3NB2A

Crystal structure of e. coli o157:h7 effector protein nlel
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
612
structure length
612
Chain Sequence
QGRACLSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGRNNVFTCTAVLTDMLTEHAKESFPEIFSLYYPVAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Biochemical and Structural Studies of a HECT-like Ubiquitin Ligase from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords secreted effector protein
total genus 222
structure length 612
sequence length 612
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3nb2A04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3nb2A02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3nb2A01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3nb2A03
3NB2A 4YCQA 2QZAA 3NAWA 2XTXA 4YC5A 4YFOA 4YDTA 2O6WA 3PSZA 5DNSA 2QYUA 2XTYA 3SQVA 2XT2A 3PSSA 2J8KA 3DU1X 3SY2A 2XTWA 4YEIA 2XT4A
chains in the Genus database with same CATH superfamily
4AOFA 2LNIA 1BN8A 1Z3YA 3EDTB 1QRCA 3Q49B 1FCHA 3FUKA 3N6ZA 4UQZA 3I3NA 1N4QA 4HORA 4UWHA 1HG5A 2ETCA 1H2VC 1EYHA 1FVFA 3KRGA 3C5RA 2QXZA 1H19A 3QK0A 2XQ0A 3QJZA 3RIBA 4QFVA 4UWFA 4WNGA 1JCSA 1SA4A 5ITZF 2VGXB 5D0OD 2BKKB 3FY4A 3OXFA 2VQ2A 3G2WA 4L7TA 3FU5A 3DSTA 2J4BA 3URZA 2W7ZA 3UKRG 3Q9NC 4YFOA 4G25A 3Q75A 2IOSA 3DPYA 3B7UX 5EIDA 3ZXSA 4BETA 1Z5SC 2BUGA 2Y1LE 4DX6D 2C2LA 3UMVA 3UTMA 2WXPA 5AJDA 1H80A 2UY1A 2HM8A 4CCAA 2WXOA 4ANVA 1OCCE 3JXIA 5JJ6A 4N3AA 2ODLA 2AVPA 4J8YA 4DI3A 2LUHA 1BPOA 1QJVA 4U04A 1S64A 3J5PA 2IU1A 3E33A 2AXVA 3V31A 2XRZA 4V02C 2V5FA 2NC9A 2NYJA 3JQ1A 3JYSA 4FULA 4HB5A 5B3SE 1TNYA 1YA0A 2DZNA 5KNHD 4J8FA 4FHJA 3VMWA 1UOHA 4UI9C 3LMWA 3IV0A 4JEUA 2J07A 3UIPC 4U07A 2KXPC 3LJYA 5BUZA 4NURA 1BI8B 3OXGA 2DYRE 3PZDA 5AQ9A 4DRXE 4U96D 4JPSA 4G11A 2ETAA 3PETA 3AG1E 3TG4A 4YEIA 1LLWA 3T5VA 4KH3A 2X6WA 4HI9A 4F6RD 2UVFA 2LO6A 5BW8C 3V30A 3KEAA 3C3QA 1HG8A 3S7DA 2YUHA 3CR3A 5B1BE 3B7BA 2VBMA 4L2LA 4C9BB 1QQ1A 2O0VA 3ZU7B 3VMVA 5JLVC 3AG3E 1N0QA 1IXVA 4JHJA 3FUMA 4HLLA 4XI9A 2XTYA 4APFA 4RG9A 1ZB1A 2XZDG 1FVHA 3ASGA 2EILE 1JRGA 3L9TA 3PUJA 3AS4A 1MYOA 1BU9A 4JD2G 2HYZA 4XLAA 2KCKA 2IJGX 3ZKJA 4GZCA 1OFDA 4F3VA 4XLFA 3ONKA 4BFRA 1MX6A 2GROB 2JLBA 4GTPA 2X3HA 3NQPA 2R02A 3QWWA 4N3BA 3ZHEB 3Q15A 4Y6CA 4AEZC 5BXOA 4TUUA 2H6GA 3FUJA 1FT2A 4APOA 4WWOA 3D9LA 1U3CA 4GA0A 3B90A 3DXMG 1QCXA 2F8XK 1OWMA 1KZPA 3ISMC 3RK6A 3CVXA 4J0UA 4OJOA 1FT1A 3MGBA 3CQCB 1XGWA 3FTYA 3SFYA 1BHEA 4CT0A 1IA5A 5EYLA 3GW4A 2IONA 3PUKA 4J8EA 1EE6A 2XEVA 3LKUA 3DEOA 4EBAA 3L16A 1NA3A 3WWGA 2BTDA 3SNXA 2CG2A 2A5EA 5AMVA 2XEEA 1QA3A 1DBGA 3ZSCA 5CMYA 1NZNA 2UY1B 3ASDA 2FF4A 3TXMA 4R7LA 3ONLA 4XKBA 4ANXA 4QQIA 1UN9A 4DX7D 3IEGA 3SF4A 2WXHA 1OFMA 4ATZD 3CK9A 2PYGA 2KATA 2XHEA 2P2CP 3PVLA 3VSUA 4C0MA 1EDUA 2R59A 4GPMA 4GZDA 2I1JA 1TJCA 3FUIA 5LX8A 3DSUA 1D8EA 3IHVA 2BX6A 3GQ9A 4ACKA 4KYOB 1K5CA 5G2NA 3ABKE 4DX2A 3EHQA 2P9SG 1O8HA 3LYAA 3R7QA 5IY5E 2WXGA 5ENTD 4YZQA 3D3MA 4G8KA 3SQVA 4A1SA 5JJ7A 2XT2A 2L6BA 4Z03A 4Q96A 3EHRA 3ZPPA 2A5UA 4D10C 3LEWA 1Z6TA 4L23A 3PS6A 3FU6A 2VFQA 1E90A 4URKA 1UJKA 4GPKA 4XI0A 4LG6A 5E76A 2WXKA 1CZFA 2WXNA 4XLHA 2LXMA 4CDNA 5KJLA 3CKCA 4JW1A 3UUXA 2AXZA 2LAHA 4FHKA 4LRZA 4H7YA 1TN7A 3DEPA 3Q73A 3KD7A 4OJPA 1OCOE 4K0RA 2B6CA 2OVBA 3KSLA 5CMWA 1TNOA 4A3VA 2V4HC 2ZXWE 3MV2B 4GTQA 2XS1A 3HG0D 2H6FA 4DUIA 1KLXA 3GQAA 2IOUG 4U0UA 4J8SA 4KT6B 3I4RB 3EU9A 4U95D 3V79K 3Q78A 3NAWA 2ZGGA 4N5CA 4HBDA 2NTBA 3FH8A 2NT9A 3TWUA 1JUQA 3PREA 3ULQA 2PYHA 5LCWC 5KNGA 3B95A 3QC1A 4EECA 3UIOC 3Q47B 5EYPF 1ZBPA 4I17A 2OVFA 3APFA 1E7VA 4YDYA 1E8ZA 3LY8A 1OWLA 4YC5A 4PDXA 3C3OA 3MV3B 3L13A 4I1AA 3EQNA 2HO1A 2Y4UA 4F53A 4AM9A 1SQMA 4XN3A 5C1EA 2X6KA 4I1OB 2IO3C 1IB4A 3SO8A 5EN5D 2RFMA 2E0IA 4U0ZA 2DZOA 2BM6A 3JQ0A 1A17A 1K3ZD 1AP7A 3UINC 3ZN3A 5ENSD 4XONA 4W8QA 3SUCA 2BM7A 3JX8A 2PQNA 2WM9A 2J4DA 4OVUA 2EIJE 5E75A 2R17C 5LP0A 4BY6A 3X2QE 4AY5A 1U3DA 1RZ4A 3R9MA 3FP3A 3D9MA 4ILGA 5AYWD 4OVVA 2B0OE 3TG5A 1HFAA 3DXKG 3L08A 1LD7A 4XZ4A 2VJJA 3ESKA 4DI4A 4B0ZA 4GYOA 4XE0A 4M3OA 3G2SA 4RLYA 4O1OA 5AARA 3C98A 4ILIA 2IY0C 4I84A 1O1TA 2KZTB 1D8DA 5AQ7A 4CGWA 4U7EB 4O1PA 5EIBE 3LCAA 4FA6A 4WWPA 3ASFA 4DX5D 1MZCA 3TWSA 4HNAD 3FDHA 3L54A 2VSYA 2XZTG 3UXGA 4XOPA 3DWLG 4HI8A 5ENPD 2XCCA 3GQ8A 3TXNA 1OCZE 2XC1A 2IEJA 3TAXA 4C48B 3GZ2A 3MZLB 4BTAA 1SW6A 5KBAA 1O5MA 5G04C 1N4SA 4LERA 3RRUA 4IRUA 3OTNA 4GZ3A 5B1AE 3FHEA 4OZYA 4AXHA 2EWEA 2QZAA 5KCMA 4GTOA 3FTSA 3VSTA 1L5JA 4JRAC 4K5CA 2O04A 4HQDA 4HRLA 2BEDA 5AQBA 4BTBA 4DPRA 4XLCA 2GRNB 4YCQA 2X3MA 5KJNA 1PLUA 4N2QA 3SFZA 1QBQA 2L6JA 4I6GA 3VSVA 3PEUB 3FUHA 2X6FA 4G1TA 4AJWA 1TYUA 1BD8A 3T8MA 2J8KA 1PAQA 3QARA 3QOUA 3NBNB 3AS8A 2J9QA 3UM1A 4RSYA 5KJKA 3FH7A 4LNUD 2F3LA 4NIKA 4PMHA 4U63A 4BESA 1JCQA 2O1DA 1VDYA 1TEZA 4MKTA 2EIKE 2VTBA 3FU0A 4GTTA 1AWCB 4JB8P 5AQAA 3N90A 1P5QA 4XORA 2HR2A 1BI7B 4MS6A 4U49A 3LY9A 3ULYA 5D66A 3D9PA 1HF8A 3FTXA 5A7DB 3VTYA 2PM7A 2O6WA 3ZEFA 5DBKA 2VGYA 4BERA 1JTAA 3FEYA 1H0AA 4I9CA 3CHOA 3DPDA 3PZ4A 5DIZA 1QA2A 1JWFA 5C1CA 1DC2A 2R03A 1XG2A 1QRBA 4NK6A 2BM5A 2NTPA 4K5AB 5ANRA 3CVNA 3CHSA 2GRQB 3TWRA 3PEVB 3B13A 1ELWA 4F1PA 3AG4E 5HS0A 3IHYA 2AJAA 1Q2ZA 2R5SA 3NOCD 3QB2A 1JPLA 1IHGA 3LS8A 2BKGA 3HXEA 1IDKA 1IHBA 5EDSA 2I1KA 2KCLA 4HFGA 1E8WA 2QFCA 4XEIG 2JABA 1RU4A 3EHMA 2J8IA 1QZ2A 3OAWA 2QYUA 3K9IA 4JHRA 3FH5A 3QAQA 2CHXA 2X6HA 3JXJA 5CRVA 4BWRA 4J8DA 3CHPA 2QC9A 3CLJA 4KBQA 2ZIRA 5G05C 2I9CA 4DK5A 3RO3A 4GAAA 4XLEA 3EQOA 4UWKA 1O1RA 2ETBA 1SA5A 3U9WA 4ILHB 3MEKA 2J49A 4CDRA 5EKQD 1OFLA 1O8FA 5KJMA 1B89A 1YMPA 2XGMA 3VLFA 3ZRHA 3AJIA 3O48A 4I1MA 3ZXPA 1DCEA 4UWGA 1QNFA 5BNWA 3PSZA 3D9IA 2VTBB 1N0RA 2VGXA 3BQOA 1WG0A 1TYVA 3FUEA 2ZISA 3HDXA 2NTQA 2KM4A 4U8YD 4HOQA 5G04J 1A5EA 2AWIA 4JVSA 3GYZA 2VFPA 2PL2A 2O17A 1UJJA 4PH4B 3EIJA 3ZNGA 3UX4A 3ZPJA 3KS2A 2VYIA 5EILA 5CEDB 3P1UA 3W9FA 3HXCA 3DU1X 2WXFA 3HYMB 1KCDA 3RRNB 2KCVA 4FJYA 5A23A 4UWLA 1KQ5A 5ENOD 4YEJA 3PNTB 4TUMA 3AS5A 3SYJA 4C0EA 3HRAA 3UKUG 1TN6A 3UT7A 2VJ8A 1BLXB 4KVMA 2RKKA 3V2XA 1NP7A 1W3BA 1KTWA 4GCOA 4W8SA 5HI7A 1DABA 4AVZA 2P9LG 2LAIA 4NACA 3AU4A 3SFXA 3AK5A 1H2TC 4W8RA 5JHBA 3SY2A 3E32A 5H7PA 5G55A 1WM5A 4AP2A 3P2BA 3FEXA 5T3RA 3RRMB 1O88A 3ASOE 5EX0A 1HU3A 4ABNA 4FP7A 2LSVA 4AIFA 4W9RA 2NT6A 3ZGQA 1NHCA 5AN8A 1IQRA 1DCQA 4LUNU 4YZXA 3UM0A 2QX3A 1O8MA 3CK8A 3ZVVA 2V5QC 3WXXA 4F1SA 2YHEA 2WXRA 2Y0BG 1K8FA 3HHMA 4FC8A 5C1DA 3SD5A 5CECB 3D9HA 4BX8A 2E2EA 2P58C 3LVRE 4FU3A 2WQHA 2Z8GA 5AENA 4BX9A 2QY1A 2DVWA 2WXIA 3ML8A 2OEVA 3C3RA 5KWDA 2X85A 3E30A 3RJVA 3UM2A 2VBKA 2CHZA 5FIOA 3LXUX 2J08A 2RG8A 5D0QD 3UW0A 4E85A 4L2YA 4JA9A 4OJLA 1N95A 2MOWA 1S70B 4CRWA 4YDOA 1INZA 3HXFA 2L0IA 3JUIA 4UI9J 3CEQA 3CIAA 4HOTA 1H6KA 2MHKA 4FLBA 1IDJA 4XR6A 3Q5MA 4A3TA 5ENNA 2O0WA 3SZ7A 1ELKA 4YVQC 5C2YA 3CVWA 4I2WA 2R05A 4YZ0A 4LNGA 5LFAA 1DVPA 2PQRA 3MJWA 4G26A 1TNBA 1NA0A 3FWVA 3QWPA 1OGMX 4OJ6A 4GYYA 3UQ3A 4NQ0A 5FQ7A 4Z68A 2VGEA 5BT1A 4N5QA 5FQ8A 4TXRA 3I5PA 1UW4B 3T9GA 3LPZA 2X6XA 2P9PG 4LNBA 1OWPA 4Z06A 3Q7AA 3TL5A 4G23A 2WMNA 1EA0A 4GYWA 1N94A 3L82A 3GRHA 4W8TA 4OM9A 1E96B 3APCA 3B7RL 2XCBA 4I43A 4LSZE 4EHMA 3H09A 4J6IA 3ASNE 2BF0X 1U2VG 2MRIA 4WNFA 4MBGA 2FO7A 1O8IA 3Q7FA 2H6HA 3MYVA 1YCSB 4OAUC 4JZYA 3I4GA 1KPSB 4XX5A 1JCRA 3O4ZA 2LSUA 3PE4A 4X8QA 3Q4AB 3DSSA 2Y4TA 2PZIA 3B7SA 3FFLA 4GA1A 2I6HA 5FJYA 1KCCA 5FINA 3B7TA 1ELRA 5CERB 3E4BA 2L9BA 4EZLA 4XN0A 4O60A 2IF4A 2WMOA 4GZ6A 3MX3A 5A6CA 4EZKA 5FQ4A 5CBNA 3TWVA 3DSVA 3N71A 2GRMA 2ZGDA 3C72A 1X5BA 1MX2A 3D9JA 1OWOA 2V4LA 3G2TA 3D9KA 5CEAA 4DJAA 3S7JA 1EPUA 4PS7A 4ME2A 4JA7A 4FLHA 3RIQA 2QYJA 3FULA 3SHFA 2IOLA 4DLOA 4KZCA 3GZSA 3ZYKA 3PH0C 5CCMA 4YDTA 4HVBA 3ENEA 5ENQD 2CG3A 5BXUA 3V2OA 4XKCA 4CZ2D 4Z05A 2WQ7A 3FUNA 4YVOA 2BM4A 3EJNA 3CGHA 3TWTA 1N4RA 3NB2A 2DWZA 3CQGB 4ATGA 4EZJA 3U64A 2XENA 4I6EA 2XS8A 4UQYA 2F37A 4U8HA 4LEUA 3T8KA 1RW2A 4XMYA 3QDNA 4KZ0A 2CFUA 4OZZA 2WXJA 2GGFA 2WXMA 1LD8A 2Q7FA 4J7WA 2BSPA 3WG7E 1Z3XA 1OWNA 1UN8A 3IBEA 4B8CB 2RFAA 4TRQA 5HQ8A 3L22A 2V8SE 2EQXA 2OV8A 1YYHA 1N54A 2FI7A 3ZW3A 3VLEA 2NSPA 4Y6WA 2DIWA 2B0RA 5CRUA 1UG3A 2DBAA 4BSXA 2HE0A 3CV0A 1WAO1 3PSSA 4M7CA 4KXKB 3B4NA 1TNZA 4GU5A 3ULEG 1KT1A 3BEEA 4YZAA 2OOEA 3ZIMA 2VJIA 4OPWA 4MRUA 4B94A 3BH6B 4XOTA 3NZSA 1SVXA 5JHAA 2J8SD 3PNLB 2AXUA 3TH0A 4XL9A 2P9NG 4G24A 4K5BA 4HOSA 3GQ7A 1OXJA 2XGSA 2ZU6B 3AU5A 1HS6A 3Q79A 3ESLA 2UWJG 2X6JA 1E8YA 3E37A 1HX8A 2X38A 1HE8A 1RWRA 3FY3A 1K1BA 1WDYA 3GZ1A 2INVA 2AW6A 1K1AA 2M63A 4OAVB 5FZRA 3PZ2A 3ZYLA 1OUVA 1O8LA 3TWWA 2VSXE 1Y8MA 3L17A 2VSOE 3S2AA 4JXTA 5G05J 4ZFHA 3FTZA 2C0LA 4JEHA 3CVYA 1GQ8A 3F6QA 4JC8A 3MA5A 3ZFWA 1OFEA 3U66A 2I2OA 2V0PA 2IFUA 4BT8A 3CK7A 2XTWA 4GTMA 1TYQG 2OCCE 4Q94A 1IKND 4PUCA 4JHKA 2PNNA 1XNFA 4K03A 3VLDA 1N11A 3U4TA 5AIJA 1NFIE 2UVEA 1DNPA 1E7UA 4DX1A 4GTRA 3EU5A 3D9NA 1LLZA 1MJ0A 2L0TB 1EF1C 1IQUA 3CVUA 3NZUA 3TWXA 3HXBA 2NSZA 4IULA 3ZYMA 3CVPA 1S0PA 4A1GA 1O1SA 3PZ3A 4UUCA 1O8GA 2C0MA 4RQIA 3TJPA 1V54E 1Y6IA 3QNKA 1OCRE 3SGHA 5JA4D 5J08A 3UPVA 1OY3D 4UQXA 1LM1A 4ZHBA 4HRMB 4B89A 4GZ5A 3HIZA 4AVXA 4U4BA 3RAUA 4XQFA 4V3IA 1L1IA 5FTPA 4NRHB 1FPPA 1JWGA 1TN8A 4YDWA 4LCTA 2CFZA 5FZQA 4N39A 3TGOA 2INUA 4OYSA 1HG2A 3NF1A 3CHRA 4HWVA 2P9KG 4MLPA 3FUFA 4GTSA 5ARFA 5HKPA 3ZUVB 5BV1A 1PC2A 4CEMA 1RMGA 1WY6A 1NL4A 2X6IA 4HRNA 3BU8A 4GA2A 4UI9K 2LXLA 4GMLA 4PS3A 3CHQA 1HXIA 1KT0A 4G2VA 1X0CA 3DBSA 3PE3A 1WXRA 1K8KG 3ML3A 4JL0A 4RVBA 2XPIA 4F7AA 5BPPA 4XM3A 3JUEA 1S63A 4GB9A 3RU0A 1O8JA 3R9AB 3BG0B 3MKQB 3CVVA 2QY7A 3KEZA 4AY6A 2H6IA 3G2UA 3AAAC 2Y3AA 4EQFA 2WQ6A 2X6YA 4A55A 2F0YA 2GW1A 4N2SA 3CSFA 1WMRA 4FJZA 4GMRA 1O8DA 4PS8A 4IN3B 1H6PA 4EPZA 1SZ9A 1TR4A 3LJ3A 2DCPA 3W9GA 4BSZB 3LJNA 2WB2A 3VTXA 1MHQA 3CVLA 4G8LA 2EINE 2CHWA 3Q9UC 1OOCA 1N4PA 5ANLA 2GRPB 2IQ7A 1O8KA 4CDMA 3MKQA 1MX4A 1TYXA 3JCKC 2J09A 2WXLA 3ML9A 4ACLA 3ASHA 5FQ6A 2XPZA 2WVIA 1X81A 3AG2E 4YNDA 1TSPA 3UT4A 4GCNA 2GRLA 3APDA 2FULA 4U8VD 4XKVA 3L6AA 4N3CA 2VFNA 3ZYQA 1QQEA 4WNDA 4HOUA 4TV3A 4FADA 2VBEA 5HRYA 4HXIA 2Y69E 1N9AA 1H2UA 5FWQA 4P29A 1K4ZA 5AJLA 5ENRD 2NXPA 4EW9A 3ABLE 5T4YA 1H6OA 2KC7A 3LDZA 3SBSA 2XPYA 2OEWA 4XNFA 4WUYA 1GW6A 2V5IA 1E8XA 4GTVA 4B8AA 1DBOA 2PECA 5T8IA 5CBOA 5D2MC 4WNEA 2DYSE 2VFMA 2NSTA 4XIFA 3S7BA 1LTXA 3DRAA 4HS2A 3G2VA 3IXEA 2XT4A 5EX3A 1HZ4A 3UT8A 5BV0A 2XTXA 3LVQE 3EIQC 3ZHEA 2IO2C 3TWQA 1OGOX 2VFOA 3KAEA 3OXLA 2KZTA 3RKVA 3JURA 1HF2A 3BG1B 1TJFA 1PXZA 3FTVA 4BT9A 2ONDA 2FEZA 4EBAG 1QA1A 4L1BA 4GMJA 1MQSA 5CCLA 4URRA 3FU3A 1EZGA 4U0SA 2R2LA 4WWNA 3SI5A 3LY7A 4MXNA 3DSXA 3FTUA 4TXPA 3QKYA 1TYWA 2FO1E 4DLQA 4OJ5A 4ANUA 1PE9A 3HVEA 3ABME 1N52A 3T5XA 3PRZA 3J5QB 1KZOA 2WXQA 4KVOA 3HVEB 3EUVA 2JEKA 4I6JA 2XGOA 5J90A 4TXQA 2ILRA 3SZEA 1NI1A 3MCXA 4IYPA 1LF8A 2RD0A 3KSQA 5CHEE 4E6HA 4CYMD 2P9UG 4YELA 2VSNA 4BEPA 3B8YA 1ZU2A 5M72A 2YQ8A 5FT9A 3CSTA 3P4GA 3RO2A 2KBXA 2EIME 2YHCA 4B93B 1HO8A 1V55E 4C2LA 4L9PA 1OT8A 4O6FA 2XRYA 5ARGA 4CT4A 3HXDA 3QWVA 1IYGA 2YINA 3SBTB 4AV7A 3S7FA 5JMCB 3CVQA 2GRRB 3UI2A 2MYOA 3LYCA 5JJTA 3CKBA 4H7XA 2IQCA 4ANWA 2NZMA 3DSWA 3U3WA 2PM6A 4YDEA 1HH8A 2YNQA 1CLWA 4MR0A 4NK8A 5JMND 5LCWJ 2F8YA 3IKOB 4WAFA 3RSEG 5AAOA 3UM3A 5DNSA 1O8EA 2G0YA 1SZAA 1G3NB 3R7RA 5FZSA 3PDNA 1QYMA 3EHNA 4I9EA 4A63B 3MKRA 3BUAA 1PY1A 3FTWA 4HLEA 4Q69A 3D9OA 2A4ZA 3NOGD 1VBLA 1D9SA 3PZ1A 3E34A 4I2ZA 5LOZA 2XEHA 3FUDA 3T9KA 2WPVA 3BH7B 2FBNA 4KMOA 1AIRA 4XKWA 2P9IG 3CHMA 4CGVA 4RG6A 1TNUA
chains in the Genus database with same CATH topology
3NB2A 4YCQA 2QZAA 3NAWA 2XTXA 4YC5A 4YFOA 4YDTA 2O6WA 3PSZA 5DNSA 2QYUA 2XTYA 3SQVA 2XT2A 3PSSA 2J8KA 3DU1X 3SY2A 2XTWA 4YEIA 2XT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NB2 A;  4YCQ A;  2QZA A;  3NAW A;  2XTX A;  4YC5 A;  4YFO A;  4YDT A;  2O6W A;  3PSZ A;  5DNS A;  2QYU A;  2XTY A;  3SQV A;  2XT2 A;  3PSS A;  2J8K A;  3DU1 X;  3SY2 A;  2XTW A;  4YEI A;  2XT4 A; 
#chains in the Genus database with same CATH topology
 4AOF A;  2LNI A;  1BN8 A;  1Z3Y A;  3EDT B;  1QRC A;  3Q49 B;  1FCH A;  3FUK A;  3N6Z A;  4UQZ A;  3I3N A;  1N4Q A;  4HOR A;  4UWH A;  1HG5 A;  2ETC A;  1H2V C;  1EYH A;  1FVF A;  3KRG A;  3C5R A;  2QXZ A;  1H19 A;  3QK0 A;  2XQ0 A;  3QJZ A;  3RIB A;  4QFV A;  4UWF A;  4WNG A;  1JCS A;  1SA4 A;  5ITZ F;  2VGX B;  5D0O D;  2BKK B;  3FY4 A;  3OXF A;  2VQ2 A;  3G2W A;  4L7T A;  3FU5 A;  3DST A;  2J4B A;  3URZ A;  2W7Z A;  3UKR G;  3Q9N C;  4YFO A;  4G25 A;  3Q75 A;  2IOS A;  3DPY A;  3B7U X;  5EID A;  3ZXS A;  4BET A;  1Z5S C;  2BUG A;  2Y1L E;  4DX6 D;  2C2L A;  3UMV A;  3UTM A;  2WXP A;  5AJD A;  1H80 A;  2UY1 A;  2HM8 A;  4CCA A;  2WXO A;  4ANV A;  1OCC E;  3JXI A;  5JJ6 A;  4N3A A;  2ODL A;  2AVP A;  4J8Y A;  4DI3 A;  2LUH A;  1BPO A;  1QJV A;  4U04 A;  1S64 A;  3J5P A;  2IU1 A;  3E33 A;  2AXV A;  3V31 A;  2XRZ A;  4V02 C;  2V5F A;  2NC9 A;  2NYJ A;  3JQ1 A;  3JYS A;  4FUL A;  4HB5 A;  5B3S E;  1TNY A;  1YA0 A;  2DZN A;  5KNH D;  4J8F A;  4FHJ A;  3VMW A;  1UOH A;  4UI9 C;  3LMW A;  3IV0 A;  4JEU A;  2J07 A;  3UIP C;  4U07 A;  2KXP C;  3LJY A;  5BUZ A;  4NUR A;  1BI8 B;  3OXG A;  2DYR E;  3PZD A;  5AQ9 A;  4DRX E;  4U96 D;  4JPS A;  4G11 A;  2ETA A;  3PET A;  3AG1 E;  3TG4 A;  4YEI A;  1LLW A;  3T5V A;  4KH3 A;  2X6W A;  4HI9 A;  4F6R D;  2UVF A;  2LO6 A;  5BW8 C;  3V30 A;  3KEA A;  3C3Q A;  1HG8 A;  3S7D A;  2YUH A;  3CR3 A;  5B1B E;  3B7B A;  2VBM A;  4L2L A;  4C9B B;  1QQ1 A;  2O0V A;  3ZU7 B;  3VMV A;  5JLV C;  3AG3 E;  1N0Q A;  1IXV A;  4JHJ A;  3FUM A;  4HLL A;  4XI9 A;  2XTY A;  4APF A;  4RG9 A;  1ZB1 A;  2XZD G;  1FVH A;  3ASG A;  2EIL E;  1JRG A;  3L9T A;  3PUJ A;  3AS4 A;  1MYO A;  1BU9 A;  4JD2 G;  2HYZ A;  4XLA A;  2KCK A;  2IJG X;  3ZKJ A;  4GZC A;  1OFD A;  4F3V A;  4XLF A;  3ONK A;  4BFR A;  1MX6 A;  2GRO B;  2JLB A;  4GTP A;  2X3H A;  3NQP A;  2R02 A;  3QWW A;  4N3B A;  3ZHE B;  3Q15 A;  4Y6C A;  4AEZ C;  5BXO A;  4TUU A;  2H6G A;  3FUJ A;  1FT2 A;  4APO A;  4WWO A;  3D9L A;  1U3C A;  4GA0 A;  3B90 A;  3DXM G;  1QCX A;  2F8X K;  1OWM A;  1KZP A;  3ISM C;  3RK6 A;  3CVX A;  4J0U A;  4OJO A;  1FT1 A;  3MGB A;  3CQC B;  1XGW A;  3FTY A;  3SFY A;  1BHE A;  4CT0 A;  1IA5 A;  5EYL A;  3GW4 A;  2ION A;  3PUK A;  4J8E A;  1EE6 A;  2XEV A;  3LKU A;  3DEO A;  4EBA A;  3L16 A;  1NA3 A;  3WWG A;  2BTD A;  3SNX A;  2CG2 A;  2A5E A;  5AMV A;  2XEE A;  1QA3 A;  1DBG A;  3ZSC A;  5CMY A;  1NZN A;  2UY1 B;  3ASD A;  2FF4 A;  3TXM A;  4R7L A;  3ONL A;  4XKB A;  4ANX A;  4QQI A;  1UN9 A;  4DX7 D;  3IEG A;  3SF4 A;  2WXH A;  1OFM A;  4ATZ D;  3CK9 A;  2PYG A;  2KAT A;  2XHE A;  2P2C P;  3PVL A;  3VSU A;  4C0M A;  1EDU A;  2R59 A;  4GPM A;  4GZD A;  2I1J A;  1TJC A;  3FUI A;  5LX8 A;  3DSU A;  1D8E A;  3IHV A;  2BX6 A;  3GQ9 A;  4ACK A;  4KYO B;  1K5C A;  5G2N A;  3ABK E;  4DX2 A;  3EHQ A;  2P9S G;  1O8H A;  3LYA A;  3R7Q A;  5IY5 E;  2WXG A;  5ENT D;  4YZQ A;  3D3M A;  4G8K A;  3SQV A;  4A1S A;  5JJ7 A;  2XT2 A;  2L6B A;  4Z03 A;  4Q96 A;  3EHR A;  3ZPP A;  2A5U A;  4D10 C;  3LEW A;  1Z6T A;  4L23 A;  3PS6 A;  3FU6 A;  2VFQ A;  1E90 A;  4URK A;  1UJK A;  4GPK A;  4XI0 A;  4LG6 A;  5E76 A;  2WXK A;  1CZF A;  2WXN A;  4XLH A;  2LXM A;  4CDN A;  5KJL A;  3CKC A;  4JW1 A;  3UUX A;  2AXZ A;  2LAH A;  4FHK A;  4LRZ A;  4H7Y A;  1TN7 A;  3DEP A;  3Q73 A;  3KD7 A;  4OJP A;  1OCO E;  4K0R A;  2B6C A;  2OVB A;  3KSL A;  5CMW A;  1TNO A;  4A3V A;  2V4H C;  2ZXW E;  3MV2 B;  4GTQ A;  2XS1 A;  3HG0 D;  2H6F A;  4DUI A;  1KLX A;  3GQA A;  2IOU G;  4U0U A;  4J8S A;  4KT6 B;  3I4R B;  3EU9 A;  4U95 D;  3V79 K;  3Q78 A;  3NAW A;  2ZGG A;  4N5C A;  4HBD A;  2NTB A;  3FH8 A;  2NT9 A;  3TWU A;  1JUQ A;  3PRE A;  3ULQ A;  2PYH A;  5LCW C;  5KNG A;  3B95 A;  3QC1 A;  4EEC A;  3UIO C;  3Q47 B;  5EYP F;  1ZBP A;  4I17 A;  2OVF A;  3APF A;  1E7V A;  4YDY A;  1E8Z A;  3LY8 A;  1OWL A;  4YC5 A;  4PDX A;  3C3O A;  3MV3 B;  3L13 A;  4I1A A;  3EQN A;  2HO1 A;  2Y4U A;  4F53 A;  4AM9 A;  1SQM A;  4XN3 A;  5C1E A;  2X6K A;  4I1O B;  2IO3 C;  1IB4 A;  3SO8 A;  5EN5 D;  2RFM A;  2E0I A;  4U0Z A;  2DZO A;  2BM6 A;  3JQ0 A;  1A17 A;  1K3Z D;  1AP7 A;  3UIN C;  3ZN3 A;  5ENS D;  4XON A;  4W8Q A;  3SUC A;  2BM7 A;  3JX8 A;  2PQN A;  2WM9 A;  2J4D A;  4OVU A;  2EIJ E;  5E75 A;  2R17 C;  5LP0 A;  4BY6 A;  3X2Q E;  4AY5 A;  1U3D A;  1RZ4 A;  3R9M A;  3FP3 A;  3D9M A;  4ILG A;  5AYW D;  4OVV A;  2B0O E;  3TG5 A;  1HFA A;  3DXK G;  3L08 A;  1LD7 A;  4XZ4 A;  2VJJ A;  3ESK A;  4DI4 A;  4B0Z A;  4GYO A;  4XE0 A;  4M3O A;  3G2S A;  4RLY A;  4O1O A;  5AAR A;  3C98 A;  4ILI A;  2IY0 C;  4I84 A;  1O1T A;  2KZT B;  1D8D A;  5AQ7 A;  4CGW A;  4U7E B;  4O1P A;  5EIB E;  3LCA A;  4FA6 A;  4WWP A;  3ASF A;  4DX5 D;  1MZC A;  3TWS A;  4HNA D;  3FDH A;  3L54 A;  2VSY A;  2XZT G;  3UXG A;  4XOP A;  3DWL G;  4HI8 A;  5ENP D;  2XCC A;  3GQ8 A;  3TXN A;  1OCZ E;  2XC1 A;  2IEJ A;  3TAX A;  4C48 B;  3GZ2 A;  3MZL B;  4BTA A;  1SW6 A;  5KBA A;  1O5M A;  5G04 C;  1N4S A;  4LER A;  3RRU A;  4IRU A;  3OTN A;  4GZ3 A;  5B1A E;  3FHE A;  4OZY A;  4AXH A;  2EWE A;  2QZA A;  5KCM A;  4GTO A;  3FTS A;  3VST A;  1L5J A;  4JRA C;  4K5C A;  2O04 A;  4HQD A;  4HRL A;  2BED A;  5AQB A;  4BTB A;  4DPR A;  4XLC A;  2GRN B;  4YCQ A;  2X3M A;  5KJN A;  1PLU A;  4N2Q A;  3SFZ A;  1QBQ A;  2L6J A;  4I6G A;  3VSV A;  3PEU B;  3FUH A;  2X6F A;  4G1T A;  4AJW A;  1TYU A;  1BD8 A;  3T8M A;  2J8K A;  1PAQ A;  3QAR A;  3QOU A;  3NBN B;  3AS8 A;  2J9Q A;  3UM1 A;  4RSY A;  5KJK A;  3FH7 A;  4LNU D;  2F3L A;  4NIK A;  4PMH A;  4U63 A;  4BES A;  1JCQ A;  2O1D A;  1VDY A;  1TEZ A;  4MKT A;  2EIK E;  2VTB A;  3FU0 A;  4GTT A;  1AWC B;  4JB8 P;  5AQA A;  3N90 A;  1P5Q A;  4XOR A;  2HR2 A;  1BI7 B;  4MS6 A;  4U49 A;  3LY9 A;  3ULY A;  5D66 A;  3D9P A;  1HF8 A;  3FTX A;  5A7D B;  3VTY A;  2PM7 A;  2O6W A;  3ZEF A;  5DBK A;  2VGY A;  4BER A;  1JTA A;  3FEY A;  1H0A A;  4I9C A;  3CHO A;  3DPD A;  3PZ4 A;  5DIZ A;  1QA2 A;  1JWF A;  5C1C A;  1DC2 A;  2R03 A;  1XG2 A;  1QRB A;  4NK6 A;  2BM5 A;  2NTP A;  4K5A B;  5ANR A;  3CVN A;  3CHS A;  2GRQ B;  3TWR A;  3PEV B;  3B13 A;  1ELW A;  4F1P A;  3AG4 E;  5HS0 A;  3IHY A;  2AJA A;  1Q2Z A;  2R5S A;  3NOC D;  3QB2 A;  1JPL A;  1IHG A;  3LS8 A;  2BKG A;  3HXE A;  1IDK A;  1IHB A;  5EDS A;  2I1K A;  2KCL A;  4HFG A;  1E8W A;  2QFC A;  4XEI G;  2JAB A;  1RU4 A;  3EHM A;  2J8I A;  1QZ2 A;  3OAW A;  2QYU A;  3K9I A;  4JHR A;  3FH5 A;  3QAQ A;  2CHX A;  2X6H A;  3JXJ A;  5CRV A;  4BWR A;  4J8D A;  3CHP A;  2QC9 A;  3CLJ A;  4KBQ A;  2ZIR A;  5G05 C;  2I9C A;  4DK5 A;  3RO3 A;  4GAA A;  4XLE A;  3EQO A;  4UWK A;  1O1R A;  2ETB A;  1SA5 A;  3U9W A;  4ILH B;  3MEK A;  2J49 A;  4CDR A;  5EKQ D;  1OFL A;  1O8F A;  5KJM A;  1B89 A;  1YMP A;  2XGM A;  3VLF A;  3ZRH A;  3AJI A;  3O48 A;  4I1M A;  3ZXP A;  1DCE A;  4UWG A;  1QNF A;  5BNW A;  3PSZ A;  3D9I A;  2VTB B;  1N0R A;  2VGX A;  3BQO A;  1WG0 A;  1TYV A;  3FUE A;  2ZIS A;  3HDX A;  2NTQ A;  2KM4 A;  4U8Y D;  4HOQ A;  5G04 J;  1A5E A;  2AWI A;  4JVS A;  3GYZ A;  2VFP A;  2PL2 A;  2O17 A;  1UJJ A;  4PH4 B;  3EIJ A;  3ZNG A;  3UX4 A;  3ZPJ A;  3KS2 A;  2VYI A;  5EIL A;  5CED B;  3P1U A;  3W9F A;  3HXC A;  3DU1 X;  2WXF A;  3HYM B;  1KCD A;  3RRN B;  2KCV A;  4FJY A;  5A23 A;  4UWL A;  1KQ5 A;  5ENO D;  4YEJ A;  3PNT B;  4TUM A;  3AS5 A;  3SYJ A;  4C0E A;  3HRA A;  3UKU G;  1TN6 A;  3UT7 A;  2VJ8 A;  1BLX B;  4KVM A;  2RKK A;  3V2X A;  1NP7 A;  1W3B A;  1KTW A;  4GCO A;  4W8S A;  5HI7 A;  1DAB A;  4AVZ A;  2P9L G;  2LAI A;  4NAC A;  3AU4 A;  3SFX A;  3AK5 A;  1H2T C;  4W8R A;  5JHB A;  3SY2 A;  3E32 A;  5H7P A;  5G55 A;  1WM5 A;  4AP2 A;  3P2B A;  3FEX A;  5T3R A;  3RRM B;  1O88 A;  3ASO E;  5EX0 A;  1HU3 A;  4ABN A;  4FP7 A;  2LSV A;  4AIF A;  4W9R A;  2NT6 A;  3ZGQ A;  1NHC A;  5AN8 A;  1IQR A;  1DCQ A;  4LUN U;  4YZX A;  3UM0 A;  2QX3 A;  1O8M A;  3CK8 A;  3ZVV A;  2V5Q C;  3WXX A;  4F1S A;  2YHE A;  2WXR A;  2Y0B G;  1K8F A;  3HHM A;  4FC8 A;  5C1D A;  3SD5 A;  5CEC B;  3D9H A;  4BX8 A;  2E2E A;  2P58 C;  3LVR E;  4FU3 A;  2WQH A;  2Z8G A;  5AEN A;  4BX9 A;  2QY1 A;  2DVW A;  2WXI A;  3ML8 A;  2OEV A;  3C3R A;  5KWD A;  2X85 A;  3E30 A;  3RJV A;  3UM2 A;  2VBK A;  2CHZ A;  5FIO A;  3LXU X;  2J08 A;  2RG8 A;  5D0Q D;  3UW0 A;  4E85 A;  4L2Y A;  4JA9 A;  4OJL A;  1N95 A;  2MOW A;  1S70 B;  4CRW A;  4YDO A;  1INZ A;  3HXF A;  2L0I A;  3JUI A;  4UI9 J;  3CEQ A;  3CIA A;  4HOT A;  1H6K A;  2MHK A;  4FLB A;  1IDJ A;  4XR6 A;  3Q5M A;  4A3T A;  5ENN A;  2O0W A;  3SZ7 A;  1ELK A;  4YVQ C;  5C2Y A;  3CVW A;  4I2W A;  2R05 A;  4YZ0 A;  4LNG A;  5LFA A;  1DVP A;  2PQR A;  3MJW A;  4G26 A;  1TNB A;  1NA0 A;  3FWV A;  3QWP A;  1OGM X;  4OJ6 A;  4GYY A;  3UQ3 A;  4NQ0 A;  5FQ7 A;  4Z68 A;  2VGE A;  5BT1 A;  4N5Q A;  5FQ8 A;  4TXR A;  3I5P A;  1UW4 B;  3T9G A;  3LPZ A;  2X6X A;  2P9P G;  4LNB A;  1OWP A;  4Z06 A;  3Q7A A;  3TL5 A;  4G23 A;  2WMN A;  1EA0 A;  4GYW A;  1N94 A;  3L82 A;  3GRH A;  4W8T A;  4OM9 A;  1E96 B;  3APC A;  3B7R L;  2XCB A;  4I43 A;  4LSZ E;  4EHM A;  3H09 A;  4J6I A;  3ASN E;  2BF0 X;  1U2V G;  2MRI A;  4WNF A;  4MBG A;  2FO7 A;  1O8I A;  3Q7F A;  2H6H A;  3MYV A;  1YCS B;  4OAU C;  4JZY A;  3I4G A;  1KPS B;  4XX5 A;  1JCR A;  3O4Z A;  2LSU A;  3PE4 A;  4X8Q A;  3Q4A B;  3DSS A;  2Y4T A;  2PZI A;  3B7S A;  3FFL A;  4GA1 A;  2I6H A;  5FJY A;  1KCC A;  5FIN A;  3B7T A;  1ELR A;  5CER B;  3E4B A;  2L9B A;  4EZL A;  4XN0 A;  4O60 A;  2IF4 A;  2WMO A;  4GZ6 A;  3MX3 A;  5A6C A;  4EZK A;  5FQ4 A;  5CBN A;  3TWV A;  3DSV A;  3N71 A;  2GRM A;  2ZGD A;  3C72 A;  1X5B A;  1MX2 A;  3D9J A;  1OWO A;  2V4L A;  3G2T A;  3D9K A;  5CEA A;  4DJA A;  3S7J A;  1EPU A;  4PS7 A;  4ME2 A;  4JA7 A;  4FLH A;  3RIQ A;  2QYJ A;  3FUL A;  3SHF A;  2IOL A;  4DLO A;  4KZC A;  3GZS A;  3ZYK A;  3PH0 C;  5CCM A;  4YDT A;  4HVB A;  3ENE A;  5ENQ D;  2CG3 A;  5BXU A;  3V2O A;  4XKC A;  4CZ2 D;  4Z05 A;  2WQ7 A;  3FUN A;  4YVO A;  2BM4 A;  3EJN A;  3CGH A;  3TWT A;  1N4R A;  3NB2 A;  2DWZ A;  3CQG B;  4ATG A;  4EZJ A;  3U64 A;  2XEN A;  4I6E A;  2XS8 A;  4UQY A;  2F37 A;  4U8H A;  4LEU A;  3T8K A;  1RW2 A;  4XMY A;  3QDN A;  4KZ0 A;  2CFU A;  4OZZ A;  2WXJ A;  2GGF A;  2WXM A;  1LD8 A;  2Q7F A;  4J7W A;  2BSP A;  3WG7 E;  1Z3X A;  1OWN A;  1UN8 A;  3IBE A;  4B8C B;  2RFA A;  4TRQ A;  5HQ8 A;  3L22 A;  2V8S E;  2EQX A;  2OV8 A;  1YYH A;  1N54 A;  2FI7 A;  3ZW3 A;  3VLE A;  2NSP A;  4Y6W A;  2DIW A;  2B0R A;  5CRU A;  1UG3 A;  2DBA A;  4BSX A;  2HE0 A;  3CV0 A;  1WAO 1;  3PSS A;  4M7C A;  4KXK B;  3B4N A;  1TNZ A;  4GU5 A;  3ULE G;  1KT1 A;  3BEE A;  4YZA A;  2OOE A;  3ZIM A;  2VJI A;  4OPW A;  4MRU A;  4B94 A;  3BH6 B;  4XOT A;  3NZS A;  1SVX A;  5JHA A;  2J8S D;  3PNL B;  2AXU A;  3TH0 A;  4XL9 A;  2P9N G;  4G24 A;  4K5B A;  4HOS A;  3GQ7 A;  1OXJ A;  2XGS A;  2ZU6 B;  3AU5 A;  1HS6 A;  3Q79 A;  3ESL A;  2UWJ G;  2X6J A;  1E8Y A;  3E37 A;  1HX8 A;  2X38 A;  1HE8 A;  1RWR A;  3FY3 A;  1K1B A;  1WDY A;  3GZ1 A;  2INV A;  2AW6 A;  1K1A A;  2M63 A;  4OAV B;  5FZR A;  3PZ2 A;  3ZYL A;  1OUV A;  1O8L A;  3TWW A;  2VSX E;  1Y8M A;  3L17 A;  2VSO E;  3S2A A;  4JXT A;  5G05 J;  4ZFH A;  3FTZ A;  2C0L A;  4JEH A;  3CVY A;  1GQ8 A;  3F6Q A;  4JC8 A;  3MA5 A;  3ZFW A;  1OFE A;  3U66 A;  2I2O A;  2V0P A;  2IFU A;  4BT8 A;  3CK7 A;  2XTW A;  4GTM A;  1TYQ G;  2OCC E;  4Q94 A;  1IKN D;  4PUC A;  4JHK A;  2PNN A;  1XNF A;  4K03 A;  3VLD A;  1N11 A;  3U4T A;  5AIJ A;  1NFI E;  2UVE A;  1DNP A;  1E7U A;  4DX1 A;  4GTR A;  3EU5 A;  3D9N A;  1LLZ A;  1MJ0 A;  2L0T B;  1EF1 C;  1IQU A;  3CVU A;  3NZU A;  3TWX A;  3HXB A;  2NSZ A;  4IUL A;  3ZYM A;  3CVP A;  1S0P A;  4A1G A;  1O1S A;  3PZ3 A;  4UUC A;  1O8G A;  2C0M A;  4RQI A;  3TJP A;  1V54 E;  1Y6I A;  3QNK A;  1OCR E;  3SGH A;  5JA4 D;  5J08 A;  3UPV A;  1OY3 D;  4UQX A;  1LM1 A;  4ZHB A;  4HRM B;  4B89 A;  4GZ5 A;  3HIZ A;  4AVX A;  4U4B A;  3RAU A;  4XQF A;  4V3I A;  1L1I A;  5FTP A;  4NRH B;  1FPP A;  1JWG A;  1TN8 A;  4YDW A;  4LCT A;  2CFZ A;  5FZQ A;  4N39 A;  3TGO A;  2INU A;  4OYS A;  1HG2 A;  3NF1 A;  3CHR A;  4HWV A;  2P9K G;  4MLP A;  3FUF A;  4GTS A;  5ARF A;  5HKP A;  3ZUV B;  5BV1 A;  1PC2 A;  4CEM A;  1RMG A;  1WY6 A;  1NL4 A;  2X6I A;  4HRN A;  3BU8 A;  4GA2 A;  4UI9 K;  2LXL A;  4GML A;  4PS3 A;  3CHQ A;  1HXI A;  1KT0 A;  4G2V A;  1X0C A;  3DBS A;  3PE3 A;  1WXR A;  1K8K G;  3ML3 A;  4JL0 A;  4RVB A;  2XPI A;  4F7A A;  5BPP A;  4XM3 A;  3JUE A;  1S63 A;  4GB9 A;  3RU0 A;  1O8J A;  3R9A B;  3BG0 B;  3MKQ B;  3CVV A;  2QY7 A;  3KEZ A;  4AY6 A;  2H6I A;  3G2U A;  3AAA C;  2Y3A A;  4EQF A;  2WQ6 A;  2X6Y A;  4A55 A;  2F0Y A;  2GW1 A;  4N2S A;  3CSF A;  1WMR A;  4FJZ A;  4GMR A;  1O8D A;  4PS8 A;  4IN3 B;  1H6P A;  4EPZ A;  1SZ9 A;  1TR4 A;  3LJ3 A;  2DCP A;  3W9G A;  4BSZ B;  3LJN A;  2WB2 A;  3VTX A;  1MHQ A;  3CVL A;  4G8L A;  2EIN E;  2CHW A;  3Q9U C;  1OOC A;  1N4P A;  5ANL A;  2GRP B;  2IQ7 A;  1O8K A;  4CDM A;  3MKQ A;  1MX4 A;  1TYX A;  3JCK C;  2J09 A;  2WXL A;  3ML9 A;  4ACL A;  3ASH A;  5FQ6 A;  2XPZ A;  2WVI A;  1X81 A;  3AG2 E;  4YND A;  1TSP A;  3UT4 A;  4GCN A;  2GRL A;  3APD A;  2FUL A;  4U8V D;  4XKV A;  3L6A A;  4N3C A;  2VFN A;  3ZYQ A;  1QQE A;  4WND A;  4HOU A;  4TV3 A;  4FAD A;  2VBE A;  5HRY A;  4HXI A;  2Y69 E;  1N9A A;  1H2U A;  5FWQ A;  4P29 A;  1K4Z A;  5AJL A;  5ENR D;  2NXP A;  4EW9 A;  3ABL E;  5T4Y A;  1H6O A;  2KC7 A;  3LDZ A;  3SBS A;  2XPY A;  2OEW A;  4XNF A;  4WUY A;  1GW6 A;  2V5I A;  1E8X A;  4GTV A;  4B8A A;  1DBO A;  2PEC A;  5T8I A;  5CBO A;  5D2M C;  4WNE A;  2DYS E;  2VFM A;  2NST A;  4XIF A;  3S7B A;  1LTX A;  3DRA A;  4HS2 A;  3G2V A;  3IXE A;  2XT4 A;  5EX3 A;  1HZ4 A;  3UT8 A;  5BV0 A;  2XTX A;  3LVQ E;  3EIQ C;  3ZHE A;  2IO2 C;  3TWQ A;  1OGO X;  2VFO A;  3KAE A;  3OXL A;  2KZT A;  3RKV A;  3JUR A;  1HF2 A;  3BG1 B;  1TJF A;  1PXZ A;  3FTV A;  4BT9 A;  2OND A;  2FEZ A;  4EBA G;  1QA1 A;  4L1B A;  4GMJ A;  1MQS A;  5CCL A;  4URR A;  3FU3 A;  1EZG A;  4U0S A;  2R2L A;  4WWN A;  3SI5 A;  3LY7 A;  4MXN A;  3DSX A;  3FTU A;  4TXP A;  3QKY A;  1TYW A;  2FO1 E;  4DLQ A;  4OJ5 A;  4ANU A;  1PE9 A;  3HVE A;  3ABM E;  1N52 A;  3T5X A;  3PRZ A;  3J5Q B;  1KZO A;  2WXQ A;  4KVO A;  3HVE B;  3EUV A;  2JEK A;  4I6J A;  2XGO A;  5J90 A;  4TXQ A;  2ILR A;  3SZE A;  1NI1 A;  3MCX A;  4IYP A;  1LF8 A;  2RD0 A;  3KSQ A;  5CHE E;  4E6H A;  4CYM D;  2P9U G;  4YEL A;  2VSN A;  4BEP A;  3B8Y A;  1ZU2 A;  5M72 A;  2YQ8 A;  5FT9 A;  3CST A;  3P4G A;  3RO2 A;  2KBX A;  2EIM E;  2YHC A;  4B93 B;  1HO8 A;  1V55 E;  4C2L A;  4L9P A;  1OT8 A;  4O6F A;  2XRY A;  5ARG A;  4CT4 A;  3HXD A;  3QWV A;  1IYG A;  2YIN A;  3SBT B;  4AV7 A;  3S7F A;  5JMC B;  3CVQ A;  2GRR B;  3UI2 A;  2MYO A;  3LYC A;  5JJT A;  3CKB A;  4H7X A;  2IQC A;  4ANW A;  2NZM A;  3DSW A;  3U3W A;  2PM6 A;  4YDE A;  1HH8 A;  2YNQ A;  1CLW A;  4MR0 A;  4NK8 A;  5JMN D;  5LCW J;  2F8Y A;  3IKO B;  4WAF A;  3RSE G;  5AAO A;  3UM3 A;  5DNS A;  1O8E A;  2G0Y A;  1SZA A;  1G3N B;  3R7R A;  5FZS A;  3PDN A;  1QYM A;  3EHN A;  4I9E A;  4A63 B;  3MKR A;  3BUA A;  1PY1 A;  3FTW A;  4HLE A;  4Q69 A;  3D9O A;  2A4Z A;  3NOG D;  1VBL A;  1D9S A;  3PZ1 A;  3E34 A;  4I2Z A;  5LOZ A;  2XEH A;  3FUD A;  3T9K A;  2WPV A;  3BH7 B;  2FBN A;  4KMO A;  1AIR A;  4XKW A;  2P9I G;  3CHM A;  4CGV A;  4RG6 A;  1TNU A; 
#chains in the Genus database with same CATH homology
 3NB2 A;  4YCQ A;  2QZA A;  3NAW A;  2XTX A;  4YC5 A;  4YFO A;  4YDT A;  2O6W A;  3PSZ A;  5DNS A;  2QYU A;  2XTY A;  3SQV A;  2XT2 A;  3PSS A;  2J8K A;  3DU1 X;  3SY2 A;  2XTW A;  4YEI A;  2XT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...