3NASA

The crystal structure of beta-phosphoglucomutase from bacillus subtilis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
207
Chain Sequence
b'LKAVIFDLDGVITDTAEYHFLAWKHIAEQIDIPFDRDMNERLKGISREESLESILIFGGAETKYTNAEKQELMHRKNRDYQMLISKLTPEDLLPGIGRLLCQLKNENIKIGLASSSRNAPKILRRLAIIDDFHAIVDPPDIFLTAAAMLDVSPADCAAIEDAEAGISAIKSAGMFAVGVGADLVVRQTSDLTLELLHEEWEQYRIRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-phosphoglucomutase
publication title The crystal structure of beta-phosphoglucomutase from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 58
structure length 207
sequence length 223
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2010-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3nasA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3nasA01
1KYTA 5A3SA 3WK6A 2HI0A 5AKEA 4UM5A 3ZW7A 3OCZA 2IOFA 2MU1A 3EF0A 3A1DA 2RB5A 1Z5GA 5AI4A 3EF1A 5AK4A 5AK6A 3AR2A 2HF2A 2P11A 5AKIA 5AIAA 5ALVA 4JB3A 3UM9A 2FPXA 1Q92A 3K1ZA 1YJ5A 2B30A 3MPOA 1YV9A 4UM7A 4KNVA 5FP0A 1X42A 5AIBA 2R8ZA 3QYPA 2GO7A 5ALKA 5AM2A 3KC2A 4XOUA 3U7FB 3A1CA 4EZEA 5AW3A 3DAOA 1VJ5A 4L6AA 3ZX4A 5AK3A 1LTQA 1Z4PX 5IT0A 2AUTA 2CFSA 5AW5A 2P9JA 1RRCA 5AKKA 1U2SA 5AK5A 1L7OA 3M9LA 3ZTWA 3MC1A 5ALZA 1TE2A 3E84A 3PCTA 2NYVA 1CQZA 4QJBA 5AW2A 3ZWKA 1ZD2P 3ET5A 2W4MA 5AKJA 4BBJA 3N8GA 3B9RA 2G0AA 3U7GA 2JARA 4EENA 4HAIA 3AR9A 3ZVMA 2C8LA 2HOQA 2HCFA 3N5KA 1VFPA 2I34A 1J97A 3I6BA 5AESA 4DFDA 1Z4OA 2FI1A 2I6XA 2B1RA 3SLRA 2GHQA 3ESRA 4H1WA 2NO4A 1QQ6A 2BY4A 2YFYA 5ALXA 4UW9A 4F72A 2YJ6A 1L7MA 4FE3A 5AM5A 3WGVA 2HHLA 1NRWA 1RLTA 1WPGA 4EELA 1SWWA 2RARA 2Q5EA 3WK7A 2OYCA 5JJBA 5ALMA 2G09A 5IS2A 5A3RA 2YMMA 4J03A 4Y2SA 5T41A 3W5AA 2FUEA 4KNWA 4CNQA 1RQNA 3QUCA 2GHTA 3NUQA 2HF7A 4HGQA 3HLTA 2B8JA 3L8FA 1L8OA 2B82A 3J7TA 4CF5A 4OFZA 4E88A 4HGRA 4CF3A 3L7YA 3P96A 2DQSA 4UMVA 4KYTA 2EAUA 1S8OA 3WKCA 1ZD4A 1RPZA 2YJ3A 4EX7A 1Z4NA 2AGVA 5AKHA 2Q4RA 2W43A 2OA0A 2HO4A 5AKZA 2WFAA 1TJ5A 3MMZA 5AW1A 1Z4MA 3U7HB 4KN8A 1WZCA 3U26A 1Z4IA 1EK2A 3SF0A 4YH1A 1NF2A 3U13A 3I28A 1VJRA 4PNHA 4ZEWA 4BX3A 3ZVNA 2IOHA 2BDEA 3L0CA 1YDFA 3OPXA 2NO5A 2ZOSA 4XE5A 3SHQA 3W5BA 2B8EA 1ZRNA 2YMPA 1XP5A 3ONNA 1T5TA 5AW0A 1ZD3A 2FPUA 4OD0A 3M1YA 3WK9A 3QLEA 3AR5A 2YBDA 4Y2YA 2GMWA 4BYGA 2OM6A 4L6CA 4ZEVA 4YCLA 1FEZA 4C4RA 2IOFK 1TA0A 4C4SA 4CF4A 5AW8A 3KDPA 4DWOA 4HGNA 3HYCA 3FGOA 4DW8A 2D2VA 4YIHA 4Y2PA 2IYEA 2BDUA 2YMLA 3S6JA 3PGVA 3AR3A 2C9MA 3UMCA 3OCVA 5AM0A 4UATA 3I1YA 1SWVA 5ALPA 1RKQA 1YS9A 1Q91A 4FFDA 5ALIA 5AVVA 3N1UA 2FPSA 2WF5A 2CN1A 1T5SA 2C8KA 1QQ7A 2G80A 5AW4A 5AVXA 3R09A 3B9BA 4AS3A 3WK4A 2WHEA 4NAVA 2VKQA 3CZ4A 4UU1A 3R4CA 3ZVLA 4FYPA 1J8DA 3ZWDA 3WGUA 5AHXA 5AKGA 4GIBA 2P69A 1ZOLA 5ALQA 1Z4LA 4QQFA 3FPSA 1U7PA 3SD7A 4UASA 3WKEA 3OCXA 5AW6A 2P27A 2IA5A 1L7PA 1IWOA 2PQ0A 2B0CA 3QGMA 4UARA 4L57A 3B8EA 4XQ0A 3L0BA 3AR4A 2WM8A 3MN1A 4G63A 1U2TA 3IB6A 4RETA 4YCNA 3QU5A 2RBKA 3FZQA 2HEGA 3L8EA 2R8XA 4YIKA 3WKDA 1ZD5A 1Z4QA 3L0YA 3SKXA 3SMVA 3ZX5A 2ZBDA 3AR6A 5ALEA 1RMYA 3NASA 2FPRA 3ET4A 4I9GA 4OHFA 5AI0A 4F71A 3SKYA 3QU4A 2G08A 4HGOA 3ZI4A 4CE6A 4UMFA 5AVZA 1Z88A 3QNMA 2FUCA 1T9ZA 2HX1A 3DNPA 4Y2QA 3EWIA 4AS2A 3QXGA 3NAMA 4Y2UA 4MWOA 4DCCA 3NALA 2YJ5A 3L8GA 4Y2RA 4EEKA 5ALNA 2MSNA 2I33A 5AVQA 2GFHA 5A3QA 2CFRA 3QX7A 2G06A 4O8CA 1NNLA 5ALRA 3WKAA 5ALGA 4BKMA 1JUDA 2QYHA 3DDHA 3QU9A 3IRUA 3WKBA 5ALLA 1QQ5A 3UMBA 2YN4A 4BEVA 3QUTA 1S2OA 3RF6A 1RKUA 1RLOA 1N8NA 3ED5A 1K1EA 1RMTA 5AKXA 4NFLA 3VAYA 5AVWA 2FDRA 3A1EA 4UAVA 4HGPA 2YMQA 1L7NA 3QU7A 1YNSA 2OBBA 4NWIA 2WF8A 1WVIA 2ZBGA 1XPJA 4XPZA 4KX3A 1ZJJA 3L5KA 1L8LA 5ALHA 4B6JA 3U7EB 2EARA 3OTQA 3OCWA 3EPRA 2FEAA 5AVTA 3PGLA 5ALUA 2AH5A 2HSZA 1PW5A 1YMQA 3L8HA 5AW7A 1TJ4A 1Z4JA 4IG4A 3WK5A 4ZEXA 2JAWA 5AW9A 4BX2A 4UMDA 2R8EA 1U7OA 2G07A 4AP9A 4Y2VA 3IJ5A 5AVSA 2PR7A 3KOOA 1Y8AA 4HYTA 4G9BA 2O2XA 5AM1A 3OCYA 5ALTA 3FVVA 4BNDB 4YGYA 5ALSA 2ODAA 1RLMA 5ALFA 1RMQA 3TLMA 2FPWA 2JGAA 4NV0A 4UU0A 4YCMA 1XVIA 2B1QA 2G1AA 2ZBEA 1QYIA 3D6JA 3E81A 3NIWA 3FPBA 2MU2A 2ZXEA 3CNHA 3E8MA 2QLTA 2JAUA 5AM3A 2PKEA 3OCUA 3QUQA 4Y2TA 3BWVA 1LVHA 2O9JA 3KBBA 2W11A 2R8YA 4EX6A 3L1VA 3QUBA 4Y3UA 1O03A 1RDFA 3NRJA 3F9RA 4C4TA 3FM9A 3NANA 3DV9A 5AKLA 1RC8A 5ALWA 5AKYA 5AVYA 4BX0A 5AI5A 1N9KA 1ZRMA 3GYGA 3AR8A 4Y2JA 1CR6A 3N28A 3ZTYA 5AVRA 3KD3A 2I55A 4BEWA 4IFTA 3PDWA 2I54A 2ZG6A 1WR8A 4MUMA 5IT4A 4BNDA 1RQLA 3ZUPA 4UAUA 3R9KA 4UMEA 2YY6A 3ZU6A 1MH9A 2WF9A 5ALYA 5AI8A 2CFTA 3I76A 5AM4A 1U02A 2Q4TA 3ESQA 1Z4KA 4KX5A 3QU2A 5ALOA 2ZBFA 4JDPA 2RAVA 3BA6A 4RESA 5AI9A 2C4NA 4Y2XA 2EATA 1QH9A 5ALJA 2YJ4A 3E58A 3L1UA 2WF7A 3WK8A 2WF6A 3RFUA 1O08A 5E0OA 1F5SA 3KZXA 2HDOA 3UMGA 4OCZA 5ALDA 3AR7A 5AICA 1RKVA 1EK1A 3A3YA 4GXTA 5AI6A 3N07A 2C88A 3W5CA 1TJ3A 1ZS9A 4J2TA 3W5DA 2JAOA 1AQ6A 2X4DA 4I9FA 1SU4A 3U19A 1L6RA 2AMYA 2I7DA 1Z5UA 5AVUA 4NABA
chains in the Genus database with same CATH superfamily
1NMXA 4YJKA 4FWBA 3MRTA 2GN1A 4R6WA 2VQDA 2MU1A 1YGPA 3EYZA 2GOLA 4QC2A 3C7KA 3AUXA 3GEIA 4P2HA 4YPVA 2GD0A 1DWPA 4D4GA 3N2YA 4GR4A 2HYDA 4HG2A 2ANBA 3Q87B 1LNZA 1YR6A 3PR3A 4TS1A 4MI3A 1ATZA 2C2DA 2O1WA 2Q5JA 4IUCS 1E2QA 2YXBA 2EAPA 4GECA 1CE8A 1YJ8A 1LI5A 4I46A 3KCNA 1H4TA 2IXBA 1NX6A 1QRDA 1YQGA 3ZEIA 1D04A 1I5RA 2GHQA 1QQ6A 2VL7A 4LXTA 4KXQA 4UW9A 2IXEA 3QOFA 4EEYA 2L69A 2AN1A 1YASA 5J8YA 4FOTA 2HHXA 4C6RA 1SQSA 2PUJA 2W7TA 3F6YA 2E6UX 3DOFA 3WV5A 9ICGA 2Y92A 2QRGA 2DQZA 1SZHA 3EVTA 4UMVA 3C98A 1IIBA 3DBVO 5J23A 1UJ4A 2WMNB 1CU1A 1P91A 3EY4A 1E2GA 1H2ZA 3UV7A 3L84A 2IPNA 1LF5A 4MI6A 3BE6A 1SEPA 3D8SA 4ALIA 3EYWA 5LQSA 2FX2A 5E6UA 2FPUA 3C6YA 3IAS1 1Q7EA 3WWPA 1TVEA 5LQDA 4DA4A 4HTFA 3GAMA 4ZQHA 3N7TA 4Q9DA 4JYAB 1X3SA 4GKAA 4Q15A 1U6IA 4MQLA 2PRIA 4MB0A 5LSAA 3FWKA 3RWBA 2FZGA 3EGCA 2APJA 3S8MA 2FXVA 2GEUA 1UJCA 2HK8A 2R6R1 3OPNA 3UXYA 2D5IA 4MCHA 1XC7A 1BH6A 3KRTA 3L0PA 3O8QA 4WACA 4NLGA 4M4SA 4XSHA 1N5OX 2DLNA 3K9NA 3STVA 3QPWA 3OU7A 3P9ZA 3BVPA 7GPBA 1NYTA 3SYNA 4PHCA 4GI1A 1G5PA 4JKOA 1Z6XA 1Z2PX 4L6IA 4A73A 3U2QA 5L8VA 3MLAA 3IOMA 5L3QA 1TMGE 1E7RA 1CJMA 5LJIA 1U7HA 1BVSA 1O54A 1EEHA 2FMKA 2W9AA 2ZANA 2GJ4A 3V8PA 1SCAA 1CR0A 1QVAA 1MJNA 1NI4A 1TTHA 3JARB 4QPDA 3DT6A 2CNLA 4NBLA 3AUTA 2RHRA 3G2OA 3CSSA 5KKCA 3PVZA 4L4ZA 4ODIA 8ICNA 4XWOA 1RYMA 2OK7A 3U7EB 3ITDA 1UDCA 3UHFA 1E58A 4RCYA 1PL0A 3A0HU 4JQZA 2AH5A 3G6WA 3RSLA 1BFDA 4YMIA 1GU7A 2NO7A 1XJCA 7ICTA 2GKSA 1MU0A 3EOZA 2CDRA 1D2GA 2HRCA 1BMFA 4NV3A 3O8NA 4U2BA 4PCVA 1XNGA 1L7QA 1RHJA 2Z9DA 4ZOHC 3PR4A 1HSOA 1SHKA 1U7DA 1FDWA 1Y9AA 3I3OA 2WUEA 4F2PA 1CRLA 1U3DA 3FDIA 2FEOA 4FQ5A 1OYWA 4UUPA 2HBLA 4A8PA 4WFQA 4D42A 1CZOA 3HFGA 1K6IA 3WSTA 1WUIS 2BKVA 1SBIA 2HMAA 3BSYA 3NBXX 2DYKA 4JXKA 4B48A 2X0FA 3GUZA 4YC7A 2ZTEA 3E15A 3L9XA 4JC8A 1WS6A 3HE3A 2ID9A 4WI1A 3L4JA 3KHRA 4AYXA 1N32B 1BQ4A 8ICFA 1U0BB 3WV4A 3U61B 2H06A 3JTMA 3S7ZA 3VAAA 1US8A 3R0QA 3U17A 1T3NA 4FVTA 2FMTA 3PTAA 1T6XA 1YQUA 5EUCA 1TT7A 3F6CA 3QSYA 1G7CA 3NC1C 4DBVO 4AJLA 4RAOA 1U7UA 1NVGA 4RVSA 3PQCA 2HSDA 4ONEA 5FR1A 4HY3A 1Z07A 4DJJA 3H5VA 1PZGA 3V1TC 2QUAA 4NMMA 3CUKA 5FYDA 3JWPA 1FJHA 1GZVA 3PHIA 3LUKA 3DEIA 5E1OA 4AJ4A 1A5SB 4CQLB 3FOWA 4BIIA 1BN7A 5F3RA 3TNFA 3SN6A 2JLUA 3K2QA 4P33A 4KC0A 1R0LA 1CZRA 1E3TA 4MHTA 5ALXA 2OILA 2FU5C 2HVIA 5I7RA 3RARA 3EPJA 2UVPB 2WYVA 3Q3EA 1IE3A 5DLFA 1SHUX 4L02A 4PXSA 1MIHA 4D5GA 4E4TA 3TMKA 2Q9CA 2ID8A 4PFJA 4Q6BA 4IR9A 4KPUA 1QGED 3MILA 4PO8A 4MGEA 2WMYA 7REQA 2FFJA 4CG3A 1YZFA 1ZA1A 3TDMA 4NCJA 5SY4A 1KSFX 2XICA 4DARA 1JLHA 4JX9A 4DEVA 3VZDA 2PZ8A 2BP7B 5KTPA 2BTEA 3LYLA 3K9HA 2WTUA 4MUGA 2NUTA 1PJZA 4N7BA 2P9CA 3UA3A 2ZYHA 3GJTA 2I2FA 2JC3A 1HE5A 1SCIA 4XM1A 2R68A 2RAFA 5DGHA 3WRXA 1KI3A 2ZQZA 3L8DA 3G9QA 3NV7A 1JHYA 3KLOA 3A6JA 1PT9A 3WU2U 1EFTA 1L5KA 1XZHA 1XPUA 3CLSC 3RSCA 1P9LA 1N63A 3PC6A 3PMNA 3G5LA 4G1UC 3DYVA 2KSOB 3G2KA 3EFHA 3PUKA 1WEKA 2C2BA 2WSIA 3I05A 5KNDH 2PFPA 2PQ0A 3HADA 3K4QA 1TLLA 1UKCA 3FB1A 5K6AC 2B0JA 2R8XA 1J0CA 2Y77A 1P7CA 4B31A 4AO8A 2J7PA 4UMFA 1WW8A 2ATVA 2ZKIA 3KEQA 3FZEA 2HX1A 3URKA 1H22A 2GEKA 2GZHA 2OCPA 1GKYA 2PTGA 2K7FA 2FN3A 5ALNA 2HDHA 4EK9A 3UFXA 1ZJMA 2CDNA 4LA4A 1E9DA 5TF4A 4URFA 2X3UA 4R16A 1K1EA 1NYQA 3FTNA 4OXQA 1N7JA 3D5TA 2Y71A 1ZJJA 3DONA 2JVKA 3ENZA 3AM4A 4MR8B 2JEOA 2GK3A 1YDGA 5ALUA 1PT6A 1XALA 3LFUA 1GNSA 2JFOA 2OAEA 5SV2A 3AFGA 1V26A 4TWRA 4DRZA 4WN9A 1JLMA 1ILEA 3GJ4A 4EVSA 3R0VA 2B78A 4NC9A 5AVOA 3GXBA 3PNVA 3M33A 3JRXA 3W1EA 5JZBA 3FHLA 1RJGA 4Y6PA 5FBLB 3CFYA 5CB4B 1USWA 4RD0A 4YT4A 3PUIA 5LWHA 1EI9A 4P82A 4BKQA 3CKKA 1AM4D 1HDOA 3PNKA 2CVQA 5AKYA 5A03A 3DM5A 1PWXA 4R84A 3QHAA 1Z1BA 3ZLBA 3IT2A 5COQA 3IP6A 1J99A 5EE5B 4W7HA 3R9KA 2VTEA 2QNRA 4RL6A 3I9FA 1XAJA 1C8VB 3PX0A 8OHMA 3D8UA 4C0SA 3WJAA 3OBBA 5KJEA 5C5CA 3OUZA 5I8PA 4J1SA 3TLGB 4C4YA 3ESYA 1ZW6A 4F9TA 4Y0AA 2VF2A 2FLPA 3EC2A 1BE6A 2H1WA 3HDVA 4QGBA 2IOYA 3OCCA 5GAJA 621PA 3EXFB 2C88A 5K9ZA 5HJ7A 1PWHA 1JSXA 5DPMA 1ZVQA 3WBJA 1QYWA 1KQ3A 4F12A 2X6RA 5A3SA 1HK7A 2H31A 1J70A 4DR4B 2VBIA 3CVJA 2VDWB 4N82A 3JWGA 4REOA 2QLBA 1GTSA 4J9KA 2QRUA 4G5RA 3JPWA 2F59A 1KAHA 4M1MA 1KE1A 2LR0A 4KR9A 1JLRA 2P7IA 4UB6U 5CVUA 1YRBA 1YZTA 2HTEA 2D1FA 1PRYA 4EFKA 3WLPA 3PEWA 1W36D 2NVBA 1TEXA 1U0HC 4YAWA 1HYGA 3JPTA 4D82A 3MC1A 2ALZA 2X5OA 4AECA 4CEIB 3M5WA 4C7MA 1NK5A 4J9RA 1E1QD 5KYXB 1O0CA 1N6RA 2X8LA 3U16A 4DYDA 2QAGB 1O95C 1T3QA 3A31A 2JJMA 3AEZA 1EVIA 3HO8A 3MTIA 1AKRA 4BLOA 5JAZA 2IS1A 4HGQA 4OLAA 2JLVA 1F0PA 1Q2XA 3CMMA 4EI8A 5U9CA 1DJPA 2A5JA 2VYNA 4YCJA 3UCEA 2W90A 1BA3A 5E9AA 3NW9A 1U3GA 4LJRA 2ISCA 3EPIA 1ATIA 2RBGA 4LVCA 1DQZA 1JPVA 2FFBA 1E2NA 3L0DA 4MQEB 3KM0A 1JQEA 3BWCA 2DECA 1BCSA 2H85A 4M54A 1II0A 2L82A 3KOWA 3M89A 3PTLA 3FNQA 1WDWB 3PDIB 1EHIA 2Z3WA 1QO0D 2PYZA 3CX4A 2EOAA 5EXPA 2OZPA 5B1SA 5I7FA 5BYBA 5ARDA 4D3XA 4KLNA 1KQPA 2WKSA 4XDHA 4F5DA 1VFNA 2VHUA 3O38A 2Q8QA 1Q7BA 3UNXA 5IX8A 1U7TA 2PD3A 2PSFA 3J80A 1RQ2A 3WQBA 1X8KA 4O2AA 8ICLA 1DLJA 4IVQA 3GIKA 3DF7A 2PFKA 1P3Y1 3AY7A 1N8KA 1KLNA 4B9TA 5DO9A 2XV1A 1VIAA 3AETA 3SAHA 2I4MA 2K87A 1MC4A 3F2IA 5JRDS 1WHSA 1ZKMA 3QKIA 3D3NA 1PLKA 3WB1A 5DB7A 2ZIVB 1N9GA 3SYMA 3EIQA 3JVVA 1P75A 1BPBA 2AXNA 4Q4JA 3JTEA 3DUFA 3QY9A 3O92A 2YS6A 3EWAA 5WRFA 3H5TA 2H3ZA 1P74A 3OQNA 4LECA 4OOFA 4K9NA 3IP7A 2ZAIA 3MUEA 3PEUA 5HIKA 2AW3A 4IIBA 4DL4A 4E1VA 2Z95A 3FI0A 4JR2A 4OQMA 3I8OA 4EVIA 1O96B 3PB3A 3L4EA 5KI6A 2COEA 2A78A 2GESA 1ZQGA 4F4WA 1NSFA 4PZ0A 2XMZA 4EJ2A 2B7LA 2XSZD 3WBFA 3DHYA 1F14A 4RH3A 2OHFA 3L07A 1A2KC 3KQUA 2FEAA 1PNVA 2KJ8A 3K30A 5KPDA 1SXQA 3H11B 1Z4JA 1XNJA 1Y80A 2H0QA 1VI2A 3LF1A 1DDIA 2JZBB 4FN4A 2DFDA 1WCWA 1E9AA 1CS0B 3ZWWA 4DCSA 2PK3A 3QEAZ 3PVXA 4RU1A 1QZ3A 2DF4B 5HBGA 2QW8A 3HCPA 4F5WA 4JLJA 8ATCA 3HBMA 2ZRHA 3VNSA 2ZXIA 1LBEA 1VMEA 3OG9A 3GUUA 5FOXA 4ZALA 4ZVVA 1TXGA 1BX3A 3OEHD 1GLNA 2A7XA 4DLLA 3LRTA 4MUMA 1EQ2A 5A3JA 2RGUA 3F2CA 3L82B 2CLFB 5AMXA 3T5JA 2UZ3A 2Q6KA 5HJEA 3BICA 5COAA 4LNUB 2H4YA 4BVJA 1PCXA 1G3IA 3E0QA 3EAQA 2F1JA 4W5OA 2RGNA 2W7PA 5JVDB 2IUFA 4EYOA 1TCAA 1BPXA 2ZATA 2X7JA 4MQ6A 1NF9A 2ZP1A 3RVMA 1E3WA 3VPDA 3U19A 3KBOA 3SF8A 3WLTA 2X8BA 4W5RA 1QO7A 5CW2A 5CHGA 3EF0A 2HF2A 1Q3HA 4HBZA 3D3EA 5B5SA 3GD5A 3N0RA 1G5RA 3D3JA 4HGYA 3C6KA 4ENVA 2XTZA 2IXTA 5HS6A 2AN9A 4I4CA 3NZEA 4KLAA 1XKXA 2EQ5A 1R27A 4JT8A 2O4UX 2F1KA 1JFFB 4TV8B 3TPFA 5JBQA 1U1EA 1Y4SA 2VOEA 1WD7A 1DOZA 1EXMA 1EX9A 3K8ZA 1EFAA 4CQMD 3I64A 5KAFU 3OTWA 2HD4A 3KJXA 4Y98A 4J03A 1WMDA 1R15A 3PTZA 3HZZA 3H17A 1RQNA 2VUHB 4X20B 1B0XA 3LZ6A 2DWQA 4HZIA 5K8UA 3VKUA 4O3SA 2X2PA 1CY4A 2V8BA 3IM1A 2Q9UA 1A7AA 2EZUA 3KP1A 2YQZA 1FJGB 4S1TA 2C97A 3Q7PA 4R1PA 3ZE6A 5EEGA 2P0YA 3L0CA 1TRHA 3BZBA 4ZARA 2QXUA 1UMBB 3VU9B 4JEHA 1CUDA 2NYUA 2C98A 4KSBA 1M54A 1EB9A 3RJ9A 1XU7A 1S76D 3NJRA 5HM6A 5F3XB 2Y1IA 4BYGA 3TMYA 5H82A 3PSAA 4M2LA 1FW8A 3T5PA 2G04A 1BPEA 4ESHA 4KFRA 2X7XA 3JZAA 4M8LA 4JJ4A 4KQFA 2OCBA 4AZ0A 3GV7B 4RHUA 2PMZC 4QIWF 5KU1A 3L41A 2IIQA 4EI2A 5I4KA 4EHJA 4RXUA 4RA9B 5FEUA 3L0ZA 1O94A 1QQ7A 3QBEA 3QHPA 3H1GA 2JHGA 2V6MA 1K1QA 4L72A 3O2QB 2XNHA 2QX6A 4TT3A 5ALQA 5JFGA 2KW5A 3OOHA 3PO5A 2RKWA 5JXHA 2PXIA 4XQEA 3GZNB 3I61A 2HA2A 1U2TA 4WZAB 2PUVA 2HJ9A 3P9RA 3R3HA 4FGUA 3D2NA 1U49A 5TVKA 5KJCA 2O8EB 3TYXA 2BCGY 5AHOA 5M34A 4RA6A 2O8BB 2IHMA 2Y9UA 2C2YA 3P2OA 1BOOA 1FBTA 1Q1AA 4UDOA 3PVSA 1J8QA 3K35A 1LLFA 4ZCPA 2ZTLA 4PGYA 4FR5A 1BEZA 2G5GX 4D56A 3N0WA 1DSSG 4LCEA 4OJ5A 2G28A 3L6EA 3UJCA 1NJGA 2JIMA 4QBGB 3LCCA 3VU3A 1PHPA 2AKEA 2WD8A 5BVGB 1EFDN 3H0KA 4OXIA 3O8LA 4QGHA 4IQ0A 1RR6A 3ALRA 2G5IB 3N70A 1RAGA 1Y82A 2JGJA 1LQTA 3IX7A 4WVFA 3UWSA 1CRQA 1UKZA 3KPVA 3S2EA 9ICXA 1JPNA 2NSYA 2KK0A 4P4NA 4BP9A 4GOKA 3OIYA 1DEAA 2QQFA 4Q47A 4B83A 1N8TA 4PSAA 4LYDA 1ZAKA 3V8BA 3MGHA 3AHHA 4C7VA 3W6ZA 4OFWA 1NJWA 1MMFB 3RLFA 2COKA 5H59A 3UJ7A 1RYHA 3ONWA 1C7QA 1YHNA 5DTQA 1SV4A 4EW6A 4BZPA 2MJLA 3F3MA 5IUJC 5DI3B 1UZLA 3OAAA 2ZRFA 1TK2A 1L5GB 4EHNA 1VCIA 3G23A 1E6LA 3VDNB 5A5EA 1G20A 1WBJB 3UICA 3GFTA 3MTAA 3DLTA 4QSHA 4B32A 4DJAA 3ZI0A 1OLXB 4K6MA 4YRDA 1DO0A 4BRSA 2Q6OA 5AI6A 3PWSA 3UJBA 4G89A 2L18A 2I7CA 3E5NA 3QVWA 4WK6A 5BN5A 2Y1XA 2AB0A 1M7GA 1EK6A 2Y93A 3ZXUB 2OXFA 1U1FA 4YP3A 3OEYA 1SKAA 4AY6A 4ECTA 2C82A 4GX1A 5JAHA 2H8GA 3ZHOA 2YJZA 5U4XA 2PUEA 3LDAA 5I48A 3U7FB 5B5EU 4DR3B 3JASB 1XTPA 4KIFA 5CFNA 4N8EA 5DM2A 4E6EA 4NCNA 3EPKA 3I73A 4OXNA 3SAGA 4F4KA 2HK7A 4CLEA 3ANXA 4KQ2A 1NTOA 2XODA 1RJ9A 3U7GA 4PGQA 2OLJA 4YUZA 3EGDB 4HDMA 2GN9A 4NZZA 3ZE0B 3EXG2 4AMVA 2WE7A 1S8FA 2NO6A 4Q9JA 2ZROA 1J8FA 3F98A 4GH5A 3U60B 4DLAA 4KNWA 3W7AA 2BQ3A 3I83A 4DNFA 5DLGA 3GJ6A 4M89A 5LZ9A 1D2AA 4BBAA 4R7TA 4X8OA 2VT6A 4ZT5A 3CKYA 4ALKA 3ZWNA 3BGDA 4XYBA 1X86B 3N97B 2AMVA 2ZWAA 5JAQA 3OZCA 1SKSA 3C7AA 1MO6A 5ADHA 3OZVA 1NXQA 3MGBA 1RTKA 1G63A 4C4PA 2IP4A 4PJ0U 1XFAA 3WIOA 4FR2A 3S8EA 1QOZA 4N0DA 3BWXA 4E6PA 2QJTA 1KFKB 1XTVA 2D1RA 3C1OA 4V0OA 3NMUF 1KFJB 5DYWA 3GCGA 4KWTA 5EIFA 2EZZA 2CE7A 3ZV4A 3TQ1A 2RIRA 4M7RA 4V38A 2OO5C 1UFRA 4M9LA 2VHVA 2PBRA 1N25A 1FBNA 1UUFA 2RC5A 4XCXA 5HKKD 1M2EA 1GD1O 2YL2A 3VISA 5C8YF 4MV4A 5E4YA 4HI0E 2QI9F 5KVSA 2ZRQA 3ST7A 3R77A 1QM5A 3PL1A 2H3FA 1RHQA 3TIFA 4OKSA 4C3OB 4DLNA 3LA8A 2D7DA 4Q43A 1ZQTA 1SCUA 3CF6R 3PX7A 1XD2A 3O21A 1GGKA 1XDGA 3IJPA 3E4DA 4IIGA 1XAIA 4KUGA 4O6VA 4ID3A 4EPVA 4KODA 3LUJA 3QE0A 4HMPA 1YZYA 1E6WA 2H1CA 4CLRA 3NAMA 2C2ZA 4CLOB 5A7HA 2E82A 3Q1LA 4IFIA 4UHJA 1GAQA 4M88A 4HDNA 3COSA 4GX5A 4JMLA 4MVJM 1Z5OA 5T5QA 2O3TA 3T7DA 2BGWA 2UUOA 4HGPA 1M2WA 4I3GA 4DG9A 3WQQA 3T4EA 3L6DA 1FRFS 4LV6A 3PW5A 1SHJA 3F49S 3AT1A 2PLAA 3MTGA 1XELA 5H7XA 4N0QA 3V1NA 2EZYA 3VVLA 1TK3A 4R83A 2PR7A 2P3QA 1V5IA 1X9WA 1UFVA 1XO0A 4U00A 2XBUA 3DDWA 1JHUA 4PLHA 3FW1A 2E8PA 2ZJ8A 1P62B 4HB0A 2Z2XA 2AFVA 1CCWA 2BFOA 2K6GA 4IEEA 2BSXA 5DBGA 2C29D 5J5VA 4YR7A 1NKTA 4DLSA 3NHKA 1IXZA 1SXGA 3RFVA 4URYR 3QKSA 2J59A 1QHSA 1YVUA 4X85A 1OLUA 5JOQA 2ZYSA 3EEFA 4ZOLA 1REQA 3Q88A 5ALOA 3TFSA 1IDOA 1OOEA 5JD3A 2P65A 4WBXC 4Y2XA 4DL2A 2CYCA 1KJYA 5FH9A 1P6XA 5BMVB 3C3MA 1XO1A 1QSSA 1XWFA 5FOUA 4ND8B 3PXGA 1Y7LA 3MWEB 2DCUA 4HH0A 1BEUB 3COJA 1LBHA 2BCVA 2HWUA 3BS7A 3KYCA 3I42A 5CBPB 2AN4A 2XYRA 2OWEA 3W04A 4LZZA 1GDHA 3GRAA 2P79A 4Q1AA 1GYRA 1GFIA 1JB9A 2A9JA 1Z5GA 2Y99A 3OQJA 1YB5A 1A2QA 4RF4A 3Q2OA 1TCUA 1ZI9A 5ADUS 2C96A 4JYCA 5LBUA 2PS9A 2GGSA 4QPNA 4NI5A 1BMFD 1KZYC 1SL1A 3F96A 3DMTC 5E7QA 4ZV7A 3DOIA 3NFRA 2SICE 1G2IA 2H18A 1JQLB 2Q62A 4U5XA 5AW5A 2F7SA 5D4BA 2FSSA 1UBKS 3HDQA 1QYXA 3RAEC 1DIAA 1RWNA 1QIIA 1QVWA 3FOBA 1ZC4A 3P0EA 4Y2GA 4B84A 3EGVA 3PNCA 3A10A 3FMPB 4M0AA 3GCXA 3LFHA 3O83A 4I4TB 3FH0A 1E2IA 4DR2B 3MJFA 4B9UA 4GQIA 3WGVA 5G4LA 2C59A 3IC5A 2HJRA 3FWZA 3COPA 4DKJA 4Z9XA 3W5AA 3ABSB 2B61A 3PGJA 4O4LB 1AQYA 2C78A 4KFCA 5GJCA 1R6XA 3K1RB 3KZNA 3Q8LA 4TS9A 1C3JA 2I67A 2BMAA 2SCUA 1P1FA 5LQJA 3R0XA 4JLAA 4TM7A 3ZGLA 4C0BA 1QCZA 1L5QA 3PNOA 3WHLA 4PRKA 3F6BX 1FDVA 2OBMA 1P5JA 1BJKA 1HNXB 1YDFA 2F8LA 3GRRA 2YINC 2B8EA 4BLVA 3CGGA 1IWBB 3UGKA 2AS0A 1T5BA 3CZPA 5AOCA 2HRZA 3V4FA 2E0IA 1K8QA 2VUTA 1B41A 1N3IA 5FTNA 3OWOA 1P5FA 3PSFA 2WUDA 4YMMA 1VLZA 1WBBA 4P4SA 2Z2JA 1WULS 1DAOA 1U0LA 2Z8YM 4IP0A 3ML1A 4IR1A 2YZNA 2EYUA 3TOSA 3QELB 5AHKA 3DLAA 1ULZA 4NM1A 2ACKA 2WJAA 4JOBA 3V2HA 1RRPA 1PKEA 3BZUA 4YDRA 2XUZA 4UASA 1LI7A 1FTSA 3A0RB 1UZUA 3MQ2A 4YUAA 1HKHA 1K27A 2PVSA 1IWOA 4YCSA 4J0FA 2OXTA 5DRYA 2NU8B 2IYUA 1UQRA 2RONA 4XSVA 3HWSA 5AJWA 2BDTA 1I32A 2NTNA 2X0IA 3B3JA 4PVDA 1U2EA 2OCEA 3TADC 3ZJVA 2H4FA 2Q7XA 2G77B 5KVQA 3E61A 5KX5B 2EQYA 1D3AA 3OPQA 5CCEA 4CQMA 1MA7A 2RHJA 4IHAA 4IIYA 3B13B 2IK8A 1AXGA 5A3QA 4UHDA 2ZYTX 3KYDB 2QTMA 4UVEA 1G7SA 3FZYA 2ZPAA 3TAQA 2OENG 3X0DA 3Q3HA 4K7JA 3VSCA 3DFMA 2XNJA 1S9FA 3VAYA 1ZU5A 2QD3A 2TMDA 3MRXA 4F86A 1O6FA 1WTCA 3PITA 1L7NA 2AMLA 4KAJA 3HEAA 3ABQB 3FDZB 1OWMA 1GNTA 3KLBA 1I94B 3ER9A 4UNSA 2AFHA 4F5QA 4S0ZA 1Q0UA 1KERA 4ZC1A 1A9OA 3L0IB 2MU2A 2FPLA 1JIKA 1KDVA 1Z83A 1W5EA 4G01B 4O08A 1FNCA 1Y8RA 2BZSA 4XVUA 3FM9A 4G84A 3CLUD 2QZZA 3L4PA 4I9HA 4X8LA 4JEMA 3O3OB 5AVRA 3MG9A 1WD5A 2J7PD 3S1LA 3UAZA 4E5DA 1HDGO 4X97A 3ZU6A 1HDYA 3HMKA 4MI1A 4GGPA 5AM4A 3ROTA 4A92A 2JLAA 2FLLA 1S8NA 1JEOA 3K0FA 4G41A 2WHRA 2YRWA 5EUQB 4B33A 2NADA 2XGMA 1JVNA 4OB8A 3R8CA 1QFJA 4LBVA 4YQEA 4DR5B 1N5XA 3RHSA 3LHKA 1VL0A 5LP6B 3D3KA 5K8IA 2KJQA 5B6IA 4N4AA 1W7AA 3IPLA 3TTWA 4D4MA 5DSZA 3VGPA 1CUWA 1TC2A 2RC6A 2BFCB 5BR1A 3LLCA 1V8BA 1XMQB 3B82A 4PHEA 3THYA 3K2BA 4K2AA 1BMDA 4TQRA 1T8TA 4XOUA 2YN2A 3UK7A 5AD1A 1Y7HA 2QENA 1ZQ1C 4NENB 1E4OA 1L7OA 5CYPA 1VG9B 3BIJA 4HKTA 4GLJA 3MSXA 2YQEA 4EENA 2QRMA 1Z4OA 3C8DA 3ICOA 1D4ZA 1FXSA 4YROA 2R25B 4BJ5A 3AI7A 2ZB8A 3TQIA 1X9IA 3M1LA 3ZY5A 3UW3A 5KFYA 2Y1KA 5T41A 4RWEA 4AWAA 5DHQA 1QCCA 4D9IA 3IESA 3L7AA 4KJXA 1RWVA 5EQDA 1RPAA 3AZPA 2ZJ7A 4P98A 2Q5OA 3W6NA 2V6GA 4HYEA 1GKIA 1TF2A 2A9VA 1XRNA 1UP7A 3H1AA 5DQHA 2NPFA 2ZIAA 4A8TA 1ZQDA 2I3GA 4V0LA 2XXAA 4L50A 3EMDA 2AD1A 2V9ZA 4UQLA 5KFKA 4JLKA 1GPJA 1S2NA 2YMPA 4ZT2A 1UPCA 4CF7A 5J2EA 1P4GA 5B1YA 1MIOA 4RAQA 5H4HA 8MHTA 1CV2A 3RUEA 1TU3A 3SZOA 4DLUA 4OJNA 1EIWA 1Y63A 2DPJA 4KQCA 5IUKC 5EJMA 4NBRA 3SBDA 4Y1EA 3UMCA 1Z00B 4X1YB 3INTA 4TLLB 2WZBA 7ICSA 2FJPA 5K0SA 2ZSFA 3TWOA 4OHRA 2GO1A 1GQFA 1LNSA 4AXBA 3EMBA 4TKZA 1OWLA 3CZ4A 4MO9A 4PG4A 5JY6A 4YHHB 1V3VA 3W1WA 3ZDYB 1U7PA 1FFSA 2YC2C 2H4JA 3ESZA 4BFUA 3SZ3A 1J2UA 1UCVA 3RHZA 4F96A 2PKCA 3UHAA 2VYND 5DFAA 2K8AA 2BEWB 3JQ9C 5HM8A 1NK7A 4WQMA 2C2KA 1T9KA 2Z4TA 3D4PA 3D2QA 3EPHA 1FCJA 1E2MA 4CETA 3KAJA 3VVCA 3NM4A 1JZTA 3TQOA 1M8KA 3NALA 2YJ5A 4Z51A 3RJEA 5SYNA 1AS2A 4HDQB 4IH4A 3IXMA 4QLOA 3ESBA 3ZKWB 3RBZA 4YMTA 1L5NA 4BNFA 1XMPA 3CZMA 3ROEA 3RJKA 2PMFA 4I5DA 5CNIA 1C14A 5DGAA 5EQJB 1KGSA 1F6BA 4KITB 3HDGA 4P0PB 1NA5A 2WWWA 3TLCA 3CVUA 2I2DA 2HIGA 4FBLA 3NORA 3NRBA 3H8WA 3BHNA 3PP8A 4ZEXA 4O2RA 1JJVA 1ZJWA 1G1MA 521PA 4ZI7B 5CT6A 1Z08A 3LNCA 2FB9A 1DBPA 4ZA2A 2QDXA 1ZXBA 3TW6A 3RTCA 2DY0A 3IQFA 2E4ZA 2O52A 4QEZA 5A71A 4LJKA 3KBBA 3TQHA 1N2BA 1T7PA 3T7SA 4JAVC 5C5EA 1H5UA 3TSZA 5TY0A 2IHTA 1YR7A 5AI5A 5KFCA 5AXCA 2I3ZA 5DBEX 5HKKA 4V3CA 4M04A 5AOBA 1UC5B 5J0XA 3DZIA 5JLJA 4OMFG 5IT4A 2V96A 2AD5A 2VNHA 2ZI4A 4KX5A 2XZDA 3E8XA 1DIGA 3QV2A 1QXSA 3KTAA 3CONA 3L1UA 4M8IA 2UXBB 4RD1A 3HCNA 1JA1A 1D07A 3ZH2A 1G3UA 4RVFA 1OW5A 2EAOA 1L3IA 3QVVA 4URVR 1NLZA 5C8XA 2PZEA 1M0WA 1GA4A 2SKDA 4CMHA 1PF7E 4X71A 1VYHA 4PX2A 3GMIA 1Z5UA 5E9JA 5DK6A 5B3JA 1GTZA 1ESEA 4NS1A 2V7XA 4US1R 3ASVA 4V03A 2DKFA 2RKOA 5D3KA 4FSHA 1Z28A 3VA7A 2DETA 4H0FA 2QY6A 4PYIA 3KB6A 5FV4A 3T7KA 4BWFB 4WCDA 2QTFA 1X14A 1DQSA 3QMPA 2WB1F 1W25A 1S01A 2M6RA 5IBCA 2UKDA 2POCA 3BKWA 4F5YA 4D4LA 4D2IA 2DKZA 5LQRA 1JHAA 4RACA 2R2AA 3SQXA 4HPXB 1Z18A 4DCMA 2JARA 2H2AA 2WWRA 2OYYA 1TPZA 2ZIZA 1G3RA 4N5NA 2B1RA 2OSBA 5B7PA 3ESRA 3LRPA 2A9OA 4NH4A 2XCQA 3PGXA 2ONCA 4AAYA 3O1HB 3K0AB 2HEIA 3NIGB 2IV3A 2XRMA 4QIHA 3H2SA 3LY7A 4ZCMA 3AINA 4BN5A 2DFPA 3B70A 5L9AA 1ZK4A 5CURA 5ENVA 4RK4A 2FUNB 2ATLA 1X9MA 2RHOA 2GZ2A 1WXQA 3Q9NA 2HTFA 2PDAA 1HZZA 3U1VA 2YJ3A 5A9RA 1XZIA 2QTNA 2C7RA 3JZMA 1FDRA 3GP5A 5L9XA 4X6XA 1KI9A 3GQVA 3FCXA 3PQ7A 4ASUD 3SS8A 3L1HA 2CHEA 2X9NA 3PFIA 1LBSA 3RIHA 3E53A 2JHDA 4B87A 3VC3A 3W5BA 1ZRNA 3RS4A 2JZNA 1ZD3A 1KBZA 4OYYA 3EW7A 3OLQA 3AUYA 5EWLB 4BAGA 1YSCA 3FBWA 4N5HX 4JYZA 3IAAA 2NUPA 3RBVA 5K0FA 4A26A 3LSYA 4B3XA 3AFIA 4D41A 3F4BA 4Z8YA 1MOQA 4MUYA 4US8A 2EQAA 3JQCA 1ZOSA 1BVUA 2BISA 4CL8A 3UOWA 2KZZA 1GGNA 3ZS9A 2MSDB 1KDTA 3R3XA 1ZEJA 2O1EA 3RK0A 1Z4LA 3B85A 1CVRA 3RTEA 1QKIA 1UK6A 2QYSA 4EZIA 1WB6A 4L57A 3EDMA 8ICXA 2Y0CA 3IB6A 3SZUA 1ZVMA 3VC8A 4DLTA 1ZZEA 5JRTA 5EMLA 3LX4A 2DR2A 5J0OA 3MLBA 3V4OA 5G0SA 4YAOA 1MORA 2D6FC 4RY9A 1A9RA 1E1YA 3ZDXB 3RWOA 2I99A 4E46A 1KWKA 1LZKA 1R00A 3C1AA 3BREA 3O26A 2ZI3A 4AU1A 1N4AA 1FUIA 1J56A 1RKXA 1GL3A 2GAAA 5J0WA 1NK4A 2KTQA 3RYHA 3LBYA 4L5JA 4G86A 3M2PA 1DEKA 3FNFA 4G5XA 1OBFO 2HMTA 3FUXA 3NO4A 1Q17A 5I7SA 3AF6A 1VGRA 5HXAA 3HBLA 1ZL0A 1IH8A 1E5QA 3BILA 4OGLA 3KV1A 4RT2A 3TRDA 3ESCA 1O94D 3GFQA 1SU7A 1K7YA 2O0HA 4PNZA 3GWZA 2JK0A 4Q9KA 2OPBA 3SCZA 4TT3D 3HJEA 4WNIA 1GSOA 5BQXA 2IXGA 3A04A 3G82C 4KLRA 3ROGA 4ZMSA 4G85A 3THOA 4P3XA 1EKXA 4ITRC 3T94A 1FNSA 2EEPA 3RC7A 1J2NA 1AKWA 1GPLA 2QTRA 3IP8A 4PIMA 3ACCA 1OV4A 1IK6A 1QHHA 1KP2A 3CF4G 2ZIWB 2YYAA 2MCFA 1T9DA 4Q9IA 3GDOA 1Y5LA 3LG2A 3RW9A 1DNPA 3BQTA 1AN0A 1WZEA 1RHUA 4DYVA 3SJAA 3K5PA 1TA9A 2NPOA 1J90A 3IO5A 5HWSA 2Q4TA 3UHPA 4AI6A 4L7VA 5JSFA 5KL8B 2IF0A 3MFIA 3TTXA 3K1TA 1B43A 1TEHA 3O4GA 1AUVA 3ZE2B 4CLXA 1H0HA 1KR2A 3T4XA 4FD2A 4B47A 1KJJA 3EA0A 2DPHA 4RENA 4BNNA 1KTQA 3GGDA 1EWYA 1OU0A 4N7JA 3KQPA 2YYSA 4YQZA 3UUGA 3G1UA 4D8WA 4DEXA 3FF1A 2H65A 2AU0A 4ECXA 1O0SA 1H0RA 4Q48A 1SBQA 4J9MA 1RXWA 3KT6A 3T5MA 2G36A 3MPOA 3M7IA 3D8BA 3H0MB 1I2MA 1JAHA 4CMCA 4G1VA 4UTPA 4UTVA 4BBZA 1XVUA 3D3WA 4CKBB 1U63A 3A2NA 1QZZA 3SFVA 3LO8A 3AYZB 4IQWA 2QNBA 4QNMA 4DLZA 1VSQA 1CDDA 4P4MA 1CI4A 3KTDA 1ID8A 3A05A 4TWBA 3OAAD 2H9IA 3VNQA 4FUTA 5IAOA 4BQNA 9LDBA 1DDOA 2WJVA 4V0SA 4YAUA 2FRVA 3BMOB 3T5GA 3O1LA 3E9NA 2EC5A 2RGBA 1ZFNA 4RJLA 1HGXA 3LQKA 4KMSA 2J6TA 4F3KA 2CXPA 2HBYA 1KSGA 4LGMA 3BMXA 4EBDA 3SAJA 1IVYA 3STHA 4ED9A 1K88A 2IUYA 3O8DA 5KZMB 1BQ3A 1W1UA 4QTUB 2IKSA 4QZDA 5F9FA 4KQ1A 3D4BA 3EUEA 4UDNA 5G41A 3MDCA 4IOMA 1JEQA 4Q9AA 2GOYA 2UZ4A 4KLZA 2JI6A 2D59A 2DFNA 3WL3A 3VR5D 5C8YA 1L3BA 1G41A 3X1JA 1YTLA 1VBNA 2O8FA 4G1FA 1HT2E 1JNXX 1VECA 2CPRA 4RGYA 1K6JA 1BZYA 1I2AA 2KSQA 5K3CA 3M6FA 4CMIA 4YMSA 3OSUA 1PZNA 2AEFA 4W99A 2ZRMA 1X8XA 1KQQA 5GONF 1WB9A 4ZCRA 3OU2A 1HG0A 4QA9A 2ABWA 2MR5A 5B53A 2GJAA 2NO1A 1RWXA 3QJ5A 1SD2A 1G6KA 3BH6A 2H7XA 2WM8A 4NYMQ 1KGDA 1N6KA 5KKNB 3GA5A 4RIIA 2QTLA 4IGFA 3CLHA 1XCMA 4CIWA 3WYNA 2A58A 2O2EA 3GVIA 3ZUGA 2ST1A 4JBYA 4MWGA 1GCAA 4PGMA 4TLCA 1PR5A 1WVMA 4C1NA 4XUEA 1SC1A 2DUMA 3DE1X 4QTYA 1WJGA 3LCVB 4U5QA 4URUR 1E5TA 4JA0A 4KK3A 3WYGA 4ELTA 1S3IA 3KQNA 2QP9X 4Z9YA 1GAWA 1ZIPA 2FRDC 3AVVA 1D2EA 3FOFC 2G82A 4MUXA 1NJ6A 3D3QA 3LHSA 1R4MA 3ELUA 2IHKA 4P7FA 4MITA 1N2IA 3KOOA 1VMIA 4JLSA 4P7GA 4BNDB 2O20A 3QX9A 1I13A 4MIYA 3SENA 1TEVA 3FKSD 4EVRA 5DJ5A 3IVRA 1H8HA 4YJDA 1V16B 3QW2A 3F1LA 2NTEA 2GN2A 3PQ3A 3OJSA 3D6VA 3OECA 5L4SA 4MVJH 1HFWA 3GIMA 3JU3A 1UBOS 4Z7JA 1M73E 5FUWA 3H5AA 1XSLA 1O9GA 4WAUA 4XYEA 5E7JA 3EFEA 4BEWA 1TAQA 3QBVA 2PLWA 3UC5A 5C4GB 4R0MA 4HDRA 1RXIA 5T6BA 2QPAA 2N1BA 1DQPA 3FYCA 4HDSB 4NJEB 4JVNA 1Z8HA 1F8YA 4PAMA 4ZCIA 4RCZA 3BORA 3TN7A 1UK9A 1YJQA 2C4KA 4A8HA 2HF8A 3L02A 1O6BA 2FMQA 2JL1A 2FMFA 1FX0A 3IDOA 5EINA 1VDVA 2VP5A 1AMNA 3SG0A 1T2FA 2XNKA 4RDIA 3W8DA 3VC7A 2I4TA 1SOMA 3RH0A 2I2WA 3MT7A 3GGPA 2KHVA 3H42B 2BEVA 1E77A 5J40A 3SQWA 4BZQA 3A1FA 1P0PA 5EJGA 5CXQA 1ZOPA 4LWPA 3PJFA 1T8RA 4G5YA 4LQLA 1MPXA 3L01A 4II7A 3WLEA 1XCBA 1DADA 3BS5A 1DC6A 4N3GA 1Z68A 2ODGA 2NO9A 3EDCA 5FDFA 3R75A 2ZGVA 4FOSA 4JBHA 4QJBA 1SOUA 1QIKA 3OQMA 3OJFA 4J16C 2FZKA 4RUAA 4ZMBA 1M2VA 3JVUA 1PVQA 3LBIA 4M1QA 1TB4A 4MVCA 1J24A 4Z2YA 4BECA 1QKJA 3K0BA 3EEBA 2GS9A 5KT4A 5LQCA 2HU8A 5B7QA 2PH7A 4HWGA 4CF5A 1Y6RA 1GZ6A 1CVIA 5DBIA 3KUXA 3CMCO 3I9V1 1VMKA 3GEPA 4GMKA 1FQJA 2DUUA 3KZ1E 1M76A 1V96A 3IPRA 5L6MB 1U81A 1X70A 2J3JA 1KIMA 1X0VA 5EZYF 1BS9A 3UH0A 2R5FA 4FE4A 4DMRA 4L4UA 1J0DA 1ZMXA 2PKRA 1PN3A 2PZJA 3QVLA 1ECFA 3HFJA 2CHGA 3HBFA 2KP7A 5KTRA 1QE0A 1W88B 4J9UE 1ZAYA 2EW8A 3H5LA 4YFKA 4JEIA 3T9DA 1Y7TA 4KPFC 3H9JA 1KBOA 5JH7A 3H3FA 1RFGE 3R7DA 4J7XA 3T3MB 3CZCA 2PU7A 1F2VA 2HBZA 4TWAA 3ZJ5A 3S6JA 1PT5A 7ICOA 2H48A 4ZVKA 1YD7A 1ZJ4A 3N7RC 1GG2A 2FMIA 1EU1A 4TRMA 1QZTA 2O2HA 2E37A 4M60A 8ICJA 4YUWA 2P69A 4EHFA 1BU8A 1A7KA 2R8GA 3DOOA 4LXQA 4GOLD 4UCFA 5JEEA 1LPMA 3OZSA 1QTIA 2D3WA 2DT8A 3V8VA 2H63A 1JDBB 1AKUA 2JI4A 3ZE9A 3ANLA 1MB4A 4P32A 4P7KA 4PS1A 1K7CA 2FSUA 1T5LA 4EW3A 4QDUA 4D4IA 3CLTC 1ZIDA 16PKA 3GOHA 5KDDA 3NWEA 3FPFA 1UMDA 4AY5A 1FFAA 3MHPA 5CB6A 3UJ3X 1QHFA 4K9PA 1JIHA 1PKXA 4QVKA 2SNIE 1KEJA 4FSDA 3T3IA 2M2IA 3BKXA 2Q3LA 3LK7A 1SIWA 2OWOA 1PBTA 5JARA 1RHMA 1XTRA 3H5OA 1UFOA 5IDWA 5CTAA 4QJ5A 4ASUA 3OZAA 1RLJA 2VP9A 3C0KA 1BGVA 5BURA 4RPXA 4NOJA 4OI4A 1ISGA 4KN6A 4RTLA 3HO6A 3RH6A 2GLUA 2R79A 3OCYA 3AM5A 4I8DA 3AC0A 1NP6A 2QB5A 3ANSA 3D6AA 5FWYB 3PT9A 2HSEA 1P0QA 4IVNA 4Y2TA 4CIYA 5LBTA 1JRLA 1UT5A 2EZ8A 1PWYE 3WLQA 5MFPA 3SE7A 3P0JA 2HHJA 2B6GA 2HWYA 5CXUA 1I7DA 3DEYX 3GIWA 3HA7A 2C7QA 4MPPA 1VDZA 4BO0A 8ICYA 4Q66C 4G23A 4I27A 1YOBA 1UXHA 1F9EA 1TKBA 4PHFA 1E0JA 5F98A 1DCTA 3BGSA 4TTJA 1NR1A 4KJZA 3SI8A 1GRCA 2PD6A 1O08A 1DAIA 1O2DA 1EAMA 5CDFE 2BPGA 2H0AA 2ZPUA 4TSFD 1SEVA 1TM3E 3FYSA 3V2UA 1XDZA 4DNOA 3IV9A 3DDZX 4ESEA 3RB4A 3NKFA 4RHYA 1LK7A 4ND3A 3DMHA 2UYYA 4WCFB 1UAGA 4BASA 3RS9A 3W9UA 4DUYB 3S2ZA 3N7AA 4DL6A 3A6PC 4P08A 3C2MA 1LW6E 1YJ5A 4M7OA 3A26A 3AHJA 4MW9A 2OT3B 1PDVA 1UDRA 4F3NA 5F5LA 1KP3A 4X7RA 4Q1BA 4K6CA 5KFEA 1WMAA 2G4VA 3RHTA 4AKIA 5IPFA 4QD3A 1V85A 4Y1RB 1MB0A 4P22A 3RS3A 3ZVMA 2YW2A 1MEJA 4W9NA 5DNEA 1M83A 1YS2X 2JFHA 5DWVA 5J4HA 2I8AA 2XCIA 3HT3A 3GHYA 3TRIA 2V7VA 2Q5EA 4UBBA 5JSZB 4TTIA 4WZBB 5KTMA 1K4KA 1DT5A 2HLNA 3UATA 1KXJA 5BSUA 4ZIRB 5ER9A 1X7GA 4H7KA 4QRIA 4Y1FA 1H5NA 9ICWA 4QHSA 3G2PA 5CXXA 1OGJA 4QAQA 5EIWA 4NQRA 2PUCA 1WTAA 1CEXA 1OBOA 2X42A 3SIPA 2C9YA 2H2DA 1K6EA 4IHKA 3CT6A 8ICVA 4LYJA 5KNCH 4BJ6A 5CU7A 2H9YA 4JJEA 1IULA 3OQBA 3BMCA 5JTIA 4A6DA 2I91A 2V65A 1KS2A 4J9QA 1I14A 5L3SB 3HGQA 1ZQMA 1XZCA 4OKIA 4L6CA 5B6JA 4BVKA 4IOKA 2LBPA 1A8PA 3UN1A 3UKOA 5DK4A 3BGOS 4QOFA 5DQIA 1Z16A 3UUFA 3DBHA 1P8AA 3EIFA 4IV0A 3PGVA 1UBHS 4I2CA 4XJSA 4XX1A 4OBXA 4GZ3A 4L9AA 1EP9A 1PVOA 1N7HA 3NOVA 3HCRA 2DFTA 4HEA6 1UDXA 3ZVKA 4JI0B 1OZGA 2RKBA 4UNQA 2ALJA 1A5ZA 3OETA 1BE8A 1X80A 4S1OA 3RYFB 5LDGA 5LN1A 3OQIB 5ES3A 4UM9D 1YFLA 4JV1A 2QMZA 4TMZA 3BL8A 4YQWA 4R2LA 3AR6A 1HFEL 4U2CA 3TUJC 5AVZA 1BKDR 1Q20A 3WWYA 4I66A 4O0IA 4E31A 4ZJYA 3KVRA 2CMFA 4D8TA 4KPYA 1RRGA 1UJ5A 3F5MA 5JCOC 1VL5A 1XLTA 2P3LA 5E8RA 1VBKA 4CF6A 5KAPA 2XD9A 1VHWA 2DWUA 1QBKC 2ZVDA 3FIJA 3B2QA 1VA5A 2ORIA 3KQTA 1W36B 3F2VA 1FFYA 4BLRA 1OCEA 3VDMA 3V2GA 3CH6A 5JS7A 1G1AA 4QPCA 3K09A 3C23A 3OU6A 4YJ3F 5KQPA 2IDJA 1FP1D 2REQA 2XJ9A 4E7PA 3QQPA 1HE8B 2F00A 5H8WA 3MTQA 1JLKA 4X3PA 1XVIA 4ON9A 2AOXA 3VR5A 5JSKA 2FK7A 4LMPA 2PO5A 3ADCA 4UQGA 5FA5A 1EP1B 4JUIA 2IZ6A 4NZYA 4FD3A 3HY3A 2Y1JA 3ZQ4A 2CBGA 3MPUA 1CK4A 1ZLYA 4J0JA 2JGKA 3UXEA 4ZRDA 1VRWA 3BXXA 1OXTA 1ZIXA 3IUEA 3I4FA 2D74A 4GX0A 3SM3A 3OQ1A 5TQJA 4DJTA 2Z0MA 3RK4A 1X7ZB 1ZH8A 3DW3X 1Z26A 4WKBA 5A1JA 3ESQA 1ZJYA 3BA6A 5IHPA 3QWAA 4FPXA 3ZD6A 1QTRA 1POXA 1OAOC 3ZZNA 4G4JA 4C7OA 3BMQA 4F06A 3PHJA 1YBVA 2XZPA 1JIJA 1NG1A 1LLCA 3L8CA 3GMTA 3ZBPA 2N46A 5HSGA 1T15A 4IQGA 2I87A 3TOXA 2Z83A 3HGMA 3WGTA 3G2LA 1QLNA 1ZC3A 1YQDA 1A4IA 4H7JA 1F1BA 3NH6A 2NU9B 3COZA 3F8TA 1IN6A 2ZRBA 1QE3A 1BPYA 1TF5A 2E4VA 2P9TA 5ECWA 4RM3A 2EFCB 1WNFA 1YK0A 4Y6GB 1XT6A 1K2VN 3DF9A 5J0SA 4BQQA 3KK0A 9ICMA 3LVWA 1BXKA 3ASZA 2VHZA 1H3FA 4WEOA 5E6SA 5KCMA 2DT5A 2IEZA 1SRQA 1W2HA 3GGSA 5IJ0B 3GG2A 4FKZA 4CODB 3ZWKA 5TS2A 2XB6A 3UYLA 1B73A 4L2IB 3B9RA 2BYTA 2JI8A 4HRYA 1L5FA 1H2FA 5KFGA 3K9BA 5HMLA 3Q12A 3FKSA 1MHTA 3HVKA 1WUYA 2A14A 3VUEA 1ZGGA 5FX2A 2PH1A 3RV4A 2G09A 5LOVF 3FCOA 5D5QA 1AKEA 4PYQA 2RP5A 1KAEA 1Z5PA 3Q8WA 3LQ1A 3BTSA 4GE3A 1J25A 3QPVA 2Y0SC 4PZLA 3RVKA 4MDYA 4MICA 1CLEA 3PHHA 3GLHE 3HU1A 2QU7A 3D6UA 4YNBA 4AN0A 2XZLA 4XGKA 5IYZF 4YJ2B 4JP5A 1MQ9A 1I7QB 1DEOA 2QX7A 2PUDA 1VKNA 2ZUDA 3QFCA 3T9CA 4X64B 5CDFA 5F5XA 4PF1A 4ZEVA 2OM2A 4AYTA 5J1SB 1Q1ZA 5EHNA 4PX5A 4QU5A 1N75A 4HEJA 1EDOA 3VMMA 4OGWA 4WXHA 2P2NA 3IT1A 3LCMA 2FWIA 4JHXA 1E62A 4RHTA 4DC0A 5TQVA 2M9MA 1KMIY 2Z6VA 4DMHA 2A0WA 4A6PA 3LWDA 4GWLA 3AY3A 3JATA 3P5SA 4N3NA 1D2CA 9ICPA 2F3QA 5C1BA 1UWCA 4GLXA 1ITZA 1E3JA 1NLFA 2Q8NA 3NHSA 8ICBA 2CE2X 2P27A 1NBIA 2X3FA 4BFLA 3HVJA 3GFGA 3RR8A 1NAIA 4HK4A 2WYOA 2CLKB 2VQEB 4OHMA 3NDJA 5DCWA 1OFHA 2H08A 3L0YA 2D8CA 5KTOA 3DHNA 3VOSA 1HIWA 1K86A 2ZAOA 4OHFA 2BLNA 9ICCA 1X6IA 4IF4A 3LC7O 2F2AB 1U0NA 4FILA 2YFKA 3SP1A 5F4ZA 5BYJA 1CR1A 3BPSA 5ECDA 3GU3A 4GPZA 1Z29A 4A8EA 2WTNA 2XUDA 1NE2A 8ABPA 3IN5A 2C2EA 3MFHA 3L4SO 4WESB 2W22A 3GOQA 1C8LA 1XYGA 3UWMA 4I55F 2C42A 1ZX1A 3DKVA 4HS9A 4ER0A 2KLHA 4M1KA 1OIXA 2QBYB 1S6YA 4U39A 4NWIA 2WAAA 4YRZA 3CIFA 4GC9A 3UWPA 1JSCA 1VJDA 3OKFA 3CVXA 2X6TA 3DSRA 4AURA 5B12A 3FNIA 3SNKA 4MHOA 5J2TF 1N5WA 3JYOA 1WUTA 5D00A 3TCKA 3PC8A 3CZQA 4O9MA 1JHVA 3GR6A 3WFJA 1M5RA 4C04A 1P7YA 3CEMA 3U4IA 3P0IA 3MZ0A 1XCPA 3TS1A 2D0PB 4DR6B 1L4HA 1A9PA 3HXPA 3SR6A 5KYNA 5IVKA 4DR1B 5KOYA 3P20A 4BOYA 5D46A 3RF9A 3S7TA 3IMKA 4MJXA 1CT9A 1M1YE 1S2LA 1L4FA 2OGWA 1O89A 2X1VA 1W0KA 4EVQA 5A4KA 1I9GA 1OWOA 2Y6UA 3MAGA 4TVKA 4O29A 3SBEA 4D9NA 4J91A 3DJYA 2X4GA 1HLGA 1DG9A 1SNYA 5DKFA 1SOAA 3BRQA 1IB6A 3SDBA 3PBKA 2FUKA 4ZVMA 3DDOA 4ZDIA 5LCXA 1E2KA 4X8MA 2A5FA 2NUAA 3LA6A 5AK4A 4IRUB 2BDPA 4DL3A 3PUWA 3THXB 2GR9A 1MENA 3VV3A 1ZITA 4M55A 1ZRHA 1G4AE 3B2NA 2R8PA 5KNLA 5AW3A 2CFCA 4ZYUA 4QWBA 1BX1A 4REMA 3G0OA 2P35A 1IY8A 3IEIA 4LK2A 3JALB 5ECYA 3GFPA 2YBEA 5A9SB 3WZLA 2D06A 1V41E 1YVRA 2D2FA 2II6A 4NEGA 4I50B 2C5GA 4JR0A 4NJMA 3PYMA 3EVCA 4QARA 5A0FA 2H07A 3GJ5A 3JQBC 2IYAA 1BXGB 2CDCA 2YQ5A 5A6SB 2ISQA 4QYIA 4B9AA 1ENYA 4KHZA 3VNRA 4GLLA 1QZXA 2GPTA 2C3MA 1KI6B 2R5WA 3PWTA 5FI0B 3PY8A 4ROSA 3W2EA 4OSPA 3HLKA 3ND5A 4H6WA 1TIPA 5FQNA 4ZHQF 5AUNB 2OCLA 1SK9A 4S05A 3PQEA 4KW7A 4TV9B 3FDXA 1TO2E 3EUWA 2NO5A 3UV3A 1PDWA 1CZLA 1DJNA 1DG3A 4QQ8A 1ZR2A 1Y3IA 5KWJA 5KQLA 3QLEA 3A9SA 2HMWA 3L93A 2YBDA 5KG6A 1PEYA 1ID1A 4TSFA 1HFKA 5H68A 2QX4A 1QS0B 4M37A 2PMKA 3FCYA 3DBRB 1QG2A 2WW8A 2RGRA 1NC1A 5GONA 2VA3A 3M6ZA 3ZPXA 3K3PA 3BE5A 4YV2A 3WGIA 1QR2A 2JRZA 1A27A 9ICTA 2JF0A 2Q0XA 2JIRA 3M4XA 4MYHA 4BAZA 1T4CB 4LEIA 1VMDA 5AVXA 4OX9B 1MC1A 3M5PA 5HUHA 1R9JA 1YFJA 2OORC 2Q2QA 2E5LB 3CU5A 1P2SA 4ME6A 4ICAA 1G66A 3PEYA 1YQEA 2KKVA 4QWWA 1BKYA 1M67A 2FPRA 4M7WA 4G0ZA 5C7YA 1P4HA 3AMVA 3PL5A 2NRXA 2PX6A 2OP1A 2DULA 4A82A 3QA9A 2A57A 4RLSA 4BXOB 4ABTA 3X1WA 2BHLA 4JD5A 3ZXSA 3SFTA 1JU9A 3QUTA 4I2GA 2KMDA 2GYWA 1VOTA 5IILA 4XGIA 2R6FA 3OQOA 5T67A 2IDZA 1F1JA 4G0YA 5FLKA 4G1EB 4OK3A 3E7WA 4JXXA 4G5GA 3A6EA 4XXHA 1TZMA 2JGIA 4YONB 4C07A 4JLPA 1LDEA 1EPUA 3B60A 3KTQA 3KQYA 2YHIB 3D2SA 3OPYA 3KKAA 4X00A 4YCMA 1H8ED 2I22A 4ZH4A 4JWMA 1QF9A 1N0VC 2FPIB 2CJYA 4FNAA 3CH5A 2OC4A 1RDFA 3GGCA 1S2GA 2O6KA 3ME5A 3HNRA 4OMCA 1ZRMA 4KUHA 4XFDA 3RYCB 2WIAA 5EE1A 3TTYA 4QNNA 4MCIA 4BB9A 2B36A 3EW9A 3V9PA 1PTJC 3O4FA 4N9WA 4DN6A 1V2GA 2DHQA 3GFFA 4GVXA 4DQIA 4IY1A 5DGCA 7ICHA 4YEDA 1CF9A 5THKA 4DV5B 2R97A 3JAMA 3WNZA 3H7AA 4K87A 3F2BA 2GA8A 5AOVA 3EUB2 2NRVA 3Q3JB 2VWGA 1NUHA 1SO8A 2YIMA 2FW6A 2GZDA 2EJBA 1ZNYA 2B3TA 3A9TA 3W5CA 2K4IA 3REQA 1CE8B 3BOSA 4YP6A 3CISA 2PCJA 1V71A 4DCUA 1HLPA 5J4YA 1N2JA 2KI5A 3FLEA 4IEIA 4M9GA 4M0DA 1TVKA 4E03A 1JHMA 5TE9A 1T91A 4KQ6A 1SBYA 4Z4HA 3FYUA 3BHIA 2CZCA 1H8HD 1E1DA 5HF6A 4K9DA 4ROTA 2JEJA 4L6AA 4I2FA 2NAPA 1ECBA 1MFPA 3BJEA 3SJUA 1TLTA 2IP2A 1FRVA 2YTUA 1JIUA 3Q6MA 4QJFB 1N7IA 4G3IA 1BQEA 4IZ6A 1V8OA 3R7FA 3DXYA 4H1WA 3DBIA 4RD3A 4KQWA 3L4KA 3FCEA 4Y9RA 2G1KA 1FIUA 2XMBA 4K9MA 5EZYA 2QSJA 1N0WA 5E6UB 4EYIB 4KZKA 1L5RA 3VDXA 2HU7A 4YLGA 2Z6UA 2X2OA 4M22A 2B82A 3UG6A 3LX5A 4HTFB 4WOJA 3RF7A 3UAYA 5FA6A 4D4HA 4Z4GA 4G67A 3BQ9A 3T7RA 2JLQA 2YVQA 3TDNA 3RNLA 3TIIA 1ZQPA 2G72A 5JG7A 1A50B 1PG0A 4FBGA 4QG3A 2PRZA 4DF8A 5NLLA 3R5JA 4CPDA 4CV0A 4EKEA 3GZJA 1E96A 1D1TA 4RKEA 3NHFA 4I2AA 2HA4A 4AZTA 4AVYA 5CJPA 4RVGA 3HKZF 1WXEA 4RGBA 2AQ4A 3QVJA 3O8QB 3D02A 3TKYA 4IZIA 5IKMA 5EVCA 4FHDA 2JXJA 3DM9B 1CZUA 1SVUA 3AR3A 4PFQA 3HBNA 1I4LD 1ZBDA 2O8DA 1A1SA 3IODA 5EJEA 3PXDA 1Q7CA 2BM1A 1LJUA 2PL3A 3R3ZA 2WHEA 4KN4A 5L3QB 4YTEA 1PS0A 2NX2A 4CKWA 2PGNA 2D1QA 3NHUA 2JLCA 5CLLA 3RJTA 3JPNA 5FLYA 2XB2A 4UCQA 4B9EA 1RRVA 4C7YA 2FW9A 1NI4B 2PS3A 2XJ4A 4BTEA 3D4LA 5HP4A 5F7OA 1VBFA 3PXUA 2XBMA 1DPFA 3RVPA 3EZ7A 4GXJA 2VH1A 1QRAA 4ZD6A 2HOIA 4MVJG 2QSYA 3MJSA 1FUKA 5CLJA 3IR5A 3WLHA 3HJFA 1TMKA 4QREA 5JAPA 2XWPA 2BN4A 1QCDA 2GZRA 1GGHA 3OFVA 5FI1B 1J39A 3TBFA 2J3QA 3L1KA 3IVMA 1HT3A 3C45A 4OM7A 4C29A 2OBBA 2AUNA 2RSLA 1P2DA 2QS9A 4LN1A 4R8SA 3UMYA 2YH2A 1MDFA 2ZIUA 4L0MA 2XQKA 5K6RA 1UFQA 5D5PA 1SAYA 3MYYA 3ILYA 1EE9A 2IY7A 2ZU6A 2JGAA 2HHHB 2XE6A 2Q7DA 1KJ9A 4B6RA 1Q3KA 1Q3VA 2BPOA 2V58A 5G53C 3I01A 1FYWA 3M3PA 4KE8A 1NFFA 4NX2A 1EJBA 1XLUA 4MAAA 2XUPA 2RG7A 5GOZA 4LVNA 2B25A 3EVFA 3PC2A 1US8B 4WHMA 1Q6YA 4HZUA 4RVCA 4M0UA 4KMUA 4KAXA 3SYTA 4H60A 3NP9A 2GA9A 3LT4A 4IPTA 4JDPA 3NBKA 4QICA 2DHDA 1FIQA 1I2BA 2B2XA 4N49A 1X1QA 2CXSA 3JQEA 4G0OA 2PJDA 5K0GA 1KKMA 1QG6A 3CCFA 5CA0F 3ZY3A 1EESA 5FOVA 3VKWA 2I80A 5AVKA 3D9QX 5E8JA 1BVRA 5C46F 1KORA 1VHQA 4PO9A 2ZWPA 4B71A 1YIAA 2JG3A 1U8YA 3GPIA 4WJKB 4ACAA 1YCDA 5A06A 3X1YA 1XZLA 3CW8X 2AMJA 4WUTA 1MNQA 2PZGA 1ZCFA 5LD2C 3BK2A 4F5RA 3ZLUA 1E0AA 2QV7A 4JYPA 4LOLA 2I78A 1CF2O 4JWNA 4Q8EA 4YYZA 1QV7A 4FW8A 4XUCA 3T7IA 1QR6A 1PT8A 3R5XA 1VJ5A 4RSMA 4NLBA 3FUTA 1SHTX 4JBGA 4N0PA 3ZYZA 4B8WA 1RWKA 2QR5A 3EARA 4POAA 3OE4A 2HHTA 1SUFA 4KPUB 2V6IA 3RRGA 3AX6A 1DGSA 3CVVA 2WUWE 1WUHS 4ADSG 1CP3A 1VYUA 5A02A 4DQXA 7REQB 1YHZA 4URZR 4E3ZA 1SVOA 3NVDA 1Z33A 3FPCA 5IM5A 3K6SA 3IP5A 1OIVA 4PYKA 3RRMA 2ZAGA 1QX4A 1KEKA 2GM3A 5IS2A 9ICIA 2NUTB 4Q9HA 1MJGA 3IIEA 4AG6A 1AF4A 1O97C 4OLBA 4X1IA 4BCBA 5KFWA 3BS4A 3AB3A 4JJAA 1JMVA 4HX5A 5JWHA 3CR8A 2X0KA 2R6GA 3AIOA 4ZO7A 2Q29A 2I7TA 4BKOA 3KJHA 2BZFA 2GBPA 2GD6A 4LMBA 1V3UA 4D74A 1NBEA 3EULA 4GLOA 1LS6A 1Y9ZA 1SKYE 3FSRA 2ONYA 1P1RA 1M8PA 4X62B 2HMSA 1YZ7A 4PNPA 3ECSA 3VVMA 2BFAA 3W5HA 1XNSA 3VR6D 1AG9A 2XUFA 3AI1A 5FNVF 3HDJA 1VJTA 1DZIA 3LDHA 4ZYTA 2YUIA 4NF2A 3FTCA 3JQRA 4JQCA 4YMHA 3WGJA 3JPSA 2IU6A 3M8RA 3DEZA 3ZWPA 4TTRA 1V8PA 2WINI 5DGTA 4C9BA 1HDXA 3BAFA 4EG6A 3SBXA 1CJUC 1V37A 4HQNA 2BGJA 1XZJA 1OT3A 3KDAA 3UFXB 3NDBB 1XYVA 1KZ9A 3CUWA 3TTSA 3HKDA 2TS1A 3PHLA 1ZH6A 3DCNA 1MAAA 1YA4A 3E27A 1Z4QA 2RI0A 1ECWA 4F2DA 5CPBA 3MTBA 5JWRA 4BU1A 1RYSA 4HS4A 4FZRA 2YC4C 1P6QA 1Z88A 2RE8A 4M0EA 2C31A 4MK4A 4EGQA 3ZTTA 1J20A 2UVUA 2WWVD 3TVTA 3TG2A 4UHEA 1JIVA 3NAGA 1TVAA 4Y9SA 3BB1A 4WN9B 5BYKA 4OV6B 1NI3A 4GKVA 3WHIA 3NNNA 4V0RA 3IPXA 1LSSA 2RH9B 2EF0A 3CWCA 3E5MA 2C9OA 4IWYA 4R9SA 1OXMA 5D5HA 3FN4A 4YJ3A 1K6MA 3HRKA 4OJ6A 4R2HA 3CHYA 2FZCA 2ARKA 5I7OA 4O5EA 3CNLA 4YRGA 2GN8A 3DEAA 3MBOA 5LNK1 1QYVA 1R6DA 3OZDA 4BP8A 3GP8A 3IOCA 421PA 3KUCA 2Y9PB 1QYCA 2FQXA 3KEFA 4A6EA 1QAMA 3GARA 3QFSA 4ALLA 1WIWA 2AG8A 4WOCA 4AJ9A 1ZY2A 4YI5A 2B5WA 1EG7A 2VUIB 1VPVA 1WQ1R 4IDFA 1OYVA 1WV0A 8GPBA 3NGMA 2PL1A 4C8OA 4CIXA 2YS7A 1NLYA 2FPGA 4DMCA 1HYEA 3AHIA 4Y3UA 1C29B 3W3AA 1FMFA 2JBAA 2F3RA 2VZ0A 3ZQUA 2VHYA 4XIIA 3K1JA 5BNZA 2IT1A 1GGFA 1FL9A 3NVAA 2VF8A 4F3YA 4TLEA 2Q6LA 4RQBA 5LU8A 1EDBA 4L5CA 3EH1A 4ZT6A 3L0OA 5HDQA 1XMVA 4ZN6A 2ZBFA 4UB1A 4FFSA 3B78A 4DBZA 4RO0A 3DMRA 1JSLA 1C0LA 4EHKA 4Y6RA 4PWZA 4G07A 5CJ2A 3VOBA 3B1KA 4CKCA 1VPTA 4Z7QB 3GVPA 2KD1A 3GJRA 1DXYA 3KNZA 4Q3AA 1SBNE 2PV7A 2H52A 1NP7A 1UJNA 2AZTA 1H4SA 1T25A 4X5VA 4PGFA 1NU8A 3WWDA 4YAJA 3DZ8A 3O5AA 5M2QA 2W6CX 1ZN8A 4LDAA 3AM9A 3S8YA 1J4AA 3CO0S 1OX6A 1ESNA 1C4OA 5C37A 3GUVA 4UM7A 4L8LA 2JFVA 5KVCA 3UKJA 1HRKA 3PHBE 2XMPA 4DFKA 2KE5A 3VQTA 1C1HA 4AO6A 5DMXA 1ZR4A 7ICVA 2VHXA 2Q3JA 3MWYW 5H9WA 5LOVA 1IG0A 5KTYA 1CQZA 1E5DA 5AW2A 1PX2A 1VFPA 5F7XA 3RC3A 5JFTA 4Y30A 4IKPA 1H8EA 1UQTA 1X1BA 1YR3A 4KWCA 2X76A 1E6UA 2AOUA 3TIXB 3ODPA 1KFDA 2CB0A 1Q5PA 2D1YA 3BYZA 1BCSB 1GPUA 4XD2A 3OCJA 1G64A 1NN3A 1WUJS 2XIQA 1SFRA 1SB8A 1I0IA 3T9FA 1SB3C 1Q22A 2YASA 1P7VA 3ESDA 5IYZA 1JBKA 5KTSA 2QT0A 3RKRA 1BIFA 2C2XA 1UBGA 5KNBA 3WX0A 5DTEA 4OYRA 1VM6A 4M8SA 4CQNA 2CSUA 4O2AB 3ZN2A 4WKGA 3T1HB 3Q7EA 5AW1A 3VSAA 1XSNA 5EHZA 4USAA 1CYEA 3EJ6A 2FE1A 3U40A 4M9ZA 4I14A 2YOFA 4L5BA 1MAVA 3AETB 1Z0JA 2JGEA 4OD0A 1WHSB 3AR5A 3PV8A 4Q21A 1XD9A 3CUVA 1N9GB 3DUWA 2O2IA 4F4ZA 1CLUA 5LL6P 4C08A 4Q4JB 3K70C 2MSCB 3GNQA 1NBAA 5DIZA 4LJ6A 3DUFB 3NOXA 1T26A 5DLDA 1YE5A 5T6MA 4A7PA 4NEQA 1B26A 5J2UF 2AXTU 3FJYA 4KOEC 1KFSA 3GEEA 1W19A 1OPRA 3BN3A 3A4VA 3VYVA 3CUYA 1JLSA 2EAMA 1JDVA 3R6TA 1GRQA 3TXXA 1CG6A 5JMWA 4NNPA 3TI7A 5JSYA 2AVNA 3EZFA 1PK1A 3LLMA 3OHPA 2J6IA 1QGYA 5BSTA 3GMDA 1L7DA 1BN6A 3SGLA 2JR5A 4FNMA 2OCIA 4BKUA 1R0SA 4DWVA 4C7JA 1FFGA 1QP0A 5BUCA 4BWVA 1JXMA 2VVTA 4ACBA 1NZPA 2GSWA 3DAPA 2A0FA 2O23A 1ZLXA 1FQOA 2F62A 2VJMA 5KSYA 4FM9A 5T8KA 4EW2A 1H23A 4I55A 4KN9S 4NLCA 2AUMA 5GM1A 2VIIA 1QGZA 1IBKB 4EBFA 1J06A 2F3UA 3ESAA 1QVZA 2PZAA 4PCAA 5KEIA 4B9SA 2KB0A 4WNYA 1JAXA 5EWGA 3F6RA 2LGJA 4XVQA 1BAPA 4S3MA 4IQTA 3GBPA 1LGYA 3VSDA 5J2TA 4MWZA 1LSOA 1M75A 2P3OA 3ETJA 4JLNA 2NVUA 1ORWA 4CV3A 2HR1A 5AVTA 5L1KA 1JT9A 2WV9A 4WK2B 3SZ2A 4ZAWA 1QTMA 3RSOA 2CL6X 2WAOA 4I5IA 3CNEA 1IXRA 4Q45A 7ICNA 5KFTA 4HWOA 1SXHA 1DC5A 1GNLA 2VBFA 4E2WA 5F35A 4J4TA 4QWDA 3FWYA 3BWVA 4M1SA 5FUYA 3DTVA 1OROA 4RQ6A 3GFVA 4DIKA 1O03A 4B2IA 1QPBA 3N8DA 2PMZF 3SQNA 3N2ZB 5AP9A 1HX7A 4TKUA 2PAAA 3KAPA 4US9A 3AOGA 1E3WB 3AHCA 2PX5A 5EZQA 4WY5A 4QZHA 3SF8B 2DMRA 2XI9A 4POOA 2ZIXA 3FOZA 3C74A 4N3CA 2ACEA 4XPIA 4PXYA 4V39A 2RD2A 3PYLA 3E58A 2WYIA 4PHPA 5JYCA 3I9MA 3MD9A 4GQAA 4AULA 2LTAA 2WVHA 1SB9A 3W5UA 1HPLA 2QJOA 2LKYA 1JA0A 1TJ3A 3C28A 2ZFUA 3KVVA 1H3EA 1FFXA 3MMPA 1N56A 3OZUA 2XUKA 1RWPA 3VVBA 2PXHA 1HWYA 1VHDA 3TRFA 4CG0A 2P11A 4C0WA 2XO7A 1ZGAA 3V1MA 2CYBA 1NSYA 3PDHA 4MKFA 2EGUA 4ZKEA 3VTFA 3MWDA 4DHEA 5EIAA 4YT8A 1VLBA 1C9JA 4IDAA 2ECFA 4KQ9A 2FPMA 4YACA 2C07A 5K8LA 4IS3A 3D2LA 4PC7A 3IIJA 3GLTA 3Q15C 4DNPA 1ZD2P 3V1YA 2GUWA 3OD1A 1SM4A 1EQAA 3ROQA 2I6XA 4ZQCB 3KUKA 1PJRA 3M6XA 1TJPB 1QSLA 3EXEA 5K2MA 2XE4A 1U3VA 1W0KD 1OVGA 3LGAA 5BPFA 1WE2A 2QRPA 4OJOA 2EP7A 1LSUA 4TLMB 4RM2A 2FEXA 5COBA 3Q9SA 5DG7A 2YWBA 4PTYA 4AXXA 1QNLA 4ZHQA 1W46A 2H1FA 5K3AA 3VZPA 1G19A 2OHGA 2N42A 3QTTA 2DHCA 3FNBA 2Q4EA 2ZS7A 4LOKA 4AB1A 4IFBA 2RHDA 4GYKA 5TNXA 4EX7A 4RK7A 4AZ0B 3UT0A 3GDXA 2OUIA 2HLDA 1HZJA 5I4BA 5EJAA 4DTIA 1FXUA 4H0NA 4PNHA 4ZEWA 3E1SA 2WU4A 1VXRA 3LT1A 2SKEA 1E8DA 3FVTA 4RJTA 2QZSA 1E61A 2C5EA 1N5LA 3PXEA 3TH5A 1F0NA 6YASA 5KDOA 5C2JB 1I3OA 4FFLA 2LE0A 1L5MA 1MTOA 1IHOA 4G65A 2IE8A 4RZRA 5JUMA 3WHKA 4RA6B 3Q3CA 4WFIA 1EVLA 2AQ8A 3AL2A 3PS9A 3T5LA 3HB9A 4YRBA 5GV7A 1MOPA 2VJNA 3FHJA 1RYUA 3CH7A 1ONOA 1OFGA 1IZ9A 4ED0A 1G38A 3K4GA 5F73A 1T8PA 3ROZA 3U4QA 3OP1A 4AX8A 3QLTA 2I3DA 2Q3DA 1UMCA 9ICNA 2ODBA 1L7BA 2FWRA 1EGVB 1H38A 5IJAA 3NS7A 3HWTA 1YE3A 3JVEA 3L8MA 4XTCS 2XPCA 3FMFA 1A1VA 4ZOEA 4X8HA 1Y81A 1V5EA 2OD9A 4GEGA 3GX1A 1LPBB 4RY0A 1W9HA 1JALA 1MG5A 4I2EA 1U11A 2YB4A 4B3RB 3KWJA 4JYBA 4S1NA 3GAZA 4YR2A 1NBOA 1L8LA 1Y5NA 1QF6A 1YVDA 5MGBA 2GB4A 4OP2A 1AS3A 3WMEA 4GVPA 4RNCA 3UAWA 1NXTA 3EWNA 3TFWA 4UCXA 4IV5A 3UXPA 1DBQA 5LYYA 1QX3A 4B6FA 2CFOA 5KG5A 2W2KA 4YVZA 3VR6A 1G20B 1TU4A 5DH9A 1NVAA 1CUFA 2O9JA 4B4UA 2V3CC 3DFFA 1SOVA 4JB0A 4XX0A 3PENA 2O59A 3HJBA 3JQGA 4DB2A 3TL2A 4REQA 3ZWYA 2DFLA 5JXWA 5BN5B 1Z7WA 3BSFA 3KTFA 3PRHA 2MSLA 2YY6A 1MABA 5DXFA 4YJGA 5LIPA 1NQVA 5BOLA 3OT4A 3WY9A 1SBTA 4F4CA 1F7UA 4KBGA 1V3TA 5CT4A 3JYQA 1M0SA 3P71T 4XGRA 4FHZA 2ZB4A 4UAWA 4KXWA 4MV3A 3K16A 4ZRNA 4G56A 2IYQA 2KKPA 3AP1A 3PSTA 3TJMA 1OT5A 3U7RA 2QLLA 3JD1A 4A10A 1RJ9B 2PJUA 1PZMA 3RSQA 4LF6B 4H7DA 4DV2B 2PRYA 2AEEA 1E20A 3Q7RA 4HDMB 2HDWA 4PFKA 4RKWA 3LPMA 3WB2A 1LB1B 4KN5A 1FYEA 4IZHA 3WO1A 1LTQA 4OQ4A 1R8XA 2VQSA 2DPGA 4LCBA 4DCPA 4TQ9A 4OF4A 1MD9A 2ZYWX 4ZU6X 4LK3A 2XB9A 4DV1B 1CUAA 4BBJA 5A0LA 2HCFA 1L1FA 1E92A 2GCGA 4ZDJA 1FUUA 3ON5A 4INJA 4WIAA 3CPHA 5DTIA 2OMKA 3OJ0A 4ECZA 1KFTA 4Z86A 5GTIU 1V3QE 2OOKA 3ZDZB 1JG2A 2B8JA 2AZDA 2WHPA 1Y3AA 2Y4OA 5K3EA 1NWCA 1RQXA 1OH7A 2VR1A 2Y9TA 3V6JA 2EW2A 1FUEA 1VKJA 5CNMA 3DLBA 1JAZA 4BNHA 4UZSA 5IIOA 3UWKA 1Z4IA 2W2MA 2VC2B 2QTVA 2D13A 3HXMA 2QV0A 2R7KA 2FFAA 1BYIA 1J42A 3I12A 4EB0A 1BG6A 3EISA 4FYXA 3THRA 2C2HA 3NTLA 2VJKA 1S8AA 3BFPA 1BEEA 5KHAA 4Z54A 5ED4A 1SCUB 1XD2B 2VUUA 4L3VA 3OMLA 1XSEA 2M1ZA 4RV4A 4YK7A 4DJEC 3F73A 1A8SA 2RHWA 3C15C 2IIVA 1ZQVA 4CLRB 4UEKA 3U0VA 5AKGA 1CY2A 3EBPA 2VP4A 2YZ2A 5EHIA 1Q0TA 3WGNA 3C8HA 4HDNB 3M0EA 2AF3C 3PF8A 4W4TA 3B20A 4QZ9A 4II2A 5DHFA 1BXRA 1GAEO 4DJFC 3WKDA 3E48A 5IINA 3ECCA 3L2OB 2IF2A 2XCSB 4AKHA 4U7HA 3A4IA 2QYTA 1U99A 3ZGZA 3G6KA 4J29A 4IDEA 1ZQZA 4GXIA 1XF9A 4EEXA 3WKAA 1EFVA 2G4CA 2GN6A 2W2QA 1H5QA 3HCBA 3I9JA 3V00A 1DOAA 2XVAA 3S44A 2ZJ5A 3E2MA 1RMTA 3RVLA 4BFSA 2JIZA