3NASA

The crystal structure of beta-phosphoglucomutase from bacillus subtilis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
207
Chain Sequence
LKAVIFDLDGVITDTAEYHFLAWKHIAEQIDIPFDRDMNERLKGISREESLESILIFGGAETKYTNAEKQELMHRKNRDYQMLISKLTPEDLLPGIGRLLCQLKNENIKIGLASSSRNAPKILRRLAIIDDFHAIVDPPDIFLTAAAMLDVSPADCAAIEDAEAGISAIKSAGMFAVGVGADLVVRQTSDLTLELLHEEWEQYRIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of beta-phosphoglucomutase from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Isomerase
molecule keywords beta-phosphoglucomutase
total genus 58
structure length 207
sequence length 223
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2010-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3nasA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3nasA01
1N9KA 4XOUA 2HEGA 3U13A 5AKEA 2BDUA 1Z5UA 4F71A 1U2TA 2P69A 3E84A 4I9FA 1EK2A 4YIKA 1QQ5A 4ZEVA 3AR9A 4UU0A 3ZTYA 4NAVA 4YH1A 5AVVA 4ZEXA 1Z4NA 4UATA 3BA6A 2PKEA 5ALGA 2JAWA 1F5SA 2EATA 4J03A 5AI5A 3FPBA 3J7TA 2P27A 1SWWA 2YMQA 3WK6A 3UMBA 1Q92A 1S2OA 1U2SA 2I6XA 1Z4JA 1TJ3A 2O9JA 5AVQA 5AW1A 1Z88A 2IOFK 5AVUA 2JAUA 5AIAA 4B6JA 3KC2A 2JARA 3KZXA 3U7GA 2YY6A 4OCZA 4BNDB 1QQ6A 4H1WA 1K1EA 2YJ5A 5ALTA 3AR8A 4YGYA 3L0BA 3OCVA 4BEWA 4BBJA 5AW3A 1U7OA 3UMCA 3N07A 1TE2A 4NFLA 3OTQA 3L1UA 4FE3A 2W4MA 3EPRA 1FEZA 3PDWA 2HCFA 2YMLA 5AI8A 1ZS9A 1VJ5A 1YNSA 2WHEA 2I7DA 1L7PA 2NO5A 3ET5A 5ALKA 2R8EA 3FGOA 4Y2TA 5AI9A 5FP0A 1QYIA 4NV0A 3ESQA 2IOFA 5AIBA 2D2VA 1RQNA 5AKZA 4Y2RA 3L1VA 1T5TA 3L8EA 5AK4A 5AKHA 1N8NA 4J2TA 5ALVA 2G0AA 3HLTA 3U19A 2RB5A 3IB6A 2NO4A 3DV9A 4UAUA 2I55A 1XPJA 3WK4A 1U7PA 3I76A 5AW2A 4FYPA 3W5DA 1L8LA 2OBBA 2C9MA 3ZU6A 2RAVA 2YJ3A 2HSZA 3QGMA 3SKYA 5AHXA 1Z4MA 5E0OA 2GFHA 3I28A 5AI6A 2YMPA 3OCXA 4EX6A 2AH5A 3L8FA 3QU9A 4CF3A 2FPXA 4OD0A 2Q4RA 3QUCA 4CF5A 3FPSA 2FEAA 3NUQA 1RC8A 1L6RA 2WF8A 4EENA 5IT0A 3ZVMA 4MUMA 5AKGA 3U26A 2ZOSA 4BYGA 5AVSA 4JB3A 4O8CA 1ZD3A 3QUBA 3QU4A 5AW8A 4Y2JA 4Y2YA 2W43A 1U02A 3EF1A 4DFDA 4Y2SA 5ALIA 3S6JA 3SLRA 2GMWA 3NALA 3QUQA 4HYTA 3QU7A 1ZD5A 3B9BA 3GYGA 1Z4QA 1ZOLA 3ED5A 5ALHA 1T9ZA 2IYEA 4YIHA 3UM9A 3MMZA 3A1CA 3MN1A 1RKQA 3L0CA 3L5KA 3FM9A 5AM3A 3WK9A 2I34A 1NRWA 2OM6A 5AM1A 5AKLA 3WKAA 2YJ4A 1ZD4A 4HGRA 2R8XA 3DDHA 4AS2A 1MH9A 2Q5EA 2FPSA 2C8KA 3MC1A 3QLEA 2AUTA 2C88A 1RLMA 1J97A 5AW9A 3ZW7A 3K1ZA 3SF0A 3QNMA 4Y2UA 1RKVA 4AP9A 4JDPA 5ALFA 3WK8A 3PGVA 4OHFA 3WKDA 4BEVA 4BNDA 2AMYA 5ALXA 3ONNA 4HGPA 1S8OA 3N1UA 4KX3A 5IT4A 2MU1A 1LTQA 2P11A 5IS2A 3VAYA 4KYTA 3QU5A 1CQZA 5ALRA 3NAMA 3N28A 4L6CA 3L8HA 5AVZA 1RLOA 2ZBEA 1Z4LA 4FFDA 1QH9A 5AW4A 5AW7A 4E88A 2X4DA 3R9KA 1L7OA 1X42A 2B1RA 2WM8A 3P96A 3PCTA 3QUTA 2AGVA 3ZVNA 2GHQA 5AI0A 5AVXA 2P9JA 3AR4A 2FUEA 4UM7A 3QX7A 5A3RA 5AKXA 4EZEA 2G07A 3MPOA 3WGVA 1Z4KA 3NRJA 5ALNA 4BX3A 5AK5A 4Y2PA 3A3YA 3ZWDA 3ESRA 3ZVLA 2G08A 2HF7A 5AESA 2VKQA 4OFZA 5AM5A 1YMQA 2FDRA 4YCMA 2EARA 1IWOA 3AR3A 2ZBDA 3OCZA 2WF9A 4NWIA 3W5AA 4Y2XA 3IJ5A 5ALPA 5AM2A 5AKJA 4ZEWA 2YMMA 1PW5A 1RPZA 4UU1A 4IFTA 1XP5A 2HO4A 4C4SA 1NNLA 4DWOA 3WK7A 3QU2A 2B8JA 1Y8AA 1L7MA 5ALDA 1WZCA 3M9LA 4HGNA 2ZBFA 1J8DA 5ALJA 1TJ5A 4Y3UA 2B82A 2JAOA 1WVIA 3WGUA 3KOOA 1L7NA 3L0YA 1YJ5A 5AI4A 2ODAA 4CF4A 1RQLA 1RLTA 2FPWA 2CN1A 4MWOA 3SMVA 4NABA 5ALOA 5AVWA 4EX7A 2ZBGA 3B9RA 3SD7A 4I9GA 2GO7A 3ZX4A 2CFTA 3NANA 4AS3A 2YBDA 3U7HB 5ALMA 2OYCA 3ZWKA 2WF6A 1JUDA 2FPRA 3RFUA 3L7YA 4XQ0A 3WK5A 1ZD2P 1RMTA 3CZ4A 2RARA 1Z4OA 5A3SA 2I33A 2C8LA 1VJRA 3SHQA 4HGQA 4BX2A 3ET4A 3UMGA 4C4TA 2NYVA 2FPUA 3OCYA 2HOQA 4KNWA 2O2XA 3SKXA 4KN8A 4GIBA 3R4CA 3OPXA 2FUCA 3D6JA 4RETA 1Z5GA 2G1AA 2Q4TA 2W11A 3I1YA 2WF7A 4UMVA 5AICA 3KDPA 1QQ7A 5A3QA 3A1DA 4UASA 2WF5A 3QXGA 4UM5A 5AW0A 5AVRA 3WKBA 1WR8A 2IOHA 4Y2QA 1WPGA 3A1EA 4UMEA 4F72A 1VFPA 3AR7A 5AM4A 2R8YA 3B8EA 4XPZA 4G9BA 4PNHA 3AR2A 5JJBA 1NF2A 1O08A 2IA5A 1TJ4A 1T5SA 3OCUA 3BWVA 3OCWA 1RMYA 3EF0A 3TLMA 2YFYA 4BX0A 3ZI4A 2ZG6A 4IG4A 5ALLA 3WKCA 3W5BA 2G80A 2BDEA 1Q91A 5AW5A 1XVIA 2PQ0A 1RMQA 2YJ6A 5AW6A 3IRUA 1L8OA 5ALYA 3W5CA 2HDOA 1SU4A 2I54A 3R09A 1CR6A 2MU2A 3PGLA 3RF6A 4Y2VA 4HGOA 3NIWA 4KX5A 1Z4IA 5AKKA 3ZX5A 5ALQA 5ALWA 3NASA 4C4RA 3L8GA 5AM0A 3HYCA 1ZRNA 3EWIA 2HF2A 1ZJJA 4BKMA 5AVYA 3N5KA 2JGAA 4UMDA 1RKUA 3U7EB 2FI1A 1TA0A 4UMFA 2C4NA 1EK1A 2RBKA 4L57A 4HAIA 4QQFA 2WFAA 4DW8A 2CFRA 4CE6A 2B1QA 2EAUA 2R8ZA 3ZUPA 3KBBA 2B0CA 2HX1A 3F9RA 1KYTA 3KD3A 4RESA 3CNHA 5AVTA 4XE5A 3QYPA 3ZTWA 2B8EA 3E8MA 2QLTA 1YV9A 2B30A 1O03A 2CFSA 4L6AA 4EEKA 2GHTA 3AR5A 2HI0A 4UARA 3DAOA 5AKIA 4CNQA 5ALEA 1SWVA 3N8GA 5ALZA 2OA0A 2G06A 3AR6A 5T41A 2MSNA 3WKEA 2DQSA 3E81A 4UW9A 3U7FB 1ZRMA 2G09A 5AK3A 4QJBA 2ZXEA 4DCCA 1YS9A 2YN4A 4UAVA 2PR7A 1RDFA 2QYHA 4EELA 5AKYA 4GXTA 4YCNA 1AQ6A 3I6BA 4YCLA 3E58A 3DNPA 1Z4PX 3FVVA 3M1YA 1YDFA 2BY4A 3FZQA 5ALSA 1RRCA 4KNVA 2HHLA 1LVHA 5ALUA 5AK6A 4G63A
chains in the Genus database with same CATH superfamily
5E2BA 2CK3D 3OQMA 4REOA 2K60A 5D7BA 5BORA 1J0DA 1DX9A 3LUFA 4RD0A 4ABYA 1HO3A 3D8UA 4FXPA 2XTJA 4ZI2A 1OYOA 2OP1A 3OU7A 2GZAA 2IU4A 4F71A 1DCTA 2XUFA 2UZ1B 3PQ3A 4EPTA 4Z3KA 1SKAA 2PXCA 5JH7B 4Z8YA 5LWHA 3HRHA 4J9PA 1CUYA 5AVVA 3H04A 3T3MB 5LQKA 2HA5A 2W9XA 3C6BA 5ALGA 1Y5IA 3ROEA 1SPBS 1XN1A 1NMXA 2GYYA 5FI5A 3KR9A 5GONA 3TZHA 2JIDA 2EATA 3I42A 2VJQA 4DM7A 3DMDA 3WK6A 1U2SA 2XVMA 3OPQA 1ISGA 2GN2A 3O4JA 3H5RA 2YB4A 1E63A 1RWNA 2E4VA 1Z88A 4OKIA 4EEYA 4UQOA 5AIAA 1ZYQA 4IUDS 1U7XA 3OD1A 4J6FA 2YASA 9ATCA 3INNA 2O5VA 4QYSA 2C5BA 2ZWPA 1VIAA 1C3EA 4JC0A 4M8SA 3DC7A 3U7GA 2ATCA 3ZOZA 4IH1A 4NDAA 2LDXA 3R7BA 3HZZA 4EIWA 1EHCA 3AONB 3NTLA 1GPDG 2Z6VA 1JXOA 2WD7A 4JEUA 1Q3KA 4F50A 2OEPA 4IFBA 3N07A 2WOJA 3COVA 5KQRA 3OQNA 3C3MA 2PBFA 2WD9A 4OQZA 1N92A 1CUDA 1FEZA 2PX8A 3DAFA 3EPRA 1ZI6A 3EUWA 4N0MA 1PRYA 1DLJA 3AU8A 1ZS9A 4L76A 4DDUA 4BMZA 3N7RC 5J0PA 2YS6A 2UZIR 3SZGA 1L6IA 4JBWA 1XSNA 3O83A 4U63A 4DLVA 3QX8A 3G17A 3THXA 5CFRA 1Z18A 1ZQ1A 5E1BA 5TS2A 5HKAA 4OB6A 2QAJA 3GJ5A 1U2EA 4EPRA 3FPEA 2A1TS 3OMLA 3K1RB 4CG1A 4O4LA 5U1PA 3L1VA 3VI4B 5IXJA 2OHHA 3W2IA 4HVLA 5K7SA 3AF2A 4B81A 1CY8A 1B3BA 3EVFA 2EIHA 3MCTA 3T3PB 7ICHA 4L02A 4EY5A 1RAEA 5DXFA 3WGHA 1SCJA 3FLEA 1CUZA 3MR3A 1IULA 4MR8B 2B2XA 1K08A 5J0YA 1GPAA 1OLXB 1NLFA 3IP1A 1JXLA 3RYFA 4JP2A 3NS7A 4V0MA 3SS7X 4B9EA 2RG1A 4AJ4A 2FMUA 2BGLA 1CETA 5HF6A 1AKEA 3IOYA 1KORA 4X71A 1EGQA 4ZDWA 3FGZA 4Q4AB 4E21A 1RM5A 1R4NB 4N3CA 3TFQA 3ZU6A 2WB1C 3GWGA 1JEJA 3I1JA 421PA 3MTEA 1P2GA 4HDSB 3OH8A 2H3IA 3TANA 3NORA 4A8EA 2ZJZA 3UK1A 4FDUA 5BSEA 1K6XA 2MUTA 1XAJA 3QV2A 1XJWA 3TS1A 1FTWA 3EW7A 3W3AH 3DB1A 2QD3A 1WMEA 3JU3A 3ZE2B 1BC5A 4P0QB 4DEZA 2C8JA 4IXDA 4HUQA 3T7KA 2AC2A 4H27A 4IHJF 1OD6A 3V6HA 2E87A 1VRVA 1YRLA 2QZ4A 3EXHC 3FPSA 3FTFA 1BG6A 4PO1A 2CGEA 3QLVA 3SYMA 2OBXA 1L5LA 1GCIA 3DD5A 3IBCA 4WZZA 4HADA 2AEFA 5HBGA 1PFVA 3R23A 5LQAA 4R64A 1K7FB 1NIJA 4DLSA 1HGXA 9ICHA 4G1CA 5L1KA 4RJJA 3TTTA 4F46A 3GP8A 1KFKB 1Q8KA 1W85B 4JUBA 4DMRA 2IVZA 4KAJA 5B5SA 1BAPA 2B6GA 1Q3HA 2EW8A 2IDZA 3ROPA 1HV8A 4X7RA 4YR3A 4BC1A 1EVYA 1TMGE 1VSUA 3ANSA 4TLEA 4Z9BA 4F21A 3O84A 3RUDA 1AG9A 3MTDA 1F0PA 3WE7A 2C31A 4DFDA 3EOAI 1MOZA 3LM8A 3EGVA 1GPNA 1Y4DE 3SLRA 1N0IA 4J0FA 1NBHA 3H0RB 4FZ3A 4AKSA 3EC1A 2IH5A 1XL0A 1FTSA 1MKYA 4TMTA 1BPXA 1AGYA 3HNOA 3WWCA 3K30A 1LB1B 3HUDA 2COUA 4P4SB 4XD7A 2PGDA 3DBHB 3TLYA 4CMKA 1P33A 4QQKA 5EMHA 4K81B 1QZTA 1NN1A 1P6QA 3LYHA 1ML4A 1NXPA 1ZJ5A 2HRCA 2JKYA 1BQ3A 2EFDB 5TDHA 1L1FA 2GN6A 3MTAA 4EPXA 4F2GA 2A5LA 5DE3A 1N5RA 2JPDA 1XQ9A 2PUGA 2P41A 4LYDA 2YUIA 1ZGJA 5IC4A 3WKAA 2OD9A 1Z8DA 2PUCA 1EP2B 1PGNA 2UV8A 2HUPA 3CPEA 2C2MA 3EHEA 5KYYB 2R8XA 1GFIA 2C28A 3A3NA 3QWIA 4FUTA 4Q3LA 4EPVA 1T8EA 4O4JA 1UT6A 1SKYE 2P4EA 2YXPX 5AH0A 4YMUA 3KFUF 2B21A 1YGYA 1M6WA 2FE1A 2QENA 4Y6GB 4GF5A 2BGIA 2C88A 1NI4A 2WIKA 3CZAA 2BEJA 1BKYA 4LZWA 3Q7PA 2ZIUB 5C2JB 1L3CA 3E7DA 3TL3A 3IBFA 2JF0A 3K6SA 1MO6A 4I9NA 2J4FA 3IMKA 1ZXXA 4MR8A 1XR3A 2I1WA 2BCRA 1EDBA 5CM9C 1JQEA 1PEYA 3E3MA 4IJKA 4OGGA 2O2EA 1TTPB 2P1RA 3BORA 4I50F 5EC8A 4ZC8A 2QX9A 1LSOA 3OMXA 1NI5A 4MRMA 1P5RA 5JARA 1B1CA 1D0VA 3LLSA 4NU5A 4GRDA 1V45E 3N6VA 4LNHA 4AYWA 1DAGA 2O6LA 2R8BA 3JPRA 1O9GA 1XA3A 4MMXB 4IGFA 3RTEA 1BPDA 5DBCA 4C7VA 4D42A 4DNOA 5JWOA 1U8YA 5J1TB 4W8GA 5PNTA 4OHZA 4RPCA 1V7CA 1A27A 1C81A 1JDSA 3IAUA 4JBXA 1GTMA 4Y0VA 5A7HA 4BFWA 2FU5C 3H13A 4L4SA 4DA7A 4EKNB 1EUYA 3I62A 4NQZA 2QV7A 3AERA 5CHYA 4UHFA 3MTIA 1RADA 3BD8A 4I66A 4QOFA 1B22A 2ECPA 4LQLA 3KHGA 4TTSA 3EA0A 4MGIR 5A3RA 4CLOA 3QPBA 3E22B 1RP7A 1W4BA 3S2FA 4UUAA 2E85A 1F0YA 3BSFA 1UK6A 3FSEA 3G0GA 3BT7A 2FSVC 2LGJA 2ZFUA 4Y98A 3M82A 3ZDRA 4LC1A 2A5YB 3ZW9A 1WCYA 1XPOA 3HU2A 4H3SA 5DP1A 3GLHB 1JHDA 1Z5ZA 1W5AA 3CXUA 1DX6A 1K3FA 2P5SA 2B7LA 4D96A 4DLRA 4PLWA 2PRSA 1SXJA 3RARA 1W0KD 2B1IA 3P2MA 1RQRA 4JUCA 4XR4A 3VDMA 5BSWA 3GLQA 1XC7A 3O4RA 3K71B 3FR7A 1W4LA 3Q5GA 2FDRA 3MGAA 3KHHA 1ZJYA 4M46A 2ZW9A 4DL9A 3C74A 3RT9A 4MDHA 3WGMA 3H9GA 3K2BA 1ZWKA 1C4XA 4P3OA 4QO7A 4R8LA 2YMMA 2L18A 4W7IA 4ZEWA 4EA9A 4Z5XA 5C7OO 4JI0B 3AUYA 2GM5A 4B46A 1PU2A 1DZ3A 4FJ1A 4MUNA 5K9ZA 4C2UA 3WYEA 2Q3JA 2W2LA 1JEOA 3ICCA 5DLEA 5C1BA 2XUKA 1P2VA 1Z6GA 2YUTA 3MIZA 3MT8A 5DF1A 4E2FA 1TXGA 2QNRA 1SBNE 1S3SA 3GVHA 1HZZC 4MGYR 2I6UA 1LNSA 2Y2VA 1U5BA 1MO3A 3MFYA 1T15A 3MUOA 5E3JA 1A9RA 1P4GA 2HZBA 2KI5A 3EG5A 2IYPA 4MR9B 1SBQA 3FNBA 1LW6E 3OZDA 4N8SA 1E69A 4IRUB 1ZBDA 4BNLA 1RXSA 4EFNA 1K89A 4Y3UA 4IUBS 4M53A 3FSGD 3HY4A 2G9VA 2KHZA 3QTLA 1T2UA 2EJCA 4AIRA 2GZHA 5LA6B 3O8CA 2VP6A 2ZJBA 5DU2A 4DILA 3NOVA 2LIVA 3RADC 4O5EA 1OXUA 3G7SA 4QJ4A 1KARA 4O3PA 1ZQOA 2W2KA 4N82A 1XWFA 3E15A 4UEWA 2F67A 3GJ7A 3BIFA 3O91A 4I5IA 4KH0A 3QBJA 1JB9A 4LWPA 1N4AA 2H0RA 3SG0A 4QZVA 5HE8A 3SPXA 2LMRA 1HA3A 3VR0A 1YS1X 2BFDB 5REQA 2RAFA 3WNBA 1NVXQ 1WP4A 3Q7TA 5JSYA 2ORWA 3T4XA 4CM4B 1T2FA 3NUZA 3FCCA 1Y82A 2JBAA 1BX0A 3SZ2A 4DDVA 3K4GA 4PCUA 4MV7A 3R7AA 3LX5A 1E66A 2VF8A 2IODA 3OFSA 3OVMA 4BP3A 3ZD8A 5CMLA 5J4YA 3OZAA 4QDKA 5DFAA 5FX2A 4G23A 5J43A 1JNYA 5KAPA 3HCBA 1SBZA 3T06B 3W9BA 4TUQA 2C9OA 2WWFA 5KNDH 4XM2A 1AHNA 2C22A 2ZCJA 1JLLA 1LRKA 4HDMA 1V37A 4PBRA 4Q6WA 4I6GA 1I6MA 1ORRA 1TL7C 2X2EA 4B8WA 3V1KA 3WK5A 2KKPA 3TVDA 3QVKA 3ZW8A 4UQLA 2BTOA 2OGWA 3R3ZA 4HQ0A 2VHXA 4NESA 1G7TA 4H16A 1S9HA 4PCVA 3P9QA 1R4NA 4B0PA 4IKOA 2ZUSA 3I73A 4C0KA 1R0KA 2H2GA 5FUBA 3RG8A 4UQPA 1XZJA 1OLUA 1I51A 2DHRA 3RYCB 1Y1TA 5EY5B 2CMGA 4R1TA 4JC8A 4G4IA 2CYAA 1TUBA 1R66A 4HLUC 5DBBA 1T8WA 4LXYA 1E1CA 1NNUA 3E9CA 4P82A 4HC4A 4AUMA 3PI7A 2IEGA 5DLQC 2C5LA 2WAAA 2X3UA 5EFZA 4C0WA 3L82B 1TJYA 3GXOA 4M9SA 1WPGA 4U7TB 5BSFA 1PCXA 2FE4A 5HRUA 1C8KA 2AC4A 4ZVSA 4ZOLA 2M6SA 4TUYB 1GR0A 1IJFA 3EDMA 3ZD6A 4IOJA 4YJDA 4C3VA 3VHXA 1H0HA 1TZBA 3QELB 1MN8A 1S7GA 2R7AA 2VXOA 4QYIB 3HR8A 4MUFA 1COKA 3HW8A 1NF2A 3HB0A 1N3LA 5MN5A 5J2TA 4GXRA 1X86B 1C2TA 4HR7A 4DRXA 3H2BA 4JR1A 1LPPA 2NQ8A 2CV0A 4R2JA 2WMOB 3G5UA 4GM4A 4MVJD 5BXYA 1V2HE 2XJ9A 2R1VA 1KRPA 1Q0QA 3EZ6A 3DZIA 4QJFB 1Z12A 3QVMA 5LXTB 3P97A 3L0ZA 2JKVA 5LLDA 4BFSA 4I2CA 1LDMA 2HMYB 5K99A 5CB4B 1M6VB 4HDQB 5EE5B 3V7FA 2HU5A 2W2QA 4ZIRA 4DIOA 2BMVA 2IZ5A 4HEA6 5ICCA 2ZYWX 5FTMA 3TNDA 2ZIVA 1R0ZA 3NT5A 3K8QA 1C1XA 4OKSA 4RSMA 1M66A 3ABRB 4HDMB 4O0IA 3GMIA 2CUZA 4U39A 5LMNB 10MHA 2IY7A 1GRCA 2OPBA 2X5KO 4U5QA 5H4GA 5IWAB 1RABA 3ZY3A 3JWEA 2ZULA 4PHAA 3WLPA 2G77B 1H66A 3PUIA 3QIAA 2C2HA 4QTZA 3I9OA 3F7TA 4V0RA 2DFLA 2I54A 2Q6VA 3GC6A 4E2XA 4LF6B 2YWCA 1EFVA 3FPKA 4B4WA 2D6FC 1TZ2A 5E9AA 3CPSA 5B7GA 4QZDA 3WGIA 3JYHA 3L3FX 3CLTD 2BRUA 1BFDA 3CW2C 3HZRA 3PITA 3IUYA 1Z4IA 3VHRA 2CXHA 2FHPA 4WK2B 3RK4A 3UEOA 1U8TA 3JASA 1G59A 2EZXA 5BPCA 1VPLA 3DHNA 1DFHA 4RKEA 4BJHB 2C7OA 2D1FA 1QGDA 2E4YA 2A33A 1Q5PA 3QKRB 4PPFA 2HHUA 3EZLA 3QKIA 2NO9A 4KIFA 1CRWG 4UTRA 2EJVA 1BCRA 2QW8A 3DZHA 3QEJA 4BPRA 2BUAA 3NEAA 3RRGA 2I9GA 3ONDA 2HVIA 4DSOA 3KSMA 3UJAA 3TKAA 3IAAA 2VDVE 4PINA 3VR1A 3ZHOA 2ZSEA 5I7EA 3O0FA 1GAQA 2CEAA 3CX8A 4O3SA 1IZYA 1P3Y1 3KYCB 4GP6A 1NKCA 4MF8A 3B38A 4UDXX 1QLHA 5KT3A 1N7IA 1QKIA 4L57A 1QQTA 4IY1A 3V55A 3HI6A 3JAWB 2WFAA 1N1EA 4XOIA 4CKBB 2ZUWA 1BE8A 3FNRA 3CIFA 1RIFA 1TEHA 3F71A 4RELA 4AF7A 5KFXA 1CUVA 2O2JA 3B7WA 3OTOB 4AS1A 1Q14A 1W25A 3H2ZA 5IJAA 3KAJA 3R6GA 1YFKA 1SXEA 2P68A 3B36A 4HV4A 4M1SA 3KD3A 1RZUA 2XYGA 1KMNA 4MV9A 5DZSA 4EBEA 1MJFA 4XE5A 4W1PA 3T5BA 2KMLA 3NDIA 1Y48E 3WBJA 5E7JA 3CWQA 3GP5A 2B30A 4KODA 3M8RA 2CFSA 3HWSA 3JD1A 2OK7A 4HBGA 3K6KA 4L16A 4L6AA 1ZQKA 4TTAA 3IT2A 5A62A 2Q0XA 3C48A 2ZYDA 4FC6A 1BQ4A 1IC6A 4RU9A 1E1DA 2ET6A 1P0IA 5ALZA 3QYFA 4JNCA 3HKEB 3IP4B 1NR5A 4O02B 4UAGA 3AUOA 1Y98A 5HZKA 1G16A 4LJKA 2O5EA 3DWGA 4Z9AA 2CL6X 4HB4A 4E46A 2P2DA 4LPSA 4F5OA 1A8PA 3RC9A 4CDRA 5AK3A 4F3OA 3AX6A 4Q3DA 1NHWA 4TVKA 2NGRA 2PH3A 3BXFA 3TTSA 3OAAA 3L2OB 3F5QA 5J4VA 1U11A 1YQUA 2P9GA 4UPDA 3BH6A 2VJKA 3L9XA 3OZGA 1Q95A 1JHXA 2GNPA 3AERB 3STWA 2A8YA 4TVOA 1BMDA 2FVYA 4UQGA 2YB1A 1L3TA 1BMTA 4G0NA 1YJBA 4FDLA 4MVCA 5FOXA 1G21E 4UAZA 4IW3B 1YDFA 2VP9A 4DBLC 9ICTA 4DVJA 3MNFA 3VKVA 4EDHA 3I04M 3K31A 3K9HA 5ECYA 2C5HA 3U4IA 2WUVA 3V3KA 3W9SA 3JY6A 2QR5A 4XI9A 3IVCA 2Q50A 5JRDS 1J2NA 2H0AA 1QOPB 3L43A 1YC5A 3L6CA 2HMSA 3OLWA 4R1QA 3ZDCA 3D4PA 5L1LA 3UUGA 5SY6A 5I01A 3V8BA 5E9WA 5PGMA 4S0XA 4MINA 3H1PA 4AQDA 3TZCA 4EJMA 2IS1A 1B3RA 1Z5UA 2W22A 3IUSA 3KJQA 6GPBA 5LLSA 4BHTA 5CIWA 1A8IA 2I9PA 3KAQA 4KWHA 5KYVA 4JJGA 2Y0PA 4BJ1A 4IHAA 1OFVA 1AGRA 3KQHA 2DR2A 4NARA 4M37A 1PN3A 4TMFA 3WLQA 3LC7O 3V46A 4DMUB 1XG5A 2ANCA 2O1XA 1V11A 4F5ZA 2ROQA 4JLKA 1N2SA 1BPEA 1NXQA 3HMQA 5K3CA 4ZTBA 3ZGOA 1CEQA 2LR0A 1EA7A 3BWEA 4GL4A 4MA0A 3RU7A 1YR2A 3WHLA 4ZQFA 1JPJA 5EUQB 1APBA 4FYWA 3CUKA 1IRIA 1UT5A 5TZVA 2XUDA 4MICA 1NZFA 3E0XA 4CTJA 1TJ3A 3P94A 4US9A 5E6UA 2FSHA 2PWAA 1TCUA 2AG0A 2G8NA 4B6JA 3E5RA 3H75A 4WX2B 3PLRA 1AGXA 4BS9A 1Z2OX 2A0KA 4G97A 5SV2A 4DJAA 1A71A 1ETUA 1UBOS 5DB4A 3DBHA 4EJ6A 3O4FA 1WMDA 2AOUB 4YACA 4BUJA 5ALTA 1GPH1 3Q3IA 2QZSA 1CULC 2QUBA 4WZAA 3MR2A 2WKRA 3GO4A 1BE0A 1LK0A 1KYVA 1N61A 4IDPA 5LD2C 4Z4IA 2Q8PA 5D87A 2FUKA 2E5WA 4Z9YA 4DWVA 1MFPA 5IAEA 2GH1A 1WD5A 3C8HA 1A1VA 4NFLA 4UJ3A 3W1WA 4FE3A 2E7ZA 3GT7A 4YP3A 1DAIA 3ZDBA 2NTVA 4I4CA 3RRZA 1U8CB 3ZWYA 4A8TA 1YHZA 5ICEA 1VJ0A 1ODFA 1BO6A 1BJKA 1QE5A 1FDOA 2H3QA 2EBUA 3CRNA 2Z9BA 2QB0B 1XWIA 3SIXA 1I4TD 1VL0A 1YBFA 3UICA 2H2HA 4DDWA 4NZOA 1W7AA 4Y2TA 3ZJUA 1L4HA 5LLTA 2WSSD 3ND8A 1DGJA 4H3HB 4IOMA 1RFGE 3ADDA 1N0VC 1CEZA 1TQ8A 1JDVA 4L5YA 3ZLJA 1WMBA 4FSHA 4DZRA 4QFCA 1QNFA 4IQWA 2PRZA 4P58A 4M04A 5HKBA 4MTCA 1S0UA 4QVKA 4GXIA 2FEKA 1QZZA 3R7WA 3TKYA 3FKSD 4ZYWA 1ODLA 2HHQA 4H1UA 1X0XA 5IVPA 1YHYA 2H7VA 3N0VA 5B1EA 3CWZA 4L3WA 5E6RA 5ANRB 4C8KA 3DH0A 4ZDIA 4X54A 4RD3A 1UCVA 5E4FA 4CKWA 3GT3A 3UK7A 3D8HA 1RYFA 2NV2B 3ZHZA 1KIFA 5G0SA 5J2EA 3CSDA 1ZJMA 2FJ6A 4IIJF 5AOVA 3ILSA 5EXPA 5DI9A 5F33A 3R7LA 4L8YA 5C31A 1DOAA 1F0KA 4A0QA 3RVMA 4PGFA 4AXBA 3DLBA 1A9XA 3GZFA 1S4MA 4QWDA 1TCBA 2SKEA 3TOCA 4X66B 2JL1A 1CJVC 2NQ2C 1XDWA 4TM7A 3ZLBA 1PL8A 1TPZA 2UVQA 2PFQA 1AS2A 4J4TA 1CRQA 1Z6QA 3R6WA 1UDWA 3F53A 2UXBB 4PZ9A 9ICUA 1Z33A 2N1MA 5JBNA 1A4RA 1AQUA 1AZWA 2KJ9A 1L4MA 4GGOA 3E9MA 2QZJA 3ND5A 3RW9A 5JPCA 2ZZMA 2ZRIA 9ICGA 2ZJ5A 4H0NA 3DS8A 5JDCA 1HDCA 1VPEA 2QVBA 3KQNA 2VAXA 4PGYA 5EJ4A 3T5AA 2Q07A 4AJOA 1BMFD 2RHWA 3BMNB 1SD5A 2C3MA 2Q49A 2ZOSA 5JZOA 4AYBF 2ZRGA 4H4DA 1BOFA 2JGDA 3W77A 4BZZA 2O8EB 3FXAA 3R7DA 3X2EA 1I3LA 3VYTB 3TXAA 5J2IA 2HIAA 1BNOA 1QR2A 2BFOA 1NNSA 3GAMA 3N8IA 4N6OA 4AJLA 1UXHA 4GYYA 3U62A 2IYLD 4PVCA 4HDNB 4FBLA 2BLLA 1GLNA 2ZYRA 3NT2A 1HBJA 1ZK2A 4K87A 3RREA 4R0VA 2LHTA 1UJNA 4D9GA 1FYEA 3QU7A 3RB6A 3GLFE 1XA0A 3IBSA 2P2NA 4I2VA 4O1HA 2ZRNA 2E5FA 4IX9A 4NBKA 4QASA 1XRJA 5CTAA 1E98A 1PNTA 2NACA 4Q7KA 1U1IA 5JADA 2GR9A 5HMMA 3U6KA 2X23A 3S8MA 3AJAA 2GPWA 4W8HA 1OH6A 2F3SA 5B6IA 4C8MA 5E1OA 2CBGA 4LCJA 2BVNA 4GI3A 2WJ4A 2XDQB 3OC0A 2ZKIA 3UO8B 2X6QA 3QVJA 4CKEB 2BM0A 2ZB4A 1D4FA 2IZ6A 3IP6A 3KAPA 4DLPA 4Q4CA 2QMQA 4QYXA 2BFMA 5FUWA 2DTXA 4ESHA 5KKNB 4XVUA 2L69A 1RU3A 1WCIB 4LYFA 1SQ0A 3WYCA 3D6NB 3BX1A 1CUKA 3ESDA 4H7PA 3UWOA 2N0SA 3OHMA 4DLEA 1BHSA 1OLSA 3BS5B 2VHTA 2VYFA 1BKSB 2YHUA 3ERCA 3MBOA 5BWLA 1QLJA 5KNLA 4XUEA 1BHQ1 1RKVA 2Q3HA 3R44A 4FI3C 4MQ5A 3N39C 4U02A 2ZPUA 1NDUA 4TV8F 2YY7A 2GX6A 4ZJYA 4QAQA 4P36A 4NM1A 3DE4X 4J0DA 4URUR 1CQZA 1ZQSA 1EKXA 5EP1A 5DB7A 3J81k 2KN7A 1UC9A 2RJ3A 1TM1E 4NEHB 4R2MA 5F2KA 1Z4LA 2BHTA 2FJ0A 2YWFA 2VHQA 3TD9A 3RLFA 5DEIA 1NUAA 3AVYA 2X4DA 3LUHA 5IZCA 1NPDA 5CNIA 4ED3A 4HQOA 3G6XA 3G88A 1T9AA 5CVEA 4B3RB 1DZIA 2DPJA 2X7JA 1D3AA 5JEEA 4ASUA 1XZCA 4QXOA 1VLMA 1N2CB 2NYUA 1P72A 3F98A 4UXHA 3AY3A 4P5PA 4X65B 5AVXA 1PFUA 3ST7A 3ZK9A 3RVDA 4B87A 4S05A 2WJJA 2FPPB 4RHFA 1XQ1A 4CMIB 5K3FA 5TPWA 2EU8A 4MROA 1M0TA 3BZKA 3MPOA 3NC0C 2K5UA 3F0TA 3TZLA 4M0MA 5K3FB 2UVWA 4G0QA 4EUSA 3TCNA 2YS7A 4UB3A 7ICLA 2V55B 3BFVA 5AJYA 5SZIA 3S8EA 2BHRA 2KBEA 4HVCA 3WLHA 3AF0A 2WUGA 3OSUA 4OHOA 5DSTA 4B6EA 4E5KA 1B74A 1CK4A 3HWX1 1WY5A 4NY8A 3OJOA 2KWIA 2O2ZA 3A3YA 4E5MA 2BYTA 1EK5A 7ICIA 2JGMA 1XK7A 4HLUA 4WASA 4HKTA 2RCYA 4OYLA 1I33A 5AESA 2OO5A 1G8YA 4QFDA 4RGQA 1EDDA 5IVHA 2NRZA 1NLMA 4P32A 2GJAA 4LZGA 2PLFA 2QTTA 4H6WA 4IBOA 3TUIC 1HFKA 5D49A 4JMLA 3BXPA 3ETHA 4X91A 1Z29A 3RSZA 1E8NA 4MP3A 4YUWA 3ZBUA 3JQ8B 5FULA 5KMGA 4M36A 4IFTA 3L9WA 4A23A 3C6XA 3CRZA 5BO5A 1B15A 4DZTA 3I1FA 1W52X 3QMWA 3N86A 4NCHA 2VK2A 2HIGA 1CZNA 1F8YA 4YAJA 4EPWA 4H08A 4JL5A 1CI4A 1OXJA 3PZBA 4PGHA 3HB9A 2OO3A 2EANA 3KT6A 4AZ0A 2CFCA 3VGPA 1QK5A 1RPJA 2XTAA 2SBTA 1I4LD 4U7PB 5IAOA 1DRJA 1Z7YA 4F4WA 1CIVA 1OT3A 2QRZA 2V4ZA 4G5HA 4IXNA 2JLRA 1INLA 3AL0C 1M9NA 3ENWA 4BV8A 1N25A 4IKPA 4KO2S 4MVJE 4CMJA 2PUBA 2OCEA 1DQYA 4K28A 1NBOA 1SUAA 4TQUS 4G0XA 4C4AA 1ST2A 3BM5A 2F3PA 3N8KA 4AUEA 4CF4A 1ZCAA 3CMCO 4G0YA 1CUAA 1LBEA 4IIUA 4N3AA 4REMA 4RULA 5DTMA 3JVDA 5EOZA 1LZLA 1ZQQA 4H59A 4LRUA 1EXDA 3SC3A 1R88A 5G2OA 2W9MA 4S1OA 4CEJB 3M9WA 3O8BA 1USVA 3GZ4A 3SD7A 1OI3A 4I9GA 4ZVRA 5JYDA 1QRRA 1MXFA 3UWPA 1WA5A 5CFLA 4QDJA 1BCSA 2GO7A 1Y80A 3EGIA 5KOHB 4PGQA 4WKCA 2XHEA 1F5NA 4YCXA 2HF8A 4M0FA 1PSZA 2OKGA 4P7BA 3GFPA 3QXXA 1CJSA 3RYIB 4F4DA 1A4UA 1MMFB 3PVZA 1QVWA 2WW8A 1NDHA 2X8BA 1Z36A 4KMOA 4MVJG 4RANA 3SXPA 1X6JA 3QEBZ 2QMHA 2PY6A 5F9HA 2IP4A 4EYGA 3HH8A 4X6YA 4E0BA 5BSKA 1FNDA 2O7QA 2QY6A 3IUQA 3RFVA 3DMYA 3CEPB 5HP4A 3KUKA 5D5HA 2ATIA 2X4LA 4C3ZA 1FC0A 4GQBA 1Y0BA 1VJRA 4J0EA 2ONYA 1TQDA 1J0AA 4IV5A 3X2SA 1DHRA 2HW8A 2EV9A 2J3DA 4H3KB 4HDCA 3WHPA 4XWKA 2A78A 2GEKA 1M73E 2O2XA 2W00A 2WSSA 4GMGA 4OIFA 4P80A 3U7RA 1S1CA 1I36A 5LNK6 1T6XA 5LUAA 2NTYC 3IPLA 1JXMA 3QWAA 1FP4B 1JH8A 1UJ5A 2V7VA 5BR1A 4L5IA 5JI2E 1AN0A 4M1KA 1K8ZB 3GV8B 4GBJA 4PG7A 1XHEA 3NBFA 4M6WB 5AICA 7ICJA 2P2YA 1XWLA 5BSUA 4KQ9A 4RJKA 2FRVA 4UVHA 2WNSA 4CR7A 1SB3C 4X1KA 1UM9B 4I5EA 4XTRA 5EKXA 5G02A 3WL6A 4BLSA 1H65A 1JEAA 1DAKA 2E6UX 1WMSA 3LT4A 1YI1A 2KNJA 2QORA 4BY9E 2VIXA 5CHEA 3AMZA 5FWYA 1T0BA 2ZSDA 2XQFA 1FRVA 3H8WA 2AI3A 3NM4A 5WRFA 1K06A 2EAOA 4IQGA 5DYIA 4P35A 3M3DA 3ADCA 2TYSB 1GGHA 2GD1O 2VDMB 1FLNA 2DBZA 4D80A 1RWWA 1Z5VA 3COYA 4HAWA 3O7WA 2PJUA 3TEJA 5KQSA 2DQ4A 3HV2A 2IS2A 3L02A 3AVQA 4M1OA 4R1UA 5AD1A 2OCYC 3AF4A 4K03A 4E2YA 1NUPA 2MYPA 2IX3A 1I3NA 2XNDA 2FYTA 4FGWA 3VR5H 3DDUA 1NYRA 2CJYA 4NMMA 4FMDB 5CEJA 5ALLA 4CXMA 5NULA 1TKDA 2YQ5A 3TLJA 5EWLB 4PIVA 5LQDA 1P2UA 3R2JA 2JLQA 1XNQB 5EKSA 2PU5A 5BQXA 2D4AA 2HQRA 4TZ0A 4Q1VA 4Q1DA 1E6UA 1QCCA 3RHZA 5I4KA 2M0NA 2AF3C 2E9SA 2D62A 3WLMA 3OQ6A 3U40A 4XA5A 1RMQA 1AK9A 2Y1LA 2YJ6A 3MOIA 4WZ6A 2ZANA 1OAKA 4NEGA 3IRUA 4MGKR 4KDCA 3W5CA 3ZQJA 1GZ6A 3B0YA 5E6RB 4BFVA 5HYVA 2FZKA 2VDQB 2BT4A 3LXUX 4JBYA 2KE5A 4O29A 1SQ6A 1DPFA 2UDPA 4YAGA 1ILWA 4MW4A 4L8WB 3QSGA 5JAOA 2Z6QA 2R6GA 1DO0A 4DF3A 5IUKC 3LK6A 2B3TA 3EMDA 4LJ8A 5IC5A 1CC1S 4RQ8A 4FCWA 2I87A 2Y92A 1EZ4A 4QOHA 3D8NA 3HYCA 3SDZA 5M5BA 1IL0A 1WHTA 3OHPA 1B93A 4X20B 5IJWA 3T5HA 3G6VA 3GYBA 5DN6A 3S99A 3KXLA 4FDAA 4Y6QA 4BO1A 1BCRB 1L7BA 1I4WA 1R4MA 1RKUA 2TMDA 4GMKA 4QDXA 3SFVA 8ICNA 1SU7A 3GGOA 3KP1A 5L3SA 3WGZA 1TAHA 3NBAA 1EK1A 3LOUA 5CJ2A 4P4MA 3MLEA 3KZOA 3AN1A 2CF5A 4HGYA 2O2SA 1KERA 5GJVC 5K3DA 4H35A 1K4MA 4GFJA 4QE3A 1F4VA 4DGQA 1D04A 4UAJA 1PAUA 3ZC3A 2ADMA 5B66U 2QMUA 3BHNA 9ICQA 2V6BA 4DR4B 5FNZA 1RM0A 2I65A 3NWJA 4H17A 2DWQA 4INPA 1KYTA 1JAIA 3C14C 3RU3A 2R8RA 3AM3A 3S1AB 1Z0SA 4IAOA 4MLDA 4I2JA 2P79A 4B9LA 4DCPA 5FPKA 1RKXA 2HJRA 3AM5A 3HCNA 3TOZA 1G2IA 2YOGA 3EPHA 1KPGA 1R8XA 5ES3A 1K6MA 3ORQA 2XVZA 3G2HA 1NYTA 1V5GA 3G59A 4HVTA 2XY4A 3T3HA 2ONCA 2O5CA 2GCIA 1J2JA 4O2AB 3H5TA 3MR5A 3QQPA 2JJ1D 2IS4A 3RANA 3H11B 3C6ZA 4F9EA 1LKYA 2W6IA 3DBRA 3Q3GE 1H94A 4ATNA 2PM8A 3CUWA 4IYJA 2LKDA 3AEYA 3DJFA 2KICA 3N0RA 3RIMA 5KI6A 2UU9B 4BL5A 3DR5A 4KLFA 2D0PB 3LMKA 1NVMB 2RKBA 3T6KA 4EYKA 3LTNC 2JLUA 2BKAA 4OI0A 1VE7A 3I8SA 2NU7A 4Q93A 4IS3A 4U9UA 3PFFA 4MUGA 3JYQA 5TRTA 3NVVA 2ZJFA 4GE0A 4RHXA 3BVPA 3D0QA 4KMSA 4OI1A 4F5NA 3WYNA 5A4MS 1H93A 2IV2X 2BFFB 4FFNA 3UAOA 2EZZA 2P91A 1T2VA 1U94A 1L3UA 1IN4A 4NNJA 3VSCA 1N2CE 1KBUA 1UDXA 8ICEA 3OICA 3O4IA 2YC4C 2IWRA 1NUSA 5H5JA 4L0MA 3AQEA 3WS7A 2CL0X 2H5JA 1N6LA 2I4OA 2O50A 2BCGY 2RHTA 3B1JA 1ODIA 3MGGA 3IR6A 2VPTA 1BD4A 4UB4A 2ZJ1A 1ZI8A 4I4IA 1D7OA 1UC8A 3BG5A 3W4JA 3WLEA 4OHVA 2OL4A 3C3AA 3LYSA 3DG9A 5K8UA 1X9SA 1E4EA 1G7SA 1N2BA 1UKAA 4C4ZA 4C4PA 3BD9A 4HTAA 5IDXA 2V7QD 2YZKA 4N8EA 3K05A 1R6BX 2ZJ3A 4RCVA 4ACOA 2P30A 3C6KA 3D8BA 3DDCA 4D25A 1WXGA 1KZ9A 2DLDA 3M5CA 4OBXA 4ZYZA 4ZOAA 3OLVA 3RHFA 3ESBA 3USZA 2JFGA 2QSUA 3EQ8A 5IVKA 5EESA 5TXGA 1VIMA 3CLTC 1G2QA 1Y5LA 4NICA 4CCSA 5JNUA 3A6DA 3VU9A 1T9BA 5J2UA 3CINA 1Z08A 1VDMA 3UK6A 3CVYA 2KX7A 3ANTA 1NKEA 4RQ6A 1CR2A 3N2EA 3ZGYA 2KFNA 4XIFA 3IR5A 3TJRA 1JI0A 2B4TO 4NLLA 4YRFA 5DNVA 3VPXA 4M1WA 3V4FA 3EEOA 3QKRA 3CO0S 1JI3A 4GSYA 7ICVA 4JUIA 2DWPA 3DJYA 1UKEA 2JAUA 3IAM6 2FZLA 2XE4A 3HR7A 3JRWA 5G0VA 2QVZX 2RFLA 4LAFA 2RGBA 4F5WA 1V8FA 2IU3A 2WIDA 3G6WA 5BMVB 1JKIA 4WPGA 4WL0A 4RVUA 1PW7A 3VJRA 4B6RA 1GGVA 1F8UA 3F5MA 4QDZA 4WEQA 1J21A 1EVLA 1C9DB 2Z04A 4WOBA 4CKBA 2ISQA 3IMGA 4YJ3A 1E5DA 1HWYA 4H77A 2H65A 3ORFA 1PD1A 3A2MA 5TT0A 1XTBA 3E8SA 5JJCA 2ZAOA 1JTEA 4BZWA 2WB1F 2LV8A 1F6DA 1QK4A 3IQHX 1NK5A 1SBHA 3PDIB 5E79U 2AVNA 4GRIA 4W82A 1WETA 4BNTA 4QWWA 4QZBA 3MJEA 2ZSAA 3BL5A 4D46A 4LF4B 1R00A 4NLCA 2ZTCA 5ALKA 4JVMA 4J9LA 1FJHA 3KOUA 4MUYA 3KS9A 3ESQA 1JMSA 1TAQA 3GZNB 3RTBA 4EFLA 3NO4A 1QO0A 3AUUA 2D2VA 4W9NC 4Y2RA 2I2WA 4AMBA 4G8BA 5BWMA 2BL4A 3BWXA 4ZGWA 3JRNA 1FCJA 4I2HA 5GTIU 1LTHR 1RVDA 2GSWA 3CZQA 3R3VA 3U5ZB 1ODTC 2ZXFA 5LQRA 4ZZ3A 1FXWF 1AKVA 3A27A 3IB6A 4PHFA 2RLTA 4BKPA 2BHLA 3ZLVA 4E13A 4UUOA 4JI8B 1JFVA 3FUXA 4UAUA 2I55A 2VJLA 3WMEA 1KZYC 4LTDA 4CL3A 1ONNA 1THMA 3KWFA 5KSWB 5AJWA 4GM1A 4CJXA 2HSGA 3I76A 2DVMA 2WV9A 3M6WA 5JD5A 1DAPA 3F73A 1BD3A 4OX9B 4HRVA 4CGYA 4KLOA 4YJHB 1FZTA 1BGVA 1E3EA 1VG1A 3CS3A 3Q8WA 4FLEA 4TV9F 4EBBA 1YVRA 4YWHA 1FUUA 1OJ7A 3SKYA 3C7DB 3K9QO 1DT3A 1F3OA 2AXPA 4ENPA 1F8GA 1RAGA 1RXUA 3CKYA 2A0XA 4FCVA 4J0QA 4E4RA 1KJ9A 1I2CA 3AGQA 1XZGA 2DSTA 3WMFA 4LCBA 2BFBA 3MJFA 4RVNA 3G3EA 4HX9A 4FZNA 1HUOA 2W54A 1VZ2A 1XVLA 2JW5A 3EWNA 3EBPA 2R65A 4R98A 3DTNA 4DUYB 5HM8A 2QRGA 3PT9A 4IIXA 2WAOA 3IAFA 1E2BA 3K2EA 3WWOA 2FMPA 5L1JA 3FSGA 1JKMA 1M2EA 1J06A 2VEOA 2YW2A 3LQ2A 5JDIA 3A8TA 1CNFA 1QAOA 5HW0A 3OX4A 4MRRA 4XM0A 2I1LA 4AN0A 1Y9JA 2DJ5A 2WSLA 4I14A 5FUVA 2V1UA 3JQAD 1DHTA 1U9ZA 2IXTA 2OSBA 3WRYC 1NONA 3QEKA 2JATA 4YJFB 1P2SA 3S3TA 4CMAA 2C9CA 4IZ6A 1CR4A 2X5OA 5FQOA 1H2WA 1ZNXA 3Q3JB 4UBCA 4Y2YA 4KV7A 3P9CA 4OKNA 2C03A 3S1AA 3VYUB 3EF1A 4I19A 2DJIA 4NMWA 3JPQA 1AOXA 2G9UA 3F6RA 3VR5D 1FYXA 4A8JA 3Q9UA 2IYNA 4D43A 4TTPA 2RGNC 2PI4A 1RCUA 3WO1A 4D3FA 4Y1FA 3D3QA 2YRXA 1VCHA 4HDKB 3ZHBA 4CM4A 2WTUA 2IUUA 5CCEA 3CZ9A 8ICLA 3UJ9A 4LE2A 3N7SC 2GILA 3AF5A 3PFCA 4JOSA 5H82A 5B57C 1VI6A 5T4EA 2GD2A 4JI6B 1W36C 4TS1A 3RRYA 4OQFA 3LFUA 2R8JA 1XL1A 2PZGA 2GASA 3EIHA 5LZ9A 2DPGA 1QHHB 3L5KA 4S2UA 5M2QA 2Z1NA 4Q24A 3G2JA 2OM6A 5AM1A 4KMOB 5AKLA 1EGHA 5EHNA 2FN3A 2Q9BA 2FSUA 1S4QA 4RQ2A 1U45A 3VR6A 5BYBA 2LP4Y 5FBHA 4F2SA 3QXCA 1FFBA 2JEJA 1G5RA 1MH9A 2HWUA 4H1TA 4K9OA 4K6FA 1XWWA 4UE2A 3V33A 4DCTA 3PTAA 4YMSA 4Y2HA 5B12A 2M9NA 1LPAB 1RWKA 4P3KA 3ROMA 2BDTA 1XHFA 1O0BA 3K8ZA 3K1ZA 2X41A 1VLHA 4IJQA 5SZHB 1U3VA 3QP9A 3PGVA 3W04A 1TOAA 3FOBA 2DPMA 2JI7A 4PLGA 4PHCA 4KX3A 1G0OA 3AFMA 1J2UA 3DT8A 1L8QA 2A86A 5CFZA 3RBZA 1P9LA 1SHUX 3VC3A 2AOXA 2IV3A 3K15A 2FLLA 3DO6A 4NOJA 3AGPA 1TF2A 3OO1A 1LY1A 4PL1A 2G5PA 1MT3A 3ISBA 1QIMA 3BMQA 3K1AA 2CHGA 2PMWB 4YQEA 3I8XA 2B1RA 4HRYA 3HM9A 4GI2A 3W7VA 3DKIA 4TKVA 1O0CA 4DCOA 3ZU5A 5J9FA 4G4SP 1E2KA 4R2HA 4S1VA 5B37A 1GXSA 5K05A 5HRCA 4Q19A 4UM7A 1CG6A 1OYYA 1K3TA 3FMGA 4X3PA 2ZVQX 1MENA 3SZMA 2PJRA 2HT6A 3IDOA 2XB8A 1YDEA 4DPMA 3WGVA 3MCWA 4UCXA 4Z6EA 2HC9A 3EDOA 4P4UA 2DKNA 3FPFA 1WUIS 2FWIA 2HGZA 2R60A 2W6PA 2YBEA 1XB2A 3A05A 4IIYA 2AMFA 3ZIDA 3GJQA 3N8NA 1QIGA 3AESA 1HNZB 2B4KA 1T9DA 1YH3A 3H2HA 4CEIB 2L19A 4WKOA 3JQRA 3OM1A 1ZMOA 4XZ3A 5D00A 2GAOA 2DBVO 2LI6A 2G67A 3KYIB 3JV7A 4BKOA 3FFXA 4LZZA 4G0PA 3TX2A 1E79D 1REQB 3L7NA 3FCAA 5C8ZA 1SK8A 5KYXB 4GXJA 1CY6A 4XOUA 4UE3S 1SUFA 1ZOPA 3HB7A 3VX4A 1G4HA 4BKRA 5AM2A 3U3KA 6REQB 3UMRA 2W2VA 2AXEA 1GZ5A 2MMCA 3H05A 1XRSB 1URPA 1U0BB 3ABZA 1QORA 2GLXA 3DYBA 4UCQA 3BWBA 3NPMA 1HTTA 1LLCA 2VATA 3GFRA 1XBTA 4GC5A 3EB9A 4D9CA 3HK2A 2VDKB 2HCBA 1EH5A 3I2IA 4M0DA 4JBLA 3UJNA 2P75A 4PHTA 1YCGA 2J0QA 3KQYA 2I03A 4NECA 4EY3A 1W30A 3DBRB 4ON9A 4YN3A 3TX6A 1PJAA 3CZCA 1XC9A 3Q2OA 4CLRA 4MR7B 3E6AA 1AXEA 2FCAA 3UOAB 5CAEA 4L78A 3G0HA 1KEVA 1I1OA 1DTWA 3JYOA 3N2GA 4ZPJA 5KTPA 1GGJA 4WOPA 4RL4A 4WLVA 3F8WA 1II8A 3E03A 4Z86A 1JPNA 5AFSA 3M33A 4R63A 2HHAA 3FDZA 2BTQA 2Y67A 3ZCTA 1IHUA 1MX3A 4LKOA 3NHZA 5DEOA 4O1IA 2O7RA 4AB1A 2ZETA 2JLYA 2Z9DA 4H7IA 3C2KA 1SCBA 2CDNA 3O82A 2OY0A 4RUAA 1CLEA 1K5PA 1QB7A 5JJLA 1BU5A 2OVFA 3KOMA 4JI5B 5HF5A 3KR1A 1SB8A 2V9ZA 3LGSA 4QHSA 4R5MA 5EIXA 3LLVA 2L0XA 5FBQB 1IOZA 4N5DA 1NMYA 1B76A 3I0MA 3B1XA 3EGCA 2CB0A 4GKKB 1IIBA 3UWMA 3MT9A 5BN3B 5IANA 4M9NA 1CIPA 1XZNA 3SEQA 1GQSA 5JXIA 3GLGA 3BH0A 4KB5A 1VRWA 3HXQA 4RE6A 1F3LA 2CXPA 2FTKE 3RTGA 2BD0A 3EPGA 2GRAA 1UR5A 2C1EA 4RTJA 2H9YA 5JCOC 1E1KA 5I7SA 5K8CA 4GOMD 5F1KA 1JLMA 2OV3A 2JCSA 4HEA1 4EGCB 4QUJA 3X1JA 1NK7A 1XLTC 2CYBA 4CQJA 4QXAA 1AF4A 1DIAA 2C8LA 3P5BA 4L7VA 3SSAA 3MGCA 3U2QA 3ZHVA 2GBLC 2JAPA 2Y68A 2YQEA 3KJFA 5HFJA 4ZI7A 5C3MA 4IDHA 5A4IS 2J7KA 1WCNA 7ICKA 1O8CA 3ZIAD 3Q6IA 3A9RA 4HS9A 5EQFA 2IK8A 3IBYA 1YAHA 4R3WA 2OZPA 3PDJA 2RD2A 1XIVA 2IZZA 3T7CA 5FADA 1OW3B 1CVIA 5IJ0A 1X7GA 4XSVA 2IYYA 2QHXA 1MAUA 2RK4A 4MQEB 3EXEB 1YZ6A 5K4LA 3A1DA 3ME5A 2YJZA 3GJ3A 2WFLA 4QUAA 2EGGA 2JVIA 1JZSA 2Q3FA 4GZ5A 5EJAA 4ZAYA 3H65A 1YRBA 2K4MA 1M2GA 2C2OA 4UCWA 4AMGA 2F6RA 2YZ2A 4NP6A 2HWXA 2XDYA 3DP7A 9ICWA 3SV3A 1ORDA 3GLRA 4XCQA 3G2KA 1Z45A 1RM3A 4FMBB 5FYDA 3ROKA 1A0OA 3D3NA 5FNVA 3W8NA 4ETWA 3EZFA 4YRGA 4E4YA 5HHHA 1OKKD 3V7JA 3AETA 3JCZA 1JI7A 2F43B 3PYXA 4IDAA 4ZCQA 9ICJA 1PGQA 3MA0A 3VR4D 4N0EA 3T0GA 2PUHA 3IALA 1ZQGA 2G36A 4KQXA 3D7NA 3K2IA 5AOBA 5B1YA 4CNBA 1G3UA 1KEKA 5BUCA 3CEHA 5THQA 2NVUB 3VC2A 2Z2XA 3L41A 4JLWA 3PV0A 3M2PA 4ZCSA 5JS6A 5KOIA 1Z73A 1WTAA 1QP0A 1TEXA 1XTPA 4U6NA 1L4NA 5D84A 1GNQA 3NGDA 4RPYA 3FBTA 4RZIA 1P7VA 5TR9A 4DDTA 1UFOA 4FT2A 5G1NA 5TS3A 1Y7LA 1TRHA 3DL0A 4AJKA 3WB0A 1DG9A 2CCKA 2Y05A 3FOAA 2QXYA 3K4PA 1DEKA 2HDHA 1FU7A 5JCJD 2EFHB 2ZVJA 5E0KB 3FVRA 3TW0A 2WQ7A 4AJNA 3HBFA 3EG9A 1YZUA 4POOA 3DDOA 1E4OA 4WOCA 1A50B 1CHDA 3QG5A 2FN7A 4JP5A 2WD7B 1CZUA 3A25A 2DUUA 3BSYA 3OT1A 4PPGA 1CR6A 1IEWA 3HRKA 5GY7A 3ZI0A 1U2GC 5I7RA 1YONA 4NKRA 3MOGA 4Y2VA 5KQGA 2CK3A 3IHWA 2A5DA 3OURA 1ZHOA 2B4RO 1N33B 1KAOA 3MB8A 3GH1A 2EH9A 5JHHB 4KBYA 1ZQYA 4V1CB 3UFXB 4DSFA 2PRYA 2ZDQA 5D6NA 4LEIA 4BQSA 4LNUB 3ZV6A 2LRHA 2CCJA 3ELUA 2O0JA 2ASJA 1G7RA 4F3RA 4RH0A 2QB0A 3ORYA 1RBMA 1U5CA 1XDZA 4AJHA 4LF5B 3INYA 1EFKA 5FPSA 5KTNA 1GSOA 4D0GA 4X85A 4EHFA 4GLJA 4UVIA 4D02A 5ABPA 1IEVA 2VT2A 5LYJF 5DGBA 2I8LA 3C4QA 3CUVA 2A14A 4O5AA 3PSTA 4RIGA 5L3ZA 4S1WA 3WNQA 1KETA 2TRSB 1S0VA 1NJGA 3GOHA 3HYTA 4R05A 3N7PD 1H8HD 2I6GA 3C3DA 2JR5A 3LWDA 4M89A 4JI7B 4LIPD 1AB5A 1NVEA 3JR3A 3ETJA 2FGJA 2I80A 3N7TA 1WZNA 4J1SA 2PSHA 3LQKA 3CHYA 4HFNA 4BGUA 1VIDA 4NU8X 4WBNF 2IBSA 3MVEA 1M83A 3ZUPA 1Z00B 2YVKA 4CEJA 3KBBA 1GUZA 1UIMA 1P29A 3V1LA 1KBOA 2QTZA 1K1QA 2NSJA 4DJEC 2NUPA 4WXPA 3VFDA 4PY2A 4DNQA 4BNHA 3ESCA 4ZOCA 3ZDDA 3MHPA 3G1UA 2J3QA 4ZOLF 4BMPB 3R8CA 1NK8A 1VM6A 4HZUB 4OP2A 4UBNA 1W5FA 3OJWA 1MGPA 1WS6A 1T4CA 1SU6A 2J5BA 1UBCA 2QRVB 2QTAA 1D6JA 1NXTA 3GNQA 3L4BC 3ROGA 3AR5A 121PA 2R6CA 4N5IX 4RWZA 3THWB 2HA7A 5B5EU 2IBTA 2AW5A 1RI3A 4EZ6A 2O3RA 2X5NA 4ZV9A 3FYUB 1IN5A 1V43A 5KVCA 4QZ8A 3X3HA 1E32A 4GGMX 5HRAA 5IBQA 4DL7A 1IM4A 5LZ4A 2DQSA 1N8TA 3BGSA 1WWVA 1I1HA 3GNLA 4M8KA 5JQGB 4KP7A 1WXHA 2ZYUX 4P53A 2EZUA 3RJGA 4YJGB 1WDLA 2QARB 1UBTS 1HX7A 3JAKB 4ARBA 3IMFA 4DUGD 1K6EA 2F8SA 2XOEA 3EK2A 3QI2A 4KW7A 5KFSA 1G9TA 4AF6A 4IEIA 1A2OA 2IIQA 4TLLB 5KINB 4D8UA 4LRQA 4YCLA 2NZ2A 5ESDA 1JMVA 1X66A 1OZGA 4CG0A 3A58B 4X61A 4LJ7A 4N6NA 1RJDA 3P26A 4J0HA 2PFGA 8ABPA 3Q7EA 3EJWA 4EL0A 1CDOA 2B98A 4YXWA 2R96A 1LVHA 4JUDX 2K4IA 1N8SA 5IKXA 3A1NA 2W3RA 2B5OA 5HTKA 1GPMA 2AK3A 1IXZA 1F2TA 1QRSA 4GQIA 1OB2A 2N3ZA 5CX1A 4IFEA 6ABPA 2E5LB 3SJ7A 3EARA 5L7WA 1GA6A 2KVCA 3NHKA 2P40A 2JIZA 1PWYE 3HEMA 1ZK0A 2CB9A 1FFDA 2VWGA 1QF7A 1XZIA 2WVGA 4F91B 5DLDA 4ZGBA 1P5JA 2YXBA 2APJA 4J9VA 3G9UA 4Z7NB 3CBQA 4P38A 3I37X 1E0DA 1D6MA 4KK4A 1MTZA 4TKVB 3RJ5A 4TTRA 4O4IF 2GM3A 1KYXA 1T2NA 4B34A 4C5CA 4EKYA 1RYZA 4TLAA 4RD2A 1HKHA 3TAHA 3U39A 4C04A 1CJUC 4CM8B 5C0YA 5JXGA 3DLAA 2NVBA 2RC5A 2DECA 5CXSA 4JVNA 3PW5A 2YVLA 7ICRA 5D3KA 3TOXA 2ZIEA 5JDIC 1DDIA 3OCJA 1BH2A 2YMQA 2DC1A 2GCEA 2IXDA 5FI3A 4YYZA 2ZYAA 3K0AA 4JYAB 1Z4JA 1TYEB 5HOQA 3OQIB 2O9JA 2JS7A 4RMNA 2W6NA 2Q5OA 2X9NA 3RJMA 4C4XA 2CD9A 2GEUA 4LQ4A 1H05A 5F4BA 2B92A 3DTYA 2X0IA 4G9EA 3RJFA 5BV2P 2D0DA 3UBTA 2PYZA 1X1TA 3A6HA 5DHRA 5I7VA 1P2FA 4PR3A 4BEBA 2PS0A 2P6UA 5GPBA 1WHSB 4PHEA 3IE1A 4TXNA 1AF7A 1SC6A 1SR8A 1UK8A 2CMHA 4F3NA 4AUNA 3CF6R 1M54A 2SCUB 2OBFA 1J5PA 1DWOA 1GUFA 1OXXK 1UBGA 1WKVA 1YASA 2HBLA 2P3OA 2VJMA 3GCWA 3KE9A 5BSRA 1RAAA 1WCIA 2GAAA 4KACA 4MZDA 5EXXA 4BP9A 3QHPA 3A1WA 2C00A 4WK6A 4ZKEA 5K0BA 1G3RA 2DKOA 1XKXA 3UT5B 3N2YA 4KBFA 1L4LA 2V6IA 3ET5A 4C2AA 1QF6A 4I1YA 2BV3A 3FRJA 1EEXB 4F1KA 3ENZA 4ZT5A 4YJKA 1JN3A 5DH9A 1KRXA 4XVCA 4GDFA 5AP9A 4PX9A 4TT8A 2ASVA 2OCLA 3B70A 4WADA 1JEQB 2F3UA 3BSSA 3O93A 1F44A 1N8NA 5BPFA 1C8LA 1FDUA 2WJIA 2EAMA 1J9GA 3IIJA 5FXMA 1P1BA 2YX8A 2AQ8A 1AUPA 1IXRA 5KT2A 3FRIA 1Z5WA 5DOVA 2CF6A 1NMEA 2NSDA 1EGAA 3HDHA 5F12A 2XB6A 1TM3E 1E9CA 3OIDA 3LQ4A 2UZ3A 3BEDA 4I50B 2RIPA 4TXLA 4M9ZA 2HSEA 1LC0A 1PJBA 1RXEA 2AJBA 5DX1A 2JJ1A 3PWSA 4J7XA 4KQMA 1PK1A 4UHDA 3TLBA 3O1LA 1T6YA 1VJTA 2E55A 4YONB 2XTNA 4ZCLA 2ZIVB 5DP2A 4HO1X 1SHZA 2QVXX 2IOYA 3I5UA 4IDQA 4Y9UA 2JGKA 5FWXA 4BV2A 4AKGA 4D44A 1LBHA 2GFHA 4UTZA 4XQ9A 2VPIA 4WHMA 1CEXA 2Z5LA 1DIRA 1NW9B 2PMCA 2QJOA 4CF3A 4Q7QA 2PR2A 4MJXA 3RC7A 2OT3B 3K35A 5BQOA 1KJYA 2JFHA 3AW9A 2FSSA 3KWMA 4U7FA 3W7BA 5CA0A 3FNGA 1T1JA 2FEAA 1J33A 5EJ5A 1ZN8A 3ROQA 2OFFA 4EENA 3GQVA 3C3CA 5C7IO 2CSXA 2D8CA 5KYXA 4DV4B 5AKGA 4TUYA 2EXXA 4B35A 1JJBA 1XZLA 1VLJA 4MVJI 4FBTA 1QG2A 4PFSA 2ON6A 3ZQ6A 4C3OB 4YXFA 5CB4F 4I8IA 4DR2B 1ARZA 2Y1FA 3THYB 4YRIA 2A9JA 3H8VA 3V80A 1M33A 2AFVA 8ICIA 4X6XA 4OXNA 4EI9A 3W78A 2FN9A 1UBFA 3KLBA 4O2AF 3KZIU 4OHRA 3BWDD 4Q0MA 5DGIA 4TGLA 1RS0A 1UKZA 2XB9A 2Z5FA 3UCFA 8ICWA 1DRVA 1GL6A 1G8SA 2QTVA 2GKSA 3CNLA 3CWCA 2IHUA 1G1MA 3IVGA 1NW7A 1X8JA 1XCPA 5BMVF 2Q62A 3R7WB 1NFQA 2CRXA 4GP9A 1NI3A 1SUWA 3SVLA 2XWQA 3HTXA 1FFCA 3JVVA 4MW7A 2XB2A 2C2DA 4QULA 3IVRA 5IN5A 5F1YA 5LMUB 3ZG6A 3BTUA 3B9PA 3B9JA 3DMTC 5ER6A 2JD1A 3AHIA 5MN4A 3IEXA 5DBOA 1OFUA 2OYSA 2Z83A 5JYBA 1T43A 2YJ4A 1ZQNA 2XBLA 1YCDA 1SK9A 1I6WA 4UZEA 1U2PA 4IM7A 3URMA 2NP7A 3V1MA 4UHEA 2R47A 2WA1A 2DR3A 4HDRB 1DMRA 2QLMA 1O94C 9ICMA 1CQIB 3ADPA 1I7DA 4OU5A 3VCBA 4ELUA 1ZUHA 2CUNA 1Q2UA 3IUPA 4F3YA 5IM4F 5DNCA 2QRKA 5JMPA 1X15A 1ESCA 1F60A 2VOEA 4LBVA 2JLCA 2M2IA 4G25A 3JQ9C 3HABA 1PS8A 4OL0A 5TMEA 3V8MA 3AIIA 1TZJA 5ALFA 3WK8A 1KVUA 1T13A 2FB9A 4RSRA 3R20A 5HCNA 5C80A 1Q74A 4GW3A 2VRWA 1G2OA 1F20A 4I8XA 2AJCA 4KXMA 2E0IA 3KV1A 4JJ7A 3OZCA 2BCUA 4LECA 2W8ZA 2HA3A 4M2YA 1JJVA 5CT6A 4OFWA 3V3TA 1ZQDA 3MSXA 4RGBA 2MDTA 2J09A 2VAMA 2OV4A 1FX0A 1YQWA 3KD2A 2H2IA 2WABA 1E1QD 4PAWA 2JI6A 3KIPA 3M6FA 4LRWA 1O8BA 1NBIA 4R1MA 1B0ZA 5JQGF 2AK2A 5LJLA 2OCAA 5L3RA 4UTVA 1QWSA 3GFVA 1TNDA 4DYHA 1NMQA 4A82A 3FDSA 4ANFA 4F9GA 1VE3A 2EGUA 5DM0A 3O1JC 4JJEA 2G8LA 1RPTA 2V7WA 4BDPA 4PQFA 3M1IA 5J40A 3RIXA 4DCMA 1YF3A 1G2PA 3PHHA 4BMYA 2FPMA 2YYSA 3EA4A 5LM3A 3T3IA 1Z0DA 4BKUA 4RPXA 2MSKA 3LNTA 1C0LA 1YJXA 3LW7A 5BSTA 1PSWA 4YECA 3RJ9A 5IEJA 1Q44A 5JTUA 3HXMA 1U8XX 2D1RA 3AIOA 4D9JA 1HI9A 1KQPA 3RR8A 3TAXA 1NSFA 3CTMA 1CZRA 2H4WA 2WPNA 1IUOA 2BGWA 4CQMA 3A0HU 1HYGA 3IDZA 4DLTA 4RNMA 2H59A 1EWTA 4HXEB 4CWAA 1UBMS 2JLWA 4Q4JA 1ILEA 4MAMA 2CXOA 1NJ6A 2F3TA 2VA3A 1TK8A 3IVAA 4W8OA 1YBVA 1SXJB 1TKBA 2B0JA 4WFIA 3U4HA 4CVNA 4OO3A 5IAAA 5TEVA 3ZDAA 1OWNA 5FRDA 1GPUA 4WNIA 2A94A 2Q41A 1MQ3A 4QUBA 2LKCA 4XFKA 9ICAA 5H16A 5JZVA 2R6DA 4ZO8A 3KXDA 4TL9A 5ALPA 3PSPA 2CNNA 1TUBB 2GBPA 2PEZA 1UJCA 1W4AA 3BK1A 3DZDA 4I5GA 2PI5A 3PS9A 1O96A 3OE7D 2R1VB 4U3JB 2F1OA 3U3RA 1AKUA 1I2AA 1Y9EA 2JNWA 1IZ9A 4I8DA 4L08A 1I0IA 2B7CA 2IXAA 5TT1A 3SHTA 1MBZA 4HB0A 1G21A 1O97C 3NBZC 1I4OA 1X7ZA 1M2WA 2IIBA 2XT9A 4C8NA 5YASA 1H2RS 1OFUX 3D2SA 5AJZA 1Z6YA 4YUVA 3WWPA 1YRAA 3P2IA 4HWGA 4ZMRA 2BSXA 1T4BA 4CKCA 4WKPA 3K9GA 3QH4A 4GR9A 4ZVKA 2PVPA 2QTMA 3EULA 1R9JA 3C1OA 3LUAA 2ES4A 2GERA 1H5NA 1MC5A 4FNOA 3UC9A 1LPBB 2WU0A 1DE0A 4M83A 4ZCPA 3UV3A 1JB1A 1B0XA 1J0XO 2RI1A 2LCFA 1GZHB 1QV7A 1P5FA 3CW8X 3FG9A 4QXRA 3BRWA 2GZRA 3OQJA 1BRTA 1NJWA 4KQ2A 4QIHA 4XJVA 3ZXSA 1L5QA 4WCFB 5KREA 1IY1A 4Q3BA 3BAFA 1K2WA 1D8BA 1X7HA 4B5KA 4E1BA 4M9GA 1SY7A 3KKNA 1VBKA 2AI1A 2R4TA 3DE5X 4G0WA 3NXKA 3LVQE 4URVR 2BKLA 1Z19A 2BM1A 5TVGA 4HLDA 1DIGA 2W37A 4U2DA 3N2IA 3SK0A 2ZI4A 1DQRA 3TIFA 3VZCA 3ZX4A 3DGFC 3VOTA 4CU5A 2WM2A 3GZNA 1CRZA 4YHBA 4P4PA 4EJSB 3JXEA 5G0WA 7ICOA 3FZGA 4C76A 4CT5A 3INGA 2IYTA 3AHCA 2M98A 5GWXA 1U1CA 5K2MA 4W9MC 5KDLA 2OYCA 2O57A 3DOHA 1NT4A 5HUHA 4C0BA 3ICOA 4UTOA 3SC6A 3ZEAA 3A11A 1JUDA 1W93A 4BNWA 2PH1A 2XWJI 4ZTUB 1SJ9A 1Q7TA 4R2LA 1U0TA 1LD3A 3GPIA 4A10A 4RQ4A 1DBWA 1G9SA 1Z4OA 1QONA 2RARA 2GNAA 4QM7A 4FGLA 2GEDA 3JYNA 2A9OA 1MU0A 2IYUA 3AH8A 3JASB 4DMMA 5JAMA 4LJ9A 1F2UA 2P0EA 2QTWB 3DW3X 5FPHA 3DEYX 5BN5A 1XXHA 2AG8A 2OXEA 3SKXA 1K8YB 3ZVRA 2WB4A 2X13A 1LWNA 4LV6A 5LA6F 4DTCA 3RHTA 3MEQA 1KGDA 3TB6A 1QHSA 2EWWA 3H16A 3IRVA 5A4KA 4A36A 4AZTA 1MR3F 2ZAGA 5EWMB 5DNEA 5BOSB 2L17A 1UJMA 5I7HA 1KZ6A 4R0NA 5BR4A 1B2RA 4J0GA 4ASUD 4QFMA 2H1WA 4MHSA 2OAGA 2GK4A 1RSZA 4J90A 3SQIA 1C8BA 1ZIXA 1EEHA 3G8DA 2XF8A 1KO7A 1QYCA 3JX9A 3DE7X 4HB3A 3KLPX 2PV7A 5BQ3A 3I5AA 5LVAA 1V8ZA 1EUZA 1YO6A 3UXOA 4PNHA 1XQYA 5DYTA 3AR2A 1AGNA 4L8FA 2YQZA 3EZNA 1UA1A 3RS2A 1Y3DE 2IA5A 4RMJA 1T5IA 2HLPA 4BFXA 1S02A 5DYWA 4F8JA 1YUNA 1D2MA 1MA7A 1XCOA 4E09A 3RAPR 3EF0A 1JIQA 2WG0A 3KELA 2RBGA 4EP1A 1JGTA 4J49A 1EHIA 1EFCA 3A4MA 3M1AA 1B0UA 2HBYA 1Y88A 5FLEX 1M2HA 3WKCA 1TPYA 3QWBA 3TZ6A 4FBMA 4LOLA 1IK6A 2XNJA 4Q15A 4HPXB 3U3DA 2VDRB 1UWCA 2A0YA 2BDEA 2REQA 4EG6A 2RSLA 4I4TA 1XJQA 2OBMA 2CMDA 2IXBA 2FWNA 1N77A 2Z3ZA 2P9ZA 3BULA 3MK31 1HLDA 3KALA 4R8KA 1Q22A 5BSHA 1AQNA 5T7BA 2EWMA 4S04A 1L3BA 1SUEA 2WHYA 3LS2A 1L7DA 4M8IA 1P2BA 2RQ5A 3BH7A 5I9TA 3DEKA 4QTUB 3UTCA 1GADO 1XTKA 4DCGA 4JSTA 4RD6A 5ARBA 1BPYA 4LDAA 4JYZA 1JV2B 5LP1A 1K7SN 4A15A 2VZ9A 3FIUA 1JHOA 2B61A 3DW1X 4HQNA 1X39A 1PLKA 4NZNA 1NGSA 3BRSA 5G1OA 2ISCA 2C3OA 4DPLA 1T3HA 2W93A 4TUYF 2FP3A 4ZT3A 2OXFA 3CW9A 2BPFA 4KOAA 1ZK1A 2WINI 3HKDA 3EFBA 1B8NA 4GEKA 2X8LA 1V38A 4ECWA 1OI4A 1LX7A 4KXXA 2CJPA 4JT2A 3AVUA 1KDPA 2PH7A 1E60A 4O2AA 4OSPA 4EHIA 1KDZA 1YWGO 3GEHA 5L9XA 3LCJA 3HO1A 3H5AA 4CKXA 3LBFA 5KUTA 3L7KA 1XMOB 3ECSA 2HNBA 3H2SA 16PKA 1CNMA 3D4NA 1QDEA 1HEIA 3VKHA 1J2RA 4GXQA 4OHBA 4KFUA 4R9NA 4B6GA 3S8YA 1R18A 3RSFA 4MRMB 1V7QA 1BMFA 1JS1X 2D5AA 2E1FA 1GV0A 2XGSA 3A4IA 4HLCA 2XTZA 3GJSA 1YA8A 4IO1A 1GCGA 2XKAA 3F2VA 5EP3A 4ALMA 4E31A 5CCBA 2BZ1A 4XSGA 2F90A 4CKYA 2OGTA 4HWKA 4UREA 3H9EO 3AOGA 5IIIA 9ICFA 2VJCA 3LUGA 3VNUA 5CA1F 4WLEA 2VHYA 5FBVB 1D2GA 3VJMA 1YFLA 4I1RA 2W0MA 3WL5A 1KAHA 4RPIA 5ENZA 2GZSA 3OQVA 4KO4S 1SUCA 2VYVD 4H2DA 1X80A 4F5DA 4ZPXA 1RWXA 1MIHA 5LIRA 5C81A 2XUOA 3BQTA 4DE5A 3PDCA 2C1XA 1A5AB 4NE7A 3JPYA 4HDAA 2QLTA 5KX5A 1ZHHA 2JHAA 4PPYA 3PEFA 2HI0A 3PZRA 4DRYA 2IL1A 3LD9A 5IM4A 3V2UA 5HNKA 5ALEA 2WICA 4HTFA 3JVIA 1RQXA 1JLKA 3L7MA 3MD0A 5DCUA 4PX5A 4QBFA 2W70A 1XLTA 2NRXA 2LUOA 3QKSB 3L79A 3QFTA 1LWOA 2CHEA 3ESAA 5KNCD 5JRTA 2H5IA 1TVEA 3EGEA 5JY6A 4YMOA 3FKSA 4N5NA 1MZVA 2Y1GA 4QG7A 2AOTB 2XH8A 4US0R 4AM8A 4BO6A 5IKOA 1YT3A 4P4GA 4P0TA 4G0VA 1N3IA 2Q5LA 3KYDB 5J0SA 1I1NA 4RKYA 5EE0A 1PS0A 2VJOA 4DDMA 3WADA 3CUSA 1D07A 1UBHS 1W6UA 3L7CA 4DWIA 4WK0B 1YB1A 2Z4RA 3VDXA 1CRLA 2CHQA 3WLRA 1D4ZA 4IDCA 3KBOA 4BLWA 4C6RA 1NRIA 3DV0A 2NAPA 4LWOA 4JNKA 1GPJA 1D8TA 3FZQA 1HEUA 3OJXA 3F46A 4H60A 4IJUA 5A1TA 1NWHA 4LXUA 4OJPA 1CLUA 1PR3A 4RNDB 5IVIA 2C3PA 3W1VA 4MEYA 3K7EA 5E2AA 5FEUA 2P9BA 4REQB 5FDFA 2Q27A 4JLVA 4OQDA 4FFMA 1JF8A 1P31A 1HIWA 3NAGA 5EVCA 4ARZB 1IXRC 4P7FA 4MA4A 3N7AA 5DQGA 3EPLA 2B78A 2XZTA 3KDSE 2P69A 5CG2A 2ZB3A 2X7XA 3B51X 2WZCA 3L4KA 5JOQA 4YIKA 1MVLA 2X0KA 4NNPA 1OWPA 2J6UA 3KHLA 4R2XA 4HRXA 1SXJE 3QI7A 1QGUA 5F64A 3O1IC 4C6SA 3RR7A 4ENTA 1O4WA 3V8QA 1EUCB 2P9HA 2A57A 5IC6A 2A9FA 3JWGA 5FLKA 3D2CA 3EGOA 1OXBB 4D4HA 5EWFA 4XR9A 4O3MA 5G1PA 2XCTB 4OXIA 3PX6A 4J0IA 1O5IA 1ZH6A 2IA6A 1Z37A 2J9XB 3E23A 5JNSA 2ZZNA 2BFCB 1SWWA 3KAKA 3HA2A 1Y3AA 3DA8A 2QB1A 3WDMA 5BR8B 2C97A 3TLXA 5IJZA 2O0KA 3KOWA 2VRNA 4DS3A 2BUBA 1ZGZA 5KWSA 4C2TA 3IOMA 4G5QA 4HQLA 3KC2A 1OCEA 4TTIA 1OLXA 3RFCA 1LVUA 4FMCF 4RPHA 3RYFB 2EZ9A 4M0AA 1CUXA 3RUIA 2L2QA 2X1MA 3RYTC 4S2EA 1RT9A 2QKQA 2G9ZA 3TPCA 4ETNA 4RS4A 2YJ5A 4MK4A 4BQOA 1Y8CA 3GLIA 3EY4A 3KKZA 3ES9A 2NLOA 1B73A 3OEYA 4YRLA 5LC1A 2C58A 2KZZA 3TINA 3ZCXA 4CT0A 3NTUA 1EE1A 2BGUA 3UMCA 4YCAA 3OTQA 1C7JA 1RRFA 2NO7A 3KYBA 3OF3A 5EJ7A 2JCYA 5L4NA 1ZM9A 4YMNA 3V6KA 1YR3A 1KI4A 2GN4A 3NRWA 2O20A 2WP8J 2VBGA 3H2YA 4ZQCB 1L7PA 2QP4A 4WAUA 3DD1A 2PKWA 5JBIA 3PKJA 2XY6A 4K9DA 3ICEA 1RWVA 4UPVA 2MCFA 4O4LF 1AZLA 3MGVA 2E3JA 1SKRA 1VIVA 3HCDA 3R3WA 4PLYA 5HEKA 1W29A 5EHGA 4EUKA 2XCIA 2FZ4A 1ESDA 1SIOA 1TUEA 1NLZA 2ZBRA 4PGMA 5FIUA 2VTBB 1I2MA 1Q1ZA 1THZA 2PUDA 4G5XA 3SV4A 1I3OA 3IUEA 4XTCS 1BROA 4PONA 4YLGA 5B1HA 2F55A 1Y4UA 5DBGA 2KG5A 1NKVA 2H2AA 1NNI1 4P4SA 4PTZA 1RZTA 1L2TA 4FIDA 3P20A 2HNKA 3MQ4A 1QVVA 4V24A 5IM5A 1W9HA 3VVCA 4RTQA 1KVSA 1PHRA 2VJYA 1UXIA 1ESMA 2OG2A 2QV0A 1SZHA 1QVRA 2A1JA 1BXRA 2PFPA 2JZNA 3BGDA 3C7KA 2QNBA 3VHQA 5KL1B 2RHMA 4BUZA 4DARA 3MWJA 3WISA 2J1LA 3FGNA 2KLHA 3QFCA 1MC8A 4YPVA 5HIMA 4DRZA 4XCVA 2E49A 3IKVA 3UWSA 3STYA 2O8BA 4IC9A 3WLJA 5ERXA 1NX6A 1NYQA 2WK1A 3SZOA 3RYIA 1Z3IX 3N2KA 3MQFA 3UZUA 1EZZA 4GX2A 4P0PA 1LJ8A 5CB8A 4KAXA 1XKLA 5LZ5A 4YDQA 1UFVA 3GOQA 5ADHA 1RJWA 1T2DA 4F2RA 5JS7A 2C94A 2GEJA 3BTOA 5A4DA 5CB0A 1JWLA 2W83A 3O2SB 2JG3A 5KG2A 3DYVA 2C95A 2R5WA 3K9NA 3TB4A 1MN6A 3OIYA 3A28A 4ED9A 4BLUA 4BNUA 2WF8A 2OCBA 2XBMA 2MSLA 2A9VA 3EGXB 4Q8EA 3PJEA 1SV0C 4X8LA 4DA9A 4BMCA 4N3BA 3MWGA 3NP7A 3VQTA 4JB3A 2DT8A 2EJWA 5JXJA 1D2EA 2C77A 3IN5A 2PGAA 1SKWA 1E6LA 3OEHD 2QE7A 4HMQA 2WLSA 1P81A 1X92A 3NLLA 5I5EA 1AS3A 4Q4AA 4ZVQA 1TKAA 1IQPA 4Q3AA 1QR6A 4YS6A 3CE6A 1TVCA 3C98A 4JT4A 1PK7A 3FIJA 4QX6A 3TW4A 3DT6A 2EQYA 3R5KA 5C8XA 4DC0A 3D4LA 4ND8B 4FD2A 4QOEA 2WTAA 2G5TA 1IBRA 4MQBA 3GFSA 3Q6NA 4EL5A 5DW3A 3IQDB 3HN2A 2A92A 5ELXA 2GSDA 3I72A 2YZMA 2ZS8A 3BXZA 4WJ3B 2IPXA 3PO4A 1YKGA 2FLKA 2CNBA 3DE3X 1Y42X 1U6IA 3N76A 1XD2A 5I9LA 4MWDA 4FZRA 4RNNA 5CGQB 4R81A 1X1BA 1HLPA 2HJ9A 4HWOA 2I3AA 4IIVA 2EJBA 2QQGA 3PPYA 2PRIA 2VT6A 2V6FA 3DE2X 4L4YA 3CLSC 1WUKS 4Q43A 2XKJE 2Z5GA 2WAQF 1JTFA 2ZYIA 3AM4A 9ICKA 3T9BA 5K8JB 3A9CA 3MC1A 4P4OA 1W34A 3GHYA 4IDDA 1O94D 2H57A 5K09A 1PK8A 3PC4A 3B2EA 4F38A 2IU0A 3LYLA 3UHPA 2XQJA 1PR5A 4WA7A 5FI0B 2A19A 1Z5PA 3QNMA 2H3HA 4AP9A 3K5IA 3PT5A 1ZSVA 2ZT8A 4FOTA 4ZJPA 1BX1A 2ATXA 4IR1A 3HXLA 4HGPA 1QJCA 2H4YA 1WY7A 1ADYA 2XIJA 4DLUA 4AJJA 4KO8A 1GR1A 2IEIA 5HFAA 4L6CA 4BO3A 2J0EA 4TV9A 1VBMA 1GRNA 1ZVJA 2Y0BA 2ZE5A 4RKQA 5J23A 2CLIB 1HXHA 3V8VA 2CE2X 3HU3A 1AQJA 1GJRA 1NP3A 2NZUG 3GUHA 4YRDA 3COZA 4A6PA 2CT8A 2PJZA 1X42A 1ZVMA 3U3ZA 1B8UA 3H0MB 3OSPA 3OBIA 4TMWA 5K0TA 2R6HA 3G85A 5AI0A 2VBIA 1Y8ZA 1O57A 5K6AA 1C20A 1O6BA 2J3HA 2QR3A 3JRXA 1YD7A 2DY0A 1GNLA 1R0CA 3K94A 3SHFA 1A96A 1QV6A 3MRVA 2XA1A 4IDGA 4PSKA 2G07A 3U37A 2E1EA 1GN8A 2X19A 2ZPAA 3O3OB 3IUBA 3LO8A 3LPCA 1XFDA 2CVPA 1UDCA 3OESA 4BE4A 1CVRA 4CMBA 2VSFA 1M5UA 5EZYA 5ALNA 4D4LA 5AK5A 2II6A 3AZPA 3FCUB 2KJ5A 1VSQA 1BE6A 3OTGA 2A1IA 4ITUA 3GGPA 2ANBA 1U31A 5HKLA 1KU6A 1IBKB 3X2FA 2R6ZA 1MIOA 3ITNA 2HM7A 4RZ3A 4AG5A 2IBKA 1B6RA 4JD5A 2OXRA 2RC6A 3TGWA 4ALIA 4TQSA 3T1NA 4NONA 3WY9A 2RGUA 3C3PA 3KL2A 2VJ4A 1IIRA