3NB2A

Crystal structure of e. coli o157:h7 effector protein nlel
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
612
structure length
612
Chain Sequence
QGRACLSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGRNNVFTCTAVLTDMLTEHAKESFPEIFSLYYPVAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Biochemical and Structural Studies of a HECT-like Ubiquitin Ligase from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords secreted effector protein
total genus 222
structure length 612
sequence length 612
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3nb2A04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3nb2A02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3nb2A01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3nb2A03
4YC5A 2XTWA 2O6WA 2QYUA 3SY2A 3SQVA 3DU1X 3NB2A 2XT4A 2XT2A 2XTYA 4YFOA 5DNSA 4YDTA 3PSSA 2J8KA 4YEIA 3NAWA 2XTXA 3PSZA 2QZAA 4YCQA
chains in the Genus database with same CATH superfamily
3H09A 3NB2A 4KXKB 2RKKA 3GQ9A 3AS4A 1DVPA 1TSPA 1Z3YA 4I6EA 2LXMA 3CHPA 2ETCA 2GRPB 1B89A 1L1IA 1WG0A 4UWGA 4CGWA 1S63A 4DPRA 3JXJA 2B0OE 2HE0A 3CVWA 5D2MC 3UM3A 4GTSA 2WXRA 4CYMD 4EZJA 2AXZA 2BF0X 3Q47B 4FJYA 3ULQA 1YMPA 3FUNA 2NZMA 2H6GA 4PS3A 1IQUA 3ZNGA 2BM6A 4EBAG 3AG1E 1VDYA 4G11A 3OXFA 4DX1A 2WPVA 4YZQA 2Y69E 3DPDA 4HRNA 3BQOA 2XT4A 1KLXA 1A17A 2L9BA 2QYJA 2NTQA 4C0MA 2UY1A 3FUIA 1O1RA 4LNUD 4I1AA 2IY0C 1X81A 2NSPA 2CG2A 2OEVA 4GCOA 3ML3A 2R03A 2GRNB 3QC1A 3SHFA 2WMOA 3JYSA 2GW1A 1MZCA 1OCCE 3ABKE 2HR2A 1N4SA 5JMCB 3BG0B 3ZHEB 4I17A 4MR0A 2CFZA 3HRAA 4EPZA 3ASOE 5C1CA 3SY2A 4JD2G 1OWNA 1N95A 1O8KA 2HO1A 1OFMA 4YFOA 3BH6B 4I1OB 5AARA 3RKVA 3PZ2A 5AQAA 3ABLE 4XOPA 1MX4A 4AM9A 5BV1A 1ZB1A 3VLDA 1TR4A 1DABA 4KVOA 3QARA 4TV3A 3T8MA 4XKCA 3JURA 1LD7A 2KCLA 2WXMA 3BG1B 2AXUA 2DBAA 2XHEA 2VFMA 4XEIG 3AG2E 3W9GA 3FH5A 4EECA 2AWIA 4XN0A 5J90A 4WNFA 3AJIA 4IULA 1YYHA 2LSVA 1O1SA 1OXJA 1H80A 3B7SA 1SZAA 4EW9A 3D9LA 4R7LA 4AXHA 5E76A 4XM3A 4GTPA 3CVXA 1N4QA 3AAAC 2F0YA 3UIPC 4N5QA 2P9NG 3UTMA 1QQEA 2P9SG 2DWZA 2KATA 5BT1A 3Q7FA 1D8EA 3VTYA 3E32A 1N11A 4BFRA 4Z05A 4JHJA 3LY9A 4GA2A 4DLQA 1TYQG 2Y1LE 4EZLA 2JEKA 4CT0A 2NSTA 4TXPA 2H6HA 4XX5A 2WXLA 2NXPA 2DYSE 3IEGA 2M63A 3R9AB 3MKQB 1O8JA 2WQ7A 3QWWA 5B3SE 3PEUB 4Z03A 4CDRA 4XLFA 3I5PA 2L6BA 3I4GA 4HRLA 4FP7A 5G55A 3TWWA 4XKBA 3LDZA 3AG3E 4ANVA 4NIKA 5AYWD 3U9WA 1DBOA 2V5IA 3GYZA 3LJ3A 1NZNA 3O4ZA 2UVFA 4Q69A 3DWLG 5LFAA 5EKQD 2BUGA 4RVBA 3MV2B 1XGWA 2WXOA 4HXIA 1H19A 2PL2A 3URZA 1OFEA 2FEZA 5AQ7A 2IU1A 1SA5A 4OZYA 5ENRD 4OM9A 2PZIA 4QFVA 1EPUA 4OVVA 3CKBA 3FTSA 5G04J 4NRHB 2RG8A 3UT8A 3ASDA 1KCCA 4AP2A 3C98A 2OOEA 4I1MA 1WMRA 1OWMA 4GTMA 4AVXA 5B1AE 2VGYA 4W8RA 3VSTA 4H7YA 2GRQB 4A3TA 2PNNA 2V5FA 3ULEG 2P9PG 2E2EA 4U04A 3C72A 2EIKE 4FJZA 1N54A 4JC8A 2AJAA 1UG3A 1E8WA 3TWSA 2I1JA 3SFZA 2IOLA 3Q9NC 2ONDA 1K3ZD 3D3MA 3L16A 4G2VA 1OUVA 3ZSCA 2F37A 1IDKA 2Z8GA 2KCKA 4OJOA 2P9UG 2ZGGA 1KT0A 3PZ4A 4RLYA 3Q7AA 1TYWA 5ITZF 3DXMG 1TN7A 3NQPA 1H6PA 1E96B 4IN3B 2P2CP 3Q4AB 3BH7B 4CEMA 4GTRA 2CFUA 3EHQA 4P29A 3PDNA 4PS7A 1SW6A 4E85A 1MX6A 3TWUA 3LMWA 2R05A 1AIRA 4ANXA 3ZU7B 1QRBA 3ZYLA 4BTBA 5CBNA 4FA6A 5JJ7A 4L2YA 3LVQE 4FLHA 3VSUA 1TJCA 3UUXA 2R5SA 1K8FA 2UY1B 5ANLA 5AAOA 3EHNA 3EIQC 2KBXA 3VTXA 2EIME 2CG3A 1UJJA 3FUKA 2O6WA 2CHZA 3PZ3A 3ASHA 3CVUA 3WWGA 1H2TC 3RK6A 5KJNA 2MYOA 1MYOA 3DSTA 4C0EA 2FULA 5CERB 4YDTA 5CBOA 3NZUA 3DSSA 4UI9K 1EA0A 3MV3B 3TWRA 3B7RL 4XE0A 3MA5A 4UQYA 1TNUA 3CVLA 2LO6A 2NTPA 4URRA 1FT1A 1L5JA 4XI0A 1YCSB 2WMNA 4HRMB 4K0RA 1LD8A 2YQ8A 3ENEA 4C9BB 2LXLA 4DX2A 1HG5A 1OCRE 3FU6A 4WAFA 4F1SA 1Y8MA 2YINA 2X3MA 3LJYA 1XNFA 2IOSA 5JJ6A 3B90A 4PS8A 5ANRA 2Q7FA 4CRWA 2WQ6A 4ANUA 2VBEA 2IO3C 4GYOA 3JCKC 1S0PA 3KD7A 3D9PA 1HU3A 4GMJA 4UWKA 3FUHA 5CRVA 1TYUA 1G3NB 1S70B 3FFLA 1NHCA 4EZKA 2WXQA 3ZPPA 3L08A 3UKRG 1QQ1A 3TWXA 2GRMA 5ENTD 3VSVA 3Q78A 2XC1A 3IKOB 4W8TA 5CCMA 4NQ0A 2VGEA 4GU5A 1D9SA 3L9TA 4HOSA 3PRZA 3Q75A 1QZ2A 4B94A 4GZ6A 1TNYA 3B13A 2I9CA 3CHQA 4MS6A 5AN8A 3DSVA 1KZOA 4YDWA 3LY7A 3MYVA 4J8EA 1O5MA 3CVNA 2E0IA 3CLJA 5KJMA 4DI4A 1V54E 2IQCA 2XENA 3T5XA 1O8MA 3SUCA 4ZHBA 1HF2A 3X2QE 3FTUA 2EINE 4JRAC 3D9HA 3K9IA 2PM7A 3DRAA 3B95A 3G2WA 4JEHA 4B0ZA 4YDOA 2J07A 4YDEA 4B89A 2JLBA 1HF8A 4OYSA 2VGXA 3CHRA 2XEHA 3FU3A 3UINC 5DIZA 3BUAA 2XZTG 4DUIA 2KXPC 1BI8B 3PNLB 3QK0A 1HG2A 3FULA 3KEZA 2QZAA 4FLBA 3I4RB 4YC5A 2NYJA 4BERA 1LTXA 4WUYA 1MQSA 3APDA 2AW6A 2V8SE 3LYAA 3S7JA 4OPWA 3BU8A 3MEKA 5KNHD 4JHKA 4L2LA 3QAQA 5BW8C 3R7RA 1K1BA 3CHOA 4WNGA 1DBGA 4J8DA 2PQNA 2DVWA 4A1GA 1JTAA 1FT2A 3FUDA 5HI7A 1BPOA 3MCXA 5FZQA 4MRUA 3T9GA 1SQMA 2J8IA 3S7BA 3PSZA 2GGFA 4GZ3A 5G05J 1TN8A 2DIWA 4A3VA 3DU1X 2BEDA 4NK6A 1E90A 1QYMA 3Q79A 5G04C 1AWCB 1NA0A 1OWLA 5A23A 3CHSA 5D66A 4B8AA 4GMRA 3D9MA 5M72A 4Q96A 3JUIA 5CMYA 5C1EA 4YZAA 4TUUA 3D9IA 2LAIA 2H6IA 3RRMB 4HWVA 4U95D 5T3RA 4HBDA 1WXRA 3CK7A 3FDHA 1O8IA 3APFA 3HXFA 4N3AA 1KPSB 3N71A 5JLVC 4I9CA 1UN8A 4JZYA 4YEIA 3DEOA 4YCQA 2XGOA 4KH3A 5BXOA 2VJJA 3O48A 4GTVA 1MJ0A 5CEDB 2ETAA 5AQ9A 1ZBPA 2VTBA 2VBMA 1HFAA 2OV8A 5FJYA 4AVZA 3I3NA 4GMLA 2VFNA 4FU3A 3OXLA 5BV0A 2ZU6B 3PUKA 3ISMC 3UM1A 1WDYA 3Q9UC 1JWFA 3T5VA 2QY7A 4AY5A 2IOUG 2FBNA 5CECB 2IJGX 3D9KA 3ZN3A 2DYRE 3ASFA 4PDXA 4W9RA 3G2UA 2XS8A 3FY4A 3TWVA 1FPPA 3EHRA 3HYMB 1O8HA 3U66A 2FI7A 2F8XK 2J4BA 3NF1A 3P1UA 4G23A 1BD8A 1HE8A 2X6YA 1UJKA 4KZCA 2ZIRA 3S7FA 4CZ2D 1IXVA 1JCQA 4K03A 4UWFA 3FUEA 1EF1C 1O1TA 2Y3AA 3CK9A 3RRUA 5LX8A 2XPYA 2RFAA 2C0LA 1N0QA 3PH0C 3SBSA 3TWTA 1JCRA 2R02A 4JW1A 5BNWA 4NURA 4EBAA 4DX6D 4GCNA 1EYHA 1K4ZA 4BT8A 4TXRA 4GPKA 2X6HA 2AVPA 3FU0A 3V79K 3MX3A 3PZ1A 1E8ZA 3JQ0A 3J5QB 3P4GA 4NK8A 4U0ZA 2BX6A 4RQIA 2NT9A 4RSYA 3CIAA 3C3RA 5EDSA 3SFYA 1OT8A 5JHAA 1OOCA 1RU4A 4BESA 3EDTB 2IFUA 2WXGA 4HQDA 4XR6A 2AXVA 5G2NA 4I84A 2J8KA 1OWPA 3FEXA 4LRZA 2QY1A 4OAUC 1NP7A 4XLCA 3FUFA 3P2BA 4IYPA 1TNOA 2X3HA 4F3VA 3B7UX 5G05C 3MKRA 4DX5D 3APCA 3FTXA 4EHMA 3IXEA 2V4LA 5FT9A 4HLEA 3UKUG 3UXGA 4RG9A 5FQ4A 2PM6A 2XTWA 2QYUA 5ARGA 1QRCA 1OFLA 3TG5A 2I6HA 5C1DA 2I1KA 2OCCE 1QA1A 3QNKA 3ASNE 3GZSA 4JPSA 5EYLA 1E8YA 3CV0A 2VQ2A 3AU4A 3LPZA 4UI9C 4BX9A 1HXIA 3EUVA 4XIFA 4TUMA 3KRGA 4GA1A 1Q2ZA 2J8SD 3RO2A 3Q5MA 4EQFA 2PYHA 4L7TA 4ATZD 2W7ZA 2IONA 5EILA 5AMVA 3V2OA 2CHXA 1S64A 1IHGA 5D0OD 1NFIE 3ZPJA 2X6KA 3V31A 1GW6A 2F3LA 4Y6WA 3HXEA 2F8YA 2ZXWE 4DK5A 4WNDA 2BTDA 1TNZA 3D9NA 1BHEA 4LNGA 4GYWA 3PNTB 4F7AA 4JHRA 3CVQA 3ONLA 3SQVA 4ILIA 2KC7A 1DC2A 4ATGA 4LG6A 3TWQA 5E75A 5H7PA 3C3OA 4JXTA 3HG0D 1VBLA 4W8SA 2OVBA 3PVLA 1Z5SC 5EIBE 1X5BA 2R59A 3LEWA 3CQGB 4G8LA 4BT9A 2V0PA 2BM5A 4J8FA 3UT4A 3TXNA 2ILRA 3NOGD 3W9FA 1U3CA 3QOUA 4HVBA 2V4HC 3TJPA 3V30A 3GW4A 1HZ4A 1A5EA 4JL0A 1BI7B 2WXNA 2EILE 4U49A 4O6FA 4URKA 4GA0A 1EDUA 5KNGA 2IO2C 4RG6A 1LLZA 3SNXA 3MZLB 2ZGDA 3SI5A 5FQ8A 4MLPA 4J7WA 4WWPA 2DZOA 2WXJA 3ZXPA 3GQ7A 5ENQD 4CCAA 1OCZE 2P9KG 1HO8A 4GZCA 4X8QA 2GRLA 2L0TB 5EX0A 4U8YD 4L9PA 5FINA 4XKWA 4JA7A 1O8FA 1E7UA 3CR3A 4HNAD 4LEUA 3PZDA 2BM4A 3PS6A 1BN8A 4I43A 1N52A 4LERA 5JJTA 1QCXA 3FHEA 4M3OA 3ZKJA 4J8SA 1O88A 5ENOD 4C48B 4V02C 4CT4A 2X85A 5AQBA 4MBGA 1CZFA 2VSXE 1W3BA 4LUNU 2LSUA 4UWHA 3UPVA 1O8LA 3TH0A 1OCOE 1V55E 5HKPA 2NSZA 5KBAA 4OVUA 3JQ1A 4CDMA 4HORA 3U3WA 4LCTA 4O60A 3HVEB 1K5CA 3UW0A 1U3DA 3L6AA 3ZEFA 3AS8A 1JCSA 5BXUA 2YNQA 2WM9A 1Y6IA 4B8CB 3NBNB 2CHWA 3B7TA 4YVOA 4XL9A 4XMYA 3UX4A 3GQAA 3B8YA 3DSUA 5LP0A 2HM8A 5A6CA 3FTYA 1IYGA 3L54A 4N3BA 1O8EA 2QC9A 1INZA 2R17C 4XQFA 5ENSD 4A63B 1HG8A 2INVA 2QFCA 3ASGA 4GZDA 3QB2A 3FH7A 3NOCD 1FVFA 4U0UA 4BX8A 3N90A 3V2XA 3ML8A 5FTPA 3UQ3A 3EQOA 5CHEE 3SZ7A 3FU5A 2XGMA 2YHCA 1UOHA 4GZ5A 3AG4E 3EIJA 4PMHA 3ZW3A 3UMVA 3AS5A 2BM7A 2H6FA 2KM4A 1QA3A 4BWRA 3PEVB 3D9OA 1LLWA 2J49A 3PUJA 2UVEA 2C0MA 4UWLA 2VSYA 1LM1A 4PUCA 3U4TA 2J09A 1H6KA 3RAUA 3FTVA 1JWGA 1OFDA 3ZVVA 3FTWA 3ML9A 4XLEA 4OJPA 4PH4B 3PETA 1RMGA 2DZNA 4GAAA 1DCQA 1HH8A 4LNBA 4UQZA 1H6OA 1E7VA 1UW4B 2A5EA 1CLWA 3IBEA 4ILGA 4UQXA 1X0CA 5BPPA 4OJLA 4KZ0A 4BSZB 4I2ZA 3SF4A 2G0YA 3LS8A 1DCEA 2Y4UA 4GTOA 4G8KA 3CVYA 2XRYA 3FTZA 3E33A 1RZ4A 2VFPA 1GQ8A 3ZRHA 3MJWA 1FCHA 1QA2A 5FZRA 2VTBB 2ODLA 2VGXB 3AU5A 1IHBA 3OTNA 3ZIMA 2B0RA 3EJNA 4OZZA 3ESLA 4K5CA 5KJKA 4WWNA 2X6WA 5T8IA 4OAVB 2EIJE 3HVEA 1MHQA 2LUHA 3TAXA 4ZFHA 3J5PA 5FIOA 4APOA 2YUHA 3KAEA 3DXKG 2XCBA 4ABNA 3HXBA 3E30A 1JUQA 1ELRA 4G24A 4N39A 1N4RA 4OJ6A 4ME2A 2P58C 2X6XA 3GRHA 3DPYA 3SGHA 4UI9J 1SA4A 4A55A 1WM5A 1ZU2A 3C5RA 5CEAA 3Q49B 1ELKA 4JEUA 2ZISA 1N94A 2MHKA 1H0AA 5C2YA 4YZXA 1KZPA 1NI1A 3D9JA 3QDNA 4CDNA 4BY6A 4FADA 2XPZA 1IQRA 1SVXA 1OWOA 4I6JA 4M7CA 4XLHA 3CGHA 2QXZA 2JABA 2XCCA 3CHMA 2EQXA 2VJ8A 3KS2A 2GROB 5ENNA 3CSFA 3TXMA 2RD0A 2WXIA 4FHKA 2HYZA 2EWEA 3T9KA 4J6IA 5AENA 5KJLA 1SZ9A 5DNSA 2P9LG 5FWQA 3C3QA 3QWVA 3IV0A 2XEEA 5HRYA 4XOTA 3HXDA 1U2VG 4YVQC 3LCAA 2XRZA 4E6HA 5HS0A 4U7EB 2L6JA 1WAO1 3FEYA 4AJWA 3CEQA 3ABME 1DNPA 3SFXA 1FVHA 3RIQA 2KCVA 1OGMX 2PECA 3ZGQA 3L22A 3DEPA 3LY8A 1KTWA 4N2SA 4MXNA 4OJ5A 3G2TA 1QBQA 1PAQA 1QJVA 1HS6A 4KYOB 4HFGA 2P9IG 4U07A 3KSLA 1TEZA 3VLFA 2GRRB 2A5UA 4Q94A 3MKQA 3B4NA 4WWOA 1K8KG 4AV7A 3ZYQA 3BEEA 4YELA 3FUJA 1N4PA 4ILHB 2BSPA 2WQHA 4IRUA 4JA9A 3DSXA 3TGOA 1D8DA 3FY3A 4W8QA 3G2SA 3GZ2A 1LF8A 2WXPA 2B6CA 3TG4A 4U8HA 4FULA 3CK8A 3RU0A 4QQIA 2X6JA 5DBKA 3S2AA 3SZEA 3L17A 5EX3A 5LCWC 2FO7A 4AY6A 4ANWA 1BU9A 2O1DA 5BUZA 3SD5A 5HQ8A 4KMOA 5EN5D 1TYVA 3PE3A 2R2LA 4N2QA 3R7QA 3UT7A 4XONA 4DJAA 1XG2A 1EZGA 5FQ7A 5EIDA 4XORA 2V5QC 2XEVA 4KVMA 4YNDA 4MKTA 2DCPA 4G25A 5LOZA 3ZYKA 1KCDA 2ETBA 2I2OA 2XZDG 4XN3A 1PE9A 4K5BA 1OY3D 2J08A 4Z68A 4KBQA 1JRGA 3MGBA 4D10C 3SYJA 3FP3A 1IDJA 2UWJG 3NZSA 2YHEA 2NTBA 4UUCA 4B93B 1PLUA 3HDXA 1QNFA 4HS2A 1H2UA 4YDYA 4LSZE 1AP7A 3F6QA 1BLXB 4U96D 1IA5A 5AJLA 3UIOC 3WXXA 4NACA 2OEWA 4JB8P 5T4YA 1O8DA 2VYIA 3PE4A 3KSQA 3CSTA 5FZSA 4HB5A 4DLOA 4O1OA 3ZUVB 1H2VC 3EHMA 2LNIA 4DI3A 1TYXA 5ENPD 4HOTA 1KT1A 4I2WA 2PYGA 4DX7D 2IQ7A 4WNEA 3SBTB 4BEPA 2PQRA 1ELWA 1TJFA 5IY5E 4L23A 3NAWA 4N3CA 3CQCB 3FUMA 4I6GA 2MOWA 5CCLA 2O17A 2KZTB 5LCWJ 4GTQA 4AOFA 3LVRE 2XTYA 2FO1E 2QX3A 4I9EA 5B1BE 2J9QA 4Y6CA 4GTTA 3DBSA 1PC2A 3QJZA 4CGVA 1RWRA 4GYYA 4C2LA 4F1PA 1PY1A 4HI9A 2X6FA 3N6ZA 3QKYA 3LJNA 1PXZA 3KEAA 1YA0A 4HOUA 3L82A 3CKCA 5ARFA 2Y0BG 2O04A 3DSWA 4G1TA 2BKKB 3RIBA 2XS1A 3RRNB 5EYPF 1IB4A 2XTXA 3PREA 2J4DA 1TNBA 1KQ5A 3E34A 2A4ZA 2X38A 4U63A 4HLLA 2MRIA 3ONKA 2IEJA 3VLEA 4XZ4A 3TL5A 3AK5A 4V3IA 3L13A 1O8GA 3OAWA 3E4BA 3GZ1A 2XQ0A 3HIZA 5D0QD 1HX8A 2VFOA 3RO3A 4HOQA 4YEJA 4FHJA 1N0RA 5AIJA 4BTAA 2XT2A 3ESKA 5CRUA 2WB2A 4KT6B 2X6IA 3LKUA 2LAHA 2L0IA 4O1PA 1WY6A 1Z6TA 3CVVA 1UN9A 1NA3A 2WXHA 4F6RD 4ACLA 5JA4D 2INUA 2XGSA 1P5QA 1NL4A 4GB9A 3ZFWA 4XNFA 3JXIA 1RW2A 4H7XA 3E37A 4N5CA 2WXKA 3T8KA 3LXUX 4YZ0A 3HHMA 3Q15A 3R9MA 3ZXSA 3IHYA 4TRQA 2VBKA 4FC8A 3UI2A 4Z06A 3HXCA 3RJVA 3SO8A 2VFQA 4BSXA 3JX8A 3WG7E 2O0VA 3JUEA 4BETA 4U8VD 3U64A 3ULYA 2C2LA 4A1SA 4K5AB 3EQNA 3LYCA 4U0SA 3EU9A 5JMND 3QWPA 3GQ8A 4AIFA 1EE6A 1MX2A 5A7DB 4U4BA 4XLAA 3EU5A 3FWVA 2NT6A 3OXGA 2KZTA 2WVIA 3ZHEA 2VJIA 2WXFA 4XI9A 1IKND 5KCMA 2XPIA 4HI8A 2O0WA 1K1AA 4DRXE 3G2VA 3VMWA 3S7DA 3B7BA 4F53A 1E8XA 3Q73A 3VMVA 3CVPA 4J8YA 1Z3XA 3RSEG 3UM0A 1N9AA 5JHBA 3PSSA 2Y4TA 4L1BA 2RFMA 4XKVA 4GPMA 2OVFA 2FF4A 4JVSA 5KWDA 3IHVA 4ACKA 4APFA 4J0UA 2VSNA 3ZYMA 2NC9A 1TN6A 2BKGA 3FH8A 5J08A 2VSOE 2IF4A 3UM2A 5FQ6A 5CMWA 5AJDA 1OGOX 4TXQA 4G26A 1JPLA 4AEZC
chains in the Genus database with same CATH topology
4YC5A 2XTWA 2O6WA 2QYUA 3SY2A 3SQVA 3DU1X 3NB2A 2XT4A 2XT2A 2XTYA 4YFOA 5DNSA 4YDTA 3PSSA 2J8KA 4YEIA 3NAWA 2XTXA 3PSZA 2QZAA 4YCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YC5 A;  2XTW A;  2O6W A;  2QYU A;  3SY2 A;  3SQV A;  3DU1 X;  3NB2 A;  2XT4 A;  2XT2 A;  2XTY A;  4YFO A;  5DNS A;  4YDT A;  3PSS A;  2J8K A;  4YEI A;  3NAW A;  2XTX A;  3PSZ A;  2QZA A;  4YCQ A; 
#chains in the Genus database with same CATH topology
 3H09 A;  3NB2 A;  4KXK B;  2RKK A;  3GQ9 A;  3AS4 A;  1DVP A;  1TSP A;  1Z3Y A;  4I6E A;  2LXM A;  3CHP A;  2ETC A;  2GRP B;  1B89 A;  1L1I A;  1WG0 A;  4UWG A;  4CGW A;  1S63 A;  4DPR A;  3JXJ A;  2B0O E;  2HE0 A;  3CVW A;  5D2M C;  3UM3 A;  4GTS A;  2WXR A;  4CYM D;  4EZJ A;  2AXZ A;  2BF0 X;  3Q47 B;  4FJY A;  3ULQ A;  1YMP A;  3FUN A;  2NZM A;  2H6G A;  4PS3 A;  1IQU A;  3ZNG A;  2BM6 A;  4EBA G;  3AG1 E;  1VDY A;  4G11 A;  3OXF A;  4DX1 A;  2WPV A;  4YZQ A;  2Y69 E;  3DPD A;  4HRN A;  3BQO A;  2XT4 A;  1KLX A;  1A17 A;  2L9B A;  2QYJ A;  2NTQ A;  4C0M A;  2UY1 A;  3FUI A;  1O1R A;  4LNU D;  4I1A A;  2IY0 C;  1X81 A;  2NSP A;  2CG2 A;  2OEV A;  4GCO A;  3ML3 A;  2R03 A;  2GRN B;  3QC1 A;  3SHF A;  2WMO A;  3JYS A;  2GW1 A;  1MZC A;  1OCC E;  3ABK E;  2HR2 A;  1N4S A;  5JMC B;  3BG0 B;  3ZHE B;  4I17 A;  4MR0 A;  2CFZ A;  3HRA A;  4EPZ A;  3ASO E;  5C1C A;  3SY2 A;  4JD2 G;  1OWN A;  1N95 A;  1O8K A;  2HO1 A;  1OFM A;  4YFO A;  3BH6 B;  4I1O B;  5AAR A;  3RKV A;  3PZ2 A;  5AQA A;  3ABL E;  4XOP A;  1MX4 A;  4AM9 A;  5BV1 A;  1ZB1 A;  3VLD A;  1TR4 A;  1DAB A;  4KVO A;  3QAR A;  4TV3 A;  3T8M A;  4XKC A;  3JUR A;  1LD7 A;  2KCL A;  2WXM A;  3BG1 B;  2AXU A;  2DBA A;  2XHE A;  2VFM A;  4XEI G;  3AG2 E;  3W9G A;  3FH5 A;  4EEC A;  2AWI A;  4XN0 A;  5J90 A;  4WNF A;  3AJI A;  4IUL A;  1YYH A;  2LSV A;  1O1S A;  1OXJ A;  1H80 A;  3B7S A;  1SZA A;  4EW9 A;  3D9L A;  4R7L A;  4AXH A;  5E76 A;  4XM3 A;  4GTP A;  3CVX A;  1N4Q A;  3AAA C;  2F0Y A;  3UIP C;  4N5Q A;  2P9N G;  3UTM A;  1QQE A;  2P9S G;  2DWZ A;  2KAT A;  5BT1 A;  3Q7F A;  1D8E A;  3VTY A;  3E32 A;  1N11 A;  4BFR A;  4Z05 A;  4JHJ A;  3LY9 A;  4GA2 A;  4DLQ A;  1TYQ G;  2Y1L E;  4EZL A;  2JEK A;  4CT0 A;  2NST A;  4TXP A;  2H6H A;  4XX5 A;  2WXL A;  2NXP A;  2DYS E;  3IEG A;  2M63 A;  3R9A B;  3MKQ B;  1O8J A;  2WQ7 A;  3QWW A;  5B3S E;  3PEU B;  4Z03 A;  4CDR A;  4XLF A;  3I5P A;  2L6B A;  3I4G A;  4HRL A;  4FP7 A;  5G55 A;  3TWW A;  4XKB A;  3LDZ A;  3AG3 E;  4ANV A;  4NIK A;  5AYW D;  3U9W A;  1DBO A;  2V5I A;  3GYZ A;  3LJ3 A;  1NZN A;  3O4Z A;  2UVF A;  4Q69 A;  3DWL G;  5LFA A;  5EKQ D;  2BUG A;  4RVB A;  3MV2 B;  1XGW A;  2WXO A;  4HXI A;  1H19 A;  2PL2 A;  3URZ A;  1OFE A;  2FEZ A;  5AQ7 A;  2IU1 A;  1SA5 A;  4OZY A;  5ENR D;  4OM9 A;  2PZI A;  4QFV A;  1EPU A;  4OVV A;  3CKB A;  3FTS A;  5G04 J;  4NRH B;  2RG8 A;  3UT8 A;  3ASD A;  1KCC A;  4AP2 A;  3C98 A;  2OOE A;  4I1M A;  1WMR A;  1OWM A;  4GTM A;  4AVX A;  5B1A E;  2VGY A;  4W8R A;  3VST A;  4H7Y A;  2GRQ B;  4A3T A;  2PNN A;  2V5F A;  3ULE G;  2P9P G;  2E2E A;  4U04 A;  3C72 A;  2EIK E;  4FJZ A;  1N54 A;  4JC8 A;  2AJA A;  1UG3 A;  1E8W A;  3TWS A;  2I1J A;  3SFZ A;  2IOL A;  3Q9N C;  2OND A;  1K3Z D;  3D3M A;  3L16 A;  4G2V A;  1OUV A;  3ZSC A;  2F37 A;  1IDK A;  2Z8G A;  2KCK A;  4OJO A;  2P9U G;  2ZGG A;  1KT0 A;  3PZ4 A;  4RLY A;  3Q7A A;  1TYW A;  5ITZ F;  3DXM G;  1TN7 A;  3NQP A;  1H6P A;  1E96 B;  4IN3 B;  2P2C P;  3Q4A B;  3BH7 B;  4CEM A;  4GTR A;  2CFU A;  3EHQ A;  4P29 A;  3PDN A;  4PS7 A;  1SW6 A;  4E85 A;  1MX6 A;  3TWU A;  3LMW A;  2R05 A;  1AIR A;  4ANX A;  3ZU7 B;  1QRB A;  3ZYL A;  4BTB A;  5CBN A;  4FA6 A;  5JJ7 A;  4L2Y A;  3LVQ E;  4FLH A;  3VSU A;  1TJC A;  3UUX A;  2R5S A;  1K8F A;  2UY1 B;  5ANL A;  5AAO A;  3EHN A;  3EIQ C;  2KBX A;  3VTX A;  2EIM E;  2CG3 A;  1UJJ A;  3FUK A;  2O6W A;  2CHZ A;  3PZ3 A;  3ASH A;  3CVU A;  3WWG A;  1H2T C;  3RK6 A;  5KJN A;  2MYO A;  1MYO A;  3DST A;  4C0E A;  2FUL A;  5CER B;  4YDT A;  5CBO A;  3NZU A;  3DSS A;  4UI9 K;  1EA0 A;  3MV3 B;  3TWR A;  3B7R L;  4XE0 A;  3MA5 A;  4UQY A;  1TNU A;  3CVL A;  2LO6 A;  2NTP A;  4URR A;  1FT1 A;  1L5J A;  4XI0 A;  1YCS B;  2WMN A;  4HRM B;  4K0R A;  1LD8 A;  2YQ8 A;  3ENE A;  4C9B B;  2LXL A;  4DX2 A;  1HG5 A;  1OCR E;  3FU6 A;  4WAF A;  4F1S A;  1Y8M A;  2YIN A;  2X3M A;  3LJY A;  1XNF A;  2IOS A;  5JJ6 A;  3B90 A;  4PS8 A;  5ANR A;  2Q7F A;  4CRW A;  2WQ6 A;  4ANU A;  2VBE A;  2IO3 C;  4GYO A;  3JCK C;  1S0P A;  3KD7 A;  3D9P A;  1HU3 A;  4GMJ A;  4UWK A;  3FUH A;  5CRV A;  1TYU A;  1G3N B;  1S70 B;  3FFL A;  1NHC A;  4EZK A;  2WXQ A;  3ZPP A;  3L08 A;  3UKR G;  1QQ1 A;  3TWX A;  2GRM A;  5ENT D;  3VSV A;  3Q78 A;  2XC1 A;  3IKO B;  4W8T A;  5CCM A;  4NQ0 A;  2VGE A;  4GU5 A;  1D9S A;  3L9T A;  4HOS A;  3PRZ A;  3Q75 A;  1QZ2 A;  4B94 A;  4GZ6 A;  1TNY A;  3B13 A;  2I9C A;  3CHQ A;  4MS6 A;  5AN8 A;  3DSV A;  1KZO A;  4YDW A;  3LY7 A;  3MYV A;  4J8E A;  1O5M A;  3CVN A;  2E0I A;  3CLJ A;  5KJM A;  4DI4 A;  1V54 E;  2IQC A;  2XEN A;  3T5X A;  1O8M A;  3SUC A;  4ZHB A;  1HF2 A;  3X2Q E;  3FTU A;  2EIN E;  4JRA C;  3D9H A;  3K9I A;  2PM7 A;  3DRA A;  3B95 A;  3G2W A;  4JEH A;  4B0Z A;  4YDO A;  2J07 A;  4YDE A;  4B89 A;  2JLB A;  1HF8 A;  4OYS A;  2VGX A;  3CHR A;  2XEH A;  3FU3 A;  3UIN C;  5DIZ A;  3BUA A;  2XZT G;  4DUI A;  2KXP C;  1BI8 B;  3PNL B;  3QK0 A;  1HG2 A;  3FUL A;  3KEZ A;  2QZA A;  4FLB A;  3I4R B;  4YC5 A;  2NYJ A;  4BER A;  1LTX A;  4WUY A;  1MQS A;  3APD A;  2AW6 A;  2V8S E;  3LYA A;  3S7J A;  4OPW A;  3BU8 A;  3MEK A;  5KNH D;  4JHK A;  4L2L A;  3QAQ A;  5BW8 C;  3R7R A;  1K1B A;  3CHO A;  4WNG A;  1DBG A;  4J8D A;  2PQN A;  2DVW A;  4A1G A;  1JTA A;  1FT2 A;  3FUD A;  5HI7 A;  1BPO A;  3MCX A;  5FZQ A;  4MRU A;  3T9G A;  1SQM A;  2J8I A;  3S7B A;  3PSZ A;  2GGF A;  4GZ3 A;  5G05 J;  1TN8 A;  2DIW A;  4A3V A;  3DU1 X;  2BED A;  4NK6 A;  1E90 A;  1QYM A;  3Q79 A;  5G04 C;  1AWC B;  1NA0 A;  1OWL A;  5A23 A;  3CHS A;  5D66 A;  4B8A A;  4GMR A;  3D9M A;  5M72 A;  4Q96 A;  3JUI A;  5CMY A;  5C1E A;  4YZA A;  4TUU A;  3D9I A;  2LAI A;  2H6I A;  3RRM B;  4HWV A;  4U95 D;  5T3R A;  4HBD A;  1WXR A;  3CK7 A;  3FDH A;  1O8I A;  3APF A;  3HXF A;  4N3A A;  1KPS B;  3N71 A;  5JLV C;  4I9C A;  1UN8 A;  4JZY A;  4YEI A;  3DEO A;  4YCQ A;  2XGO A;  4KH3 A;  5BXO A;  2VJJ A;  3O48 A;  4GTV A;  1MJ0 A;  5CED B;  2ETA A;  5AQ9 A;  1ZBP A;  2VTB A;  2VBM A;  1HFA A;  2OV8 A;  5FJY A;  4AVZ A;  3I3N A;  4GML A;  2VFN A;  4FU3 A;  3OXL A;  5BV0 A;  2ZU6 B;  3PUK A;  3ISM C;  3UM1 A;  1WDY A;  3Q9U C;  1JWF A;  3T5V A;  2QY7 A;  4AY5 A;  2IOU G;  2FBN A;  5CEC B;  2IJG X;  3D9K A;  3ZN3 A;  2DYR E;  3ASF A;  4PDX A;  4W9R A;  3G2U A;  2XS8 A;  3FY4 A;  3TWV A;  1FPP A;  3EHR A;  3HYM B;  1O8H A;  3U66 A;  2FI7 A;  2F8X K;  2J4B A;  3NF1 A;  3P1U A;  4G23 A;  1BD8 A;  1HE8 A;  2X6Y A;  1UJK A;  4KZC A;  2ZIR A;  3S7F A;  4CZ2 D;  1IXV A;  1JCQ A;  4K03 A;  4UWF A;  3FUE A;  1EF1 C;  1O1T A;  2Y3A A;  3CK9 A;  3RRU A;  5LX8 A;  2XPY A;  2RFA A;  2C0L A;  1N0Q A;  3PH0 C;  3SBS A;  3TWT A;  1JCR A;  2R02 A;  4JW1 A;  5BNW A;  4NUR A;  4EBA A;  4DX6 D;  4GCN A;  1EYH A;  1K4Z A;  4BT8 A;  4TXR A;  4GPK A;  2X6H A;  2AVP A;  3FU0 A;  3V79 K;  3MX3 A;  3PZ1 A;  1E8Z A;  3JQ0 A;  3J5Q B;  3P4G A;  4NK8 A;  4U0Z A;  2BX6 A;  4RQI A;  2NT9 A;  4RSY A;  3CIA A;  3C3R A;  5EDS A;  3SFY A;  1OT8 A;  5JHA A;  1OOC A;  1RU4 A;  4BES A;  3EDT B;  2IFU A;  2WXG A;  4HQD A;  4XR6 A;  2AXV A;  5G2N A;  4I84 A;  2J8K A;  1OWP A;  3FEX A;  4LRZ A;  2QY1 A;  4OAU C;  1NP7 A;  4XLC A;  3FUF A;  3P2B A;  4IYP A;  1TNO A;  2X3H A;  4F3V A;  3B7U X;  5G05 C;  3MKR A;  4DX5 D;  3APC A;  3FTX A;  4EHM A;  3IXE A;  2V4L A;  5FT9 A;  4HLE A;  3UKU G;  3UXG A;  4RG9 A;  5FQ4 A;  2PM6 A;  2XTW A;  2QYU A;  5ARG A;  1QRC A;  1OFL A;  3TG5 A;  2I6H A;  5C1D A;  2I1K A;  2OCC E;  1QA1 A;  3QNK A;  3ASN E;  3GZS A;  4JPS A;  5EYL A;  1E8Y A;  3CV0 A;  2VQ2 A;  3AU4 A;  3LPZ A;  4UI9 C;  4BX9 A;  1HXI A;  3EUV A;  4XIF A;  4TUM A;  3KRG A;  4GA1 A;  1Q2Z A;  2J8S D;  3RO2 A;  3Q5M A;  4EQF A;  2PYH A;  4L7T A;  4ATZ D;  2W7Z A;  2ION A;  5EIL A;  5AMV A;  3V2O A;  2CHX A;  1S64 A;  1IHG A;  5D0O D;  1NFI E;  3ZPJ A;  2X6K A;  3V31 A;  1GW6 A;  2F3L A;  4Y6W A;  3HXE A;  2F8Y A;  2ZXW E;  4DK5 A;  4WND A;  2BTD A;  1TNZ A;  3D9N A;  1BHE A;  4LNG A;  4GYW A;  3PNT B;  4F7A A;  4JHR A;  3CVQ A;  3ONL A;  3SQV A;  4ILI A;  2KC7 A;  1DC2 A;  4ATG A;  4LG6 A;  3TWQ A;  5E75 A;  5H7P A;  3C3O A;  4JXT A;  3HG0 D;  1VBL A;  4W8S A;  2OVB A;  3PVL A;  1Z5S C;  5EIB E;  1X5B A;  2R59 A;  3LEW A;  3CQG B;  4G8L A;  4BT9 A;  2V0P A;  2BM5 A;  4J8F A;  3UT4 A;  3TXN A;  2ILR A;  3NOG D;  3W9F A;  1U3C A;  3QOU A;  4HVB A;  2V4H C;  3TJP A;  3V30 A;  3GW4 A;  1HZ4 A;  1A5E A;  4JL0 A;  1BI7 B;  2WXN A;  2EIL E;  4U49 A;  4O6F A;  4URK A;  4GA0 A;  1EDU A;  5KNG A;  2IO2 C;  4RG6 A;  1LLZ A;  3SNX A;  3MZL B;  2ZGD A;  3SI5 A;  5FQ8 A;  4MLP A;  4J7W A;  4WWP A;  2DZO A;  2WXJ A;  3ZXP A;  3GQ7 A;  5ENQ D;  4CCA A;  1OCZ E;  2P9K G;  1HO8 A;  4GZC A;  4X8Q A;  2GRL A;  2L0T B;  5EX0 A;  4U8Y D;  4L9P A;  5FIN A;  4XKW A;  4JA7 A;  1O8F A;  1E7U A;  3CR3 A;  4HNA D;  4LEU A;  3PZD A;  2BM4 A;  3PS6 A;  1BN8 A;  4I43 A;  1N52 A;  4LER A;  5JJT A;  1QCX A;  3FHE A;  4M3O A;  3ZKJ A;  4J8S A;  1O88 A;  5ENO D;  4C48 B;  4V02 C;  4CT4 A;  2X85 A;  5AQB A;  4MBG A;  1CZF A;  2VSX E;  1W3B A;  4LUN U;  2LSU A;  4UWH A;  3UPV A;  1O8L A;  3TH0 A;  1OCO E;  1V55 E;  5HKP A;  2NSZ A;  5KBA A;  4OVU A;  3JQ1 A;  4CDM A;  4HOR A;  3U3W A;  4LCT A;  4O60 A;  3HVE B;  1K5C A;  3UW0 A;  1U3D A;  3L6A A;  3ZEF A;  3AS8 A;  1JCS A;  5BXU A;  2YNQ A;  2WM9 A;  1Y6I A;  4B8C B;  3NBN B;  2CHW A;  3B7T A;  4YVO A;  4XL9 A;  4XMY A;  3UX4 A;  3GQA A;  3B8Y A;  3DSU A;  5LP0 A;  2HM8 A;  5A6C A;  3FTY A;  1IYG A;  3L54 A;  4N3B A;  1O8E A;  2QC9 A;  1INZ A;  2R17 C;  4XQF A;  5ENS D;  4A63 B;  1HG8 A;  2INV A;  2QFC A;  3ASG A;  4GZD A;  3QB2 A;  3FH7 A;  3NOC D;  1FVF A;  4U0U A;  4BX8 A;  3N90 A;  3V2X A;  3ML8 A;  5FTP A;  3UQ3 A;  3EQO A;  5CHE E;  3SZ7 A;  3FU5 A;  2XGM A;  2YHC A;  1UOH A;  4GZ5 A;  3AG4 E;  3EIJ A;  4PMH A;  3ZW3 A;  3UMV A;  3AS5 A;  2BM7 A;  2H6F A;  2KM4 A;  1QA3 A;  4BWR A;  3PEV B;  3D9O A;  1LLW A;  2J49 A;  3PUJ A;  2UVE A;  2C0M A;  4UWL A;  2VSY A;  1LM1 A;  4PUC A;  3U4T A;  2J09 A;  1H6K A;  3RAU A;  3FTV A;  1JWG A;  1OFD A;  3ZVV A;  3FTW A;  3ML9 A;  4XLE A;  4OJP A;  4PH4 B;  3PET A;  1RMG A;  2DZN A;  4GAA A;  1DCQ A;  1HH8 A;  4LNB A;  4UQZ A;  1H6O A;  1E7V A;  1UW4 B;  2A5E A;  1CLW A;  3IBE A;  4ILG A;  4UQX A;  1X0C A;  5BPP A;  4OJL A;  4KZ0 A;  4BSZ B;  4I2Z A;  3SF4 A;  2G0Y A;  3LS8 A;  1DCE A;  2Y4U A;  4GTO A;  4G8K A;  3CVY A;  2XRY A;  3FTZ A;  3E33 A;  1RZ4 A;  2VFP A;  1GQ8 A;  3ZRH A;  3MJW A;  1FCH A;  1QA2 A;  5FZR A;  2VTB B;  2ODL A;  2VGX B;  3AU5 A;  1IHB A;  3OTN A;  3ZIM A;  2B0R A;  3EJN A;  4OZZ A;  3ESL A;  4K5C A;  5KJK A;  4WWN A;  2X6W A;  5T8I A;  4OAV B;  2EIJ E;  3HVE A;  1MHQ A;  2LUH A;  3TAX A;  4ZFH A;  3J5P A;  5FIO A;  4APO A;  2YUH A;  3KAE A;  3DXK G;  2XCB A;  4ABN A;  3HXB A;  3E30 A;  1JUQ A;  1ELR A;  4G24 A;  4N39 A;  1N4R A;  4OJ6 A;  4ME2 A;  2P58 C;  2X6X A;  3GRH A;  3DPY A;  3SGH A;  4UI9 J;  1SA4 A;  4A55 A;  1WM5 A;  1ZU2 A;  3C5R A;  5CEA A;  3Q49 B;  1ELK A;  4JEU A;  2ZIS A;  1N94 A;  2MHK A;  1H0A A;  5C2Y A;  4YZX A;  1KZP A;  1NI1 A;  3D9J A;  3QDN A;  4CDN A;  4BY6 A;  4FAD A;  2XPZ A;  1IQR A;  1SVX A;  1OWO A;  4I6J A;  4M7C A;  4XLH A;  3CGH A;  2QXZ A;  2JAB A;  2XCC A;  3CHM A;  2EQX A;  2VJ8 A;  3KS2 A;  2GRO B;  5ENN A;  3CSF A;  3TXM A;  2RD0 A;  2WXI A;  4FHK A;  2HYZ A;  2EWE A;  3T9K A;  4J6I A;  5AEN A;  5KJL A;  1SZ9 A;  5DNS A;  2P9L G;  5FWQ A;  3C3Q A;  3QWV A;  3IV0 A;  2XEE A;  5HRY A;  4XOT A;  3HXD A;  1U2V G;  4YVQ C;  3LCA A;  2XRZ A;  4E6H A;  5HS0 A;  4U7E B;  2L6J A;  1WAO 1;  3FEY A;  4AJW A;  3CEQ A;  3ABM E;  1DNP A;  3SFX A;  1FVH A;  3RIQ A;  2KCV A;  1OGM X;  2PEC A;  3ZGQ A;  3L22 A;  3DEP A;  3LY8 A;  1KTW A;  4N2S A;  4MXN A;  4OJ5 A;  3G2T A;  1QBQ A;  1PAQ A;  1QJV A;  1HS6 A;  4KYO B;  4HFG A;  2P9I G;  4U07 A;  3KSL A;  1TEZ A;  3VLF A;  2GRR B;  2A5U A;  4Q94 A;  3MKQ A;  3B4N A;  4WWO A;  1K8K G;  4AV7 A;  3ZYQ A;  3BEE A;  4YEL A;  3FUJ A;  1N4P A;  4ILH B;  2BSP A;  2WQH A;  4IRU A;  4JA9 A;  3DSX A;  3TGO A;  1D8D A;  3FY3 A;  4W8Q A;  3G2S A;  3GZ2 A;  1LF8 A;  2WXP A;  2B6C A;  3TG4 A;  4U8H A;  4FUL A;  3CK8 A;  3RU0 A;  4QQI A;  2X6J A;  5DBK A;  3S2A A;  3SZE A;  3L17 A;  5EX3 A;  5LCW C;  2FO7 A;  4AY6 A;  4ANW A;  1BU9 A;  2O1D A;  5BUZ A;  3SD5 A;  5HQ8 A;  4KMO A;  5EN5 D;  1TYV A;  3PE3 A;  2R2L A;  4N2Q A;  3R7Q A;  3UT7 A;  4XON A;  4DJA A;  1XG2 A;  1EZG A;  5FQ7 A;  5EID A;  4XOR A;  2V5Q C;  2XEV A;  4KVM A;  4YND A;  4MKT A;  2DCP A;  4G25 A;  5LOZ A;  3ZYK A;  1KCD A;  2ETB A;  2I2O A;  2XZD G;  4XN3 A;  1PE9 A;  4K5B A;  1OY3 D;  2J08 A;  4Z68 A;  4KBQ A;  1JRG A;  3MGB A;  4D10 C;  3SYJ A;  3FP3 A;  1IDJ A;  2UWJ G;  3NZS A;  2YHE A;  2NTB A;  4UUC A;  4B93 B;  1PLU A;  3HDX A;  1QNF A;  4HS2 A;  1H2U A;  4YDY A;  4LSZ E;  1AP7 A;  3F6Q A;  1BLX B;  4U96 D;  1IA5 A;  5AJL A;  3UIO C;  3WXX A;  4NAC A;  2OEW A;  4JB8 P;  5T4Y A;  1O8D A;  2VYI A;  3PE4 A;  3KSQ A;  3CST A;  5FZS A;  4HB5 A;  4DLO A;  4O1O A;  3ZUV B;  1H2V C;  3EHM A;  2LNI A;  4DI3 A;  1TYX A;  5ENP D;  4HOT A;  1KT1 A;  4I2W A;  2PYG A;  4DX7 D;  2IQ7 A;  4WNE A;  3SBT B;  4BEP A;  2PQR A;  1ELW A;  1TJF A;  5IY5 E;  4L23 A;  3NAW A;  4N3C A;  3CQC B;  3FUM A;  4I6G A;  2MOW A;  5CCL A;  2O17 A;  2KZT B;  5LCW J;  4GTQ A;  4AOF A;  3LVR E;  2XTY A;  2FO1 E;  2QX3 A;  4I9E A;  5B1B E;  2J9Q A;  4Y6C A;  4GTT A;  3DBS A;  1PC2 A;  3QJZ A;  4CGV A;  1RWR A;  4GYY A;  4C2L A;  4F1P A;  1PY1 A;  4HI9 A;  2X6F A;  3N6Z A;  3QKY A;  3LJN A;  1PXZ A;  3KEA A;  1YA0 A;  4HOU A;  3L82 A;  3CKC A;  5ARF A;  2Y0B G;  2O04 A;  3DSW A;  4G1T A;  2BKK B;  3RIB A;  2XS1 A;  3RRN B;  5EYP F;  1IB4 A;  2XTX A;  3PRE A;  2J4D A;  1TNB A;  1KQ5 A;  3E34 A;  2A4Z A;  2X38 A;  4U63 A;  4HLL A;  2MRI A;  3ONK A;  2IEJ A;  3VLE A;  4XZ4 A;  3TL5 A;  3AK5 A;  4V3I A;  3L13 A;  1O8G A;  3OAW A;  3E4B A;  3GZ1 A;  2XQ0 A;  3HIZ A;  5D0Q D;  1HX8 A;  2VFO A;  3RO3 A;  4HOQ A;  4YEJ A;  4FHJ A;  1N0R A;  5AIJ A;  4BTA A;  2XT2 A;  3ESK A;  5CRU A;  2WB2 A;  4KT6 B;  2X6I A;  3LKU A;  2LAH A;  2L0I A;  4O1P A;  1WY6 A;  1Z6T A;  3CVV A;  1UN9 A;  1NA3 A;  2WXH A;  4F6R D;  4ACL A;  5JA4 D;  2INU A;  2XGS A;  1P5Q A;  1NL4 A;  4GB9 A;  3ZFW A;  4XNF A;  3JXI A;  1RW2 A;  4H7X A;  3E37 A;  4N5C A;  2WXK A;  3T8K A;  3LXU X;  4YZ0 A;  3HHM A;  3Q15 A;  3R9M A;  3ZXS A;  3IHY A;  4TRQ A;  2VBK A;  4FC8 A;  3UI2 A;  4Z06 A;  3HXC A;  3RJV A;  3SO8 A;  2VFQ A;  4BSX A;  3JX8 A;  3WG7 E;  2O0V A;  3JUE A;  4BET A;  4U8V D;  3U64 A;  3ULY A;  2C2L A;  4A1S A;  4K5A B;  3EQN A;  3LYC A;  4U0S A;  3EU9 A;  5JMN D;  3QWP A;  3GQ8 A;  4AIF A;  1EE6 A;  1MX2 A;  5A7D B;  4U4B A;  4XLA A;  3EU5 A;  3FWV A;  2NT6 A;  3OXG A;  2KZT A;  2WVI A;  3ZHE A;  2VJI A;  2WXF A;  4XI9 A;  1IKN D;  5KCM A;  2XPI A;  4HI8 A;  2O0W A;  1K1A A;  4DRX E;  3G2V A;  3VMW A;  3S7D A;  3B7B A;  4F53 A;  1E8X A;  3Q73 A;  3VMV A;  3CVP A;  4J8Y A;  1Z3X A;  3RSE G;  3UM0 A;  1N9A A;  5JHB A;  3PSS A;  2Y4T A;  4L1B A;  2RFM A;  4XKV A;  4GPM A;  2OVF A;  2FF4 A;  4JVS A;  5KWD A;  3IHV A;  4ACK A;  4APF A;  4J0U A;  2VSN A;  3ZYM A;  2NC9 A;  1TN6 A;  2BKG A;  3FH8 A;  5J08 A;  2VSO E;  2IF4 A;  3UM2 A;  5FQ6 A;  5CMW A;  5AJD A;  1OGO X;  4TXQ A;  4G26 A;  1JPL A;  4AEZ C; 
#chains in the Genus database with same CATH homology
 4YC5 A;  2XTW A;  2O6W A;  2QYU A;  3SY2 A;  3SQV A;  3DU1 X;  3NB2 A;  2XT4 A;  2XT2 A;  2XTY A;  4YFO A;  5DNS A;  4YDT A;  3PSS A;  2J8K A;  4YEI A;  3NAW A;  2XTX A;  3PSZ A;  2QZA A;  4YCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...