3NASA

The crystal structure of beta-phosphoglucomutase from bacillus subtilis
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
207
Chain Sequence
LKAVIFDLDGVITDTAEYHFLAWKHIAEQIDIPFDRDMNERLKGISREESLESILIFGGAETKYTNAEKQELMHRKNRDYQMLISKLTPEDLLPGIGRLLCQLKNENIKIGLASSSRNAPKILRRLAIIDDFHAIVDPPDIFLTAAAMLDVSPADCAAIEDAEAGISAIKSAGMFAVGVGADLVVRQTSDLTLELLHEEWEQYRIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-phosphoglucomutase
publication title The crystal structure of beta-phosphoglucomutase from Bacillus subtilis
rcsb
source organism Bacillus subtilis
molecule tags Isomerase
total genus 58
structure length 207
sequence length 223
chains with identical sequence B
ec nomenclature ec 5.4.2.6: Beta-phosphoglucomutase.
pdb deposition date 2010-06-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 3nasA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3nasA01
3I28A 4XQ0A 2G09A 2QYHA 2ODAA 2WF6A 2YMLA 2W43A 5AW6A 4EENA 4Y2VA 1Z4KA 3EWIA 4HGNA 4J2TA 4AP9A 3HYCA 3ESRA 1U7PA 3ZTYA 4Y2RA 5AW9A 2YJ6A 3WKCA 2WF5A 1EK2A 3BA6A 3PGVA 5A3RA 3ZVNA 3WK9A 4HGRA 1N9KA 5AK4A 4F71A 3WK5A 4AS2A 3L1VA 2R8ZA 1NF2A 3E84A 1RKQA 2C4NA 2EAUA 3N28A 5AW1A 3FPSA 2ZOSA 1VJRA 1XPJA 3UMCA 1Z4NA 3QU5A 1SU4A 3A1DA 4KX3A 3WKAA 2O9JA 5AVTA 2P11A 2JAWA 4FFDA 2I7DA 1L8LA 4YIHA 3ET5A 5AKKA 1QH9A 5AKXA 4HYTA 1RKUA 2C8LA 3ZX5A 2W11A 3R9KA 4EELA 4XE5A 3ZU6A 2R8YA 5AI0A 1NRWA 3QNMA 2JAOA 5ALUA 1T5SA 5ALMA 3K1ZA 4UM5A 3DV9A 1RLOA 1WR8A 1WVIA 1F5SA 3WK7A 5AVYA 2ZBGA 2HOQA 2FPUA 4YIKA 4OD0A 2WF9A 2ZBFA 3WKEA 3SLRA 1ZRMA 3U26A 4HGOA 5A3QA 4UM7A 5ALOA 1JUDA 5ALNA 4BX3A 1YDFA 5AKIA 2GFHA 1KYTA 4YH1A 4Y2QA 5AESA 2X4DA 4NABA 3AR5A 2NO4A 4HAIA 1X42A 2BDEA 1L7PA 3N8GA 3B9RA 2MU1A 3NUQA 3M1YA 2YY6A 1LTQA 2Q4RA 5AM4A 3U7FB 3PDWA 1T5TA 2O2XA 1ZOLA 3AR9A 3OTQA 4IFTA 4ZEWA 3RF6A 4EEKA 2AUTA 4Y3UA 2NYVA 4UU0A 3OCVA 3P96A 2R8XA 1ZRNA 3IB6A 3AR3A 3NANA 1K1EA 4PNHA 5AM0A 1EK1A 1Z4PX 3L1UA 3WGVA 3CNHA 1L8OA 2HEGA 3CZ4A 1O08A 5ALXA 1VFPA 4BX2A 4NFLA 4Y2PA 5ALKA 4NWIA 5ALYA 5AVXA 2HO4A 4IG4A 1TJ3A 3WKDA 3ZW7A 3S6JA 5AI8A 4UATA 3QUBA 2P69A 3U7GA 4YGYA 5AKHA 4UAVA 4H1WA 2FDRA 2ZBEA 1Q91A 1T9ZA 2I55A 3WK8A 5AW3A 2AGVA 3BWVA 2C8KA 3FVVA 4KYTA 3U19A 4HGPA 2HHLA 4Y2TA 5ALHA 1QYIA 4UW9A 3A3YA 3W5CA 3KBBA 2I6XA 3AR4A 3L0CA 2B8EA 4EX7A 2FI1A 3IJ5A 3AR7A 3WKBA 3QX7A 2FPWA 1ZD5A 4CNQA 1RLTA 4DW8A 2MSNA 5AKZA 2IOFK 1RMQA 2ZG6A 5AW0A 2RAVA 3W5BA 5AM3A 4UU1A 3ZX4A 3UM9A 2QLTA 4FE3A 3OCZA 3A1CA 2FUCA 3I6BA 4KNVA 5ALDA 2CN1A 2WHEA 3QU4A 3OCUA 2I54A 1YS9A 4UASA 1Z4LA 4YCLA 5JJBA 1RPZA 1ZD4A 5ALTA 4C4TA 2YMQA 3MC1A 3OCXA 3SD7A 3PGLA 4QJBA 3ONNA 4L57A 2PKEA 3ZVMA 3WGUA 5AHXA 3UMBA 2OBBA 2G07A 2HX1A 2B82A 3ZI4A 1RQLA 2CFTA 1U2SA 4ZEVA 3I76A 2G06A 3L8HA 1TJ5A 2B0CA 1RLMA 3A1EA 3B9BA 3KC2A 2ZXEA 5ALWA 2GMWA 3MN1A 5AW5A 3AR6A 2JGAA 4I9FA 2C88A 5IT4A 4CF3A 5AW4A 4UMVA 1QQ7A 3SF0A 4YCNA 3U7EB 4CF4A 4BNDA 5AVVA 1IWOA 4JDPA 2RARA 4HGQA 2GHTA 2G08A 1YJ5A 2EATA 2WF8A 5ALQA 2YJ3A 4I9GA 4QQFA 1XP5A 3L0YA 3QGMA 1AQ6A 1TJ4A 3FZQA 1O03A 3WK4A 4EX6A 2FUEA 5AM2A 2OA0A 1J8DA 1Z4JA 1QQ6A 4Y2YA 1Z5GA 4DCCA 2FPSA 4O8CA 3SHQA 3W5AA 3QXGA 3ED5A 3DAOA 4XOUA 4C4SA 1S2OA 3FGOA 3RFUA 3TLMA 1L6RA 4BYGA 3QYPA 5ALRA 3I1YA 5IS2A 2WFAA 3N5KA 3VAYA 3W5DA 4G63A 5AK6A 2G0AA 5AIAA 5AIBA 3EPRA 1J97A 3QUQA 3L5KA 5T41A 5ALPA 2R8EA 4L6AA 4OHFA 3R4CA 5AK3A 2WF7A 3B8EA 2YJ4A 4NV0A 1FEZA 4KN8A 4Y2SA 2WM8A 4BEVA 1U2TA 5AVSA 2JAUA 2IOHA 1YNSA 4AS3A 2FPXA 2PQ0A 1ZD2P 4L6CA 3SMVA 2MU2A 3R09A 5ALVA 1RRCA 5AKLA 4EZEA 5AM1A 1Z4MA 5AVZA 1Y8AA 3EF1A 1RMYA 3AR2A 4BBJA 3IRUA 4GIBA 4KNWA 5AK5A 3ZUPA 1S8OA 3QU7A 5ALIA 1WPGA 5AW8A 4G9BA 4B6JA 4UMFA 4DFDA 2HF7A 2YJ5A 2W4MA 5AKGA 1ZS9A 1Z4IA 3L7YA 5ALGA 2GO7A 1RKVA 1U7OA 2YMPA 3L0BA 4Y2UA 4BEWA 2OYCA 2GHQA 4UARA 2YBDA 3EF0A 1TE2A 5ALZA 5ALSA 4UAUA 3HLTA 5AW2A 3OCYA 2AH5A 4CF5A 3KD3A 3AR8A 3DNPA 1YMQA 5AI6A 2B1RA 2CFSA 3U7HB 1CR6A 2HDOA 3OCWA 4XPZA 1RDFA 2C9MA 4BX0A 3E8MA 2IYEA 3U13A 2IA5A 5AKEA 1U02A 1L7OA 3OPXA 4E88A 1Z4QA 2B30A 5AVRA 3F9RA 5FP0A 5AI9A 2NO5A 4GXTA 3ZTWA 3L8GA 4BNDB 2HSZA 3ZVLA 5AW7A 4YCMA 2Q5EA 2VKQA 2Q4TA 1Z4OA 2BY4A 2G80A 1SWVA 3ZWDA 1MH9A 1L7NA 5AM5A 1Q92A 3E58A 3L8EA 1XVIA 3NRJA 1CQZA 3SKYA 4JB3A 3E81A 3KOOA 1TA0A 4J03A 1RQNA 5AVUA 3QUCA 4MWOA 1LVHA 5AI5A 3WK6A 2P9JA 1WZCA 4OFZA 4C4RA 1YV9A 2YFYA 3ET4A 4RESA 3J7TA 2FEAA 3GYGA 1NNLA 1ZD3A 1ZJJA 2ZBDA 1VJ5A 2CFRA 3NALA 3FM9A 4Y2XA 4ZEXA 1L7MA 4FYPA 3QU9A 2EARA 3QUTA 3N1UA 3M9LA 2HCFA 2YMMA 5E0OA 3UMGA 3NIWA 3PCTA 4KX5A 4MUMA 2D2VA 2B8JA 4RETA 1RC8A 3L8FA 3NASA 2RBKA 4OCZA 3SKXA 4BKMA 1PW5A 4NAVA 2HI0A 5AKJA 5AKYA 5ALJA 4UMDA 3D6JA 2DQSA 5AI4A 5A3SA 3ESQA 2OM6A 2IOFA 1N8NA 1QQ5A 3KDPA 1Z88A 5ALLA 2P27A 5ALFA 2B1QA 5IT0A 1RMTA 3NAMA 2BDUA 2YN4A 3MPOA 5AVWA 1SWWA 5ALEA 3DDHA 5AVQA 1Z5UA 2HF2A 2AMYA 4UMEA 2JARA 3ZWKA 2G1AA 4DWOA 2I34A 2PR7A 5AICA 3KZXA 2FPRA 2RB5A 4Y2JA 3MMZA 4CE6A 3QU2A 3FPBA 3QLEA 2I33A 3N07A 4F72A
chains in the Genus database with same CATH superfamily
2OZVA 3RHZA 2NVUA 1A9PA 2X8JB 4QXQA 4RGBA 1ETUA 4MSUA 4F60A 2G72A 4H7KA 1ZUWA 2WABA 1G3IA 5FL7A 1T6BY 3N53A 1U2RA 4DY4A 2JA2A 5DEIA 3VPDA 2DF8A 4AX8A 2GH1A 4WOKA 5DBBA 1VHQA 5F7JA 4US8A 4HYTA 1QFZA 5DQHA 4TKMA 4OB6A 5F5XA 5LA6B 4MKGA 2QI9F 2WEKA 3UB2A 4LJYA 2IBKA 3DBIA 7ICFA 4GZ6A 1LDNA 4Z5XA 3WGQA 2GFHA 3RUIA 3A06A 3INGA 5FPQA 5B3AA 2C95A 3IPCA 4DVJA 3G79A 3AVYA 1MVNA 3COSA 3PI6A 4YAGA 2Z2KA 2A0FA 1EZZA 1YVDA 5E8RA 3AR3A 3FPEA 3VNUA 1A3CA 2VBGA 2PZBA 4NYJQ 3FSGD 2VHTA 4P5EA 2RFLA 3AK4A 4OI2A 1Y1SA 1IK6A 2D3TA 2VUTA 4CT0A 4DRXB 1EJ6A 4QM7A 1Q17A 4QODA 2BH9A 1J9ZA 3W5SA 3DUFA 3IT2A 1MB2A 4UNIA 3A1WA 4RIFA 3BQ1A 1XA0A 1W1UA 3HRIA 4PN3A 4PZZA 4MQBA 1T4DA 3SVLA 3LGXA 3UCEA 5EGNA 3EXEA 3SDBA 4PHCA 1L5YA 1W4BA 4TMYA 1Q16A 3ZD9A 3FDSA 3WL6A 4AY6A 2GILA 1DRJA 1HETA 5ELLA 3AL0C 1RLMA 3W7BA 1T3ZA 5H68A 1TZ2A 2ATCA 2O57A 1U2GA 5JOQA 2VSFA 1QHIA 1UQVA 2YXDA 5A05A 3KHRA 2H4HA 5KFCA 4DR1B 4OBBA 4J16A 4RANA 3OFKA 1GTVA 4BVAA 4ZTUB 4X71A 1WP9A 1Z4JA 3LPMA 3VHXB 3RIMA 1FB5A 4JLDA 2IYXA 1VLBA 4N39A 3CJTA 1B8UA 3HN7A 5JZMA 1OW5A 3OQNA 1M1YB 3LA8A 4NS4A 3T1VA 4Z99A 3W3AH 4DT1B 1PNQA 2PBFA 1AU9A 1EA5A 1A8IA 1GCGA 1XLUA 1N2GA 5CDFA 4PGXA 4ZDJA 4BE9A 3HBJA 4UAZA 1TM7E 4M1OA 4AKEA 1KDVA 1W8IA 3WOVA 4DFDA 1I7NA 1XCJA 1CYDA 3WL5A 2KLHA 4MICA 2JHDA 2FE1A 5TPZA 3GA7A 1PCXA 4RHFA 3AL0B 4EKYA 4JVSB 3JTEA 1H4TA 2FQQA 3JZIA 1HE2A 5GM1A 3U31A 2BT4A 2P9QA 4MGKR 4TS4A 3O6VA 1J42A 5IC4A 1TZKA 4DS3A 1N0VC 1X1TA 4E2WA 4TKUB 3X1YA 4WUTA 4FLFA 2RI6A 3TIIA 2ZJ0A 2I1QA 3MT8A 3GFSA 2ZJYA 1HORA 5BWLA 2BSXA 2MYPA 3UJ8A 2P91A 3VHQA 1LLFA 2IYAA 4CM7A 3FUTA 5EJ4A 1H0SA 3PUHA 4QDUA 3ZD7A 3K70D 3ZY5A 4IDHA 1MJGM 2F00A 1YH3A 4MUYA 3E3LA 5E7MA 1WLSA 4DV1B 3OVMA 4FXOA 1E2UA 5DI9A 4U2CA 3SZGA 2MAXA 4HFRA 1WTAA 2FMIA 4ENVA 2KMLA 3EY4A 1XD2B 3MDAA 2XV1A 2CXNA 3LUAA 5J2HA 1JDBB 1W4RA 1GPAA 1GL6A 1G42A 1XYYA 3N07A 9ICFA 3JATA 2PZJA 1P1FA 4BB6A 4W5RA 2ODAA 3F9IA 2WWWA 3JSXA 4XFJA 1T0PA 2AKEA 4CRWB 4MS4B 4TLLB 1VDVA 3T0GA 3P27A 2XHEA 3T94A 1FE8A 2I76A 2DFVA 1FMCA 3SMQA 3GRPA 1R3UA 4I2VA 4EY4A 1G1MA 5LDGA 1QTQA 8ADHA 2ZJZA 1FVXA 8GPBA 4JGGA 2XO7A 2P11A 3U3XA 2PWZA 2QN1A 3MJEA 1KDYA 5JHHB 2XCTB 3HZRA 6PFKA 1JPNA 4ECZA 4BN5A 4B2IA 1H69A 4P3KA 4DQ0A 1BA3A 4PGGA 5DX0A 1KYTA 1NUTA 1G291 1EWYA 3HJHA 1D1QA 4PE5B 3C21A 3AR5A 1KIAA 4GNRA 1K1QA 1T43A 3LUDA 1L1RA 3VDMA 3QFTA 3PXUA 2H48A 5BQOA 1YQTA 1GZ5A 4JLMA 1ISHA 4DG8A 2GPBA 2PGIA 1EFPB 2VDWB 3BE4A 2X14A 4NWIA 4EPXA 4O3NA 4POAA 1HKUA 5CAEA 1J49A 4GLBA 1OXKB 2QE7D 2QT9A 3NWEA 2JIOA 4V0LA 3REQB 2BFCA 3ZU5A 1MHPA 2B6NA 4LRQA 4M1ZA 4YP0A 3E5MA 3LUGA 4B3HA 3BJYA 3DA8A 4GPZA 1WZIA 2BGTA 3PX4A 1FLVA 4B4WA 5D01A 2IYUA 4CGZA 5DNUA 3H19A 2H1VA 3REGA 3TDMA 3OTWA 3GZTB 5KFKA 1CZLA 1YVEI 2HQOA 5KT2A 3GRFA 1A9QA 3A7DA 2IDKA 1MQ3A 1Q3KA 1F9AA 3PV8A 1SK8A 4ZFNA 1YDMA 1B0UA 2XDQA 1A5AB 2YXBA 5E3JA 4L9WA 3C6XA 4H1TA 2XKJE 2DKFA 3LHIA 4TMXA 2PMBA 4RC9A 1T91A 4PICA 3TL3A 1NJWA 5TY0A 1SC4A 4CWAA 3G5MA 4MYDA 2J0VA 3V4VB 1J90A 2EVWX 1VPTA 2JVKA 1T1IA 4ZO7A 4LXIA 3I1YA 4NQZA 3FCUB 2IU3A 1CY4A 1QG0A 3CKYA 1OV4A 1MO4A 4F5EA 2QRHA 4GEKA 4AJKA 4OJ5A 5J2AA 2F8SA 3GPCA 2PQ0A 1DC7A 3N3BC 1ZUNA 3H5TA 2ZR8A 4XGKA 1RE1A 1RWWA 2VOEA 1BE0A 4PSKA 2H1IA 1KS9A 1QB8A 3DPIA 3SC6A 3KHLA 2CC2A 2IW1A 4K1LA 2HF7A 4TYWA 1HDGO 2NNLD 2OCPA 4MR7A 5ALGA 4DDVA 3EQ2A 2CHQA 1QH1A 1G21E 1EK6A 4LC0A 3BE6A 3HEMA 2C2MA 3BXPA 4R9RA 4PLTA 5FO1A 1V43A 2JJ1A 1JAXA 1ZZEA 2PYDA 1Z0ZA 6Q21A 1MX9A 2X3YA 1UXOA 2MINB 2BH2A 4UEKA 2H1LA 2HMUA 5ABPA 4RKRA 3KAJA 4YR3A 3I2GA 3HCWA 3R5FA 1ZQPA 1QHNA 4XGIA 1E2HA 5HS6A 2P6UA 4QT4A 4QX6A 3BN3A 4OQQA 5IKXA 5KTMA 3B1ZA 2GZRA 3DW1X 5B12A 5G1OA 5KFZA 1LDBA 2FEKA 4Q4AB 4A0FA 5KYWB 3CX6A 4HMQA 1ZN7A 3ZHQA 3NHZA 1H38A 3IIEA 3X1DA 3HJUA 4PR3A 2M9MA 1KAOA 1XMVA 1YB6A 2QL5A 3B1WA 1FFXA 5LZ2A 3DV0B 4JFAA 4XUGB 1PLJA 3A26A 3L84A 4ASUD 2GN6A 2OG1A 2ENUA 1RI4A 4HDQB 2P0YA 721PA 1SWWA 1NBEA 4JJ6A 2O8FB 4CIAA 1O8BA 3PW2A 2VL7A 3U44B 2C2HA 4OMFG 2X7XA 3NO4A 1IXYA 1QCKA 1P5JA 1RIIA 4CE6A 4V02A 2A9OA 4PG5A 2B2NA 1E96A 4R66A 2R68A 1QH8A 2H8KA 4MVYA 2XB4A 1XMQB 2VCHA 2WIFA 1ISRA 5JNSA 4BRWA 3OU2A 2R8ZA 2O19A 3H2IA 2Q5CA 5TJHA 5AUQA 2XI4A 2CLEB 4KPFC 4ISCA 1F48A 4JK3A 1QOPB 1JHUA 2IY7A 4NOMA 4FZNA 3CZAA 1GAWA 4YO7A 4NJEB 5IK2D 2B7LA 2Y1IA 5IBRA 2GXSA 4D99A 5C8ZA 4Y67A 3QBJA 5L3QB 2E37A 2B5VA 3N7AA 2IPXA 1D5CA 4O5AA 2A1UB 3LHSA 3OIDA 4XLTA 1QFYA 1UKCA 3SEQA 2HCTA 2XWPA 2NZWA 3PXEA 3ICQB 2YZNA 1NSFA 2GN8A 3FFXA 4XVHA 1PV1A 3SXPA 2CK3D 2WD7A 4MVCA 2BEJA 3UCXA 2DC1A 1JI3A 3RFCA 1NUSA 2AUMA 4P3XA 1S3FA 2C9YA 4BGUA 2O0JA 4BWMA 1G5RA 5G0VA 1GIAA 1P4GA 4REMA 4C5AA 4ZQIA 4M0KA 2VHJA 2F64A 4C0QC 2DJ5A 4UBLA 3UVEA 3MFIA 1K5HA 2VN8A 1ZQSA 2YZ2A 2RAVA 2DPXA 1DOQA 2F55A 2OQRA 2PX6A 3ZUGA 2V59A 3EXIA 2A8YA 3WZMA 4J0FA 4JQZA 2AN4A 2WT8A 4GC5A 3HB1A 3QE0A 4RQ4A 1GPMA 4KGVA 4Y30A 2XOXA 1RACA 1JXAA 3TR6A 2XIQA 1P3DA 5FTNA 4HBGA 3EB9A 3ACCA 4KQHA 1LLQA 4XRGA 3OTIA 5L1MA 2F59A 3CJRA 4ED9A 3IT1A 3T7JA 4AVYA 1OLUB 4NS1A 1PN3A 2E6UX 4XW2A 1K6XA 4GR5A 4HEA6 4EH1A 2P1RA 1NVTA 3WU2U 4LZPA 5C31A 4JVNA 3OT1B 4PX9A 2QX6A 1E5VA 4N8DA 4CI9A 2CMKA 4AURA 4EEZA 4BGIA 1MW8X 2CMGA 3QI2A 2NV2B 4QDJA 3UXOA 3BS5B 1XDGA 2CDNA 5CM2Z 2PHZA 2PNFA 1NUPA 2XGGA 3KVNA 3WB2A 1J9EA 1TA9A 3NVZA 1OKKD 3QVSA 2R66A 4UZFA 2Y8EA 2EDCA 2XDYA 4QELA 2HBKA 1NW6A 2OXTA 4I8XA 3LP6A 4YP1A 3LRPA 3S1AA 4O4HA 2OGZA 3KD3A 3C7AA 1PEYA 5AI6A 2WM2A 3KELA 3O7WA 3Q8MA 4RVNA 3INTA 4Q9JA 1V1RB 3LKDA 1VL8A 3VO9A 5DASA 3RK1A 4B6EA 3ZTWA 1NUAA 3F5MA 1JEYB 2BZSA 1E9VA 2H0AA 2P75A 3SM3A 3L8EA 3WOHA 1NKEA 4EY8A 3EZLA 2D1FA 3E81A 2VUHB 1T4CB 2YHAA 4CLDA 1V25A 2ZUCA 1Y6ZA 5GQSA 2AR7A 3ZBPA 1JE0A 2HIMA 3H8SA 2AGPA 2QN2A 4PAOA 1AUQA 3FA2A 2C2BA 5FH9A 1J0EA 4RLHA 1B0XA 5IASA 5L3ZA 1UC4B 2DGDA 1N5XA 1FXWA 2Q9AA 1J25A 2XICA 4LOLA 2OCIA 3UGKA 4K88A 2ZSUA 2LKDA 4OCZA 4G3XA 4FX2A 1WNTA 7ICUA 2ZXUA 2NYAA 5AKYA 4UE3S 2JFUA 2Z4RA 5JCPA 1KS2A 2Q2VA 2CLHB 4D98A 4CLOA 3AUFA 3DVQX 5DBFA 1HOTA 1RRVA 1ECWA 1ESDA 1V41E 1AQLA 4FMCB 1Y9AA 3IR6A 2X0EA 4G1CA 1G5IA 2F8LA 4EUEA 2GPWA 4K0RA 5ECWA 3LDAA 3EDQA 5KNBA 1TL7C 4WERA 4X20A 3SXUB 2R00C 1KH3A 3RJEA 1T9DA 4F46A 1EHCA 1N2EA 4RWZA 2WAYA 4L0MA 3RJFA 5KFFA 5JVDA 2F3PA 3CVWA 4FKZA 3G7NA 2ZVJA 3GP8A 1JYFA 3CS3A 3QIVA 1YK1A 1FDRA 2L19A 5KG1A 4BECA 1EHIA 3GLHA 5JY1A 2C22A 5CH8A 5GADl 5FPKA 4B85A 5KG3A 1MZVA 4HH1A 1IRIA 1ZXLA 2TECE 1NUHA 3OTQA 3VKVA 4F2HA 4QGGA 1VYHA 4OIMA 3NANA 4WI1A 4LFCB 3MQFA 3EZ5A 2HEGA 4AN4A 4HLUC 1U9IC 5EWMB 2RAUA 2ZYRA 3QTBA 3DBLB 1VFNA 4KLGA 1KJ8A 4UBIA 3S7TA 4OGKA 1ZJNA 1N5IA 1T9ZA 1VECA 1XV5A 3AETA 1SRQA 3I6YA 5IANA 4B7ZA 2WHPB 4YQFA 4QGSA 4PSUA 4R5HA 4LF8B 1NQWA 3PQ7A 1NE2A 2QIOA 2E8MA 4OLJA 4AJ1A 1R16A 2I2DA 1GOTA 1QX3A 4TPKA 1ZD5A 1SCUA 2EJTA 4PL2A 1W5TA 2HNKA 3ZI7A 3TK1A 5MF6A 1GKUB 1YT3A 2C5LA 5F7OA 5ALDA 2ADOA 5K3AA 2V7XA 4CQMA 5DP1A 4REQA 5CX4A 4CKCB 1KZGB 5FBRB 2JJYA 5F33A 2WUGA 3MJFA 1KO4A 4NBSA 5CD1A 3LVWA 3T1NA 1YKGA 5DKWA 2G8NA 3IKVA 1EUQA 3E3NA 4FR5A 3T5CA 4AU1A 2ZREA 3DVLA 4GSYA 3B6IA 5A9SA 4ZGBA 2ZSFA 4UUAA 3WGIA 4L4SA 4RCZA 4HDRA 4P4UA 3KD2A 4P86A 2QN7A 4D4KA 2BKXA 2WQ7A 2D2FA 4JI2B 2F90A 4YJGA 3P20A 5ALRA 2FW8A 2ZIXA 4JP2A 5FR2A 4LQCA 4ERNA 2ASDA 4LRWA 2R8BA 1E6CA 4IJ5A 3M8KA 5BNTA 3HB9A 2Z1NA 4IOMA 1TT7A 1CBUA 2AC4A 1ZQAA 2JZCA 2NRWA 1LKYB 3F6PA 3FNIA 2K2QB 4EA8A 4Q9AA 3QKSB 4M9SA 4PBTA 1QLWA 4R1TA 5JSFA 3K73O 1TE2A 1VPWA 3FHTA 1IFXA 2O05A 5F52A 3PVZA 3H5NA 5HIAA 4RPJA 3PEWA 3TIGA 1JHXA 5TNXA 3BDVA 1FIQA 4LZJA 5C80A 1BFUA 2FZCA 5ADHA 3REOA 2GJSA 4G86A 3UFBA 3DMFA 4GSKA 3QFHA 1IHUA 2NU6A 2ZDGA 1GQOA 4NV1A 5AM5A 3PNBA 2WU1A 5CMLA 4AO8A 4WL0A 3ZEIA 2QRKA 4IQGA 4REOA 1J33A 1BX3A 1H6BA 2I8CA 1O9BA 3LT0A 4PHHA 4YRIA 4W1SA 3UGJA 4R1NA 4QPCA 2KJQA 1NXVA 1WG8A 4AUEA 1ZD3A 4K05A 4AB1A 5FNVA 5HR5A 5IJXA 3DGEC 3I72A 3MGIA 2J6SA 1Y3AA 1XHEA 4DREA 3VCBA 4CT5A 5B30A 1ZQUA 3HCBA 3SKXA 3CX8A 3CYFA 3RRJA 1DAOA 4ED6A 4LVSA 3OBIA 3LX8A 4W82A 1CKEA 2PR2A 1ZVMA 4DBLC 4PPNA 3ZWKA 3FJOA 5COAA 3HT3A 1G98A 1L7BA 3L8ZA 1ELOA 2LXNA 3IAM1 1D9ZA 2VP2A 4OG2A 3QV2A 3HJEA 1W75A 2Z95A 1UMDA 4W1QA 3VJKA 3GFQA 4UUBA 2HC9A 1EDDA 4M36A 4XH9B 2LW7A 4XXHA 3Q1KA 4KW7A 1WE2A 1JT9A 4XDZA 3DR5A 1CZHA 1II8A 4DB4A 3SSAA 4I4TA 5JC1A 3TRHA 2PD4A 3JTMA 4GP6A 1C0KA 3G23A 1BU8A 3R5KA 3GOQA 3KS9A 2PT6A 1G7TA 4N18A 4F4FA 1CU1A 4N9QA 3T1OA 2OOSA 3CF0A 4WLUA 5INTA 1PT5A 1YJ8A 2PUCA 1RZTA 4NAHA 1SKSA 4ZTZB 1QU2A 2VYFA 4KLFA 2G82A 2NWQA 3OWXA 3Q8KA 1ZSYA 4C4ZA 3GJ7A 4DOAA 2FP3A 3UJAA 4EMTA 4OXKA 1S77D 4FR0A 4DOCA 2QVGA 4TWJA 1VIMA 3HR8A 5ALKA 1CUGA 2XD4A 2VDPB 1UXJA 2F48A 4RMJA 1J1IA 2OP0A 4JQYA 1N0HA 5D49A 2DQYA 1JIXA 2I8AA 3F5DA 4JBNA 1PGPA 4RQ7A 1N7HA 4BB9A 2BBOA 2OAQ1 3OZTA 3EXAA 4GPEA 1B8PA 3FZNA 1EDZA 4KQIA 3HVUA 1EWQA 3VC1A 2F4NA 4KRXA 3M89A 1G9TA 2X22A 3LHDA 3NHKA 3K2EA 4K6CA 5LC1A 1Y8CA 3I6BA 2YNMC 2Q49A 1ML4A 3G0HA 4C2TA 1A9RA 5LB2A 2YHSA 3QUAA 3ZC3A 1UAAA 2F3QA 5IKEA 5JZOA 4WRRA 2W2VA 1O6GA 5KBYA 2WSSA 2QL9A 4GXNA 2H1FA 1EFTA 3F8SA 3PWTA 2BFFA 3IKTA 3IG8A 4RU1A 3RYHA 1KMHB 2WWXA 3ZHOA 2ASEA 2MSWA 5DBEX 3FZQA 2H3HA 3D4BA 2Q1SA 2EYQA 2RBGA 1V9SA 3B5JA 3K6KA 2XA1A 4P54A 1A0PA 4FYVA 1NFFA 4QGFA 2IOHA 3BHIA 2FWPA 2XE6A 5FI1B 4LZLA 1E1KA 4KLHA 4PPXA 4NCNA 1NP3A 1G20A 2BF7A 4G5SA 5AK5A 1X9WA 3WYEA 3HMQA 3CUKA 4P4PA 5BV7A 5HWSA 1LKZA 1B7GO 4BCCA 2WINI 3F2DA 4ITRC 5JUWA 4F8JA 3RYIB 5AXBA 4FYWA 3AI2A 1V1MA 4BAUA 4PZNA 1DFGA 1NPDA 4OEHA 1ZI9A 3ESCA 4HI0E 4MV1A 3HBNA 3CTPA 1ZM7A 4QJ3A 4HNAB 1G16A 4XWWA 3U81A 2RBEA 4UCXA 3V48A 2VF4X 3OURA 2V3CC 1J6UA 1NYLA 4ZQEA 4RA9A 1BKSB 3C16C 3OZCA 2ODWA 2V9CA 5TLSA 4TKVA 5EZ6B 1KY4A 4GBED 5T8KC 2DSTA 4IYJA 1XX6A 4OUDA 3PQ6A 3V1TC 4OHCA 1Q1GA 5JJCA 4YXWD 3FYUA 3AF6A 4Z6CA 3DKVA 1CNEA 4E08A 3ZH2A 1UA0A 3DEFA 1BMFA 3JARB 3GLFB 1Q3VA 4BWGA 3UK2A 3NASA 1E9CA 5A3SA 1W0JA 2ZSIA 1OAKA 4DPLA 4Y7CA 4JUFA 4D8YA 3T99A 2WMYA 1DO2A 4FHCA 5F73A 2ZITA 5EHIA 2HRQA 1NX9A 2ZZNA 5EMMA 1OWOA 1AXGA 1EFVB 4L15A 1BVYF 1U7PA 5LYJF 3U7QA 3K5WA 1WY7A 5JH7B 1WXFA 1WMAA 4Y6OA 3SN6A 2B20A 3BWCA 9ICJA 3AM9A 5MGBA 4EDHA 3PT5A 1KK2A 4P83A 4TVSA 4DA6A 3KSRA 3SF8B 2H3FA 5FJJA 5AI0A 4OH7A 3DFKA 10MHA 3KUDA 1H6DA 4WINA 2KQUA 2FGKA 1NI4B 4Q1BA 2FQYA 1XYGA 5EN4A 5KAFU 1KHTA 1B42A 3Q6NA 4UHDA 3NDBB 4WKNA 4LZZA 4R8UA 2H52A 3L92A 5FPYA 1N5KA 3GZ4A 1ZKDA 3T3IA 4BV3A 4ZYLA 4E7PA 5AOCA 1V1JA 4UC0A 4H35A 2Q7DA 3EZ2A 1QGYA 2VTEA 1X8JA 1Z6GA 3EASA 1ORVA 3GV7B 1DAMA 1SUDA 3LCRA 2BGIA 821PA 2X5NA 2RRDA 2WM3A 2CLMB 4YDHB 3AUYA 3LP8A 4G84A 2CMFA 4B9VA 2K8AA 4GNKA 3QVKA 1K7XB 1E92A 3V2HA 3G2QA 5I7VA 4PTLA 2A3RA 4NHEA 1ZPDA 4DM7A 3BOSA 2GR9A 1ODFA 5H83A 1K7FB 3IAHA 3U3ZA 4N12A 5ALTA 5CEFA 1DKMA 3OZSA 1N2ZA 1HE5A 3C14C 4HJRA 4NNOA 3U62A 3ZVMA 4ZI7B 2QUJA 3ORYA 1YR9A 5DN6A 1FDWA 5LQAA 3TXAA 3UMFA 1NXQA 2H57A 4H31A 2HHHB 4EHAA 4ZQCB 2R1TB 3D3JA 3RO7A 1UFKA 4QTTB 2WAMA 4KH0A 4IMJB 3PIIA 1X7ZB 5J0YA 3JV7A 4AD8A 4OJYA 3U4HA 4IFEA 1R6UA 3I34X 1EUDA 4AKIA 1YO6A 2QPOA 3DZJA 3TLMA 4PQEA 4YJHB 1AY0A 3PR4A 4DYHA 3KKNA 2BJHA 7REQB 2A9KA 5TMDA 4JFRA 2D5IA 1ISMA 4HZUB 3G8BA 1XWLA 4HX5A 3KQYA 5AVSA 5BOLA 1C1DA 1CJKC 2MSKA 3ZLTA 5AKLA 2PA3A 4J0HA 1L3SA 1JXOA 4AZTA 2P6OA 5JAHA 1NG9A 1HE8B 4OBEA 4PHDA 4RQTA 4XIYA 3L0BA 4CI0B 3K9CA 2EKBA 2JEIA 2JH9A 3WLIA 5YASA 3FCEA 3RARA 5AXDA 4OVKA 1RP7A 1K92A 3FNBA 2O6KA 4JQOA 2ZZMA 4F5DA 1L4NA 3SSNA 4C8OA 3ZBQA 4L3VA 3PNVA 3LOPA 3ANMA 3OM1A 4B6FA 2YZMA 3KV3O 1OWLA 2W54A 4QBHA 5CVUA 2C4KA 4A5SA 1OPXA 1T34A 4BS9A 4JMUA 3V1KA 1NP6A 2IEAA 2WJIA 3GLGE 1MQ2A 2GM4A 2ONZA 2VFAA 2VP0A 9ICVA 5J2GA 1YV9A 1M8JA 3DDOA 4HD8A 1XFAA 1W96A 5K0EA 3DOIA 1BVUA 2IJGX 3RJTA 5EEHA 2Z4SA 3L6CA 3PCTA 4QOGA 4FCTA 4JLUA 4LW8A 2OVBA 5CB1A 4BB0A 2AZDA 4MHTA 2IYWA 2KSOB 1G64A 2MSDB 4Q4DA 1KJNA 2M98A 3D2NA 3K31A 3GC6A 1FSSA 6ADHA 2AEFA 4ER5A 3AXTA 2FPIA 1HLFA 4AN0A 4J9SA 5FYQA 4ZT4A 3D0QA 4M0FA 3RW9A 2ZUBA 3HO6A 5IH3A 2PSEA 1ACJA 5K3OA 1YOVB 5I45A 5A3RA 3BGSA 4OLHA 3LUFA 2RJOA 5B36A 2CB9A 3HDVA 3Q12A 2VYVA 2I2CA 2BPCA 2G8LA 3OD1A 3B6EA 2KFZA 4M9XA 5U4QA 3LUPA 1UBCA 4XVCA 3IP5A 1C0LA 2UKDA 4M0MA 1JX6A 2VAMA 3VR3A 2V7QD 2NRTA 5E6SA 1TEVA 4O3RA 3VMMA 4DA0A 2E8NA 5JD5A 3KHUA 4FKBA 1DAEA 4AW9A 1Z45A 3SY8A 2D6FA 4FHDA 3AU2A 2QX4A 4HLNA 3PDIB 1DQSA 4KXYA 5H0IA 3IT3A 2WVHA 3DLCA 1BPBA 4Q18A 1LK7A 1R0CA 4IZ6A 1F8XA 5M29A 3TSZA 5JRJA 4TL6A 1K2VN 2W48A 3D3WB 1M3SA 2M32A 4NULA 3H86A 4BKOA 4QFDA 1M2GA 4MB0A 2ATEA 3BSWA 1F51E 3N97B 2OD9A 3IA7A 4UW9A 2Y1LA 1Y3BE 4MEXA 2XSZA 3QPBA 5FFMA 2ST1A 3G2JA 2XKAA 5J2UA 4PIPA 1NVGA 2ZR9A 1GRNA 4W9NC 5JD4A 3LWDA 4C1NA 1V37A 2FUCA 2Z3WA 4O4IB 4X62B 2BFPA 3DKIA 2BTEA 3NHUA 5J5AA 3T41A 4X1KB 1UF9A 1Y3CE 4CHTA 3EGEA 4BJ3A 2NP6A 4EB0A 5H02A 1PVDA 1TYBE 1OA0A 4DXHA 5BR4A 2FSUA 5DNVA 5JALA 4EJSB 5BQXA 3M5WA 8ICEA 2QUKA 3QLVA 1P19A 3B9QA 4N0QA 3GCGA 4BWYA 4I2EA 2PWBA 3GDOA 1N0UA 1TZBA 3TO5A 2YJ3A 3VGPA 3U4QB 3BD8A 2VAWA 3ST7A 1U4OA 1K4KA 3MWLA 1DPGA 3HNPA 4G4GA 1VKNA 4WN9B 2FLKA 1H1DA 1ZJMA 1PNVA 2CYCA 3ICVA 3PWKA 1TCVA 5JBQA 3NNDA 1X7GA 1NVXQ 4D9FA 3HCOA 4PCVA 5JNLA 4MV6A 4I7EA 1UKVY 3C4QA 2EZZA 3P9PA 1KOJA 1E3WA 1P61B 3AVTA 4NH4A 3ZK7A 4IGKA 1M67A 1QGAA 2EG5A 3ITEA 1QMPA 3OCYA 2KP7A 4HGYA 1PK1A 1LV8A 2YOGA 3W9YA 1Q0ZA 2D3DA 2G5GX 2OHOA 4KLIA 4BC1A 1OXTA 4DL9A 3FCAA 2BOVA 1L7DA 4OH1A 3EZ7A 1RYYA 3PGXA 1J1ZA 1NJ2A 2GS9A 3GEEA 5ER9A 4DSAA 2PUFA 4DNOA 3IURA 4QEZA 2AFIA 2OAGA 1C29B 1CRWG 3QE3A 2QLJA 1W36D 2RDMA 3IEPA 3KPVA 1L7NA 3HRKA 4ZQHA 2AFHA 3HO8A 1U0OC 2I7CA 3SR4A 3R44A 1IRXA 2EZYA 1V11A 5I9SA 4DC1A 2P9JA 2B4RO 4XYMA 3VDRA 1GUYA 4O5CA 2APJA 1E64A 2FMFA 2ECQA 2C99A 1QHSA 2E4WA 4WNIA 3MTAA 3UJNA 2Y0SC 1JQKA 3MGAA 1UBGA 1W581 2BGWA 3Q8QB 1VZ2A 2N0SA 1H6CA 1OTHA 2IRWA 3EUAA 1WXGA 3H2HA 3HYNA 1HZZA 1AKTA 1IEWA 3T34A 4B82A 1QP0A 5DTIA 1VKJA 4ZCRA 1JI0A 1ZMRA 2QRGA 3ECCA 1KJIA 2J85A 3L7CA 3WYGA 3ZJUA 1TEZA 4MQ5A 3CKLA 3UV3A 1GKYA 2XRMA 4OSPA 1ICIA 2QUAA 3OD5A 4CPDA 3MRVA 2Q41A 3R9XA 4JYCA 2QZ9A 3EPIA 2H3IA 1RVDA 2LZ0A 1RKQA 1MEEA 2GN4A 5HM6A 2WJ6A 5JY6A 2GO1A 4P2GA 3KKPA 1FTQA 4M38A 3G6YA 1NRWA 4EGAA 3GDHA 3AQEA 1P4SA 3O92A 3WK7A 1M7GA 3LQYA 2IGBA 1U98A 3MLAA 1ECLA 2GCOB 1YZ6A 1NJ8A 3P71T 4ND8A 5KNDD 2WMDA 4DIEA 1OLSB 3DHEA 3L2OB 5EJ2A 5TC4A 4JU9A 1DAGA 3DEJA 2Y1JA 1XVVA 4TUPA 2VPWA 3WHPA 3RJIA 5HA5A 3HZZA 4I2AA 3C3MA 4CKBB 4F4WA 1G8KA 1E3EA 3STXA 3ZQJA 4OO1J 1EP1B 2K4IA 1TKCA 2HUNA 2OO5C 3WKDA 4GI1A 4YCDA 4AROA 4TM7A 3FFAA 1SELA 2GHIA 2AN9A 1NVMB 4Y2TA 2KFNA 2J7PD 1ZCBA 2GLEA 1ILEA 5GV7A 5DSZA 1E4EB 3G6KA 3VTKA 5C3MA 3W0LB 3IEUA 3FKSD 4JSTA 3V7UA 2OPBA 2WE8A 2IFTA 5TGDA 2PBZA 1GWNA 2C82A 1F1BA 3S2SA 1G59A 1TUIA 5LJIA 4EMUA 4YAUA 2QQFA 1TZJA 1AM4D 3VKWA 3CP8A 4CM8B 2C9CA 1V45E 3D81A 3KC2A 3QK7A 4UCFA 4G5XA 5AVOA 1NN1A 4HQFA 4H15A 5E4TA 4UTNA 2IC5A 3JQDA 1E6KA 3B3JA 3CEJA 3TADA 4NLLA 4OI0A 1U3DA 2BPGA 3WP0A 4IGIA 5K2MA 2ERYA 4IKOA 3ETJA 1FRNA 2BKEA 1L5QA 2V5UA 2RG1A 1SIBE 2VRCA 4XVQA 4XDHA 2R6FA 4K40A 3LY5A 4KVFA 4A16A 3TRJA 4FFRA 1N6IA 1U7WA 3AMZA 3VOBA 4DJFC 2P3OA 4L6CA 5CIYA 1RRCA 4A5OA 4DQRA 4WXPA 1XEXB 4G0PA 2DPIA 3SNHA 3TVYA 4BBJA 1VGVA 3FIJA 4XB1A 4QAQA 1DCTA 4Q4JB 3GO4A 1LS1A 5E38A 1Q0PA 3FC4A 4J0KA 5KAMA 1MC1A 2BZ0A 3STWA 1QHHA 3ZD6A 4DGSA 2JKZA 2BE7A 3G88A 4Z4QA 3ZWWA 2JLZA 1QO0A 5H80A 3ITKA 2AVDA 1TADA 1WD5A 4DQVA 4KLDA 1FFHA 3CY6A 2CNWA 2JFZA 1HXHA 1JFTA 2AZXA 2RDJA 1CRLA 1SC9A 4LHWA 3I2IA 1RWBA 1US8B 4RTSA 3N2YA 2X8AA 3ZWDA 1P62B 1IK4A 2H2GA 3LCJA 4DEXA 3TQSA 2I3GA 2QTGA 3FCSB 4A2PA 1U2EA 3LVRE 4G1BA 3ZY2A 1GGKA 2YN0A 3QZ8A 1JH8A 2JLRA 3D8UA 2B94A 2GASA 2VQ6A 1MOPA 4PWYA 2P9HA 4TV9B 4UAWA 1XZFA 4PHAA 4JJIA 5K20A 3M9LA 3H9JA 4KZPA 5GONA 2VJDA 1OY1A 2ETXA 4U4AA 4QE3A 4KXVA 3V8VA 2DB3A 2JLSA 2A19A 3PNKA 3Q6MA 2HMAA 3N6XA 2GUGA 3RWMB 4FQ5A 3ZGLA 1ZIDA 4OQNA 2VAXA 2AGOA 2X0DA 2XIDA 3L4EA 1KETA 3SXJA 3V34A 1BHQ1 2IK8A 3L6UA 2QYHA 3N2NA 3E1GA 3WL8A 1FO4A 4N5HX 1CZOA 1L0BA 1XA3A 3PTLA 4LDAA 2COKA 3AB3A 1SC1A 2G5TA 4BNHA 1EFRD 4IAOA 1QSGA 2O2SA 3C3KA 4JIMA 3AUOA 2EEZA 3R0JA 1T9AA 4F86A 3UAZA 3TB4A 5L3VA 3M6FA 3MOIA 3A3KA 1HE4A 4BO2A 1O57A 4Z1MA 2P1DA 5TPWB 3E9YA 3W2HA 2ZDQA 4BFSA 4W5OA 5H8WA 1I1QB 1AT1A 5KMGA 5EXTA 4IKEA 1W35A 5ALNA 4I6JA 2YINC 3BRQA 3AI1A 2MU1A 4MFAA 4DLBA 1BQ4A 4KSYA 3PDWA 3IERA 3ZHZA 2CHUA 3G3EA 2RONA 5LWQA 3GAFA 1ZETA 1S8FA 1SL1A 4IRCA 1A72A 2DHCA 2HBYA 2RIRA 4CLRA 5CB0A 2EFGA 3U9LA 4YRTA 2KI5A 1JNXX 4CMIA 4F4CA 1FNCA 3SI7A 2A9VA 3FTFA 1SKUA 3CLTC 2KLBA 3ZWAA 5KVCA 4IWNA 4B7XA 2N46A 4NESA 1NVFA 2DWUA 3EAGA 3NVDA 3VO8A 2BZGA 1A5BB 5EQJB 2CY0A 3CKKA 3S7ZA 5DXJA 8ICZA 5JW6A 2G3YA 3FFWA 4AJJA 4MVJA 3W5BA 4QOHA 4ED8A 1EXWA 4GZLA 2R2GA 4Q34A 2GD2A 4R98A 1P2FA 3DBVO 4KXLA 1GQYA 4YDRA 5DHQA 1RPAA 3V4RA 4P3NA 1DIBA 3WGUA 1J2EA 1QVRA 4WA8A 2FR1A 2FKAA 4E32A 1CETA 1UWCA 2B98A 1KKUA 4C7ZA 3L4PA 1EUCB 1E2JA 5CVTA 4TWBA 5BRJA 2G04A 2VH5R 3UQYS 1T1SA 5ULLA 4DQXA 3NBFA 3ROZA 1FP4B 3WLHA 1VKHA 2IV2X 3ANYB 4D6XA 5JBIA 1YVPA 4HO1X 2Y4NA 3QG1A 4JYPA 3T9FA 1ODCA 2ES6A 3HN2A 4IOJA 1IHXA 1PS0A 4LJ9A 3R4CA 4EYKA 2WF7A 2A33A 1PT9A 4LBYA 4Q7EA 3QV1A 4EYQA 1RI5A 5THKA 1YRLA 4TS1A 1YKFA 1JHVA 1E2MA 2QVZX 3PPWA 4JR1A 4R8KA 2JD0A 2DLNA 1Z26A 1PJ8A 3U3OA 1SHTX 2DCUA 4INOA 4QYTA 2NZJA 2VP6A 2F62A 1HFJA 3DE3X 2HN9A 3F6CA 1G18A 1ODIA 3EF0A 1V39A 3GUVA 3RC7A 4K7JA 4JJEA 4RGQA 1NU8A 4H7IA 3LCCA 2E5LB 3EG9B 1HDEA 2FXVA 3HLYA 4FQ8A 4R54A 5TMEA 2WNHA 3KXLA 4AWXA 4KMRA 3BHJA 3DZKA 3GP3A 3JPYA 1XDZA 1B6SA 2HSDA 3X1MA 3MK31 2VP9A 7GPBA 5CA0A 4UAYA 3TARA 1ICEA 2ZKLA 3ZKWB 3G9TA 4KPUB 4BQIA 3K9FC 3LC7O 2X2EA 2QR3A 4ESHA 3HCFA 1ORHA 5E4JA 5U9CA 1V47A 4IIXA 1EU1A 5K3FB 3PCRB 1CUVA 4FVTA 1ZCFA 4M1KA 3LNTA 3QYFA 3K71B 1U7UA 4CEJB 1ZDMA 1GFZA 3IAM6 5D87A 5L40A 4DO9A 1RYDA 4FFVA 2IKQA 2FRDA 3T7SA 4V1CA 4TRNA 1OFVA 2FMPA 5F5NA 4DLWA 1ECFA 4BXOA 2ONKA 2R87A 3QY9A 5LBTA 5T67A 4RSMA 4TT3A 3I42A 2J3QA 2QAGA 1JDNA 5ANRB 1W6RA 2O8DB 1LJLA 2Q50A 3P2YA 2A1AA 1KE2A 4UOEA 2DWPA 1OU0A 1Z00B 2PCLA 4MXDA 2WD8A 3A1TA 2PFKA 2FTKE 4R2MA 4F4UA 4MGEA 2LTAA 3K15A 4AJNA 2YB1A 5JQGB 3A37A 3MB5A 3LZDA 1QTNA 4PYIA 3D3NA 1QH9A 5JSUA 1SVLA 2QTRA 4HNRA 1S0UA 1U48A 4G5QA 5HNKA 2QG9A 2IV7A 2HFKA 4QWEA 1JEQB 3JYNA 3RB0A 1ZMXA 3CLSC 3PC8C 1N5DA 4IRKA 1U63A 5HF5A 1BCRB 1ID8A 4YBZA 5C2JB 3QRWA 3G0GA 2YWDA 1AHHA 4ZVMA 4RKYA 3UHPA 5KYUA 1GQQA 1T6ZA 4CMEC 4EI8A 3VR5D 3BH6A 4FX5A 2HW8A 4M9CA 2RGWA 1Z6AA 3IJPA 3SEFA 3GVCA 1FLNA 1XXHE 1NW3A 3OU6A 3B82A 2QF7A 2RE8A 1IC6A 3HBLA 3SPXA 2CCKA 3B48A 4LC9A 4QWMA 2ADFA 1XVTA 1J8FA 3SOPA 1DJPA 2R5FA 1NVVQ 4BATA 2C9DA 3IDSA 2W6IA 2VRNA 4YP7A 3RBVA 3EE6A 2FMXA 1JLMA 1VIVA 3ZDXB 1FY2A 3SJAA 4KOAA 3JQGB 1HV8A 4JC0A 1QP4A 4AP5A 3K8QA 5AUNB 4N40A 1RBZA 1F60A 3BQMB 4BKPA 4TUSA 1J7KA 4UFPA 1FRZA 4ZI3A 3C8UA 4DBVO 5CCDA 1NXPA 4QFMA 2UYCA 1VIDA 3MINA 1ESCA 1QP8A 4QQNA 4EFNA 3FGNA 3NT5A 2HK6A 2C2KA 3FPHA 3GMDA 4NMWA 3QEBZ 3NBKA 4RMNA 4RJKA 3OZIA 1U0SY 2RHMA 3DWIA 1TW2A 4OF4A 4X91A 3PFHA 3IHTA 1ZM4A 3KQNA 4TMWA 3ORRA 1XG5A 4RQAA 5A7FA 4KN8A 4Q82A 1IEXA 5F2EA 2AK2A 3T0FA 5BW4A 2MDTA 3HY6A 4PZUA 4JOCA 5SZIA 3NHSA 3I92A 1N56A 2F9MA 1DCMA 3QI7A 3RFTA 1NDUA 5LWHA 1K5GA 4V2UA 3FZYA 1ZJ5A 4YJ2B 2HQRA 4E21A 3HWTA 4ECTA 3U60B 4GYYA 3EYWA 1OGIA 4WEQA 4TMTA 3RRFA 3WG9A 5BMVB 5B53A 5D00A 2VK2A 4BX0A 5HKKA 1S2MA 9ICXA 3A2LA 1Y4SA 5FCDA 1J5PA 1CY8A 3LBAA 4I4CA 4J3JA 5B6PA 3T95A 4PYOA 1WIWA 2BFEA 2C5FA 1K98A 1ORTA 3ZE7A 2LIVA 1UQUA 3ECSA 2HLDD 3LXMA 2FFRA 3P0IA 3TE6A 1FDOA 3NNNA 2H7XA 3PGMA 2ZJOA 5AVUA 1EP3B 2C20A 4QU0A 2ZS7A 1OXMA 3WBJA 4D44A 3KK0A 1FNMA 1U04A 2V6MA 1YUNA 2CJYA 2QV7A 3NIWA 2B8JA 1XSEA 4AYXA 2EF1A 3HA2A 5TV2A 3D6VA 2V4MA 4ZXFA 1D3AA 3T4UA 1KQPA 2ZRPA 2C2EA 2HA0A 1K6MA 2OD2A 4YV7A 1Z7EA 3FYSA 1GA4A 2P5TB 1LGYA 1XHFA 4F84A 3HG7A 1X7HA 2EWWA 4EDFA 5D84A 1ADJA 4Z4IA 3B9PA 2X2PA 1RTTA 1S1MA 3UY4A 5AFSA 1TQ2A 3MBKA 2WUFA 1U8FO 4EZBA 4FOPA 5AOBA 3DB1A 2WF5A 2M1XA 2UDPA 1PDVA 1Q83A 1XR3A 4LXUA 4YQYA 5JAPA 4QOIA 4UM8B 4L27A 1RYSA 3GB9A 3OZRA 3QEMA 3TE7A 1PQ4A 4DLTA 3VNSA 5SY4A 2R8JA 2MYNA 4PHGA 1UM9A 1SXQA 1MLDA 1Z33A 1LJUA 5ICSA 4XLZA 2HOQA 3FAZA 2WFZA 1MN6A 4HR7A 3LOQA 3PSTA 5HP4A 2JFVA 1YQGA 1SXGA 3TDNA 3NBYC 4FFOA 3ZJTA 1QIDA 2HYIC 1MQSA 1BXGB 1HLGA 2GBGA 2OESA 4YA6A 1NMEA 4NBWA 3CNQS 3I1JA 2C4MA 1SOWA 2QD3A 1R0WA 1N3IA 4P6VF 1H0KA 4D9MA 3GRZA 4TOIA 4OOEA 4DUGA 4A15A 4GLOA 3EIQA 4PNHA 3HDHA 3H1GA 1OAAA 9ATCA 4LXTA 1OZFA 5EG5A 1A9YA 4E46A 2JLVA 3F53A 4E03A 3WX0A 4Q1VA 4U7WA 3ZDZB 1O94D 1JNYA 3RS2A 1GLGA 3DCYA 3DB2A 4IVRA 4D3SA 2YWEA 2V4UA 2P9BA 2BCRA 2NX2A 3MOSA 3BRWD 1YTUA 3QPWA 4ACBA 2ZT6A 2MSNA 3M6LA 3ICCA 3P45A 4LDQA 2AKYA 1H93A 2X9NA 4EAAA 4YRGA 1NJXA 4M9UA 3HA7A 3E5RA 4S3MA 2V0CA 1YS9A 3JALB 1ZD1A 2P2GA 5M04A 1VZ3A 2ZB2A 1U6IA 4F7DA 2JEYA 2CJFA 3TFQA 4H9GA 4TQRA 4MP8A 3LGAA 4HEQA 1TVMA 5KX5B 5KFEA 5KFBA 3A1EA 3PZBA 4A8EA 2I4NA 4C7JA 3PW7A 3F74A 1BPDA 4UHEA 2XBMA 3C5EA 2HJRA 4UNSA 8OHMA 4BNDA 5AVVA 1JLRA 4K9RA 1MV8A 4RH1A 3WMWA 3CC8A 5KFJA 1R8JA 2PMFA 1KKXA 1XP5A 1U6JA 4U9HS 3UAYA 3WXMA 1XAGA 3T79A 2RI0A 3CVYA 5G0WA 1R74A 2PZKA 5EIBD 4K6MA 3O74A 1XF1A 2H0QA 3ZCRA 2JGMA 4MEBA 1QGZA 2J0UA 5AK6A 5CM9C 2QBYA 4CBVA 3Q88A 4WA7A 4ECVA 4HCJA 1T8PA 4KQJA 4GP7A 1MQ8B 2FZLA 4TZKA 2RGXA 2HQ1A 5ECYA 4CDGA 2XNKA 4MCHA 1VMKA 3K72B 3TMYA 2EIXA 4U5QA 4NZZA 1C5KA 1NVKA 5EWFA 2DBQA 3R41A 1FFVA 3LX6A 5MHTA 2I9PA 1RI3A 1FSZA 1XCPA 3ZDAA 1KR2A 2OYCA 2WWTA 1Z74A 1P81A 2A3VA 4A8HA 3B6ZA 1ZONA 1VA5A 5BV2P 1B6TA 4KIUA 2X8JA 4ZCTA 5BWMA 3SQXA 1J1UA 1CEXA 4MJXA 4CV3A 1IN5A 2CDCA 3WMEA 1IBCA 4KLMA 4O1IA 4Z8YA 3V1MA 1ZOOA 3LDHA 3UW3A 5FLXA 3V33A 1OHHA 3BXEA 4UVDA 3RR2A 4MW0A 4CR8A 2WIDA 3IQZA 1QNFA 3TZCA 2DKNA 3ET4A 1K4MA 1X9MA 1VIYA 1DE0A 2FLNA 1RHKA 4FMDB 4XQCA 4PHPA 3IAAA 3DWGA 3QUTA 4PYJA 2FR8C 1KFSA 5FA5A 3AXSA 1XKTA 2RB4A 4JLNA 4OXYA 3K09A 2H4YA 3C2KA 4XYEA 3TRDA 1J70A 3DDNA 3O8CA 1A9XB 1NQTA 4JMLA 5A6VA 5GIOE 2IOFA 1NF8A 4NLGA 4FBGA 4AAYA 3HYRA 3I4FA 4X5OA 3HDJA 3QZ7A 4DHWA 2TMKA 1EWRA 2G1JA 5KJEA 2OLEA 4DM3A 3UBMA 2IL1A 4K26A 1HZJA 3P7MA 5KL8B 3I2HA 2YDYA 3NV7A 4Z9BA 3HP4A 4UNRA 3M81A 1ZAYA 1I1HA 2ZCUA 3LKVA 1U90A 3SZUA 4DRXA 3ASUA 2VNKA 1IWPB 2V9WA 1AHPA 3TYXA 4AZWA 1TMOA 4Z4FA 3LY7A 4AS2A 1VOTA 4MZDA 1JSRA 1NOKA 1Z4NA 3IUBA 4KUGA 1SU4A 5IHXA 4DY6A 4B4VA 4CUJA 1HT1E 2B4YA 4YIHA 2K87A 1QK4A 5DG7A 5J63A 3BB4A 4RZ3A 1PR4A 3QPCA 3TLXA 3HCAA 4CG1A 3COJA 3LECA 2NVWA 2VQ3A 4GKBA 5GJWC 4HDOB 5ALOA 3SJCA 3H5OA 5JLAA 1JIVA 2V4ZA 5FV4A 2VP4A 1DJNA 2O0KA 5AM4A 2QMHA 3LL7A 5JNUA 4MR9B 4MIEA 5K3SA 1YXMA 1QE0A 4GLXA 2R44A 4Z6EA 1XEWY 2C2XA 3JZFA 5AOVA 1CUYA 3VHXA 3NXSA 2B61A 3OCJA 1BG6A 3K6RA 1Q91A 2PNJA 3L9WA 2P2LA 5E2AA 5AW3A 1M1YA 5DH9A 1G4HA 1ZQ1A 4MYRA 2ESRA 4DLZA 4DT1A 1KH2A 1G66A 4URUR 3ONDA 2NO6A 3MQ4A 2YQZA 3QX7A 2YYAA 4FBTA 1CR1A 3OKAA 2PFPA 1NBWB 4FZVA 4R1MA 3UT0A 1MOZA 2CSUA 3HKDB 1Y7IA 1EM8B 1U8AA 4H17A 2IWHA 1M5RA 3EQ9A 3BD9A 4LDRA 3S2GA 4UM9B 1JE1A 3ZCTA 4BJ1A 3W7AA 4V0KA 4Z7OB 2HMXA 5GTDA 1BEZA 4B2PA 1GU0A 4B0PA 1SQ5A 5J5VA 2KHQA 4DV6B 1X80B 1HYGA 4FZ3A 2B5OA 2GN2A 1W8DA 2I91A 4IR7A 2BTQB 4TKUA 4V03A 1M8FA 2G71A 1U2DC 3HU2A 5DGDA 2E55A 3FGOA 4MGYR 1F0MA 1Q1AA 5CLJA 5DMXA 4I1RA 3BGWA 4DMRA 4BN0A 2A30A 2W9BB 3ELWA 2LP4Y 1W25A 4ZVPA 4HT3B 2C0PA 3ILSA 1ONBA 1M9NA 1LDGA 3GQCA 1D8YA 1KWKA 1Z2AA 2QW8A 1WPGA 4G9BA 3K1RB 3DAGA 1E6LA 1KI6B 3K7EA 4RF3A 4E4RA 4KKVA 1XD2A 4M1MA 2H85A 1DC5A 3ZWOA 2B83A 3T54A 3NHYA 3DFMA 3DXZA 1DELA 1KYVA 4QZDA 4BAGA 1N2CB 4OHXA 1FZTA 5D8DA 1ZQ9A 3SFZA 2W2KB 4MS4A 4EKNB 1FJHA 2E8OA 2D13A 5AVRA 4ARAA 4NCKA 1GYPA 4P0PB 3GDGA 4DR7B 3H7AA 1QPBA 2QRMA 2A57A 1I94B 3ZDQA 4KN7A 2HREA 2WJ3A 5KQRA 3CLUC 4YREA 1YZVA 5J0OA 1T36B 4ZRMA 3FWYA 3H6HA 4D97A 1XVLA 4PPFA 1Z36A 3H9GA 3V8PA 2QLBA 4HS9A 1VLHA 4HEHA 4FEAA 2CUNA 5FUQA 2GN1A 2NYUA 1A04A 1ODSA 5COQA 1AK2A 4PL1A 4RL4A 1QGOA 3V8MA 2P6RA 1HH4A 8ICWA 1JF8A 5DLGA 4HZGA 1JYSA 5CFNA 2CNLA 3TUZC 1HTTA 3FNEA 3GAMA 3GFPA 1TO6A 3JQRA 1ZU5A 4M87A 1N8NA 4P81A 2HA7A 5KYYB 5AXCA 3V8NA 4MHVA 3AUTA 3ISVA 4K4GA 1X7WA 5D3QA 1QIFA 2GARA 1ZM3A 1ED1A 4DLLA 1EFPA 2VH2A 1V5IA 2VDWA 2DVMA 2PTGA 2VJLA 3X43A 1U2ZA 2I4LA 2Y1FA 1KYWA 1A5TA 1DKNA 5KFWA 4C0BA 4DZZA 5HDQA 3REQA 3FVQA 1P0QA 4CMHA 5E6RB 4GPAA 4J7AA 1BNOA 5DG9A 1V71A 5EE1A 1T5DX 1M8GA 3U9TA 1ZQMA 1Z9BA 4QUBA 1T5SA 1SVOA 4H7JA 5D6OA 4HQ0A 1TMYA 3ADOA 3I9V1 1Q12A 3Q7EA 4QXAA 1M6WA 2TYSB 3QVLA 3EZ6A 5KJ6A 3RH5A 5KINB 4CTJA 4LQLA 1I14A 5HEKA 3H9UA 4ER6A 5AOAA 1P1JA 4QHSA 2ZSBA 5EMJA 2FJ6A 2CNNA 3ZLUA 2PH5A 4ZI5A 1UFVA 1RKXA 4RXMA 1Z4PX 5J47A 3H97A 4JP8A 1SH7A 4H18A 1NF3A 4L8WB 2QTLA 4PM4A 1A77A 3AUUA 3WHKA 2ECPA 2ZBEA 3KPJA 2VHZA 1R15A 3ZE1B 3OCCA 1ZGAA 1A98A 2JC3A 4PBRA 2WG1A 1C3XA 3IQEA 4G1FA 5EUCA 3CRZA 3L02A 2HU5A 2G9RA 4YUYA 4FINA 4CU5A 2J4FA 5JMPA 3BXOA 3PQ3A 1LF5A 1YZGA 1ADYA 2BF4A 1WUIS 1IM2A 2O07A 1U8YA 3NS1A 3G17A 4RKQA 5HCUA 1FTNA 1MAVA 3C7TA 4DJ5X 3L41A 5K03A 4BPBA 1QHXA 2NTEA 4F38A 5H4HA 1QVVA 3SVTA 5CX1B 5NULA 4QZGA 4D4GA 4JBYA 3VZRA 3PDCA 2ZTDA 5J4HA 2MINA 4E4YA 5GJBA 2G67A 3KQLA 2P9FA 2FE4A 4JBIA 4XASA 4K2HA 3S2UA 3IUQA 3JXEA 1MUUA 1L6NA 2RSLA 1LX6A 3DKPA 2G88A 1DQPA 2AI1A 5BP7A 2J48A 2GUWA 2OFXA 4Q4AA 5KYWA 1CQPA 2F1RA 1FSFA 1JQAA 1NK4A 5FTKA 1J24A 3NFYA 2ARKA 3RC3A 2VAVA 3QPVA 4WY2A 5DQGA 3DV0A 3BSSA 1W2GA 1Y5MA 7ICOA 4PZAA 1BWQA 1I6KA 3LT2A 2B8TA 3G6WA 4C0KA 5IUJC 4ECWA 1Y80A 5FRDA 2XMPA 1V97A 3MR6A 2O8FA 5ALSA 2REXB 2YOFA 3U44A 3GCZA 2YW2A 1ADFA 2HMVA 1X40A 2VG8A 1WXEA 3ISJA 3FI9A 3VKHA 2XLCA 3E2EA 3I12A 3MILA 1VHWA 2Z1MA 3L3FX 2BQRA 3E53A 2R97A 4UDOA 1HE3A 2PFGA 1SGGA 3F4LA 3K9WA 3RIYA 3MWYW 4AWAA 3HADA 3FZEA 2I71A 1E5DA 3KQMA 4RVHA 4B3GA 4BNWA 4NJEA 4KHPB 3HKEB 2X6QA 3FROA 4JHLA 1VJ5A 2YWJA 4ECRA 2L18A 5L3QA 2FU5C 3KU4A 5HF8A 1NVEA 3BFJA 2A1UA 2XRYA 3AM3A 5CLQA 3V55A 4DL3A 3BGVA 4TLMB 2NADA 4XB2A 2CXOA 4PLHA 3ZVKA 1IH8A 4ZZ2A 4MINA 3DHYA 3T0IA 5J0SA 3FBGA 4O6VA 5L6LB 2RK4A 1E2KA 1YCDA 4RFLA 2RHTA 3MT7A 4HG2A 5MN5A 5D86A 4RK1A 4HXEB 4Y2JA 3AM4A 1FP7A 2B1GA 4ZCMA 1D0VA 3EC1A 4MV7A 3AP3A 2O5RA 3PHBE 2M6RA 2VO1A 1X1QA 1Z4KA 5HMMA 3PXXA 1EP2B 4RDIA 3O2JA 1R0LA 2C2DA 1CFZA 1JLHA 1LU9A 4LIPD 1UL1X 3RNLA 4CUKA 4RT3A 2A1TS 2Y77A 3OQIB 3HYTA 1JQJC 4QYXA 2PQMA 2I7DA 2Q6KA 4JOBA 4KXFB 4PO3X 3F9CA 4BLWA 3CH5A 2RGGA 2NTJA 1IPFA 1YA4A 5J5CA 4DSZA 4KLJA 2NXEA 4B8YA 2VXCA 1Y7LA 5EJAA 4KMMA 1Y37A 3CPSA 3KTAB 1UDRA 1Z7GA 1HNZB 2HV9A 4O4HF 4JY7A 1HDXA 2C7PA 4RF4A 4TX1A 3WDLA 4FGZA 3NFRA 2KD1A 1GUFA 4MYHA 3X0DA 1PNRA 1S2DA 1SXHA 1I3LA 1RCUA 2Q27A 5IM5A 4W5JA 1N75A 3DE5X 4MRNA 2NM0A 1OLUA 1BD4A 1ZRNA 2JZOA 3GUYA 1LNZA 4ITVA 3AKYA 2IBMA 1S97A 5FTWA 3PJFA 1JGTA 3OT1A 4B6OA 1PL8A 4IIUA 3C5WP 1WWVA 3PQEA 2F67A 4R69A 2HMYB 3VKFA 3UHJA 5KHLB 4DV2B 5JD3A 2FN7A 5JWHA 2FF7A 4CCSA 3BS5A 1CEEA 3BTVA 3QKRB 4CIBA 5JRTA 1P0FA 5K0TA 1QTIA 5DHTA 3RU2A 4E1VA 1TF2A 1ZIPA 3UMMA 2JLWA 3NMUF 2A0KA 1FXWF 3AIKA 1RMQA 5EE3A 3MUFA 4O2BB 4EMBA 5A7HA 3BXXA 3OTHA 3FPJA 3RFVA 1OLOA 3GAZA 1N6KA 1GFIA 3QW2A 2GVZC 1TU4A 1V1RA 3N7PD 2J6TA 1CG6A 2EWVA 3QQ5A 1W9HA 5KQPA 5DLFA 1NTOA 2W2LA 4XX0B 4HGQA 1U9LA 5K8IA 1JEYA 2X8WA 4QARA 3BGDA 1SG9A 3IP9A 4UB8U 2JASA 3CH4B 2QZSA 1QG2A 5MN6A 2YV3A 5HIMA 5LL6P 4IHAA 3BGIA 4J29A 1T4CA 1QYCA 4DE5A 4RD3A 2HJHA 4EF6A 4GMXA 2OGWA 3F5AA 5MGNA 1Q6YA 2IXBA 4OXQA 2ZT8A 3BIOA 1QOQB 4D9IA 1ARZA 1KU0A 3RT7A 2ZBQA 3G7UA 3ASZA 5HKAA 5TF4A 4HYQA 1FS6A 3ORSA 4B3TB 3HABA 3IJRA 5JVDF 3CH6A 2PMCA 4QNLA 2PRKA 3TAXA 3WFIA 2BHNA 4CYMA 1G21B 2P6NA 4BE4A 3EVCA 3IODA 4N4AA 4OL0A 1PFWA 5I7AA 3U2QA 3J7AC 2FWRA 5JSZB 4YD1A 1FK8A 2YMPA 1RPLA 4YMTA 2H4JA 4FGJA 2V1XA 1A97A 3N0VA 3F6RA 3MGBA 3ZDEA 3GYBA 4NF2A 2WJYA 3BEDA 2CD7A 5CXSA 5C9ZA 4P93A 4LVUA 4P36A 2P67A 2W6JD 2GEUA 1E1QA 1C9JA 1CJCA 2NACA 2C8JA 2B30A 5NLLA 4BZXA 3WZLA 3H5VA 4MHOA 2BIFA 3SXUA 4C76A 3NDRA 4JOSA 1XJ5A 3WJ2A 1W85B 4PG6A 4KE8A 2Q9CA 3U49A 4OBXA 3SYKA 1Q92A 2CXQA 3BCSA 1BYIA 3W2EA 4F5PA 1YB4A 1W5SA 4JS0A 1PR1A 4Q02A 3C1TA 4Q6WA 1J9GA 2P9GA 4HAWA 2VDQB 1MORA 2BI4A 3TZLA 1SNYA 4RAOA 1J21A 3RJMA 1UKZA 4UHKA 3IAXA 1V6SA 3WYBA 3GILA 3HVRA 4TTSA 4C6HA 1V3QE 1XXLA 3TQ1A 5A4DA 5F7XA 1WABA 1UKBA 4LJLA 3QLEA 5DSXA 3TQRA 4DDTA 1PQYA 1C7YA 5EWMA 4BJHB 2Q0ZX 4M0AA 4HF7A 4CKEB 3DBLA 4PX3A 3RBEA 4J2TA 3EVFA 2NQ8A 1UQTA 1K6EA 4XVUA 2R00A 1S5LU 2Z30A 1WDTA 2WHPA 1RHUA 1LRLA 4IIJB 1VJTA 1K3UB 1NMZA 4O3SA 3JQ7B 1EWTA 2KK0A 2Q6LA 1JJVA 1KQQA 1DAKA 2Y3IA 1Z0KA 2HT6A 4W99A 3E6AA 2YB4A 3R75A 1R6AA 1AX9A 3MWGA 1W4LA 1GCUA 2PI4A 2X8LA 3DV9A 1WB4A 2DUUA 3W5IA 4CKCA 4X61A 4JUIA 3M1AA 3P2OA 3QXCA 3KQVA 5T6BA 4CGYA 4EB6B 2DTEA 2EJVA 1E8NA 3PX0A 2EP8A 1L5GB 2ISQA 4XSVA 1U9ZA 4LV6A 1C0EA 4YH1A 5KDLA 2KE7A 3CH7A 3ROKA 3DEIA 3IA2A 4IM7A 5FOXA 3CNBA 5LKRA 5KT7A 4EKEA 1U1CA 2WMOB 3UT5B 5FOTA 3ON5A 1TJNA 2F17A 3W2IA 4J49A 4HLUA 1U9IA 1WSBA 1I36A 1B2RA 5TARA 3Q98A 3ZW7A 3IPLA 1XZIA 5IDXA 1L5VA 1K5OA 4B33A 3OHBA 4HB0A 1G9SA 1U4NA 3KKEA 1J8VA 3AF4A 5BYAA 4UE6A 5HG0A 4P82A 3IOMA 5FNVF 2HPVA 4CDMA 4A27A 4E5VA 1ZH0A 1ZYUA 3DOOA 4HN4B 2GXAA 2NUAB 2DQZA 4LYJA 1LKYA 2Z8YM 3RUFA 1N77A 2KJ9A 4FE3A 1FMFA 4Q03A 3RF7A 1J39A 3QKSA 5JAZA 2WFLB 5K99A 3I8SA 1LC3A 1DPFA 4JAVC 2Z6QA 1KO1A 3HB7A 4I0WB 2ZTUA 5A0FA 4NX2A 3K1AA 3D1JA 2B82A 3QPDA 4YRCA 2B3TA 4MUFA 3IP7A 4TRRA 4KJZA 1Z28A 3PFWO 1I7QB 2Y1CA 3WMRA 2H4WA 1W2WB 3VR2D 1E9BA 3DCIA 4HAUA 3KSBC 2FUKA 421PA 3RSSA 1U8TA 4YROA 5BSRA 4QVIA 4OKIA 4G2NA 4ED0A 1Z5GA 4O3PA 1CZRA 3FRIA 4I4TF 3HM9A 4ZODA 3ICOA 1JRPA 3RVJA 2PBLA 4EBBA 2VBFA 4S1OA 4G63A 2Q9BA 2WDPA 5ALPA 4DSOA 1C7IA 3E7PA 3TI9A 4UBKA 5CTAA 5J2EA 3EF1A 1QWSA 2WTBA 3ENZA 1EEXB 1U1FA 3QU7A 1GU1A 3PQ8A 3I1IA 5HUQA 4JCOA 2GO7A 4JR2A 5J1SB 3ZDBA 5DK4A 3R9WA 3S44A 2D0PB 5DE3A 4D26A 3RJ5A 1COWD 4HFJA 1EPUA 5M7EA 3BZKA 4JWTA 3KUKA 2ONYA 4MIYA 3C24A 2HQBA 3IIKA 2XUKA 4BNZA 2OLKA 3EPPA 2HA2A 3QQPA 1A82A 2PUEA 2MSEB 2O8BA 2VATA 3FOZA 4FDUA 2O1XA 4IG9A 2ZTHA 1Z3CA 1ZD8A 1ZNWA 3ZQ4A 2EAMA 3SYMA 1XN1A 3N5CA 1KP2A 4RK5A 2VQSA 3FM9A 3CRNA 3HRDD 3UJPA 1HEIA 3KOMA 4FILA 1L7EA 5I4BA 3HL0A 4GZ5A 5EMLA 3E0QA 1RYBA 4DLUA 3D4NA 2I66A 1LD3A 2PKQP 2ZXFA 2ATIA 3F67A 1I6MA 5ELXA 3GFGA 4QWDA 2PZ8A 4BBAA 4O8ZA 3HCRA 2PUTA 2NO7A 3M2PA 3M2TA 4KWHA 4QBTA 4BQSA 4PZEA 3AIIA 3P2EA 1O6ZA 4MV9A 1XVUA 4JIGA 4OJOA 1Z35A 4YRMA 3QUSA 4XIFA 4G26A 1ZH8A 1P1KA 4O1MA 1WV1A 2VHXA 2DYKA 4BFZA 1ADGA 4LVNA 4Q9HA 4L0CA 1YI0A 2B4KA 1OWPA 2XKBA 1RWQA 1XJ0A 1EBUA 4LJ8A 2Q5IA 4C5BA 3F6SA 1D09A 2C92A 2WIBA 2FA9A 4GVXA 2ODGA 5F21A 3MCTA 4U2BA 2XNDD 2NQTA 5B1IA 4WJZA 3QW4B 3LSYA 2E3TA 2ZBFA 4OPMA 4ZV7A 1GN8A 3PHIA 4NY1A 1KSHA 5AKIA 3GT7A 3OY2A 7ICPA 1Z6TA 3CEAA 1MO6A 2NMVA 3PLRA 1U1EA 4FYHA 1NZPA 4I9HA 3N2KB 2FYTA 2J1LA 1KMHA 4UEJA 3UXPA 2PFOA 3BSFA 4MDHA 3OAAD 4DJAA 2CKDA 4NK5A 3W4IA 2HM7A 3W3AD 2DL0A 5LIRA 3IVRA 5KTOA 1TVKB 2JGKA 3CB2A 3PHHA 5IBPA 2Z9CA 4YRSA 4LHYA 1X9IA 1AGRA 4CG0A 3VKUA 4NL4H 3DDWA 4AICA 1QYIA 3OI7A 1RRFA 2FI1A 1I7DA 4MCIA 3TQQA 3MXOA 4D9CA 2FPWA 3VC2A 1OFHA 2YNMA 2JGEA 1TK2A 2OKCA 3IXLA 1VE3A 2J3DA 4Y9DA 1A9OA 1VCOA 3MRSA 3Q15C 4AX4A 4JI1B 1P75A 8ICGA 2GZMA 1NVBA 3R5SA 3RYIA 3GEIA 2WJVA 2G07A 3E9ZA 4E11A 4II2A 3D8NA 3KX2A 4CFZA 1SKYE 2QUBA 4KR7A 5CCXA 3VSAA 3KT6A 4MX8A 2XUHA 2ZXEA 2O1WA 4BBPA 1H8EA 1NXSA 1NOIA 3U3DA 1SBNE 3WMXA 3K2QA 4HNAA 2ZZKA 3ANXA 1S3GA 5J8YC 4EG0A 1C3JA 3KYCB 3DL2A 3HB5X 2JK0A 3TX2A 3UJBA 3C3WA 3QMWA 1XDSA 4QXPA 5TMPA 3LCUA 4S2EA 1JR3E 1ADCA 1RZ3A 3NT4A 4EAQA 4G81A 5ISMA 5JDCC 2A67A 5JNRA 4AKSA 3KB2A 1EG7A 4X1YB 5BW6B 2LE0A 3GNQA 2UVUA 3F6YA 1JAZA 2WIAA 2WM8A 4B76A 2ZBPA 3JARA 3GLFA 5JYDA 1SHJA 4FCWA 2VNJA 1O77A 3RRNA 5CCEA 1Y6JA 2NV0A 2PCJA 2IHVA 4FI3F 3C1ZA 2EZTA 1YBVA 2IQIA 5AKGA 2XQKA 3DQQA 4W8GA 2EZ4A 1ZCJA 2XZPA 3FGPA 1KQFA 4B79A 3HLTA 3LPNA 2BDTA 1TPZA 3DBOB 4LJ4A 5EMKA 1ZMTA 1ZM2A 2XT9A 1EFVA 4ZALA 4XPZA 2WR8A 1GU7A 2YV4A 1GUBA 2DUNA 4E88A 5CURA 3SIXA 3MGCA 5JH7A 5AW7A 4BVHA 1IN7A 1U47A 3G5AA 4EYIB 1VCIA 1LI5A 2AWNA 3P5SA 5HOQA 4I4IA 5T8KA 3CXRA 3Q8WA 5F1OA 3LVVA 2O3TA 2O6LA 4UEQA 4LTDA 3SF8A 4R9UC 4Y6GB 1TM5E 4ARSA 1E1DA 4B9EA 3GDWA 5MFPA 1NMXA 1J22A 2OQIA 1ZJJA 3OKFA 3OX4A 3AWDA 4FOSA 4RVGA 3H5LA 4YX9A 5KFIA 2NTNA 1NI4A 2K7ZA 3N58A 2XF2A 3I0MA 4RF2A 3BF7A 5J2TB 4E5YA 2IP2A 2B8NA 2EAOA 1P7CA 4EW1A 1KKMA 3O47A 4LXYA 1AS2A 2YJZA 5DULA 3ZGVA 3A9UA 3CF4G 1LPSA 2HHCA 4RF5A 4U2FA 4DMHA 1CXZA 1R6VA 1U80A 4PEVA 3K53A 4P5PA 5TXGA 3AUSA 3GGOA 4O3QA 3FOEC 4YR0A 4TLAA 2B34A 7ICRA 1AV7A 4EUFA 4A0QA 3HYLA 2PT7A 1RU3A 3FTNA 4Q19A 5JPCA 2FOXA 5AK4A 2YOHA 1ESEA 3DKRA 3NHAA 4GPD1 2H2DA 5J9FA 4U1RA 3ORHA 1W87A 3P97A 3EVBA 3ZCSA 4KXUA 3ZX5A 3FR7A 3TW6A 1E0SA 3ROFA 4ND1A 5K7SA 2HLPA 5ALUA 4O3FA 4UD6A 1T2UA 1V4BA 3A6FA 3HJRA 2MHCA 3TPCA 3MCAA 5TZVA 2R9VA 3ANSA 2N3ZA 3Q9SA 1CUAA 4IRMA 4E14A 1GAJA 1M2NA 4ZI7A 2Q6VA 4OK5A 2ZIZA 1H3NA 4Y6SA 5IW8A 3ZCPA 3KHSA 4R8SA 2R1TA 2BRUC 5C37A 2ZUWA 1JXQA 1X7ZA 1M8PA 3SQOA 1P77A 4I1PA 4ILKA 5KVVA 4X66B 4DWJA 3MRTA 3RIHA 4DLNA 3KEMA 3PC6A 1JQDA 4N54A 3DZHA 3HWRA 3VHRA 4KGXA 2HO4A 1E99A 1S6YA 4MW5A 5IBCA 2VPXA 5GM2A 2XEXA 4YJHA 3P4XA 4BU1A 1PVOA 3ASYA 4OATA 3CZ9A 7REQA 2J4DA 4BCDA 4HZUA 2EKDA 1WUJS 3R6WA 4R7ZA 3P26A 3JPSA 3VHLB 3PHLA 4WLVA 3IAFA 5AKZA 5CFPA 2GCNA 1VLQA 3N2GB 3IVGA 2YHUA 4EZ9A 1JI7A 3IQDB 3EF3A 3ND5A 3PO4A 2FPGB 3DZBA 4W5NA 3O84A 3FDZB 2PKEA 4NXNB 5CXXA 5L3SB 2Q0XA 4C89A 2D7JA 3CLHA 2QM8A 4ACOA 5HE9A 3JD0A 3L6RA 3PC2A 4QUGA 1GQRA 3IPXA 4K6OA 2I9KA 2FQWA 1ORIA 4D57A 4GI3A 4LQDA 1NV8A 1IUKA 5IEJA 3WLTA 4MPTA 2WB1F 3AEVA 2R8IA 9ICGA 1O03A 4OLAA 2QB1A 1H65A 3RUHA 3HV0A 3G0BA 4BNMA 1TX4B 4TUYA 2W55A 4MQLA 2I1LA 1KOGA 3AO0B 4K0KB 5I4CA 3QSGA 4OIFA 3BL5A 4QIWC 3OPMA 2WJPA 3T5KA 3T9BA 4CJXA 2ZSAA 1IE3A 1FXUA 3ZYCA 3S8YA 2HDHA 5EP1A 1B6RA 2FX3A 2P77A 3T7KA 2CMDA 3CLVA 1BJRE 2AVNA 2KSOA 1WSAA 1ZRSA 2H51A 2AOUB 5ALIA 4M9GA 3LC2O 2G6TA 4HRXA 2EP7A 3RNOA 1D2EA 3ORQA 2KG5A 4EO4A 2W58A 3F3KA 3HTXA 1XL1A 4FE4A 2GVNA 1BDHA 4DLKA 4P0QB 3EOAI 3JAMA 4U7DA 2LIPA 1QLHA 3BFKA 2XOKA 4WX2B 4JP5A 1P18A 4ZO4A 2WMNB 2ZAGA 1YOVA 3HBMA 4RPKA 1ZIYA 4Q1FA 2SNIE 3BZUA 1UMCB 4GT1A 3ZGXA 2EF0A 3HEAA 1OT5A 5T7BA 3C2QA 4N82A 2JHPA 4EEYA 3ODGA 4BRZA 5J2UF 1EGQA 5DHSA 4B7UA 3I1FA 1IQPA 3VNBA 2R5NA 3MTQA 3MERA 2EARA 2IYTA 5E0OA 4C3VA 1A71A 1M75A 1JU4A 3G2HA 4LZGA 2F6RA 2ZW9A 2BN4A 1IBKB 1IL0A 3TFSA 3U16A 3ZHVA 4AMZA 1FS4A 3OESA 4KO1S 3PDIA 3ND7A 4ZIRB 4I2NA 4O5OA 5LZ8A 1W7AA 3UAGA 2EJBA 2FPRA 2IKSA 1U8EA 3A6EA 4Q5IA 1MC5A 3D3WA 3SQMA 5D3ZA 4LE0A 3GBVA 4UB4A 1I5EA 1IY2A 2YJ6A 1M8KA 3PGVA 3MWDB 5FL7D 1C7RA 3RBAA 1NW7A 4BFTA 1C0IA 5AW1A 4GWLA 2O52A 2Q6OA 3U56A 3PRJA 2LUOA 1FW6A 4XIJA 3GJZA 5JRZA 2W11A 1L5OA 4WCVA 1F12A 4GL2A 4O4IA 4HMOA 3JWJA 1X9HA 1MOQA 5I9TA 1CJTC 5C8YB 1GG2A 5CDYA 3EFHA 5K0JA 4X1KA 3WMGA 4OMUA 3SC2B 3M4JA 2G9ZA 1SC3A 5JJKA 4O63O 1HUZA 2C2WA 5BN4B 5TMBA 5A4IS 4V0OA 4EJSA 2O2CA 4RORA 3GLIB 4FHFA 3WGJA 4F21A 2NPOA 1E3LA 3H9CA 5F78A 1S02A 4BO6A 1KORA 2AJDA 3U4QA 1X7XB 1TAGA 2R8HA 2V65A 2XXJA 4IWXA 3K9GA 3GD7A 2Z04A 2VDKB 1TJ3A 4M8KA 3S6JA 2QYSA 3ZY4A 2KW5A 4R1LA 1CW2B 4E13A 3NRCA 1JHAA 4WN9A 4KYTA 3KSAC 1PQUA 1AJEA 3CU5A 1PK7A 4GOLD 2B6HA 3X1ZA 1DAPA 2D1RA 3VI3B 3H2ZA 3ZZUA 5IF9A 2EL9A 1D2HA 4W9NA 5EVCA 7ICKA 4I36A 4MVJH 1JKMA 4B7AA 3RBXA 4PY2A 4R9VA 4L7VA 5DBIA 3P5BA 1JIQA 2QX8A 4C4TA 1QJ4A 3L7KA 4P4NA 4LSZA 4ALKA 3AKZA 1SBIA 4DCTA 3CRRA 4CR6A 1XD9A 1OAOC 4EPYA 3DO5A 2B8WA 3KAKA 4Q3AA 5BT9A 1SXJD 4WHMA 3C15C 3EYAA 4QA9A 4B8WA 2VJMB 4EGCB 2W7OA 1SGWA 4DEYA 121PA 4GUDA 3PZPA 4HGZA 3M4ZA 4DZRA 4MLCA 1BZYA 3IRVA 5EAIA 1KI4A 4YACA 3U39A 5LA6A 3OZAA 4ZTBA 4IXTA 2YWXA 2G77B 2QHXA 1DARA 4UHHA 4K4IA 2UVRA 5K6TA 4V0RA 3ERCA 3TOXA 3ZXYA 1AURA 1OBCA 4Q8EA 4RVUA 4BEVA 3ELDA 4WK2B 2HIGA 4UHBA 5DM2A 4ZDWA 1WBDA 4EZEA 3QVJA 1V8PA 1KEEB 2PSFA 4PAWA 2QNIA 4YP3A 1UWVA 1TV9A 4N7BA 3GN1A 3Q72A 4BQQA 4H7EA 2C57A 5HTOA 4RS3A 2O48X 1NZFA 5TPZD 1B3BA 2EZXA 3PNLA 3DO6A 4DMGA 3T4PA 2CLSA 3G5TA 2WA1A 2W90A 2YIMA 2ZYVX 4F9GA 5DLYA 4ID3A 2ZUUA 3WLPA 3OM8A 2JCBA 3NGDA 3OJEA 1JQ5A 4ZOBA 3U6BA 2D8MA 2VBCA 3O2QB 3R7SA 1Z17A 4XQEA 3LRXA 4BKRA 1O96B 1PDOA 5KTKA 3DWEX 2JS7A 3N0WA 3OFSA 3PP8A 5ESRA 5K0SA 4CFYA 1NXTA 2J3MA 4RIIA 1CQZA 3NAQA 1QYRA 5JISA 3GY0A 4GU5A 2QDXA 1PZNA 4DVGA 3K0CC 1YR3A 4I1YA 3S2IA 1AK1A 1GEEA 1BEUB 4INPA 4DIKA 5B58T 5JLJA 3ABOB 4ANFA 1N3BA 5AUOB 4B3CA 1MTZA 2GCOA 2A78A 4L5CA 3QVMA 3W79A 3ZE8A 3WDKA 1OLSA 5LQMA 5GJCA 3GW8A 5FV7A 1VBMA 1YFZA 2DSNA 2E49A 5IT0A 4MUHA 3NJ4A 2CXUA 1ECPA 1CLEA 1T3SA 2XJ4A 3TSAA 3KOXA 1NKBA