A 2E8MA 2G82A 4DDTA 3LXUX 1X87A 4OHKA 4LG1A 4DT1A 4G67A 3NIFB 2Z7JA 2FR1A 3FSJX 3CUEF 4UTXA 3FDSA 2GNPA 5L4LA 3VBEA 3L07A 4C7OA 2CMHA 3B6KA 2X8BA 3G2KA 3SJZA 2A78A 5I01A 4M8NE 3DZ8A 4MLDA 4Q34A 3OF3A 5JROA 2WTUA 2IPOA 3RBDA 3EF0A 2I78A 2RHTA 4DV4B 5AI6A 2QZ9A 3BK2A 5KDLA 1T3QA 1PFKA 1U0SY 3MZ0A 3ZK7A 4M7OA 1BH6A 3ZHUA 2ZTUA 2J6TA 2ID9A 4UVEA 2OA0A 3H40A 1YIAA 2VSNA 3B3QA 3B82A 4K86A 5SZHB 4BP1A 5K2OA 1P74A 3CH4B 1IHDA 1JIIA 4X6XA 3ULKA 4CEHB 2ILTA 3GLIA 1Y4ZA 1ECCA 1KAEA 3JATA 5I5EA 4MVWA 3DEIA 4KWCA 1DMRA 2R7NA 4JLWA 4LOIA 4LF5B 3L8CA 1K7SN 1V8FA 1JKJA 3CRRA 1T1GA 5ESXA 3ZHYA 3H2JA 1NVDA 4MIEA 2EJUA 1PJAA 2Q2NA 1QLNA 4LJYA 1W88B 3O2NA 1V41E 3KQSA 3GIIA 2FSSA 3D54D 3CE6A 1RWXA 4FGSA 3ROEA 4KQCA 1RU3A 2BM0A 3V6JA 2R2GA 4FT2A 2PU5A 2QD1A 2WTFA 1RP7A 3OHBA 3A9UA 3IPYA 4DLUA 4BJHB 3ICQB 1C3OB 3I53A 4P31A 3IC5A 4TKUB 2JAXA 1M8PA 2WHRA 2WKRA 4NMLA 2NRXA 3CGGA 4PG8A 1B4FA 1TK0A 3PXBA 9ICIA 4MUIA 3VX4A 3IP3A 3L8EA 2ORWA 1DAEA 1O95C 3FMVA 4PZYA 1UC9A 3RF6A 2RGUA 1SXPA 2H06A 3B3GA 3FHOA 3LCCA 2Y1GA 5I9NA 1AUQA 2VYND 3ETGA 1Y81A 4HJRA 4B4DA 2RKWA 4L78A 3LVFO 4N8DA 4RQNA 3EMDA 4F56A 1HDEA 1G21A 5E7JA 1I3NA 2PWBA 2JI8A 2XV1A 2R1VB 3AEVA 3MWDA 1KFTA 4V24A 3ONEA 3UJNA 1J97A 1U4SA 3UMGA 1ECGA 2FR8C 2IGTA 4G89A 4R81A 1PUIA 2V97A 3ESZA 5DE3A 1XZAA 3CJRA 3F7NA 3N2ZB 4NBKA 2I7CA 3HB7A 1USUA 4HCJA 2PIDA 1L5KA 1OVMA 3PIDA 2JJ8A 4BFTA 1QWSA 5A05A 3SBDA 3GP8A 1DIRA 3PMLA 3F6BX 1K63A 4FD2A 3TFQA 1E3QA 1YBMA 3OPYB 1PIWA 4GOND 3E84A 4LJKA 4S1WA 2MU2A 4A8EA 1SO8A 5EGNA 3RLFA 1KOFA 1TCVA 4WXPA 1OFGA 3EUFA 1ZGHA 3ILXA 1TJ4A 4BB9A 2R8GA 1QRAA 1Y82A 4FW8A 4JD5A 4LF4B 4YG2A 4J0EA 1T15A 4I8XA 5F64A 1JFFB 2J9ZB 2WB2A 3PNYA 2RG1A 5FPYA 1SOWA 6LDHA 3GLFE 2W2MA 4M46A 4I1PA 4HDMB 4TOIA 1YMQA 2GJAA 3ONFA 4ZPJA 3VZRA 5KL8B 1F0KA 4HQKA 3RSHA 1GCIA 1OAKA 5JCJD 2EZXA 4ECTA 3PZPA 1CQZA 3S8YA 1VJRA 1NI3A 5GIPE 2PTHA 1XP8A 3G89A 3KS9A 1LK7A 3TZBA 5A9TA 3NBYC 3O4VA 4I55A 5ALVA 4BMYA 1PTKA 2B4YA 2QXTA 3ND8A 1V8BA 2LBPA 4RZIA 3WAKA 1V5FA 1X1DA 4Y2JA 5KG3A 1MORA 2QYSA 2TECE 2VT2A 3EIEA 1JYEA 3HXLA 4KO1S 5G02A 2JFZA 4ZRMA 3ZS8A 4C2BA 4TKVA 5A9SB 1L4BA 3HPRA 5C4MA 3PFFA 3RQIA 3U6BA 2KLHA 2GNAA 1N2CA 3ZDDA 1JEDA 4MZXA 3K9GA 3CLUD 5FULA 5BUQA 5L6LB 3FGNA 2LPMA 4BLRA 4DRYA 1UK9A 1K1SA 3IQEA 4XRRA 1QMPA 1NQOA 4G1MB 4KAFA 4MTLA 3O8OB 3U6KA 1LSUA 4R51A 1J56A 2DLNA 3R7AA 2YMPA 3P9NA 4UAWA 2R5WA 2XEDA 3DZDA 5I5GA 3GIJA 3MTBA 5B36A 5THQA 1BTOA 3QSYA 3GHHA 2J5BA 3WYCA 1KQFA 3H5TA 2CDRA 3ZWXA 5KFNA 1QGUB 4JBNA 4NPCA 4TV8F 4IRKA 4OU4A 5JD3A 2I2XB 3IHLA 5H59A 1D9XA 3ZD7A 1PFUA 1U7ZA 5J1TB 2XE8A 3ESCA 2XZTA 4WVFA 4M86A 3C1ZA 4XW2A 3R5SA 3KK0A 1G4UR 3AOEC 1GZHB 3KYIB 1G9TA 4I9FA 1OXKB 5EMMA 3DF9A 2X1VA 3CSSA 3OY7A 1DBIA 4D9EA 9MHTA 2A5JA 3SVTA 2I4LA 1PFYA 4XJVA 3MN1A 4B75A 1KKLA 4RXMA 3LVQE 1F1BA 1YI8A 5LDDC 2O54A 2FG6C 4FNOA 1I3KA 3AU9A 5FTKA 4TSFA 1DHRA 1IN8A 3IT3A 3O73A 5FKJA 4B84A 4C7MA 3JQ8B 4WK2B 3RVKA 5LXTB 3P4UA 2AB0A 1AUVA 1OFUX 4GXJA 2UYOA 2XNHA 3D3JA 3G85A 2XBLA 3PYXA 3RYIB 4ZOLA 3TCKA 1W25A 4FU0A 2OUKA 1VIDA 2DRIA 3SEAA 5KNDD 5E4YA 1H0HA 1LPNA 5T7BA 5EFZA 3KTQA 1GFIA 2GAAA 3H2SA 4H6PA 4IQ0A 2GN9A 2VP5A 4H0CA 4UEJA 4BO5A 2I2WA 1E1QA 1JDVA 3F6EX 3K16A 1HPLA 3KPWA 3PHCA 4NPHA 3WB2A 4F6CA 4W5OA 3IDQA 2HUNA 2UVPA 3ZGXA 4NFLA 4NJEA 4JP1A 2KJQA 1EHYA 1NKCA 3ORSA 1Z45A 5JY1A 4KR2A 2AJ8A 2AFHA 4U00A 5F5XA 5HEKA 1REQB 1BRTA 4LYDA 4TQUS 1UEXC 1QH8A 1PJZA 2IP2A 1DRWA 2TRSB 3L8GA 3LKVA 3MCTA 3MJCA 4G0ZA 1O58A 4LSGA 3ABIA 3ZWOA 5KU7A 2DKZA 2P5UA 1JSLA 3WBJA 2ZJ7A 3ZY3A 2WAXA 2QROA 4AKIA 2HV9A 4FQ5A 4DLNA 5AICA 4FTWA 2YMQA 2C2DA 4IL6U 2QW1A 3KWLA 1TE2A 4UBJA 1JAYA 1EU1A 4FMBB 1NIJA 5JSZA 5A3SA 3BKWA 1D2RA 4UB4A 2LCQA 1JT9A 3LQ4A 4QHTA 3WQRA 5A6VA 4ND7A 2GK7A 3EPIA 3BE5A 1SUBA 1P60A 3N7SC 3LXRA 3VO8A 3VTKA 4ESEA 5JYBA 4C0QC 2B9EA 4NJOA 5BW4A 1HQCA 1QC5B 1Y8QA 1RYNA 3C6KA 4M36A 4IM7A 4BE4A 4EUNA 4ZCTA 4ZGGA 3HNPA 1W44A 1FDRA 4Q24A 1DHTA 3OO1A 3P2YA 2V7XA 3PGJA 4E11A 4BVJA 7ICQA 1S3FA 1TDJA 1NBME 2H7CA 4R3WA 5ALDA 2YRFA 5BV1A 1CHDA 4R1UA 2Q8NA 1PZHA 3RVDA 5D4BA 5DG7A 1CSEE 1YCHA 4PHFA 4TUYB 2Y1XA 4R8VA 3AB3A 4AN0A 4EAAA 4Q4JA 4O3MA 2I4NA 1JDUA 5ALTA 2GF2A 3GLSA 2ZG6A 5EHXA 1E0KA 1OGIA 721PA 3OZFA 1KYWA 3GXBA 1D4ZA 1NQ5A 4L8YA 2AK3A 3K1JA 5TPZA 5BRAA 1T0JB 1U2RA 2BW0A 4L3WA 4TRRA 2NRTA 2FP4A 4KO4S 1DFGA 4KLDA 3P45A 1GKLA 3LLCA 3ZV7A 4ZRDA 3WWOA 5AUNB 4X92A 1QTRA 3U9LA 5CDFE 3Q8PB 1SCNE 2VC2B 2XUFA 4LOKA 6PFKA 3FHCB 3I62A 1UM8A 2I3BA 4I4CA 5JCJA 3D31A 1INLA 3LVWA 2C57A 2GPTA 1O5TA 3KUCA 1NMYA 3EUAA 4H35A 2AVDA 3L0OA 4B74A 2FZ5A 2OBYA 2CEKA 2QRQA 2EFCB 1M75A 3DTNA 4LYHA 2YYZA 1UBSB 4P83A 2RHFA 5ELMA 3GU3A 5KFKA 5KYUA 1KJNA 5DEIA 5FOTA 2NU7A 5T3UA 1R4NA 2VYQA 3AEUB 3K31A 3NHMA 1Y6RA 2XOEA 4RTKA 4PR3A 3HBNA 3VISA 1H38A 2Q3EA 1GNQA 2C2RA 3KKOA 4M1EA 3CVOA 1C30B 1A9XB 3A31A 4GOOD 1DTWB 2C2KA 1JR4A 1WB6A 3L1JA 2KW5A 2GCGA 4CF6A 1DC8A 1KAHA 1ZU4A 1BPBA 3D0RA 3A9VA 5F1YA 4UUBA 4H0NA 1EQUA 5HF6A 2BQRA 3UBTA 1PNTA 1HNXB 5D5PA 2QG9A 1H4TA 1E3IA 4MEAA 5J2UF 3NM4A 1NOMA 1P4AA 1VLLA 5EIOA 1ZK2A 4YYEA 3BZCA 5K4LA 1M1ZA 1SXIA 4RPIA 3ZX4A 4CMEA 2Q5QA 2H51A 4DLYA 5A62A 5EUCA 2ETXA 3LUBA 2CFTA 2ZAIA 3OTQA 3G59A 2LPEA 1UOQA 4FX2A 4J7AA 1P9RA 2G88A 5D87A 3SHWA 4DJEC 4MP6A 2DAPA 3CX4A 1F2UB 5AVYA 4L07A 2E8NA 2C1ZA 1Y8CA 5DI9A 3IA2A 2RKBA 4EAQA 2JI6A 1YUNA 1OLUB 2VRCD 2X23A 3BULA 1HEKA 2ANBA 3DTTA 3E3AA 3G8AA 3L6DA 4I1RA 4MI9A 1ZESA 1NSTA 3KL4A 3AP2A 4U7WA 3A9CA 2PT5A 3DZHA 5LBTA 1EUCA 2PKYX 3R7WB 4DQUA 2BTEA 3HXTA 3PC3A 4CR6A 3FTPA 2QB5A 2HEGA 3K0BA 6YASA 4CETA 1RC8A 1XNQB 4CM9D 5LSAA 4RJ2A 3NPMA 4NCJA 5JH7B 2B37A 2H4HA 1GGKA 1VL5A 5G3ZA 1C4WA 1EFVB 4K9LA 5CVEA 3PW5A 1RHUA 5G53C 2YB4A 4C7XA 2D8MA 4NR0A 2UV8A 4LRWA 1RXUA 1RWOA 2IOQA 2R8YA 3DV2A 5PNTA 5I7AA 4I50F 2YDXA 1L0BA 5JRTA 1SVMA 3HABA 3T5MA 5BN5A 4XCXA 1U1CA 3HR4A 3EBLA 1YZUA 4EYIB 3NR2A 1LNQA 5TDHA 3TNJA 3UWDA 4CI0B 4XRGA 5FV4A 4BY9E 1E2KA 1TAHA 4HLUC 1FL9A 3OCWA 3EEYA 3P5BA 5M2QA 4CDMA 3W5UA 3MABA 2CBGA 4OX9Y 1N9GB 2WSSA 3JW8A 5HF9A 1OXUA 1Y5NA 3LZ6A 3IULA 3WLEA 1J2JA 1ODLA 1HNNA 2C5AA 3D2CA 3LPDA 1YHYA 3BHNA 4YRNA 4FKMA 4K6MA 1FBNA 1E94E 1JDPA 3SP1A 1W94A 3EJ6A 2P62A 4OOFA 4ACBA 1W4BA 4GMFA 5CM8B 2R1VA 3AM1A 2QE6A 2JAPA 1P39A 2PZAA 4GPIB 2ANCA 1SC3A 4M0UA 4MDYA 3DZKA 5C32A 4EEYA 5JQGF 3K70D 4FYWA 3WAGA 2QTWB 5B55A 3BXXA 1JF8A 5TZVA 2R96A 2JFBA 1XD8A 4J0QA 3VO9A 1IVYA 3BE8A 2PUHA 3OIWA 3QKRA 3CW8X 3KT3A 1OGJA 1I6WA 3CZMA 1R8YA 3K92A 3PX4A 4PNPA 3UGQA 4RTNA 2IDMA 3LYSA 2PKWA 1DAOA 3V2IA 1T2EA 4QZCA 3RKRA 3H5AA 5J2TA 5AJYA 3V1LA 3UAWA 1BVHA 1PR9A 3OCJA 5K3BA 4H15A 3UICA 1E18A 3LKDA 3FGOA 4AF6A 1SULA 1UZUA 3LUFA 4N40A 4DS3A 4JLAA 4UQOA 5A0FA 4OB8A 5EIEA 1K7XB 1QGDA 2OR3A 1GPBA 2X8AA 3A6LA 3WSTA 3JTMA 5IHXA 2C7GA 4CTJA 2QTBA 3PW4A 1HDRA 2A6PA 4MQ5A 3DC2A 3HXKA 4II3A 1N2GA 1CIPA 4FOSA 4XGIA 1NVAA 1VCHA 3LLVA 1I1NA 2VAWA 3EIHA 3C97A 3GLQA 3GRPA 4G2TA 1OI3A 1F2VA 1QANA 1ZI6A 3E0QA 1IH8A 1KO4A 2ZUSA 3OZWA 4GQIA 4DPMA 5B4VA 4GM0A 1SNYA 4F0JA 1LW6E 3BWYA 1SOAA 2R1TA 4RV9A 4J4HA 2DQYA 1LZLA 1RKUA 4UHCA 2YWBA 4UBCA 1M2VA 4GR9A 3GGGA 1LLCA 3H5WA 1N1MA 2O5CA 3FD8A 3GJ5A 4ZQGA 3SQNA 3C4VA 2AI1A 4RS3A 2A86A 2AEMA 4CKXA 2QD3A 5E9JA 3RKUA 1UMBA 3EZXA 3WXBA 3FKJA 5EQDA 4EL0A 1DAIA 3LTNC 2O5RA 1XRPA 4ZU3A 2BMVA 1ID8A 1BRMA 3V8MA 4NL9A 1YRYE 5KT5A 1Y0BA 4GX2A 2B4TO 4TZ6A 3N59A 2A1JA 1KL7A 1PU2A 2GD6A 3BUSA 2P35A 3IJ5A 3SAJA 2E21A 3W3AD 4TXMA 2O2YA 3BK1A 3JD4A 4LIPD 2OQ2A 4ZI3A 4M2YA 2C9BA 1KI7A 4L5YA 1R10A 4JASB 3SR6A 1O97D 1U1EA 1XNRB 3QVMA 4NYIR 1CY6A 4FVTA 1Q3HA 3DULA 3GEDA 5LVAA 1YZKA 3WNCA 2KV2A 4KPEC 4TPKA 3JYPA 1QHHA 5DTIA 4M9XA 1DAGA 4LX8A 5IULC 5DM70 1JVBA 3PTLA 4ARSA 5A02A 5CIYA 2E2WA 3RWOA 3CWQA 4CZ2A 4MIYA 4ND4A 2ODTX 2RGXA 4D74A 1KJQA 3GMSA 1BVUA 1OE0A 3QOWA 4L4YA 4BZQA 4MQEA 4K9QA 3S29A 3BXPA 4X1IA 5K8TA 1OU4A 4F4KA 5F2KA 2GTIA 4KFTA 1CJTC 2FEKA 1QR6A 1SXJB 4LZGA 1RJFA 2R8PA 3G2JA 3I5UA 3K94A 3PC8A 3U31A 4BQNA 5AI0A 1DO8A 1GVHA 1CUVA 1QP7A 3VZCA 5JVDB 2DUNA 5BV2P 4KN8A 3U9TA 3KR0A 3GLUA 4TWRA 2YZ7A 4QWAA 4PQGA 3S28A 3UCFA 1QU2A 5CB1A 1ZQFA 4FEGA 4PX2A 13PKA 4WKNA 3DBRB 3LC0A 3RUFA 3GUHA 1NFRA 5CHYA 1SBZA 1FLAA 5A3RA 1HMYA 2QPLA 1KLNA 2VSOA 4MQBA 1M1YE 4Q7KA 1C81A 1U28A 4C89A 1P1HA 4S12A 2RGGA 1HRDA 3AIMA 1E9RA 2Q3JA 2FPMA 1HTBA 1JHAA 1NQAO 2JK1A 3E8XA 2ZKLA 2OCIA 3KDSE 5ECDA 1JXLA 5G0WA 4JB3A 1JEOA 1Z0FA 3T9CA 5J4YA 4TZ0A 1L8QA 2PSJA 2EATA 2WU8A 3BCUA 1Z35A 1Y4DE 5K8IA 1MW9X 5CXQA 1GQFA 2CT8A 1P3Y1 2R6DA 3GJZA 1PK3A 4LRXA 1WULS 2RK3A 4GFDA 4OSEA 3ZVMA 4B3RB 1G3RA 1BXRB 1XZBA 2JFWA 2QDXA 3G9QA 4DBLE 4E5MA 2FGJA 5GONA 3IG8A 1EAYA 4YREA 5IJWA 4BCCA 1D1QA 1S4QA 3ZWVA 1U5CA 3DT6A 4UE6A 1FDUA 2KNJA 2PMCA 1WWKA 4AJIA 3MCAA 4DV0B 1OX5A 4QNNA 3SOZA 4YXWD 1T6NA 4IR9A 1PLKA 2N0SA 3Q9NA 1J2NA 4K6OA 4YQFA 1BXRA 4B9SA 3ZTYA 3BS5B 1U0JA 2QZJA 1H2WA 1JPVA 2YWEA 3INTA 3JQ9C 3DNPA 1ZN2A 3EARA 3FCAA 4V0RA 4B4UA 2YCLA 2RDJA 4RVCA 1SJ9A 4EI7A 1GR1A 4G8CA 5HF8A 5JT1A 5ER6A 1OX4A 1SKYE 2F3RA 3UVEA 3KVVA 3H6GA 3H0KA 3RUIA 1NVFA 3HR8A 5E2BA 5IKXA 3HHEA 2NZXA 2XA2A 4B3TB 1JSZA 1JHXA 1CVIA 1JG6A 3O1IC 3RSGA 3TX6A 3ZPXA 3RYFB 1I7SB 4KQKA 1RIIA 3L7OA 1VLHA 1T4CB 3KZIU 2AC4A 2HHJA 1GWNA 3TTVA 4CFZA 2BT4A 7GPBA 2HMWA 1YL5A 1KEEB 4NV0A 1ENYA 2FMUA 3KQVA 1QMGA 4GWGA 4IDNA 4EZEA 5A0VA 1AQNA 2Q1XA 4BMXA 1XMPA 1IJKA 2OYRA 2OV3A 4N8SA 4BWYA 4LHYA 5IJ9B 3I5MA 2VHVA 5LUAA 2HHWA 2XLCA 2HQBA 1EA5A 1JMYA 3IAXA 3LY5A 1VG0B 1YRQA 5LZ4A 2XCTB 4JCCA 1KAQA 4QDKA 4ALKA 4JVNA 1AB5A 3CISA 4FFDA 1II8B 3KKEA 4P4LA 5M34A 4TWAA 4Q15A 3RH5A 3BB3A 5ALIA 4PR0A 3ZXSA 3KUDA 4B3JA 1HLGA 4HDSA 5UKDA 2W6QA 1SBQA 1N92A 1XTJA 4AWXA 1Q91A 3CRVA 2QM0A 4RJIA 4B40A 5F1OA 4BKMA 2HOIA 3H1BA 4W1PA 2J6IA 3ANYB 1KSFX 3N6VA 3W9BA 4RA9A 3UKOA 4TROA 3OQIA 1JEQA 3KVYA 4P54A 4J07A 2GZ3A 2FN9A 3V48A 4GYJA 5DT9A 4RQTA 3PSIA 1WE2A 3QVTA 3VVMA 2P6RA 3P0FA 4Y18A 4YMTA 1UPCA 1EP3B 5CCDA 4PLZA 1E2FA 1X7GA 2D1QA 2IZ6A 2IYUA 1NK7A 3U80A 1SV4A 1FNSA 3GJXC 3M3HA 4PC1A 3UJBA 4OHPA 4PAWA 1AVTA 3FLMA 4GT1A 4MWOA 4OXXA 3TMAA 1QF6A 1H5QA 4KWEA 3SYZA 1JECA 4TYMA 5FTJA 2GUGA 2JZBB 3DE5X 2FPPB 3MMXA 4ZN6A 4DSAA 1XTVA 5CYFA 3RJEA 3BILA 3EVCA 5K3FA 4DS5A 2D4AA 2J07A 1JSXA 3TIGA 3G3EA 3V4VB 5B64A 1IHYA 3H1EA 3OMWA 3GJ8A 4G3XA 1W96A 1C14A 3Q12A 1UOEA 3R6LA 4MUKA 4AP5A 1JA9A 1W8DA 4AJJA 1PJLA 4O5KA 3OZUA 3FOCA 4ZDKA 5AVUA 2ACVA 1T5DX 1X80A 1LC0A 3ENVA 4KH1A 5GTHU 2BR4A 5F9HA 4KK3A 2GZ2A 5ETJA 5FA6A 1E3DA 3AIIA 3F9RA 3E7FA 4YAFA 1CPYA 1E4YA 1NZJA 2B35A 3I6QA 4P38A 4K46A 4BNGA 5CB4A 4OK5A 3T3IA 1TC2A 4KFCA 1QONA 2F3UA 4DY6A 5JZMA 1BXKA 2G5CA 3VR6H 4CV3A 4C4RA 1NTRA 1V7ZA 4Q4LA 4WZAB 1VG1A 2EKQA 3H4IA 4RVOA 3CLUC 2OD9A 1L5OA 1ZQUA 2HXYA 2V3VA 1TEXA 4GS5A 4HR7A 4JB8A 4L4SA 5IUKC 2BOVA 5CIQA 4CUZA 2BUBA 3FFAA 2UZ1A 2ZIUA 2MINB 2RGWA 3PHHA 3EIUA 5LYJA 5IWAB 2FLWA 2ZYVX 1PGQA 2BR0A 1M1YB 2GA9A 2WWWA 2Z4TA 1O0BA 2VDVE 1IOLA 4UQGA 3K8OE 3ZTWA 1V43A 2FEXA 2V6FA 2GBIA 3TOSA 2RHDA 3NUQA 3K96A 5FNZA 1KJJA 2AOVA 3F74A 1B41A 3UBMA 1K8YB 2ZIUB 2O06A 1ZK0A 1ZGCA 1Q19A 4JKOA 3QWHA 1KMCA 3DWGA 4QARA 1XQYA 3LIPA 3MLEA 2AGOA 2XD9A 2VK2A 1NKBA 2WDZA 2FPWA 3ZQJA 4C2UA 4IKOA 2C22A 1J9EA 2YY7A 3R09A 1LLFA 4XIGS 1YR8A 3DGEC 5IDQA 5L3QA 3OE1A 5IF9A 3SENA 4LRUA 2BTOA 4TRNA 4YQEA 3T9FA 2GD2A 4MJ7A 1AHHA 5A03A 3HZRA 4F71A 1Q15A 2QRGA 3AETB 1DTSA 3U0BA 5C0OE 3ZJ5A 3Q8QB 1NPDA 3NJRA 1QFSA 4C0KA 3G5MA 4DO9A 2GN2A 1YR6A 3LAWA 2OP1A 2WWTA 4D8WA 1DIGA 4PGXA 4CLRA 3JQDA 1FNBA 4DEVA 9LDTA 1S8OA 2X9QA 4HQNA 4J43A 2Q4TA 3K0AA 4IDEA 1EESA 4E3ZA 1B2RA 1PR6A 1GFSA 3MD0A 4YT8A 1OIVA 3NV9A 4DR7B 1ZN7A 5TGDA 1S8FA 1HDZA 3SLGA 4BC1A 2Z6AA 1QZXA 1ORIA 3EW7A 3ZZTA 3U60B 3DEJA 4LSWA 3MTIA 2DVMA 3IOBA 4D9NA 2WQ6A 4S1TA 3VXKA 2GASA 1QXSA 2ZB3A 1ZICA 3RNLA 4E5VA 1C0IA 2GEVA 3V4SA 4ZK2A 3GLFA 1TRKA 5JJBA 3ZDFA 3KOUA 3GVXA 2P7HA 4JBWA 2BMFA 1ZNYA 1WD5A 4P36A 3TIXB 5BURA 1NAHA 1T3HA 2RIPA 3FUVA 1T4DA 1PVRA 1P72A 3JAWB 3CCBA 1N2XA 2VF7A 2AH5A 4B6RA 1ZVVA 4KLHA 1XRNA 4LMRA 2UVRA 1N9KA 2VSXA 3VJLA 1YIOA 2GDZA 2YFYA 3A05A 3B1FA 4PO8A 2IBMA 3ZGOA 1SG0A 3GLFB 2C94A 4PLGA 2A5GA 1FMTA 3VGJA 2IPNA 1VDMA 1ISRA 4QHSA 1C29B 1QB7A 2JH3A 2ODPA 3W8FA 3X1JA 3RTVA 3BCHA 4G9GA 5A0TA 3K2QA 3HFJA 1A3CA 2UVVA 4NAUA 3KT8A 1QYVA 4BBJA 2QIOA 5FUXA 3K9QO 1C8KA 4I8IA 4IQUA 1Z7WA 2EVWX 4I8DA 4MVJA 4MKIA 1AQIA 5EMKA 4RIHA 4RVHA 3RGWS 5JNRA 4QM6A 1BHQ1 3DTVD 4W7SA 5IC6A 1I2CA 5EPOA 2V74B 3KOOA 2J5XA 3MWGA 3A58B 4CQNA 2LYHA 3T9DA 3JZMA 4QGGA 2FMIA 1CFZA 2BZ1A 2XDWA 3C3YA 3PWSA 4NBSA 5F3DA 2AF4C 4WZ6A 1VMEA 4L95C 4ZOLF 1U7DA 2O4CA 4OQFA 3KXLA 2RHBA 2WD7B 3JPYA 3T9EA 3ZE6A 2I4OA 2YZNA 3F7OA 4HGPA 4JP5A 5E6SB 5A7FA 1JG7A 2I5HA 2EHJA 5KFUA 1GLNA 4DZRA 1Q7GA 1QHGA 3HL0A 1NONA 1XCLA 3JYOA 1S2NA 2XY4A 5BMVB 3H42B 4ND5A 1MPTA 4NE7A 2XC9A 4Y0NA 2F3QA 3KB2A 2OBBA 3LFHA 1EBBA 4C2AA 1FXSA 5CFMA 4G1FA 2H65A 5BSGA 5KFTA 5G1PA 5M3BA 2DLCX 1KY2A 4DWVA 3SZOA 4CLOA 1WL8A 3CZRA 2FSHA 5JDIA 3T4XA 1HLDA 5CLJA 2OAGA 3ED5A 4IOKA 1LQUA 2REOA 3OOHA 1RM0A 5JE8A 3THOA 1BJRE 4P4TA 4V1CA 2AX4A 1HETA 5F3RA 4RVNA 4B34A 4LK3A 1SL1A 1R66A 1U49A 1YJBA 1QHNA 3M4NA 4H1HA 3SC6A 4RQ4A 3TOZA 4I2IA 4EITA 1LPPA 3CPHA 4JGIA 4MP8A 3AJDA 4KIFA 4YCMA 1IM5A 3C48A 5E1DA 1TYDE 2ZYGA 3KOZA 3D2LA 2YJ6A 3DMHA 3ZTTA 5KQGA 1LBTA 2RCNA 3PUKA 4KB5A 4P7GA 3TRHA 4FEEA 3KWMA 1RRMA 3O03A 4DXAA 2WSBA 3I2FA 4TXLA 1DEHA 3SAGA 1DT3A 3X43A 4B9AA 2QQGA 4F4DA 1E63A 1OLXB 1QJCA 4RYDA 5F3XB 2NWQA 3W06A 8ABPA 1BE1A 1E32A 1V47A 3CZCA 3O8RA 2KI5A 2Q1UA 1H6CA 2YX8A 1OFVA 4BO1A 4EJ6A 2F8SA 5CT4A 4AY2A 1RQ7A 3JQFA 4DMRA 1FFEA 1IXRA 5B53A 2Q2OA 4ER6A 1NXQA 2R97A 2KFNA 2ZI9A 3BWXA 4Q16A 4D99A 3OPNA 1JLLB 2M6KA 5EJFA 3V97A 1S89A 3L05A 3H9CA 2YW2A 4DADA 1AN9A 1T36B 2WF8A 1Y1TA 2ISCA 1X6VA 3EDOA 3GGOA 1NN5A 2BSXA 5JCPA 5MDHA 2KQUA 3NGXA 2OMEA 2FWMX 5KNBH 1T3SA 3TZKA 1YQXA 2H2FA 3O83A 3JQGA 4YRKA 2R8RA 3NAGA 1VPLA 4HEA1 5E6UA 4ASUD 3I09A 3ADOA 2FLNA 2Z8ZA 3BXOA 2NRWA 3V8BA 3L93A 3HDYA 1EWVA 2E3JA 3H87A 4NC9A 5FHRA 2CLOB 4P3XA 1E6UA 1J8YF 1NBHA 2H7VA 5A7GA 5ALXA 5IYZB 1U48A 4JSYA 5TMBA 1DCFA 1F4LA 1SU6A 3I32A 1DOHA 4RM3A 1XPOA 1GP2A 4Z0HO 5F5NA 4KXNA 2COEA 2PKQP 3D8UA 1ZQNA 1DADA 2J7KA 4GLFA 4OLJA 2VDNB 4RTMA 3FOAA 4D92A 4KGDA 3FROA 2ZANA 3O1JC 3CUVA 4M1OA 2GFHA 2ZUWA 1WXFA 4XIIA 1V8ZA 1VPTA 4ZVSA 4C80A 2RK6A 3MA0A 5HS6A 3INNA 2J0UA 2EW2A 2B78A 1MAAA 2R8KA 3DR3A 3UANA 3BB1A 3SS7X 1MG0A 3ZDXB 1RWWA 3MJHA 2DQSA 3JWIA 3GAMA 5J2HA 1CF2O 2IOYA 4QTUB 1V48A 4QREA 4QXPA 1W581 2Y1KA 5CDFA 2AE2A 2QA5A 3E5HA 4R2XA 1OBHA 3G82C 3W77A 3CGWA 2V6BA 2C2GA 5D8DA 1ZINA 1R8SA 1IVNA 1WDKA 1KNXA 3T7KA 3TPZA 1KYYA 3BGIA 1D1PA 3U5ZB 1LLQA 4MW7A 2DKFA 2ECFA 1KZ9A 2ODBA 1WCXA 3DVQX 5DHQA 5L95A 3C87A 3BTVA 4G0YA 4CNBA 3GJ0A 1J06A 1DC7A 1K4MA 2ZM5A 2DUUA 1T8YA 4QA9A 5GZ6A 4L6CA 3VYUB 4DRXB 5DASA 3CLKA 2KIVA 5HTKA 4BNFA 2DGZA 1TD9A 3DV0A 4XX0B 4LECA 1A0PA 2ZB2A 1IN5A 1LBEA 1I4DD 2G7MC 2HF9A 4JL6A 5G4KA 2HR1A 3HTXA 3TCXB 1QYXA 1ONOA 3VV2A 1Q6YA 2B8WA 5JUWA 4QZFA 5K05A 3PENA 4FSDA 3GZTB 1UFRA 2HSDA 4TKMA 3PT9A 3GNQA 4NCHA 1G8AA 3G2NA 4JJ7A 3C2LA 2IRWA 2XDYA 4LQCA 3TSZA 3UFXB 5GINE 1O6BA 1CNFA 2Q62A 3KR9A 2OWEA 2MT9A 2X19A 1CT9A 1Z15A 4H4EA 3T3FA 4PYRA 4RD1A 3M5WA 3AWIA 3FFWA 3AR9A 5E79U 1UKVY 3NIDB 3LI2A 1Y4AE 3CZQA 3URKA 5AHKA 2H11A 3ELBA 5JQGB 2G67A 2XRYA 4MUHA 5JZVA 4U9HS 1IAVA 4FE7A 3SYKA 3QEOA 3OCYA 3DXXA 2AX3A 2BCSA 1D8BA 3V6HA 2OZEA 3GH1A 4MYDA 4QBHA 4J9PA 4Q4HB 1YUBA 1PD0A 1YTUA 3MR3A 3G88A 3VQTA 3HFRA 4JVSB 4KQJA 2ZJ5A 2V5AA 3AVVA 2AOUA 2G83A 5JQGA 5DN6D 3L5KA 4FO6A 2Y0PA 2EDUA 1U9JA 3H11B 5L3SA 1BQ3A 3MWKA 2P65A 4HB3A 3BF8A 3GJTA 3M83A 3AT1A 1SEPA 1GNVA 1WG8A 1GQOA 1U0RA 2O6LA 2P9TA 2VUSA 4K2AA 2NZWA 3BDVA 4LGVA 4MPTA 4FT4A 2A9PA 5EWLB 3R7SA 4TVBA 3PEEA 1P2DA 4AZVA 1CDDA 1YD7A 2BGNA 2JHFA 3CSDA 3IBFA 3KE9A 2GESA 4WECA 4WRRA 4ENUA 2ZS9A 1NTOA 2IYPA 1GG5A 2RC6A 4MR7A 4AJHA 2QDKA 1T6YA 1M0SA 1JU4A 1C8LA 2HZ7A 1PJ4A 2K89A 2H5EA 4IVQA 4MGHA 3KSDO 3RJ5A 1B6TA 1SKAA 1VLZA 1FUIA 2QVZX 3BOSA 1AS0A 4AG6A 2AOXA 2FWJA 4LWZA 1VPVA 3WDLA 5HTOA 5JTTA 2AL7A 3GVHA 4ZWNA 1D2GA 3T6KA 2IP1A 1YVEI 5HMLA 1P31A 3KQTA 1YBVA 4OYRA 3UEOA 2FPOA 4QFMA 4RPZA 3HX0A 1VSTA 3SLRA 2WKPA 1J9GA 2O8CA 1RHMA 4PNEA 1ZRSA 1M8GA 1Q44A 4YI5A 5KQSA 1PCXA 2FKNA 1ZQMA 1X1CA 2N47A 4D0LB 3CF4G 3WADA 3JPPA 4MK4A 1ISFA 2BFMA 3TG2A 3L4BA 2I67A 5JTIA 2K8AA 2WF7A 4G5XA 4PRYA 4U7PB 3UV3A 1H65A 3VHXB 7ABPA 2Y8EA 2FZKA 4LRYA 2ESEA 2FK7A 3TD2A 2OO7A 3DXZA 1KFDA 1X9IA 3T7EA 4ZCRA 2CVPA 3PNQA 4MW2A 4H9GA 4RFLA 1I5OA 1IVSA 1PG2A 2WINI 9ICTA 4MQUA 3CH6A 5FIUA 3EOZA 1NE7A 3ABSB 3F53A 2E4YA 2Q99A 3JPWA 5ICEA 3EUB2 1P80A 1QVWA 1XZ8A 2N9UA 3SM9A 1ISGA 1OLSA 1ZRNA 1M6WA 1OWPA 1V7PC 2XDQB 3IVMA 1ZQXA 1JEYB 5BVHA 2VJLA 3P96A 4XTCS 4BUJA 4WL0A 3QGMA 4GZ5A 2G17A 1J1ZA 1H3FA 4LXHA 3K9WA 1ZISA 1O97C 2ZYRA 2JAQA 1N57A 1P33A 5C7LO 4AURA 1XTZA 1XZFA 1RADA 1YZ3A 2DF8A 4LE1A 3ZCQA 3C5EA 1D2AA 4A9AA 4HNGA 4B9VA 2ATEA 4CTMA 2JJYA 2BQ3A 2IZ7A 4KSCA 4BX9C 5SY6A 1KQQA 2LKDA 4G85A 1DKUA 2C4KA 3RI3A 3QX7A 3SBOA 2PRSA 4RIGA 1CUJA 3UMBA 3L8ZA 3D0OA 3LP8A 1TTTA 5F7JA 2H1HA 2W7TA 2MYTA 3DPUA 2RJNA 4GXTA 5IDVA 4RHUA 1ZQZA 1Z0DA 2HF8A 2R1TB 2EZUA 4X5OA 5BRJA 2AOWA 1ZVMA 1KJ8A 1D0IA 3JVUA 4O0MA 1FOEB 2VPWA 4OFWA 3NDPA 4QBTA 3B78A 1R1DA 2XE6A 3LC7O 5TQ2B 4CIAA 2BEKA 1XEFA 3AOEA 4G0MA 4IXDA 3RM3A 1UR5A 4E15A 4V1CI 3GY0A 4UEOA 4BZWA 3BGSA 4OMCA 3GZNB 4UUOA 5I9IA 1ZY2A 1KH1A 1OROA 2AN5A 1QB8A 2VBCA 1JL3A 1V9PA 3AY0A 3FUWA 3M49A 2QG6A 4MKGA 1GAQA 1P5ZB 4Y2HA 3ZYZA 4FJ2A 3ES9A 2OCPA 1ZD2P 2F6RA 2R6HA 3D8TA 4UHJA 2EGUA 4GKKB 1H5UA 1NJ8A 2AZDA 2PZGA 3IUJA 3HVIA