3NB2A

Crystal structure of e. coli o157:h7 effector protein nlel
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
612
structure length
612
Chain Sequence
QGRACLSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGRNNVFTCTAVLTDMLTEHAKESFPEIFSLYYPVAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords secreted effector protein
publication title Biochemical and Structural Studies of a HECT-like Ubiquitin Ligase from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 222
structure length 612
sequence length 612
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3nb2A04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3nb2A02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3nb2A01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3nb2A03
4YDTA 2XT2A 2XTXA 3DU1X 4YC5A 2J8KA 4YFOA 3PSZA 3SY2A 2XTWA 3NB2A 3PSSA 4YEIA 2QYUA 2O6WA 2XTYA 2QZAA 3SQVA 2XT4A 4YCQA 3NAWA 5DNSA
chains in the Genus database with same CATH superfamily
3AG2E 3APDA 2NT9A 4EW9A 5CERB 2AJAA 4G8LA 3V2OA 1OCRE 2QC9A 2X6IA 3WWGA 3FUKA 1FVHA 5CHEE 2F3LA 3B7RL 3UKRG 4UWGA 2LXMA 2V5IA 4FJYA 1JCRA 1O1RA 4XMYA 4U8YD 2BM4A 3CR3A 3HG0D 4LNUD 3EQNA 4R7LA 5KNGA 3NB2A 3FU5A 4XE0A 4D10C 2VQ2A 2A4ZA 1HXIA 2P9UG 4GTMA 2J49A 5AYWD 3PZ3A 1O8EA 2ZU6B 3ULYA 3IBEA 1IHGA 2EIME 2AWIA 3UT7A 3CVVA 3QK0A 2OVFA 3UQ3A 2O0VA 4HRLA 3SZEA 3MX3A 4CT0A 2ZISA 5EIDA 1DBGA 4JW1A 5EX0A 1U2VG 3ZUVB 2BM5A 3GQ9A 3PUKA 2X38A 4HLEA 4AXHA 4XORA 2IJGX 1S70B 3D9PA 2UY1A 4ACKA 3S7JA 3TWUA 2BEDA 2OOEA 1HS6A 4XKVA 3I3NA 1OUVA 2XPZA 2PYHA 3ML9A 4BTBA 1OXJA 2INUA 4CYMD 1SVXA 3S2AA 3TWTA 3NQPA 1TNOA 2P58C 2ETBA 2PQRA 1O5MA 3UTMA 3OXFA 4A55A 2IOUG 2XPYA 3EUVA 3NAWA 4KZ0A 2BF0X 5JHAA 2WQ6A 1OFMA 3DSXA 4RLYA 3LY8A 2VGEA 2P9LG 4YFOA 1EA0A 3E34A 3U66A 2Z8GA 3W9FA 4OVUA 1IQRA 3JYSA 3LMWA 3HXEA 4KT6B 4C2LA 4N2SA 2C0MA 4JPSA 2MYOA 3SD5A 1DBOA 3AU5A 3B7UX 2CHXA 2VSYA 1OFLA 2BUGA 3PVLA 4OAUC 5BT1A 2J9QA 3HIZA 1XGWA 2PQNA 3SY2A 3PREA 4V3IA 3S7BA 3L16A 1IDJA 1TYVA 3MEKA 4YEJA 5CMYA 2KM4A 4HBDA 5J08A 4L9PA 1W3BA 2B6CA 4N3AA 4WUYA 4W8TA 2NC9A 3KEAA 3IHYA 4B89A 1VBLA 1N0QA 3Q9UC 1TYXA 1RZ4A 4GPKA 2I9CA 2I1KA 5A23A 3T5XA 4QFVA 2X3MA 1AWCB 1MYOA 3LVQE 4GCNA 4LRZA 2WPVA 3UM1A 4G2VA 3FULA 2WXNA 3ML8A 1MX2A 2X6HA 4A3VA 2AXVA 4XLAA 3FUFA 3PS6A 5JJTA 1H2VC 2IQ7A 2J8SD 3QARA 4GMLA 1FT2A 2PNNA 2WMOA 2RKKA 3B7TA 3SNXA 2KATA 3L9TA 4J8YA 3SHFA 2LSVA 3ULEG 3ZGQA 4YVOA 5B1AE 3PEUB 3EU5A 2CG2A 4UWLA 3IEGA 2RFAA 1PC2A 3FUEA 4J7WA 3CHPA 1O8KA 4NURA 3JCKC 3DSVA 3D9NA 1Z5SC 2ONDA 2BKKB 1PE9A 1G3NB 2F8YA 3BG0B 3CHOA 3AS5A 4XL9A 3CVXA 2P9PG 4U7EB 1E90A 3V31A 3B13A 3TG5A 3PUJA 1ZB1A 4GZ5A 1CZFA 3ZPPA 1UG3A 4IRUA 2I2OA 2IY0C 5CEDB 2QYUA 2L6JA 3ZYMA 3CHSA 3CK9A 4FHKA 3CVLA 4UWKA 2XEHA 4I2ZA 2NTBA 4YDTA 2OEVA 3L17A 2O1DA 3VTYA 4UWFA 1EE6A 4XLFA 4HOTA 4YELA 4L2YA 4V02C 3UM0A 1K3ZD 1X81A 2XZTG 5CCLA 1QYMA 1TN6A 4JHRA 3ZRHA 4CRWA 3Q75A 3DSWA 2PZIA 4CT4A 3SGHA 2VSXE 4LNBA 4W9RA 3ASNE 1RMGA 3SI5A 2DYRE 5B1BE 2R59A 4AV7A 2LXLA 1AIRA 3LS8A 2YUHA 3PZ1A 4XLCA 1PLUA 2WM9A 4DX5D 2ZGGA 3OXGA 4FLBA 3ASGA 3TG4A 4I84A 2P9SG 5D0OD 5KJLA 3APFA 5FQ7A 2OVBA 4AVZA 2F8XK 1IYGA 2EWEA 3NOGD 2FO7A 5T3RA 2WMNA 2Q7FA 2R05A 3ZN3A 3PDNA 3E32A 1UOHA 1DC2A 3MKRA 2FULA 3UUXA 3UXGA 3ASFA 3BUAA 5A7DB 1U3CA 1CLWA 4UWHA 3CIAA 4PS8A 4PS7A 3MKQB 3FY3A 1NA0A 3LKUA 3NOCD 3ZIMA 3I5PA 4DX1A 3FU3A 5JMND 2NSTA 2J09A 3FEXA 1TJFA 4YDOA 5JLVC 3D9JA 2INVA 3ZYLA 1SQMA 4HNAD 1XG2A 4L7TA 3AJIA 3L22A 2VFMA 4GMRA 1HFAA 2X3HA 4YZAA 3T8MA 2XGOA 2BKGA 2J8IA 2VFQA 3TH0A 4K5BA 1HU3A 1KZPA 3X2QE 3C3OA 3GRHA 4ATZD 4F1SA 4ILGA 2DBAA 2XRZA 3ASDA 2KXPC 3FFLA 4I6EA 2P2CP 3FTVA 2J4BA 5KJNA 2QY1A 3QWPA 4GTRA 2QX3A 1O8MA 5G2NA 3FUHA 4GTVA 3B7SA 3K9IA 3S7DA 4I9CA 1YYHA 5CBOA 4XI9A 1K1BA 3B8YA 3KAEA 4WAFA 3FUMA 4DI3A 1OOCA 4XQFA 2VFOA 3CK8A 2WXIA 3CVUA 5CMWA 2Y1LE 2PYGA 3ISMC 3HXCA 2KCVA 4OPWA 3ML3A 2XHEA 4HOQA 5D0QD 2Y0BG 5G04J 4BERA 1NP7A 3PSZA 1UN8A 4Z03A 4I2WA 1E7UA 3PETA 3SZ7A 4W8RA 2WXKA 5ENPD 4APOA 3Q73A 5AJDA 2NZMA 2KZTB 5D2MC 2GRMA 1H19A 1BI7B 1QRBA 4ME2A 4G24A 3T8KA 5ANLA 4N3CA 2X6XA 4GPMA 3OAWA 3R7QA 4GTOA 3TGOA 2VYIA 3CK7A 4AVXA 4OJOA 3CVQA 1KZOA 4GYOA 4XN3A 3MKQA 1HG8A 5LFAA 1KTWA 2P9NG 4UQXA 3LCAA 3B4NA 4XLEA 2H6FA 5KWDA 4AP2A 1BN8A 1SA4A 5DBKA 2ETCA 3L82A 3Q4AB 4YNDA 1QBQA 4EBAA 4N39A 3ZXSA 4BSZB 1HF2A 3Q47B 3LY7A 4C9BB 5EN5D 3MA5A 2VBMA 2P9KG 2F37A 2QXZA 5CCMA 4IULA 3UKUG 4O1PA 4K5CA 4GA1A 1DABA 1QQEA 1K1AA 1Q2ZA 4KVMA 4E85A 3ULQA 1SA5A 2GW1A 5LCWC 4Q96A 3HVEB 4LEUA 3U3WA 1PY1A 2XT2A 4XN0A 2P9IG 3P1UA 4YDEA 1KT0A 1E8WA 3UINC 1FVFA 3CGHA 1K4ZA 4U8HA 5ARGA 3BU8A 1OFEA 1BLXB 4A63B 1TNUA 1EPUA 1N11A 2QFCA 4YZXA 1LLZA 1KPSB 4U07A 2J08A 1E8YA 2XTYA 3RAUA 1WXRA 2VGYA 5CRVA 4KBQA 2CHWA 3MGBA 2VBEA 5AIJA 4JD2G 2XGMA 5ENSD 2WXFA 3VLDA 4EZJA 5DIZA 2Y4UA 5E76A 3CKBA 4XLHA 2Y69E 1TN8A 4OJLA 3MYVA 2KCLA 3LJNA 2Y3AA 3AS8A 2WXOA 2XGSA 3T9KA 3Q78A 4XOTA 2WXQA 2QY7A 2VTBB 1UW4B 4F6RD 2DZNA 2XC1A 2O0WA 1OT8A 4I1MA 3EHMA 2ILRA 2WQ7A 1SZAA 4KVOA 4Q94A 1LM1A 5BV0A 4AOFA 2IONA 4J8EA 3KSLA 1HG2A 3ASHA 1MHQA 4HORA 3KRGA 5LCWJ 1H2TC 4I1AA 1E7VA 5BUZA 2RFMA 5AENA 4Z05A 4A1SA 4TXQA 2WXRA 3I4RB 5KJKA 1UJJA 4L23A 3QWWA 3UPVA 4ILHB 3SYJA 1VDYA 3APCA 2OEWA 2H6GA 1TNYA 3LYAA 3UM2A 1ELKA 4WNDA 4HB5A 4DLOA 4G26A 4NIKA 1OCCE 1EDUA 3DU1X 1LTXA 3VSVA 1PXZA 2EQXA 4JEHA 2IEJA 5AQBA 3TXNA 2EIJE 3F6QA 2B0OE 1UJKA 5J90A 5FQ6A 2AXZA 2YINA 2WXJA 1X0CA 4WWNA 2LAHA 4HOSA 5ENOD 2NT6A 4I43A 1O8DA 4UI9K 1U3DA 2G0YA 2IOSA 2IO3C 3PZ2A 4XOPA 2XQ0A 1HE8A 1QA2A 3VLEA 3TWWA 4URRA 4WNGA 1O8IA 5HI7A 4C0EA 1YA0A 1FT1A 3ZFWA 3U64A 3U9WA 4ZFHA 1MQSA 1NZNA 3D9MA 2RD0A 4OAVB 5AMVA 3RO3A 2UVFA 1N54A 1ZU2A 4JRAC 1K5CA 2CFZA 1OFDA 3KS2A 1KCDA 1INZA 5ENTD 3CSFA 4XKCA 3DSUA 3JUIA 1MX4A 4AJWA 2VTBA 1RWRA 1HO8A 1OWMA 3QNKA 1N0RA 4ANUA 4J6IA 5BXOA 3PE4A 3B95A 3QB2A 4RG9A 1YMPA 3Q7FA 4E6HA 1KQ5A 1TEZA 4M3OA 1OY3D 3FUNA 4K5AB 1IB4A 4CDNA 3HRAA 4GYYA 1GW6A 4J0UA 3P4GA 5H7PA 4DK5A 1PAQA 1O88A 2WXPA 2QZAA 3CVPA 4PMHA 2NSPA 1NI1A 1K8FA 2JEKA 5BPPA 3LVRE 4LUNU 1MX6A 3SBTB 1N4PA 3RRMB 4MBGA 2A5UA 1TNBA 4CZ2D 3FH8A 3Q9NC 1OCOE 1Y6IA 3NBNB 3L13A 3JURA 1EZGA 1Z3YA 4Y6CA 2FO1E 2MHKA 3DEOA 2LSUA 4GZDA 3FUDA 1V55E 2WQHA 3DPYA 1EF1C 4F53A 1WG0A 2V0PA 1OGOX 4APFA 4PS3A 5BW8C 3EHQA 5BXUA 2EINE 2OCCE 1NHCA 3VSUA 4NACA 4EZLA 5LX8A 3EHNA 1OWNA 4TV3A 1S63A 2VSOE 2ZGDA 3D3MA 3LDZA 3BH6B 1NFIE 4UQZA 1O8HA 5ARFA 3TXMA 1HX8A 3AU4A 4HI9A 1QA1A 1BPOA 4N5QA 4U49A 3FY4A 3D9KA 4GB9A 3GW4A 4WNEA 1Z6TA 4XKBA 1O8LA 2LNIA 5JJ6A 4AIFA 1WY6A 1WMRA 1H6PA 4CEMA 3GZ2A 3R9MA 1IQUA 4DI4A 4KZCA 3PEVB 4G25A 2BM6A 3HXDA 3TJPA 2XEVA 5FZRA 3FTUA 3C98A 2Y4TA 3MJWA 3ZYQA 4EZKA 3CQCB 4EHMA 5KCMA 5G04C 4YC5A 4FULA 2V5QC 2IOLA 4XIFA 3NZSA 2H6HA 2EILE 4Y6WA 4OJ5A 3WXXA 3GYZA 5AJLA 3O4ZA 2B0RA 3MV2B 4OJPA 2NSZA 2KCKA 3ZKJA 1IKND 3C5RA 1N4QA 4JXTA 3SBSA 2GRQB 3VLFA 3V2XA 1NL4A 4JHJA 4GTSA 1QNFA 4ANWA 3G2SA 3FP3A 4PUCA 4TRQA 4UQYA 5KJMA 3TWQA 3T9GA 5FZSA 4XX5A 1SW6A 1WAO1 4I9EA 2E0IA 1JCSA 5T4YA 3CEQA 4UI9J 4GZ6A 2C2LA 2J4DA 4ANXA 4B93B 2KC7A 4GYWA 5G05J 4BESA 1N4RA 1QZ2A 4I1OB 4KH3A 3FUJA 3D9IA 1S64A 1O8GA 5E75A 4OZZA 3VTXA 2XEEA 3DRAA 1N94A 3Q5MA 3QDNA 2V4HC 1HZ4A 2L0IA 2IU1A 4A1GA 3UX4A 1IA5A 4BY6A 1IDKA 3H09A 3P2BA 5FZQA 5EKQD 3ABME 1XNFA 2MOWA 3CHRA 4B8AA 4N3BA 1OCZE 4BX9A 4TXRA 3UW0A 3HHMA 4HFGA 2XRYA 3AAAC 3L08A 5ITZF 4O60A 3RK6A 4L2LA 3U4TA 1QJVA 4JHKA 5FINA 2GRRB 2XTWA 2C0LA 3BEEA 3HXBA 4XR6A 1FCHA 3TAXA 1O8FA 4CCAA 3G2UA 1LD7A 3B7BA 5ANRA 3C72A 1DCQA 2CFUA 4ILIA 5C2YA 2R2LA 4U0SA 1OWOA 4Q69A 1KLXA 2W7ZA 2XCCA 4CDMA 1FPPA 3GQ8A 5HRYA 3L6AA 3TWXA 4MR0A 3ZHEB 4YVQC 4RVBA 3JXIA 4F7AA 3CSTA 1OWPA 3BG1B 1H6KA 3N90A 2A5EA 5FQ8A 3RU0A 5CEAA 5LP0A 2H6IA 1GQ8A 3I4GA 5EDSA 2QYJA 3QJZA 2HE0A 4FU3A 5C1CA 2O17A 3ZU7B 4B8CB 3ASOE 3PZDA 2ODLA 1HH8A 3VSTA 4G23A 1JWFA 4K03A 5T8IA 5EYLA 4GU5A 4WWOA 5FQ4A 2FF4A 3D9OA 4AY6A 5AN8A 2L9BA 3DWLG 3VMWA 2X6JA 2GRPB 3PE3A 3V30A 4YZ0A 3ZVVA 2HO1A 2L6BA 4TUMA 3DSSA 4F1PA 2AVPA 2JLBA 1DNPA 4I6JA 3PNLB 2I1JA 2GRLA 4IYPA 3UIPC 2VFPA 2AXUA 2HR2A 3TWRA 1JTAA 2YQ8A 4H7YA 4GTPA 2GROB 3FTXA 4BEPA 3CKCA 4DJAA 3ZEFA 4N5CA 4EQFA 3FU0A 1IXVA 4J8FA 4WWPA 4U95D 4A3TA 2PM6A 2RG8A 3DBSA 5FTPA 3EDTB 3V79K 1AP7A 1N95A 5EYPF 4B94A 4C0MA 3IHVA 4GMJA 4LCTA 1TYQG 5JA4D 4HWVA 3UI2A 1A17A 1TYWA 2KZTA 4GZCA 4OJ6A 4F3VA 2E2EA 3J5QB 2R17C 2EIKE 3LYCA 4FJZA 4OM9A 3MCXA 4MXNA 2WXHA 2DCPA 2XT4A 4MRUA 3TL5A 5D66A 4YCQA 3AG1E 1JCQA 3LY9A 3EHRA 3LJYA 4YDYA 3AG4E 2V5FA 4OZYA 4EECA 3FUIA 3W9GA 4KYOB 1LF8A 4KXKB 4XM3A 3FTSA 1JUQA 4HXIA 4BETA 1TNZA 2BX6A 2FI7A 3RIBA 3EJNA 3D9LA 3ZHEA 2J07A 1TJCA 4X8QA 5HQ8A 3CLJA 4LNGA 2BSPA 5EX3A 1LD8A 3UT8A 2CG3A 3N71A 3L54A 2LUHA 5ENRD 3CHQA 1A5EA 2HM8A 5AARA 2O04A 1D9SA 4BWRA 4N2QA 3HYMB 3PZ4A 3HVEA 4GTQA 5B3SE 2WXMA 3CVYA 2UWJG 3PSSA 3E37A 4ABNA 3MZLB 3ESKA 2LAIA 4MKTA 1BD8A 3KEZA 4HVBA 4LSZE 4BT9A 1H6OA 2XS1A 1O1SA 3RIQA 3C3RA 2F0YA 3SFXA 4AM9A 1X5BA 3DXMG 4L1BA 3DPDA 1DCEA 3D9HA 3KD7A 4XEIG 5FT9A 4GA0A 1E8ZA 1Z3XA 2YNQA 4B0ZA 3FTZA 5LOZA 3ZYKA 2CHZA 2X6YA 4U0ZA 2BTDA 3ESLA 4FP7A 5KNHD 4W8QA 2VSNA 2M63A 2DVWA 3EIQC 3IV0A 4GZ3A 4URKA 1MJ0A 2NXPA 5G55A 5AQ9A 3DEPA 2PECA 2MRIA 1N52A 3B90A 4XONA 1IHBA 2NYJA 3LEWA 3FU6A 4LERA 3FTYA 3FWVA 3ZPJA 3QOUA 3URZA 2XPIA 4UUCA 4XKWA 2DWZA 3Q7AA 1QQ1A 3J5PA 3RKVA 2FEZA 1JWGA 3QC1A 1BU9A 2PM7A 2VFNA 4AEZC 3GZ1A 4ZHBA 2GRNB 4XZ4A 5FIOA 5CBNA 2IO2C 3E30A 2BM7A 3G2TA 1RU4A 3LXUX 2HYZA 5EILA 3CVNA 5CECB 1N4SA 2XZDG 4NRHB 1TSPA 1Y8MA 3ABLE 2ZIRA 4BT8A 4JA7A 3SUCA 3C3QA 3TWSA 4J8SA 4XNFA 3BQOA 3VMVA 3BH7B 2YHEA 4ATGA 1ZBPA 2DIWA 1MZCA 2JABA 5ENNA 5JHBA 3AG3E 4OVVA 2VJIA 5CRUA 3SFYA 3OTNA 2I6HA 5FJYA 3MV3B 4HRMB 4HOUA 2VBKA 3JXJA 4U0UA 3ENEA 3S7FA 4G8KA 3GQAA 2R02A 1TR4A 3KSQA 1SZ9A 1O1TA 4UI9C 4FC8A 2UVEA 4BTAA 3ZW3A 4GCOA 1JPLA 5BV1A 5G05C 1QA3A 4HQDA 4U4BA 3SO8A 3Q49B 2IFUA 3E4BA 4EBAG 2LO6A 5M72A 2XCBA 5KBAA 3IXEA 4RSYA 3UT4A 4DUIA 3GQ7A 4DX2A 1LLWA 5HS0A 5EIBE 4M7CA 1ELWA 2X6KA 2OV8A 3ZXPA 1OWLA 2VGXB 1K8KG 4EPZA 3R7RA 3PH0C 4P29A 3NF1A 4NK8A 4ACLA 3RO2A 4HI8A 2IQCA 3EQOA 1HF8A 4BSXA 3EIJA 4GAAA 4OYSA 4HLLA 5BNWA 4I6GA 3SF4A 2WVIA 1N9AA 1L1IA 2YHCA 4U04A 3RRUA 4MS6A 3SQVA 3QKYA 1UN9A 4JEUA 4IN3B 2ETAA 3IKOB 5FWQA 4C48B 1B89A 3JQ1A 3QWVA 1KT1A 3GZSA 4U63A 4RQIA 4CGVA 1D8EA 3RJVA 4YZQA 4HS2A 4WNFA 2GGFA 5AQAA 3PNTB 4DX6D 4U96D 3JUEA 1KCCA 4TXPA 4DRXE 4NQ0A 2V8SE 4BX8A 2DYSE 4YDWA 3PRZA 5A6CA 4CDRA 3ONLA 4RG6A 2ZXWE 5ENQD 5AQ7A 3RSEG 3AK5A 4BFRA 2AW6A 4CGWA 1QCXA 1TN7A 3EU9A 3TWVA 4JC8A 1S0PA 3ABKE 2XTXA 1L5JA 3FEYA 3QAQA 2X85A 4G1TA 2R03A 1O8JA 1H2UA 4PDXA 3FH7A 2NTQA 3E33A 5IY5E 2IF4A 3G2WA 4G11A 2O6WA 4TUUA 2XS8A 2KBXA 3NZUA 3N6ZA 4JVSA 4DPRA 2L0TB 1H80A 1NA3A 3CVWA 4JB8P 3LPZA 2NTPA 1JRGA 3DSTA 4Z06A 4PH4B 5HKPA 1V54E 2VJ8A 4H7XA 4NK6A 3WG7E 4W8SA 4K0RA 4DX7D 2WXLA 3G2VA 1OGMX 3FHEA 2VJJA 3JQ0A 2WB2A 1YCSB 3R9AB 3ZNGA 2VGXA 2UY1B 2DZOA 5DNSA 3UMVA 2XENA 2X6WA 3JX8A 4MLPA 4O1OA 3CQGB 1EYHA 4FLHA 3HXFA 5C1DA 4DLQA 4FA6A 1BI8B 1WM5A 1HG5A 4FADA 1RW2A 1P5QA 2FBNA 3LJ3A 3ZSCA 4ANVA 2PL2A 4HRNA 3DXKG 1E8XA 3FH5A 4JZYA 3AS4A 3T5VA 4JL0A 3UIOC 3SFZA 1BHEA 5JMCB 1WDYA 4GTTA 1D8DA 4GA2A 4QQIA 4KMOA 4AY5A 4U8VD 1ELRA 2R5SA 4J8DA 3HDXA 1QRCA 3O48A 3RRNB 4I17A 3FTWA 5JJ7A 5C1EA 2V4LA 2X6FA 4O6FA 2J8KA 1H0AA 4FHJA 3Q15A 4XI0A 3OXLA 3CHMA 3UM3A 4YEIA 3FDHA 4LG6A 4Z68A 1E96B 4JA9A 3CV0A 1TYUA 3Q79A 1DVPA 3ONKA 2WXGA 5AAOA
chains in the Genus database with same CATH topology
4YDTA 2XT2A 2XTXA 3DU1X 4YC5A 2J8KA 4YFOA 3PSZA 3SY2A 2XTWA 3NB2A 3PSSA 4YEIA 2QYUA 2O6WA 2XTYA 2QZAA 3SQVA 2XT4A 4YCQA 3NAWA 5DNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YDT A;  2XT2 A;  2XTX A;  3DU1 X;  4YC5 A;  2J8K A;  4YFO A;  3PSZ A;  3SY2 A;  2XTW A;  3NB2 A;  3PSS A;  4YEI A;  2QYU A;  2O6W A;  2XTY A;  2QZA A;  3SQV A;  2XT4 A;  4YCQ A;  3NAW A;  5DNS A; 
#chains in the Genus database with same CATH topology
 3AG2 E;  3APD A;  2NT9 A;  4EW9 A;  5CER B;  2AJA A;  4G8L A;  3V2O A;  1OCR E;  2QC9 A;  2X6I A;  3WWG A;  3FUK A;  1FVH A;  5CHE E;  2F3L A;  3B7R L;  3UKR G;  4UWG A;  2LXM A;  2V5I A;  4FJY A;  1JCR A;  1O1R A;  4XMY A;  4U8Y D;  2BM4 A;  3CR3 A;  3HG0 D;  4LNU D;  3EQN A;  4R7L A;  5KNG A;  3NB2 A;  3FU5 A;  4XE0 A;  4D10 C;  2VQ2 A;  2A4Z A;  1HXI A;  2P9U G;  4GTM A;  2J49 A;  5AYW D;  3PZ3 A;  1O8E A;  2ZU6 B;  3ULY A;  3IBE A;  1IHG A;  2EIM E;  2AWI A;  3UT7 A;  3CVV A;  3QK0 A;  2OVF A;  3UQ3 A;  2O0V A;  4HRL A;  3SZE A;  3MX3 A;  4CT0 A;  2ZIS A;  5EID A;  1DBG A;  4JW1 A;  5EX0 A;  1U2V G;  3ZUV B;  2BM5 A;  3GQ9 A;  3PUK A;  2X38 A;  4HLE A;  4AXH A;  4XOR A;  2IJG X;  1S70 B;  3D9P A;  2UY1 A;  4ACK A;  3S7J A;  3TWU A;  2BED A;  2OOE A;  1HS6 A;  4XKV A;  3I3N A;  1OUV A;  2XPZ A;  2PYH A;  3ML9 A;  4BTB A;  1OXJ A;  2INU A;  4CYM D;  1SVX A;  3S2A A;  3TWT A;  3NQP A;  1TNO A;  2P58 C;  2ETB A;  2PQR A;  1O5M A;  3UTM A;  3OXF A;  4A55 A;  2IOU G;  2XPY A;  3EUV A;  3NAW A;  4KZ0 A;  2BF0 X;  5JHA A;  2WQ6 A;  1OFM A;  3DSX A;  4RLY A;  3LY8 A;  2VGE A;  2P9L G;  4YFO A;  1EA0 A;  3E34 A;  3U66 A;  2Z8G A;  3W9F A;  4OVU A;  1IQR A;  3JYS A;  3LMW A;  3HXE A;  4KT6 B;  4C2L A;  4N2S A;  2C0M A;  4JPS A;  2MYO A;  3SD5 A;  1DBO A;  3AU5 A;  3B7U X;  2CHX A;  2VSY A;  1OFL A;  2BUG A;  3PVL A;  4OAU C;  5BT1 A;  2J9Q A;  3HIZ A;  1XGW A;  2PQN A;  3SY2 A;  3PRE A;  4V3I A;  3S7B A;  3L16 A;  1IDJ A;  1TYV A;  3MEK A;  4YEJ A;  5CMY A;  2KM4 A;  4HBD A;  5J08 A;  4L9P A;  1W3B A;  2B6C A;  4N3A A;  4WUY A;  4W8T A;  2NC9 A;  3KEA A;  3IHY A;  4B89 A;  1VBL A;  1N0Q A;  3Q9U C;  1TYX A;  1RZ4 A;  4GPK A;  2I9C A;  2I1K A;  5A23 A;  3T5X A;  4QFV A;  2X3M A;  1AWC B;  1MYO A;  3LVQ E;  4GCN A;  4LRZ A;  2WPV A;  3UM1 A;  4G2V A;  3FUL A;  2WXN A;  3ML8 A;  1MX2 A;  2X6H A;  4A3V A;  2AXV A;  4XLA A;  3FUF A;  3PS6 A;  5JJT A;  1H2V C;  2IQ7 A;  2J8S D;  3QAR A;  4GML A;  1FT2 A;  2PNN A;  2WMO A;  2RKK A;  3B7T A;  3SNX A;  2KAT A;  3L9T A;  4J8Y A;  3SHF A;  2LSV A;  3ULE G;  3ZGQ A;  4YVO A;  5B1A E;  3PEU B;  3EU5 A;  2CG2 A;  4UWL A;  3IEG A;  2RFA A;  1PC2 A;  3FUE A;  4J7W A;  3CHP A;  1O8K A;  4NUR A;  3JCK C;  3DSV A;  3D9N A;  1Z5S C;  2OND A;  2BKK B;  1PE9 A;  1G3N B;  2F8Y A;  3BG0 B;  3CHO A;  3AS5 A;  4XL9 A;  3CVX A;  2P9P G;  4U7E B;  1E90 A;  3V31 A;  3B13 A;  3TG5 A;  3PUJ A;  1ZB1 A;  4GZ5 A;  1CZF A;  3ZPP A;  1UG3 A;  4IRU A;  2I2O A;  2IY0 C;  5CED B;  2QYU A;  2L6J A;  3ZYM A;  3CHS A;  3CK9 A;  4FHK A;  3CVL A;  4UWK A;  2XEH A;  4I2Z A;  2NTB A;  4YDT A;  2OEV A;  3L17 A;  2O1D A;  3VTY A;  4UWF A;  1EE6 A;  4XLF A;  4HOT A;  4YEL A;  4L2Y A;  4V02 C;  3UM0 A;  1K3Z D;  1X81 A;  2XZT G;  5CCL A;  1QYM A;  1TN6 A;  4JHR A;  3ZRH A;  4CRW A;  3Q75 A;  3DSW A;  2PZI A;  4CT4 A;  3SGH A;  2VSX E;  4LNB A;  4W9R A;  3ASN E;  1RMG A;  3SI5 A;  2DYR E;  5B1B E;  2R59 A;  4AV7 A;  2LXL A;  1AIR A;  3LS8 A;  2YUH A;  3PZ1 A;  4XLC A;  1PLU A;  2WM9 A;  4DX5 D;  2ZGG A;  3OXG A;  4FLB A;  3ASG A;  3TG4 A;  4I84 A;  2P9S G;  5D0O D;  5KJL A;  3APF A;  5FQ7 A;  2OVB A;  4AVZ A;  2F8X K;  1IYG A;  2EWE A;  3NOG D;  2FO7 A;  5T3R A;  2WMN A;  2Q7F A;  2R05 A;  3ZN3 A;  3PDN A;  3E32 A;  1UOH A;  1DC2 A;  3MKR A;  2FUL A;  3UUX A;  3UXG A;  3ASF A;  3BUA A;  5A7D B;  1U3C A;  1CLW A;  4UWH A;  3CIA A;  4PS8 A;  4PS7 A;  3MKQ B;  3FY3 A;  1NA0 A;  3LKU A;  3NOC D;  3ZIM A;  3I5P A;  4DX1 A;  3FU3 A;  5JMN D;  2NST A;  2J09 A;  3FEX A;  1TJF A;  4YDO A;  5JLV C;  3D9J A;  2INV A;  3ZYL A;  1SQM A;  4HNA D;  1XG2 A;  4L7T A;  3AJI A;  3L22 A;  2VFM A;  4GMR A;  1HFA A;  2X3H A;  4YZA A;  3T8M A;  2XGO A;  2BKG A;  2J8I A;  2VFQ A;  3TH0 A;  4K5B A;  1HU3 A;  1KZP A;  3X2Q E;  3C3O A;  3GRH A;  4ATZ D;  4F1S A;  4ILG A;  2DBA A;  2XRZ A;  3ASD A;  2KXP C;  3FFL A;  4I6E A;  2P2C P;  3FTV A;  2J4B A;  5KJN A;  2QY1 A;  3QWP A;  4GTR A;  2QX3 A;  1O8M A;  5G2N A;  3FUH A;  4GTV A;  3B7S A;  3K9I A;  3S7D A;  4I9C A;  1YYH A;  5CBO A;  4XI9 A;  1K1B A;  3B8Y A;  3KAE A;  4WAF A;  3FUM A;  4DI3 A;  1OOC A;  4XQF A;  2VFO A;  3CK8 A;  2WXI A;  3CVU A;  5CMW A;  2Y1L E;  2PYG A;  3ISM C;  3HXC A;  2KCV A;  4OPW A;  3ML3 A;  2XHE A;  4HOQ A;  5D0Q D;  2Y0B G;  5G04 J;  4BER A;  1NP7 A;  3PSZ A;  1UN8 A;  4Z03 A;  4I2W A;  1E7U A;  3PET A;  3SZ7 A;  4W8R A;  2WXK A;  5ENP D;  4APO A;  3Q73 A;  5AJD A;  2NZM A;  2KZT B;  5D2M C;  2GRM A;  1H19 A;  1BI7 B;  1QRB A;  4ME2 A;  4G24 A;  3T8K A;  5ANL A;  4N3C A;  2X6X A;  4GPM A;  3OAW A;  3R7Q A;  4GTO A;  3TGO A;  2VYI A;  3CK7 A;  4AVX A;  4OJO A;  3CVQ A;  1KZO A;  4GYO A;  4XN3 A;  3MKQ A;  1HG8 A;  5LFA A;  1KTW A;  2P9N G;  4UQX A;  3LCA A;  3B4N A;  4XLE A;  2H6F A;  5KWD A;  4AP2 A;  1BN8 A;  1SA4 A;  5DBK A;  2ETC A;  3L82 A;  3Q4A B;  4YND A;  1QBQ A;  4EBA A;  4N39 A;  3ZXS A;  4BSZ B;  1HF2 A;  3Q47 B;  3LY7 A;  4C9B B;  5EN5 D;  3MA5 A;  2VBM A;  2P9K G;  2F37 A;  2QXZ A;  5CCM A;  4IUL A;  3UKU G;  4O1P A;  4K5C A;  4GA1 A;  1DAB A;  1QQE A;  1K1A A;  1Q2Z A;  4KVM A;  4E85 A;  3ULQ A;  1SA5 A;  2GW1 A;  5LCW C;  4Q96 A;  3HVE B;  4LEU A;  3U3W A;  1PY1 A;  2XT2 A;  4XN0 A;  2P9I G;  3P1U A;  4YDE A;  1KT0 A;  1E8W A;  3UIN C;  1FVF A;  3CGH A;  1K4Z A;  4U8H A;  5ARG A;  3BU8 A;  1OFE A;  1BLX B;  4A63 B;  1TNU A;  1EPU A;  1N11 A;  2QFC A;  4YZX A;  1LLZ A;  1KPS B;  4U07 A;  2J08 A;  1E8Y A;  2XTY A;  3RAU A;  1WXR A;  2VGY A;  5CRV A;  4KBQ A;  2CHW A;  3MGB A;  2VBE A;  5AIJ A;  4JD2 G;  2XGM A;  5ENS D;  2WXF A;  3VLD A;  4EZJ A;  5DIZ A;  2Y4U A;  5E76 A;  3CKB A;  4XLH A;  2Y69 E;  1TN8 A;  4OJL A;  3MYV A;  2KCL A;  3LJN A;  2Y3A A;  3AS8 A;  2WXO A;  2XGS A;  3T9K A;  3Q78 A;  4XOT A;  2WXQ A;  2QY7 A;  2VTB B;  1UW4 B;  4F6R D;  2DZN A;  2XC1 A;  2O0W A;  1OT8 A;  4I1M A;  3EHM A;  2ILR A;  2WQ7 A;  1SZA A;  4KVO A;  4Q94 A;  1LM1 A;  5BV0 A;  4AOF A;  2ION A;  4J8E A;  3KSL A;  1HG2 A;  3ASH A;  1MHQ A;  4HOR A;  3KRG A;  5LCW J;  1H2T C;  4I1A A;  1E7V A;  5BUZ A;  2RFM A;  5AEN A;  4Z05 A;  4A1S A;  4TXQ A;  2WXR A;  3I4R B;  5KJK A;  1UJJ A;  4L23 A;  3QWW A;  3UPV A;  4ILH B;  3SYJ A;  1VDY A;  3APC A;  2OEW A;  2H6G A;  1TNY A;  3LYA A;  3UM2 A;  1ELK A;  4WND A;  4HB5 A;  4DLO A;  4G26 A;  4NIK A;  1OCC E;  1EDU A;  3DU1 X;  1LTX A;  3VSV A;  1PXZ A;  2EQX A;  4JEH A;  2IEJ A;  5AQB A;  3TXN A;  2EIJ E;  3F6Q A;  2B0O E;  1UJK A;  5J90 A;  5FQ6 A;  2AXZ A;  2YIN A;  2WXJ A;  1X0C A;  4WWN A;  2LAH A;  4HOS A;  5ENO D;  2NT6 A;  4I43 A;  1O8D A;  4UI9 K;  1U3D A;  2G0Y A;  2IOS A;  2IO3 C;  3PZ2 A;  4XOP A;  2XQ0 A;  1HE8 A;  1QA2 A;  3VLE A;  3TWW A;  4URR A;  4WNG A;  1O8I A;  5HI7 A;  4C0E A;  1YA0 A;  1FT1 A;  3ZFW A;  3U64 A;  3U9W A;  4ZFH A;  1MQS A;  1NZN A;  3D9M A;  2RD0 A;  4OAV B;  5AMV A;  3RO3 A;  2UVF A;  1N54 A;  1ZU2 A;  4JRA C;  1K5C A;  2CFZ A;  1OFD A;  3KS2 A;  1KCD A;  1INZ A;  5ENT D;  3CSF A;  4XKC A;  3DSU A;  3JUI A;  1MX4 A;  4AJW A;  2VTB A;  1RWR A;  1HO8 A;  1OWM A;  3QNK A;  1N0R A;  4ANU A;  4J6I A;  5BXO A;  3PE4 A;  3B95 A;  3QB2 A;  4RG9 A;  1YMP A;  3Q7F A;  4E6H A;  1KQ5 A;  1TEZ A;  4M3O A;  1OY3 D;  3FUN A;  4K5A B;  1IB4 A;  4CDN A;  3HRA A;  4GYY A;  1GW6 A;  4J0U A;  3P4G A;  5H7P A;  4DK5 A;  1PAQ A;  1O88 A;  2WXP A;  2QZA A;  3CVP A;  4PMH A;  2NSP A;  1NI1 A;  1K8F A;  2JEK A;  5BPP A;  3LVR E;  4LUN U;  1MX6 A;  3SBT B;  1N4P A;  3RRM B;  4MBG A;  2A5U A;  1TNB A;  4CZ2 D;  3FH8 A;  3Q9N C;  1OCO E;  1Y6I A;  3NBN B;  3L13 A;  3JUR A;  1EZG A;  1Z3Y A;  4Y6C A;  2FO1 E;  2MHK A;  3DEO A;  2LSU A;  4GZD A;  3FUD A;  1V55 E;  2WQH A;  3DPY A;  1EF1 C;  4F53 A;  1WG0 A;  2V0P A;  1OGO X;  4APF A;  4PS3 A;  5BW8 C;  3EHQ A;  5BXU A;  2EIN E;  2OCC E;  1NHC A;  3VSU A;  4NAC A;  4EZL A;  5LX8 A;  3EHN A;  1OWN A;  4TV3 A;  1S63 A;  2VSO E;  2ZGD A;  3D3M A;  3LDZ A;  3BH6 B;  1NFI E;  4UQZ A;  1O8H A;  5ARF A;  3TXM A;  1HX8 A;  3AU4 A;  4HI9 A;  1QA1 A;  1BPO A;  4N5Q A;  4U49 A;  3FY4 A;  3D9K A;  4GB9 A;  3GW4 A;  4WNE A;  1Z6T A;  4XKB A;  1O8L A;  2LNI A;  5JJ6 A;  4AIF A;  1WY6 A;  1WMR A;  1H6P A;  4CEM A;  3GZ2 A;  3R9M A;  1IQU A;  4DI4 A;  4KZC A;  3PEV B;  4G25 A;  2BM6 A;  3HXD A;  3TJP A;  2XEV A;  5FZR A;  3FTU A;  3C98 A;  2Y4T A;  3MJW A;  3ZYQ A;  4EZK A;  3CQC B;  4EHM A;  5KCM A;  5G04 C;  4YC5 A;  4FUL A;  2V5Q C;  2IOL A;  4XIF A;  3NZS A;  2H6H A;  2EIL E;  4Y6W A;  4OJ5 A;  3WXX A;  3GYZ A;  5AJL A;  3O4Z A;  2B0R A;  3MV2 B;  4OJP A;  2NSZ A;  2KCK A;  3ZKJ A;  1IKN D;  3C5R A;  1N4Q A;  4JXT A;  3SBS A;  2GRQ B;  3VLF A;  3V2X A;  1NL4 A;  4JHJ A;  4GTS A;  1QNF A;  4ANW A;  3G2S A;  3FP3 A;  4PUC A;  4TRQ A;  4UQY A;  5KJM A;  3TWQ A;  3T9G A;  5FZS A;  4XX5 A;  1SW6 A;  1WAO 1;  4I9E A;  2E0I A;  1JCS A;  5T4Y A;  3CEQ A;  4UI9 J;  4GZ6 A;  2C2L A;  2J4D A;  4ANX A;  4B93 B;  2KC7 A;  4GYW A;  5G05 J;  4BES A;  1N4R A;  1QZ2 A;  4I1O B;  4KH3 A;  3FUJ A;  3D9I A;  1S64 A;  1O8G A;  5E75 A;  4OZZ A;  3VTX A;  2XEE A;  3DRA A;  1N94 A;  3Q5M A;  3QDN A;  2V4H C;  1HZ4 A;  2L0I A;  2IU1 A;  4A1G A;  3UX4 A;  1IA5 A;  4BY6 A;  1IDK A;  3H09 A;  3P2B A;  5FZQ A;  5EKQ D;  3ABM E;  1XNF A;  2MOW A;  3CHR A;  4B8A A;  4N3B A;  1OCZ E;  4BX9 A;  4TXR A;  3UW0 A;  3HHM A;  4HFG A;  2XRY A;  3AAA C;  3L08 A;  5ITZ F;  4O60 A;  3RK6 A;  4L2L A;  3U4T A;  1QJV A;  4JHK A;  5FIN A;  2GRR B;  2XTW A;  2C0L A;  3BEE A;  3HXB A;  4XR6 A;  1FCH A;  3TAX A;  1O8F A;  4CCA A;  3G2U A;  1LD7 A;  3B7B A;  5ANR A;  3C72 A;  1DCQ A;  2CFU A;  4ILI A;  5C2Y A;  2R2L A;  4U0S A;  1OWO A;  4Q69 A;  1KLX A;  2W7Z A;  2XCC A;  4CDM A;  1FPP A;  3GQ8 A;  5HRY A;  3L6A A;  3TWX A;  4MR0 A;  3ZHE B;  4YVQ C;  4RVB A;  3JXI A;  4F7A A;  3CST A;  1OWP A;  3BG1 B;  1H6K A;  3N90 A;  2A5E A;  5FQ8 A;  3RU0 A;  5CEA A;  5LP0 A;  2H6I A;  1GQ8 A;  3I4G A;  5EDS A;  2QYJ A;  3QJZ A;  2HE0 A;  4FU3 A;  5C1C A;  2O17 A;  3ZU7 B;  4B8C B;  3ASO E;  3PZD A;  2ODL A;  1HH8 A;  3VST A;  4G23 A;  1JWF A;  4K03 A;  5T8I A;  5EYL A;  4GU5 A;  4WWO A;  5FQ4 A;  2FF4 A;  3D9O A;  4AY6 A;  5AN8 A;  2L9B A;  3DWL G;  3VMW A;  2X6J A;  2GRP B;  3PE3 A;  3V30 A;  4YZ0 A;  3ZVV A;  2HO1 A;  2L6B A;  4TUM A;  3DSS A;  4F1P A;  2AVP A;  2JLB A;  1DNP A;  4I6J A;  3PNL B;  2I1J A;  2GRL A;  4IYP A;  3UIP C;  2VFP A;  2AXU A;  2HR2 A;  3TWR A;  1JTA A;  2YQ8 A;  4H7Y A;  4GTP A;  2GRO B;  3FTX A;  4BEP A;  3CKC A;  4DJA A;  3ZEF A;  4N5C A;  4EQF A;  3FU0 A;  1IXV A;  4J8F A;  4WWP A;  4U95 D;  4A3T A;  2PM6 A;  2RG8 A;  3DBS A;  5FTP A;  3EDT B;  3V79 K;  1AP7 A;  1N95 A;  5EYP F;  4B94 A;  4C0M A;  3IHV A;  4GMJ A;  4LCT A;  1TYQ G;  5JA4 D;  4HWV A;  3UI2 A;  1A17 A;  1TYW A;  2KZT A;  4GZC A;  4OJ6 A;  4F3V A;  2E2E A;  3J5Q B;  2R17 C;  2EIK E;  3LYC A;  4FJZ A;  4OM9 A;  3MCX A;  4MXN A;  2WXH A;  2DCP A;  2XT4 A;  4MRU A;  3TL5 A;  5D66 A;  4YCQ A;  3AG1 E;  1JCQ A;  3LY9 A;  3EHR A;  3LJY A;  4YDY A;  3AG4 E;  2V5F A;  4OZY A;  4EEC A;  3FUI A;  3W9G A;  4KYO B;  1LF8 A;  4KXK B;  4XM3 A;  3FTS A;  1JUQ A;  4HXI A;  4BET A;  1TNZ A;  2BX6 A;  2FI7 A;  3RIB A;  3EJN A;  3D9L A;  3ZHE A;  2J07 A;  1TJC A;  4X8Q A;  5HQ8 A;  3CLJ A;  4LNG A;  2BSP A;  5EX3 A;  1LD8 A;  3UT8 A;  2CG3 A;  3N71 A;  3L54 A;  2LUH A;  5ENR D;  3CHQ A;  1A5E A;  2HM8 A;  5AAR A;  2O04 A;  1D9S A;  4BWR A;  4N2Q A;  3HYM B;  3PZ4 A;  3HVE A;  4GTQ A;  5B3S E;  2WXM A;  3CVY A;  2UWJ G;  3PSS A;  3E37 A;  4ABN A;  3MZL B;  3ESK A;  2LAI A;  4MKT A;  1BD8 A;  3KEZ A;  4HVB A;  4LSZ E;  4BT9 A;  1H6O A;  2XS1 A;  1O1S A;  3RIQ A;  3C3R A;  2F0Y A;  3SFX A;  4AM9 A;  1X5B A;  3DXM G;  4L1B A;  3DPD A;  1DCE A;  3D9H A;  3KD7 A;  4XEI G;  5FT9 A;  4GA0 A;  1E8Z A;  1Z3X A;  2YNQ A;  4B0Z A;  3FTZ A;  5LOZ A;  3ZYK A;  2CHZ A;  2X6Y A;  4U0Z A;  2BTD A;  3ESL A;  4FP7 A;  5KNH D;  4W8Q A;  2VSN A;  2M63 A;  2DVW A;  3EIQ C;  3IV0 A;  4GZ3 A;  4URK A;  1MJ0 A;  2NXP A;  5G55 A;  5AQ9 A;  3DEP A;  2PEC A;  2MRI A;  1N52 A;  3B90 A;  4XON A;  1IHB A;  2NYJ A;  3LEW A;  3FU6 A;  4LER A;  3FTY A;  3FWV A;  3ZPJ A;  3QOU A;  3URZ A;  2XPI A;  4UUC A;  4XKW A;  2DWZ A;  3Q7A A;  1QQ1 A;  3J5P A;  3RKV A;  2FEZ A;  1JWG A;  3QC1 A;  1BU9 A;  2PM7 A;  2VFN A;  4AEZ C;  3GZ1 A;  4ZHB A;  2GRN B;  4XZ4 A;  5FIO A;  5CBN A;  2IO2 C;  3E30 A;  2BM7 A;  3G2T A;  1RU4 A;  3LXU X;  2HYZ A;  5EIL A;  3CVN A;  5CEC B;  1N4S A;  2XZD G;  4NRH B;  1TSP A;  1Y8M A;  3ABL E;  2ZIR A;  4BT8 A;  4JA7 A;  3SUC A;  3C3Q A;  3TWS A;  4J8S A;  4XNF A;  3BQO A;  3VMV A;  3BH7 B;  2YHE A;  4ATG A;  1ZBP A;  2DIW A;  1MZC A;  2JAB A;  5ENN A;  5JHB A;  3AG3 E;  4OVV A;  2VJI A;  5CRU A;  3SFY A;  3OTN A;  2I6H A;  5FJY A;  3MV3 B;  4HRM B;  4HOU A;  2VBK A;  3JXJ A;  4U0U A;  3ENE A;  3S7F A;  4G8K A;  3GQA A;  2R02 A;  1TR4 A;  3KSQ A;  1SZ9 A;  1O1T A;  4UI9 C;  4FC8 A;  2UVE A;  4BTA A;  3ZW3 A;  4GCO A;  1JPL A;  5BV1 A;  5G05 C;  1QA3 A;  4HQD A;  4U4B A;  3SO8 A;  3Q49 B;  2IFU A;  3E4B A;  4EBA G;  2LO6 A;  5M72 A;  2XCB A;  5KBA A;  3IXE A;  4RSY A;  3UT4 A;  4DUI A;  3GQ7 A;  4DX2 A;  1LLW A;  5HS0 A;  5EIB E;  4M7C A;  1ELW A;  2X6K A;  2OV8 A;  3ZXP A;  1OWL A;  2VGX B;  1K8K G;  4EPZ A;  3R7R A;  3PH0 C;  4P29 A;  3NF1 A;  4NK8 A;  4ACL A;  3RO2 A;  4HI8 A;  2IQC A;  3EQO A;  1HF8 A;  4BSX A;  3EIJ A;  4GAA A;  4OYS A;  4HLL A;  5BNW A;  4I6G A;  3SF4 A;  2WVI A;  1N9A A;  1L1I A;  2YHC A;  4U04 A;  3RRU A;  4MS6 A;  3SQV A;  3QKY A;  1UN9 A;  4JEU A;  4IN3 B;  2ETA A;  3IKO B;  5FWQ A;  4C48 B;  1B89 A;  3JQ1 A;  3QWV A;  1KT1 A;  3GZS A;  4U63 A;  4RQI A;  4CGV A;  1D8E A;  3RJV A;  4YZQ A;  4HS2 A;  4WNF A;  2GGF A;  5AQA A;  3PNT B;  4DX6 D;  4U96 D;  3JUE A;  1KCC A;  4TXP A;  4DRX E;  4NQ0 A;  2V8S E;  4BX8 A;  2DYS E;  4YDW A;  3PRZ A;  5A6C A;  4CDR A;  3ONL A;  4RG6 A;  2ZXW E;  5ENQ D;  5AQ7 A;  3RSE G;  3AK5 A;  4BFR A;  2AW6 A;  4CGW A;  1QCX A;  1TN7 A;  3EU9 A;  3TWV A;  4JC8 A;  1S0P A;  3ABK E;  2XTX A;  1L5J A;  3FEY A;  3QAQ A;  2X85 A;  4G1T A;  2R03 A;  1O8J A;  1H2U A;  4PDX A;  3FH7 A;  2NTQ A;  3E33 A;  5IY5 E;  2IF4 A;  3G2W A;  4G11 A;  2O6W A;  4TUU A;  2XS8 A;  2KBX A;  3NZU A;  3N6Z A;  4JVS A;  4DPR A;  2L0T B;  1H80 A;  1NA3 A;  3CVW A;  4JB8 P;  3LPZ A;  2NTP A;  1JRG A;  3DST A;  4Z06 A;  4PH4 B;  5HKP A;  1V54 E;  2VJ8 A;  4H7X A;  4NK6 A;  3WG7 E;  4W8S A;  4K0R A;  4DX7 D;  2WXL A;  3G2V A;  1OGM X;  3FHE A;  2VJJ A;  3JQ0 A;  2WB2 A;  1YCS B;  3R9A B;  3ZNG A;  2VGX A;  2UY1 B;  2DZO A;  5DNS A;  3UMV A;  2XEN A;  2X6W A;  3JX8 A;  4MLP A;  4O1O A;  3CQG B;  1EYH A;  4FLH A;  3HXF A;  5C1D A;  4DLQ A;  4FA6 A;  1BI8 B;  1WM5 A;  1HG5 A;  4FAD A;  1RW2 A;  1P5Q A;  2FBN A;  3LJ3 A;  3ZSC A;  4ANV A;  2PL2 A;  4HRN A;  3DXK G;  1E8X A;  3FH5 A;  4JZY A;  3AS4 A;  3T5V A;  4JL0 A;  3UIO C;  3SFZ A;  1BHE A;  5JMC B;  1WDY A;  4GTT A;  1D8D A;  4GA2 A;  4QQI A;  4KMO A;  4AY5 A;  4U8V D;  1ELR A;  2R5S A;  4J8D A;  3HDX A;  1QRC A;  3O48 A;  3RRN B;  4I17 A;  3FTW A;  5JJ7 A;  5C1E A;  2V4L A;  2X6F A;  4O6F A;  2J8K A;  1H0A A;  4FHJ A;  3Q15 A;  4XI0 A;  3OXL A;  3CHM A;  3UM3 A;  4YEI A;  3FDH A;  4LG6 A;  4Z68 A;  1E96 B;  4JA9 A;  3CV0 A;  1TYU A;  3Q79 A;  1DVP A;  3ONK A;  2WXG A;  5AAO A; 
#chains in the Genus database with same CATH homology
 4YDT A;  2XT2 A;  2XTX A;  3DU1 X;  4YC5 A;  2J8K A;  4YFO A;  3PSZ A;  3SY2 A;  2XTW A;  3NB2 A;  3PSS A;  4YEI A;  2QYU A;  2O6W A;  2XTY A;  2QZA A;  3SQV A;  2XT4 A;  4YCQ A;  3NAW A;  5DNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...