3NB2A

Crystal structure of e. coli o157:h7 effector protein nlel
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
612
structure length
612
Chain Sequence
QGRACLSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGRNNVFTCTAVLTDMLTEHAKESFPEIFSLYYPVAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords secreted effector protein
publication title Biochemical and Structural Studies of a HECT-like Ubiquitin Ligase from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 222
structure length 612
sequence length 612
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3nb2A04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3nb2A02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3nb2A01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3nb2A03
2J8KA 3DU1X 4YDTA 3PSSA 3NAWA 3SY2A 4YEIA 3NB2A 2QYUA 4YC5A 2XT4A 2O6WA 4YFOA 2QZAA 4YCQA 2XTXA 2XTWA 2XT2A 2XTYA 3PSZA 5DNSA 3SQVA
chains in the Genus database with same CATH superfamily
2P58C 4GTQA 3EIJA 2IQ7A 2DYRE 3BQOA 3ULYA 3ESKA 2EIME 4I2ZA 4F6RD 4JEUA 3AAAC 4YCQA 3FU5A 3LY8A 4YDEA 3ZKJA 3ML3A 4FU3A 2VFMA 2XRYA 4XN3A 3RO2A 3MZLB 1UW4B 3CHRA 3CGHA 1BLXB 1U3DA 3D9OA 2I1KA 4WNDA 4JA9A 4I6JA 3EIQC 2VSNA 2KC7A 1TJCA 1NZNA 4E85A 5JLVC 3DSXA 5G05C 3RRNB 3GQ7A 2WXFA 1TJFA 2HE0A 3SYJA 1IHGA 3VSVA 4RLYA 5HS0A 1PC2A 1CLWA 5E75A 3TXMA 3QK0A 4Z03A 3TWWA 1IA5A 3NBNB 3D9JA 3DPYA 3C72A 1DC2A 5J08A 2NT9A 4Y6WA 1BD8A 3ZHEA 3G2WA 3V2XA 3HRAA 3VMVA 2R05A 2IOLA 4APOA 3ASHA 1DBOA 5JA4D 5JJTA 3H09A 3DPDA 4YC5A 1BI8B 3DSWA 1HU3A 1Z3YA 3CHOA 3EQNA 2UY1B 3FUDA 3ZYQA 4F53A 4URRA 3RRUA 3Q5MA 1JWGA 4MS6A 2X38A 4FA6A 4R7LA 1QA1A 4I1MA 1OWNA 3HDXA 1HS6A 5AMVA 1UN8A 3FTYA 4HBDA 3LXUX 4J8FA 4GZ5A 2XZDG 1B89A 4PS8A 1TYVA 2R03A 3Q47B 2HM8A 4N5QA 2P9NG 3LMWA 2XS1A 4B0ZA 3R9AB 4OJPA 4G8LA 4TV3A 4U8HA 4U49A 3UM0A 5ANLA 4Q69A 3OAWA 2VSOE 1TYUA 4C2LA 3CKBA 3ONKA 4HI9A 3ZU7B 1WDYA 1E8XA 1O8LA 2RKKA 4GCNA 1Y6IA 2QXZA 3T5XA 3BU8A 4GMJA 1EYHA 4OJLA 2X6YA 4U8VD 4BX8A 3E34A 2PL2A 1KCDA 3DSSA 3FUMA 4KBQA 2CG3A 4GTTA 4W8TA 4C0EA 3ASFA 1L1IA 3TWSA 3C3RA 4FC8A 1E8ZA 4B93B 5E76A 1K1AA 3LY7A 3R7RA 1O8DA 2V8SE 3QDNA 4CDMA 3KAEA 5JHAA 1O1SA 2VFOA 3CR3A 1H2TC 4BT8A 4HQDA 3GRHA 2RFAA 2ZGGA 3QOUA 1BI7B 4CT4A 3Q79A 3ZVVA 1K3ZD 3AG4E 1H6OA 5BNWA 3KEAA 2V5FA 3LDZA 4I9CA 4J8EA 4XR6A 2I1JA 4N3BA 2BM7A 1TR4A 4W8QA 2AWIA 1FPPA 5HI7A 2PM6A 3TWRA 2LO6A 5KJMA 3X2QE 3FUEA 3HXEA 4XX5A 4KT6B 3U3WA 3PETA 1H2VC 4BT9A 3APDA 5BW8C 4EW9A 1CZFA 4J0UA 1LM1A 3B8YA 1N4PA 4CRWA 3UM3A 2BKGA 3S7DA 2WB2A 2H6IA 4NQ0A 4HB5A 4EZJA 2ILRA 1U3CA 2L0IA 2Y1LE 2XPZA 4Z68A 4L2YA 3PSZA 3UT4A 5FQ6A 2EQXA 2B0OE 2ODLA 3KD7A 1LD7A 3CVUA 1SW6A 3UT8A 4LG6A 1ELRA 2WQ7A 1HG8A 5ITZF 4OJOA 1OCOE 3ZXSA 2WM9A 5M72A 4DJAA 4FLBA 4CZ2D 2KZTB 2UVFA 3N90A 4JPSA 5AAOA 1UJJA 5A7DB 1DCQA 1HFAA 2MOWA 1UN9A 4XONA 2I6HA 3TAXA 3QWVA 4U7EB 4BSZB 2X6WA 2GGFA 3C3QA 3JCKC 3SBTB 4YEIA 1D8DA 2J9QA 3D9PA 3MEKA 1PAQA 3UINC 3VTYA 3IV0A 4XI9A 2P2CP 1UG3A 3N6ZA 2E0IA 4PUCA 4APFA 5A6CA 4AP2A 3B4NA 3HIZA 1OGOX 5AQBA 1O8KA 2HO1A 3CQCB 4GTPA 3PUKA 3CVLA 2XTXA 1WY6A 3E30A 2VJJA 2Z8GA 5IY5E 3E37A 3J5PA 3MCXA 1EE6A 1QCXA 3CVWA 4XLHA 5DIZA 4LNBA 4L7TA 3RKVA 3G2VA 3G2UA 3UM1A 1W3BA 2I2OA 4UI9K 3FY4A 1XNFA 1JUQA 1MJ0A 2NC9A 4Y6CA 2LSVA 4OAUC 2OVFA 5ANRA 2P9IG 3ABKE 4G25A 1HZ4A 1SQMA 2IOUG 2VFPA 1OFLA 4JHRA 3IBEA 3SD5A 1TN8A 3P4GA 3FFLA 2QZAA 3EU9A 1RZ4A 1IDJA 2XS8A 3ML9A 1N0RA 2J09A 1LLWA 4KVOA 2DWZA 5FINA 4PS7A 4EBAA 3AK5A 2F8XK 5AIJA 3MV2B 1Q2ZA 3PRZA 4TRQA 3CVVA 2BTDA 5ENPD 3JXIA 4E6HA 3RJVA 3MYVA 3U4TA 2BF0X 4K5AB 5CBOA 1JPLA 3HYMB 2XENA 3CV0A 3SQVA 2AXZA 3PNTB 4M7CA 3DBSA 2WXGA 2IQCA 4YDTA 3ZYLA 4HS2A 3T8KA 5T8IA 4AOFA 4WWNA 3UQ3A 4XN0A 3HVEB 3QWPA 3HG0D 5C1DA 3FTVA 2R2LA 4PH4B 4KXKB 3PVLA 4GYWA 5EDSA 4G23A 2NSTA 5EILA 5KNHD 4GTRA 3SNXA 3L08A 4BX9A 2XCBA 2WVIA 4BY6A 2J4BA 3RU0A 1IDKA 1N54A 4XOTA 4RG6A 1O8HA 4XM3A 2EIKE 4Z05A 1QBQA 4UWLA 4I1OB 4HI8A 4ZFHA 3UIPC 5BPPA 5KBAA 1Z3XA 4XKVA 5KWDA 4AXHA 4BESA 4XLEA 3CQGB 2QX3A 2J8IA 3B95A 2GRRB 4AVZA 2X6KA 2GRPB 2GRLA 2O17A 1Y8MA 3SF4A 1L5JA 2GRNB 4WAFA 4WWOA 4FHKA 3CVXA 3FUKA 2OEVA 2KBXA 2VBKA 4GPMA 3OXGA 3LJYA 5KJLA 2VYIA 3TXNA 2FF4A 3CHPA 4KZCA 3L17A 1DABA 5CEDB 2ZGDA 1QRCA 2XC1A 1OCRE 2RG8A 3SGHA 4NK8A 4HVBA 3DSUA 5T3RA 2X6HA 4W8SA 1D8EA 5CECB 1NL4A 4XOPA 3R9MA 4EZLA 2PQRA 5LFAA 1AWCB 4A3TA 2WMOA 5B3SE 3WWGA 3MGBA 2WXNA 3IHVA 3ZNGA 4XLFA 4O6FA 4CDNA 5G04J 4URKA 3QB2A 1JCRA 2XGSA 3BH7B 5EIBE 1FCHA 3DU1X 3HHMA 3CVYA 1O8EA 1LD8A 3EHRA 4GMLA 4ME2A 3HXBA 4FJZA 2DZNA 1FVHA 4JW1A 3VLFA 2BM5A 3D9NA 3BG1B 3D9MA 4XKWA 3QKYA 2P9LG 3IHYA 2VQ2A 4CT0A 4ATGA 2HYZA 4LSZE 5AQAA 2X85A 3F6QA 3IKOB 3Q4AB 2KCLA 3NQPA 5J90A 1SA5A 5JMND 2IO2C 2RFMA 3LY9A 2W7ZA 3DSTA 5A23A 3AS4A 1V54E 4U0SA 4DX5D 1IHBA 1O8JA 1HG2A 2J8SD 1X5BA 2QY1A 1OWLA 4U96D 2X3MA 3WXXA 3L13A 3FEXA 4V3IA 5BV1A 2VFQA 3RO3A 3PZ2A 1DBGA 3ASDA 3T9GA 4H7YA 1E8YA 2WPVA 1QQ1A 1OGMX 2Y4TA 1SZ9A 2X6FA 4LUNU 2ZU6B 3GW4A 3TL5A 1E7VA 2PNNA 2X6IA 1EPUA 1KPSB 3G2SA 4A1SA 4EQFA 3CEQA 1DVPA 2PYGA 3J5QB 1MX2A 4PS3A 2WXKA 3ASNE 3ENEA 4GA0A 3FULA 1QJVA 2IF4A 3SFXA 4I6GA 1N95A 3VLDA 1IXVA 3N71A 3JUEA 1OFDA 2OV8A 1ZB1A 2F37A 1D9SA 3Q9UC 3V79K 2XCCA 4JD2G 4FJYA 2H6GA 2YUHA 1OY3D 1E8WA 4XMYA 5EYPF 2P9KG 2AVPA 2BEDA 1O8FA 4G8KA 3MA5A 2AXUA 4GYYA 3D9KA 4JVSA 1TYQG 1RMGA 4ANVA 3KS2A 2MRIA 1WXRA 5FZRA 4O1PA 2INVA 1NA0A 2PM7A 2NSPA 4MXNA 1HE8A 5EX0A 5AARA 3QJZA 3PEUB 1VDYA 2FO7A 3AU4A 4HFGA 2Y0BG 2A5UA 4FLHA 3R7QA 1MZCA 1MHQA 4LNUD 4HOSA 5ENSD 5B1AE 5JJ7A 2UWJG 4GAAA 4L2LA 4OJ5A 4MLPA 4AY6A 3B90A 3D9HA 2MHKA 4G26A 2KCKA 1SVXA 3Q15A 4OVVA 3TH0A 4UUCA 2CG2A 4OVUA 3FUIA 3DEPA 1O88A 2XEEA 3Q73A 2XTYA 2X6XA 3PH0C 3P2BA 2QFCA 5HKPA 1BHEA 5CRVA 4A1GA 4DLOA 3ABME 3C5RA 3ISMC 4JZYA 2VSXE 3Q78A 4MKTA 1S64A 5AQ7A 1BU9A 1H2UA 4DLQA 2XGOA 3BG0B 4U63A 4AEZC 4HRLA 2LNIA 1QZ2A 2DVWA 4YZQA 5FWQA 4YVQC 5C1EA 4GCOA 4GYOA 5CMYA 3HXDA 4BSXA 4GZDA 4AJWA 3S7JA 4EPZA 5FTPA 2O0VA 1N11A 4U0UA 5CMWA 2O6WA 2XQ0A 3FUFA 5ENNA 1YCSB 3T5VA 2IFUA 4UI9J 1H19A 3TG4A 4ZHBA 1O8MA 4L9PA 4GU5A 2AXVA 2XEHA 1YMPA 2MYOA 3IXEA 1O8GA 5G55A 1PXZA 3PZDA 2XTWA 4DX2A 3AS5A 3TG5A 4KH3A 2VJ8A 4TXPA 2EWEA 2OOEA 4FHJA 5CHEE 3GYZA 4JL0A 3Q49B 5FT9A 3ZEFA 4K5BA 4WUYA 1N9AA 4YEJA 3DXMG 4CDRA 4DI3A 2NTQA 1IQRA 2BKKB 1AP7A 2IO3C 4WNGA 2VFNA 3LJNA 4GPKA 5EIDA 3CHSA 4BEPA 1V55E 4ILGA 1PY1A 5CCMA 2Q7FA 2V4LA 1KZPA 4C48B 2UY1A 4J8YA 4I9EA 2GW1A 4ANXA 3SUCA 3C98A 3CK7A 4F1SA 5HQ8A 3OTNA 2V5QC 5LCWJ 3TWTA 3Q9NC 5AJLA 3RSEG 1TYWA 2NT6A 2WXRA 3W9FA 2GRMA 4BERA 4J8SA 1H0AA 1ELWA 5JMCB 4CGWA 3UIOC 4IN3B 2DCPA 3PNLB 4TXQA 1JCQA 4ILHB 3BH6B 1UJKA 4AVXA 2WXQA 1S70B 1FT2A 2EINE 3ASOE 4O1OA 2LUHA 4G1TA 3FHEA 1OXJA 5BXOA 2BM4A 4XKCA 4CGVA 2IJGX 5DNSA 3EHQA 4OZZA 4F3VA 3FTXA 2L9BA 2P9SG 4CCAA 4L1BA 2IEJA 2R17C 1N4QA 1X81A 3QAQA 4XZ4A 2LAHA 2V0PA 3CK8A 2VBMA 4EBAG 4J8DA 4HRMB 5ENRD 4MBGA 3JQ1A 1KQ5A 3UW0A 4YDWA 3PE4A 4WNEA 4B8CB 2H6FA 1TEZA 2R5SA 4AIFA 4DI4A 5FIOA 3ESLA 4FULA 3I4GA 3V30A 2J49A 1GQ8A 2L6JA 3RRMB 3AG1E 4BETA 2Y69E 3FUNA 3RIQA 3AJIA 3Q7FA 5C1CA 2CHWA 4HWVA 3LKUA 3S7FA 3ZUVB 4UWHA 3P1UA 4XQFA 3VSUA 4HLEA 3ZHEB 1OFEA 4YFOA 4HNAD 1KZOA 2BX6A 3CVQA 3FUJA 2Y3AA 4JHKA 1K8FA 3G2TA 1KTWA 4BTAA 2FO1E 1SA4A 5G2NA 3BUAA 4LNGA 2PECA 4YZ0A 2H6HA 5ARGA 4QQIA 3FTSA 3DWLG 4EECA 3NOCD 1N52A 2XHEA 3L9TA 1OFMA 4QFVA 5HRYA 3QARA 4HOTA 2F3LA 4GTOA 4DRXE 3E33A 1OCZE 2V5IA 4XNFA 4XKBA 3I3NA 2RD0A 2KCVA 1O1RA 3FWVA 4LRZA 1NHCA 1MX4A 2OCCE 5B1BE 1N4RA 3SFZA 2WXMA 4G11A 4J7WA 3CHMA 4OYSA 2XRZA 4JEHA 3LYCA 2ETCA 1H6KA 3B7RL 1LF8A 3ABLE 3SI5A 1H80A 1EDUA 3L82A 4OAVB 2O04A 2R02A 2CFUA 1TNYA 2R59A 4D10C 1OOCA 4IYPA 2FULA 3D9LA 1IB4A 4V02C 4A3VA 2DYSE 3FDHA 5D0OD 4JXTA 2M63A 3PUJA 3ZW3A 4HOUA 4GA1A 5CEAA 3ML8A 4CEMA 4A63B 4ABNA 3FH7A 2BSPA 4N3AA 3EHMA 2OVBA 3B7UX 1HO8A 1GW6A 2JABA 3L6AA 2V4HC 4OZYA 3UUXA 3LJ3A 4JRAC 2LAIA 2QC9A 1BPOA 5AYWD 4K0RA 1TNUA 2VGEA 2FBNA 4WNFA 1HG5A 2VTBA 2IY0C 1S0PA 3Q7AA 3FTUA 5BT1A 1BN8A 3LS8A 5C2YA 3UX4A 2NTPA 1WMRA 3FU6A 5AJDA 2YHCA 3DSVA 3V2OA 4BTBA 3ZFWA 3UTMA 3HXCA 1TN6A 2XPYA 2NSZA 5G05J 4U95D 2ZXWE 4UQZA 5EX3A 2XGMA 2WXOA 1UOHA 2ETBA 3S7BA 4GA2A 1KCCA 5G04C 2XEVA 4UQXA 2A5EA 3PS6A 3D3MA 1O8IA 3TWXA 3MKQA 2L0TB 4FP7A 2BUGA 3CVNA 3FTZA 3U9WA 3QC1A 4O60A 4K5CA 4Z06A 2XT2A 3AG3E 4HOQA 1IQUA 4DX7D 1HH8A 2G0YA 3CSFA 4GB9A 2KM4A 1JWFA 2LXMA 3SZ7A 3KRGA 2B0RA 3E4BA 4JA7A 1OT8A 4UWGA 3QWWA 3SY2A 3LPZA 5CERB 2X6JA 4N2QA 4I6EA 2XT4A 1E90A 4N3CA 3TGOA 5CRUA 4U4BA 1XGWA 4YNDA 4EZKA 3PEVB 1Z6TA 4I2WA 4IULA 5KNGA 5ENQD 1AIRA 1ZU2A 4I17A 3UPVA 1ELKA 2VSYA 4MRUA 5DBKA 4BFRA 4Q96A 3HVEA 5LX8A 3IEGA 3OXLA 2FEZA 2FI7A 3NAWA 3I4RB 2VGYA 4IRUA 3MX3A 4RSYA 1JRGA 2GROB 1TNOA 2UVEA 3PREA 2WXLA 2WQ6A 1ZBPA 4JB8P 4ATZD 5AENA 2DIWA 5H7PA 3NOGD 4U0ZA 1OUVA 2QYJA 5JHBA 3UMVA 3DRAA 3VLEA 1SZAA 2INUA 4YZAA 3JURA 3NB2A 3UT7A 3ZXPA 4DUIA 2L6BA 3EDTB 4GTMA 3GZ2A 3B7SA 5ENTD 2WXJA 3URZA 4YVOA 3UKUG 3FU3A 2NXPA 3MV3B 1A5EA 4W8RA 3L22A 4RQIA 1N4SA 2LSUA 3JX8A 3CHQA 1HF8A 4L23A 3KSQA 4DX1A 2YNQA 5CBNA 3ZSCA 2C0LA 4HORA 3B7TA 3AS8A 1WG0A 4RVBA 1TSPA 4NIKA 1A17A 4N5CA 2AW6A 1E7UA 4KYOB 5AN8A 3VSTA 1K8KG 3UM2A 2VGXA 4P29A 1TNZA 1IKND 2WXPA 3T9KA 5D0QD 3JQ0A 3SO8A 2C0MA 4GZ6A 1RW2A 2PZIA 3T8MA 4XL9A 2J07A 2BM6A 5BV0A 3AG2E 1MX6A 2YQ8A 4U8YD 4ANWA 3MJWA 5ARFA 4ILIA 2F0YA 2J08A 4EHMA 5LP0A 1KT1A 3ZN3A 3U66A 3HXFA 1K4ZA 4YDOA 4GTVA 4TXRA 5EN5D 1KLXA 3I5PA 4MR0A 3CKCA 3LCAA 2B6CA 2O0WA 1HF2A 4RG9A 2A4ZA 3ULEG 1NFIE 2I9CA 2CHZA 1P5QA 1OWOA 2OEWA 4I1AA 1QNFA 4UI9C 4M3OA 4OPWA 3FY3A 2PQNA 4NRHB 4HRNA 2J4DA 3PZ3A 3C3OA 3O4ZA 2P9UG 4UWFA 1FT1A 4X8QA 5KJNA 3W9GA 3VTXA 3LVQE 3LVRE 4YDYA 2VJIA 3OXFA 2JLBA 4B94A 4JHJA 1NP7A 1K1BA 1OWMA 4AM9A 3FUHA 3B13A 3UXGA 5FQ8A 5FJYA 2CFZA 4F1PA 3D9IA 4H7XA 3NZSA 1PLUA 3FTWA 4NURA 1JCSA 1VBLA 5EKQD 1QYMA 5LCWC 3TJPA 1WM5A 3NF1A 2XZTG 4PMHA 3PZ4A 3CIAA 4J6IA 1EA0A 2NTBA 2YHEA 3ZGQA 2LXLA 3EHNA 4LCTA 3TWUA 4YELA 2J8KA 2ONDA 3NZUA 5CCLA 2VTBB 3JYSA 2KATA 3APCA 3EU5A 1N0QA 1INZA 3CLJA 1S63A 3FU0A 1YYHA 2X3HA 5FZQA 5D2MC 3BEEA 4DX6D 3UKRG 3ZYMA 5FQ4A 3RK6A 4LEUA 4ACLA 4G24A 3GZSA 3VMWA 3GQAA 2AJAA 2WMNA 2WXIA 3APFA 3U64A 2IU1A 3L54A 1G3NB 4XIFA 2ZIRA 4AV7A 1OWPA 3FH8A 4AY5A 5JJ6A 3JXJA 3RIBA 2HR2A 4G2VA 4KVMA 4I43A 3ZYKA 1E96B 3S2AA 2EIJE 3MKQB 5BXUA 4XI0A 4XE0A 4U04A 4HLLA 3DEOA 5FZSA 4TUUA 3GZ1A 2EILE 1O5MA 2JEKA 2QYUA 4TUMA 1HX8A 1TYXA 1DCEA 5FQ7A 3K9IA 1XG2A 1U2VG 2IONA 3PE3A 4A55A 1PE9A 1LLZA 1EF1C 4C9BB 1O1TA 3MKRA 4JC8A 1IYGA 2VBEA 1MYOA 4BWRA 4ANUA 3WG7E 3SBSA 3UI2A 5KCMA 1X0CA 3B7BA 4CYMD 1QRBA 1H6PA 1DNPA 2NYJA 4OM9A 4LERA 4XLCA 1YA0A 2KXPC 4GTSA 5KJKA 3GQ8A 2E2EA 4GMRA 4C0MA 3LYAA 3L16A 2XPIA 1KT0A 4GZCA 5T4YA 1QQEA 3PSSA 5EYLA 4DPRA 3ONLA 2Y4UA 4FADA 1N94A 2NZMA 2DZOA 1NA3A 4UQYA 3ULQA 3FP3A 4YZXA 4WWPA 3KSLA 3EJNA 3DXKG 2IOSA 3SFYA 3SZEA 1RU4A 4NK6A 4I84A 3ZPJA 4U07A 2KZTA 2C2LA 4N2SA 2WQHA 4ACKA 4DK5A 1EZGA 4KMOA 4XEIG 3EQOA 3CK9A 4W9RA 4UWKA 3V31A 3ASGA 3CVPA 4NACA 1TNBA 3O48A 2QY7A 3Q75A 2ETAA 4OJ6A 3E32A 1WAO1 4HXIA 3FH5A 5LOZA 2F8YA 3ZPPA 2P9PG 4F7AA 1Z5SC 4Q94A 4K03A 5D66A 5ENOD 3LEWA 3ZIMA 1RWRA 1LTXA 3AU5A 4XLAA 1QA2A 3ZRHA 2DBAA 3CSTA 1JTAA 2GRQB 1QA3A 3EUVA 3JUIA 4PDXA 4KZ0A 3FEYA 1OCCE 1TN7A 2ZISA 3KEZA 4N39A 4XORA 3PZ1A 4B8AA 5BUZA 4GZ3A 2YINA 3PDNA 3QNKA 3SHFA 3TWVA 2CHXA 2PYHA 3TWQA 4B89A 3GQ9A 1HXIA 2WXHA 1MQSA 1NI1A 5AQ9A 2O1DA 1FVFA 1K5CA 3RAUA 2VGXB
chains in the Genus database with same CATH topology
2J8KA 3DU1X 4YDTA 3PSSA 3NAWA 3SY2A 4YEIA 3NB2A 2QYUA 4YC5A 2XT4A 2O6WA 4YFOA 2QZAA 4YCQA 2XTXA 2XTWA 2XT2A 2XTYA 3PSZA 5DNSA 3SQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8K A;  3DU1 X;  4YDT A;  3PSS A;  3NAW A;  3SY2 A;  4YEI A;  3NB2 A;  2QYU A;  4YC5 A;  2XT4 A;  2O6W A;  4YFO A;  2QZA A;  4YCQ A;  2XTX A;  2XTW A;  2XT2 A;  2XTY A;  3PSZ A;  5DNS A;  3SQV A; 
#chains in the Genus database with same CATH topology
 2P58 C;  4GTQ A;  3EIJ A;  2IQ7 A;  2DYR E;  3BQO A;  3ULY A;  3ESK A;  2EIM E;  4I2Z A;  4F6R D;  4JEU A;  3AAA C;  4YCQ A;  3FU5 A;  3LY8 A;  4YDE A;  3ZKJ A;  3ML3 A;  4FU3 A;  2VFM A;  2XRY A;  4XN3 A;  3RO2 A;  3MZL B;  1UW4 B;  3CHR A;  3CGH A;  1BLX B;  1U3D A;  3D9O A;  2I1K A;  4WND A;  4JA9 A;  4I6J A;  3EIQ C;  2VSN A;  2KC7 A;  1TJC A;  1NZN A;  4E85 A;  5JLV C;  3DSX A;  5G05 C;  3RRN B;  3GQ7 A;  2WXF A;  1TJF A;  2HE0 A;  3SYJ A;  1IHG A;  3VSV A;  4RLY A;  5HS0 A;  1PC2 A;  1CLW A;  5E75 A;  3TXM A;  3QK0 A;  4Z03 A;  3TWW A;  1IA5 A;  3NBN B;  3D9J A;  3DPY A;  3C72 A;  1DC2 A;  5J08 A;  2NT9 A;  4Y6W A;  1BD8 A;  3ZHE A;  3G2W A;  3V2X A;  3HRA A;  3VMV A;  2R05 A;  2IOL A;  4APO A;  3ASH A;  1DBO A;  5JA4 D;  5JJT A;  3H09 A;  3DPD A;  4YC5 A;  1BI8 B;  3DSW A;  1HU3 A;  1Z3Y A;  3CHO A;  3EQN A;  2UY1 B;  3FUD A;  3ZYQ A;  4F53 A;  4URR A;  3RRU A;  3Q5M A;  1JWG A;  4MS6 A;  2X38 A;  4FA6 A;  4R7L A;  1QA1 A;  4I1M A;  1OWN A;  3HDX A;  1HS6 A;  5AMV A;  1UN8 A;  3FTY A;  4HBD A;  3LXU X;  4J8F A;  4GZ5 A;  2XZD G;  1B89 A;  4PS8 A;  1TYV A;  2R03 A;  3Q47 B;  2HM8 A;  4N5Q A;  2P9N G;  3LMW A;  2XS1 A;  4B0Z A;  3R9A B;  4OJP A;  4G8L A;  4TV3 A;  4U8H A;  4U49 A;  3UM0 A;  5ANL A;  4Q69 A;  3OAW A;  2VSO E;  1TYU A;  4C2L A;  3CKB A;  3ONK A;  4HI9 A;  3ZU7 B;  1WDY A;  1E8X A;  1O8L A;  2RKK A;  4GCN A;  1Y6I A;  2QXZ A;  3T5X A;  3BU8 A;  4GMJ A;  1EYH A;  4OJL A;  2X6Y A;  4U8V D;  4BX8 A;  3E34 A;  2PL2 A;  1KCD A;  3DSS A;  3FUM A;  4KBQ A;  2CG3 A;  4GTT A;  4W8T A;  4C0E A;  3ASF A;  1L1I A;  3TWS A;  3C3R A;  4FC8 A;  1E8Z A;  4B93 B;  5E76 A;  1K1A A;  3LY7 A;  3R7R A;  1O8D A;  2V8S E;  3QDN A;  4CDM A;  3KAE A;  5JHA A;  1O1S A;  2VFO A;  3CR3 A;  1H2T C;  4BT8 A;  4HQD A;  3GRH A;  2RFA A;  2ZGG A;  3QOU A;  1BI7 B;  4CT4 A;  3Q79 A;  3ZVV A;  1K3Z D;  3AG4 E;  1H6O A;  5BNW A;  3KEA A;  2V5F A;  3LDZ A;  4I9C A;  4J8E A;  4XR6 A;  2I1J A;  4N3B A;  2BM7 A;  1TR4 A;  4W8Q A;  2AWI A;  1FPP A;  5HI7 A;  2PM6 A;  3TWR A;  2LO6 A;  5KJM A;  3X2Q E;  3FUE A;  3HXE A;  4XX5 A;  4KT6 B;  3U3W A;  3PET A;  1H2V C;  4BT9 A;  3APD A;  5BW8 C;  4EW9 A;  1CZF A;  4J0U A;  1LM1 A;  3B8Y A;  1N4P A;  4CRW A;  3UM3 A;  2BKG A;  3S7D A;  2WB2 A;  2H6I A;  4NQ0 A;  4HB5 A;  4EZJ A;  2ILR A;  1U3C A;  2L0I A;  2Y1L E;  2XPZ A;  4Z68 A;  4L2Y A;  3PSZ A;  3UT4 A;  5FQ6 A;  2EQX A;  2B0O E;  2ODL A;  3KD7 A;  1LD7 A;  3CVU A;  1SW6 A;  3UT8 A;  4LG6 A;  1ELR A;  2WQ7 A;  1HG8 A;  5ITZ F;  4OJO A;  1OCO E;  3ZXS A;  2WM9 A;  5M72 A;  4DJA A;  4FLB A;  4CZ2 D;  2KZT B;  2UVF A;  3N90 A;  4JPS A;  5AAO A;  1UJJ A;  5A7D B;  1DCQ A;  1HFA A;  2MOW A;  1UN9 A;  4XON A;  2I6H A;  3TAX A;  3QWV A;  4U7E B;  4BSZ B;  2X6W A;  2GGF A;  3C3Q A;  3JCK C;  3SBT B;  4YEI A;  1D8D A;  2J9Q A;  3D9P A;  3MEK A;  1PAQ A;  3UIN C;  3VTY A;  3IV0 A;  4XI9 A;  2P2C P;  1UG3 A;  3N6Z A;  2E0I A;  4PUC A;  4APF A;  5A6C A;  4AP2 A;  3B4N A;  3HIZ A;  1OGO X;  5AQB A;  1O8K A;  2HO1 A;  3CQC B;  4GTP A;  3PUK A;  3CVL A;  2XTX A;  1WY6 A;  3E30 A;  2VJJ A;  2Z8G A;  5IY5 E;  3E37 A;  3J5P A;  3MCX A;  1EE6 A;  1QCX A;  3CVW A;  4XLH A;  5DIZ A;  4LNB A;  4L7T A;  3RKV A;  3G2V A;  3G2U A;  3UM1 A;  1W3B A;  2I2O A;  4UI9 K;  3FY4 A;  1XNF A;  1JUQ A;  1MJ0 A;  2NC9 A;  4Y6C A;  2LSV A;  4OAU C;  2OVF A;  5ANR A;  2P9I G;  3ABK E;  4G25 A;  1HZ4 A;  1SQM A;  2IOU G;  2VFP A;  1OFL A;  4JHR A;  3IBE A;  3SD5 A;  1TN8 A;  3P4G A;  3FFL A;  2QZA A;  3EU9 A;  1RZ4 A;  1IDJ A;  2XS8 A;  3ML9 A;  1N0R A;  2J09 A;  1LLW A;  4KVO A;  2DWZ A;  5FIN A;  4PS7 A;  4EBA A;  3AK5 A;  2F8X K;  5AIJ A;  3MV2 B;  1Q2Z A;  3PRZ A;  4TRQ A;  3CVV A;  2BTD A;  5ENP D;  3JXI A;  4E6H A;  3RJV A;  3MYV A;  3U4T A;  2BF0 X;  4K5A B;  5CBO A;  1JPL A;  3HYM B;  2XEN A;  3CV0 A;  3SQV A;  2AXZ A;  3PNT B;  4M7C A;  3DBS A;  2WXG A;  2IQC A;  4YDT A;  3ZYL A;  4HS2 A;  3T8K A;  5T8I A;  4AOF A;  4WWN A;  3UQ3 A;  4XN0 A;  3HVE B;  3QWP A;  3HG0 D;  5C1D A;  3FTV A;  2R2L A;  4PH4 B;  4KXK B;  3PVL A;  4GYW A;  5EDS A;  4G23 A;  2NST A;  5EIL A;  5KNH D;  4GTR A;  3SNX A;  3L08 A;  4BX9 A;  2XCB A;  2WVI A;  4BY6 A;  2J4B A;  3RU0 A;  1IDK A;  1N54 A;  4XOT A;  4RG6 A;  1O8H A;  4XM3 A;  2EIK E;  4Z05 A;  1QBQ A;  4UWL A;  4I1O B;  4HI8 A;  4ZFH A;  3UIP C;  5BPP A;  5KBA A;  1Z3X A;  4XKV A;  5KWD A;  4AXH A;  4BES A;  4XLE A;  3CQG B;  2QX3 A;  2J8I A;  3B95 A;  2GRR B;  4AVZ A;  2X6K A;  2GRP B;  2GRL A;  2O17 A;  1Y8M A;  3SF4 A;  1L5J A;  2GRN B;  4WAF A;  4WWO A;  4FHK A;  3CVX A;  3FUK A;  2OEV A;  2KBX A;  2VBK A;  4GPM A;  3OXG A;  3LJY A;  5KJL A;  2VYI A;  3TXN A;  2FF4 A;  3CHP A;  4KZC A;  3L17 A;  1DAB A;  5CED B;  2ZGD A;  1QRC A;  2XC1 A;  1OCR E;  2RG8 A;  3SGH A;  4NK8 A;  4HVB A;  3DSU A;  5T3R A;  2X6H A;  4W8S A;  1D8E A;  5CEC B;  1NL4 A;  4XOP A;  3R9M A;  4EZL A;  2PQR A;  5LFA A;  1AWC B;  4A3T A;  2WMO A;  5B3S E;  3WWG A;  3MGB A;  2WXN A;  3IHV A;  3ZNG A;  4XLF A;  4O6F A;  4CDN A;  5G04 J;  4URK A;  3QB2 A;  1JCR A;  2XGS A;  3BH7 B;  5EIB E;  1FCH A;  3DU1 X;  3HHM A;  3CVY A;  1O8E A;  1LD8 A;  3EHR A;  4GML A;  4ME2 A;  3HXB A;  4FJZ A;  2DZN A;  1FVH A;  4JW1 A;  3VLF A;  2BM5 A;  3D9N A;  3BG1 B;  3D9M A;  4XKW A;  3QKY A;  2P9L G;  3IHY A;  2VQ2 A;  4CT0 A;  4ATG A;  2HYZ A;  4LSZ E;  5AQA A;  2X85 A;  3F6Q A;  3IKO B;  3Q4A B;  2KCL A;  3NQP A;  5J90 A;  1SA5 A;  5JMN D;  2IO2 C;  2RFM A;  3LY9 A;  2W7Z A;  3DST A;  5A23 A;  3AS4 A;  1V54 E;  4U0S A;  4DX5 D;  1IHB A;  1O8J A;  1HG2 A;  2J8S D;  1X5B A;  2QY1 A;  1OWL A;  4U96 D;  2X3M A;  3WXX A;  3L13 A;  3FEX A;  4V3I A;  5BV1 A;  2VFQ A;  3RO3 A;  3PZ2 A;  1DBG A;  3ASD A;  3T9G A;  4H7Y A;  1E8Y A;  2WPV A;  1QQ1 A;  1OGM X;  2Y4T A;  1SZ9 A;  2X6F A;  4LUN U;  2ZU6 B;  3GW4 A;  3TL5 A;  1E7V A;  2PNN A;  2X6I A;  1EPU A;  1KPS B;  3G2S A;  4A1S A;  4EQF A;  3CEQ A;  1DVP A;  2PYG A;  3J5Q B;  1MX2 A;  4PS3 A;  2WXK A;  3ASN E;  3ENE A;  4GA0 A;  3FUL A;  1QJV A;  2IF4 A;  3SFX A;  4I6G A;  1N95 A;  3VLD A;  1IXV A;  3N71 A;  3JUE A;  1OFD A;  2OV8 A;  1ZB1 A;  2F37 A;  1D9S A;  3Q9U C;  3V79 K;  2XCC A;  4JD2 G;  4FJY A;  2H6G A;  2YUH A;  1OY3 D;  1E8W A;  4XMY A;  5EYP F;  2P9K G;  2AVP A;  2BED A;  1O8F A;  4G8K A;  3MA5 A;  2AXU A;  4GYY A;  3D9K A;  4JVS A;  1TYQ G;  1RMG A;  4ANV A;  3KS2 A;  2MRI A;  1WXR A;  5FZR A;  4O1P A;  2INV A;  1NA0 A;  2PM7 A;  2NSP A;  4MXN A;  1HE8 A;  5EX0 A;  5AAR A;  3QJZ A;  3PEU B;  1VDY A;  2FO7 A;  3AU4 A;  4HFG A;  2Y0B G;  2A5U A;  4FLH A;  3R7Q A;  1MZC A;  1MHQ A;  4LNU D;  4HOS A;  5ENS D;  5B1A E;  5JJ7 A;  2UWJ G;  4GAA A;  4L2L A;  4OJ5 A;  4MLP A;  4AY6 A;  3B90 A;  3D9H A;  2MHK A;  4G26 A;  2KCK A;  1SVX A;  3Q15 A;  4OVV A;  3TH0 A;  4UUC A;  2CG2 A;  4OVU A;  3FUI A;  3DEP A;  1O88 A;  2XEE A;  3Q73 A;  2XTY A;  2X6X A;  3PH0 C;  3P2B A;  2QFC A;  5HKP A;  1BHE A;  5CRV A;  4A1G A;  4DLO A;  3ABM E;  3C5R A;  3ISM C;  4JZY A;  2VSX E;  3Q78 A;  4MKT A;  1S64 A;  5AQ7 A;  1BU9 A;  1H2U A;  4DLQ A;  2XGO A;  3BG0 B;  4U63 A;  4AEZ C;  4HRL A;  2LNI A;  1QZ2 A;  2DVW A;  4YZQ A;  5FWQ A;  4YVQ C;  5C1E A;  4GCO A;  4GYO A;  5CMY A;  3HXD A;  4BSX A;  4GZD A;  4AJW A;  3S7J A;  4EPZ A;  5FTP A;  2O0V A;  1N11 A;  4U0U A;  5CMW A;  2O6W A;  2XQ0 A;  3FUF A;  5ENN A;  1YCS B;  3T5V A;  2IFU A;  4UI9 J;  1H19 A;  3TG4 A;  4ZHB A;  1O8M A;  4L9P A;  4GU5 A;  2AXV A;  2XEH A;  1YMP A;  2MYO A;  3IXE A;  1O8G A;  5G55 A;  1PXZ A;  3PZD A;  2XTW A;  4DX2 A;  3AS5 A;  3TG5 A;  4KH3 A;  2VJ8 A;  4TXP A;  2EWE A;  2OOE A;  4FHJ A;  5CHE E;  3GYZ A;  4JL0 A;  3Q49 B;  5FT9 A;  3ZEF A;  4K5B A;  4WUY A;  1N9A A;  4YEJ A;  3DXM G;  4CDR A;  4DI3 A;  2NTQ A;  1IQR A;  2BKK B;  1AP7 A;  2IO3 C;  4WNG A;  2VFN A;  3LJN A;  4GPK A;  5EID A;  3CHS A;  4BEP A;  1V55 E;  4ILG A;  1PY1 A;  5CCM A;  2Q7F A;  2V4L A;  1KZP A;  4C48 B;  2UY1 A;  4J8Y A;  4I9E A;  2GW1 A;  4ANX A;  3SUC A;  3C98 A;  3CK7 A;  4F1S A;  5HQ8 A;  3OTN A;  2V5Q C;  5LCW J;  3TWT A;  3Q9N C;  5AJL A;  3RSE G;  1TYW A;  2NT6 A;  2WXR A;  3W9F A;  2GRM A;  4BER A;  4J8S A;  1H0A A;  1ELW A;  5JMC B;  4CGW A;  3UIO C;  4IN3 B;  2DCP A;  3PNL B;  4TXQ A;  1JCQ A;  4ILH B;  3BH6 B;  1UJK A;  4AVX A;  2WXQ A;  1S70 B;  1FT2 A;  2EIN E;  3ASO E;  4O1O A;  2LUH A;  4G1T A;  3FHE A;  1OXJ A;  5BXO A;  2BM4 A;  4XKC A;  4CGV A;  2IJG X;  5DNS A;  3EHQ A;  4OZZ A;  4F3V A;  3FTX A;  2L9B A;  2P9S G;  4CCA A;  4L1B A;  2IEJ A;  2R17 C;  1N4Q A;  1X81 A;  3QAQ A;  4XZ4 A;  2LAH A;  2V0P A;  3CK8 A;  2VBM A;  4EBA G;  4J8D A;  4HRM B;  5ENR D;  4MBG A;  3JQ1 A;  1KQ5 A;  3UW0 A;  4YDW A;  3PE4 A;  4WNE A;  4B8C B;  2H6F A;  1TEZ A;  2R5S A;  4AIF A;  4DI4 A;  5FIO A;  3ESL A;  4FUL A;  3I4G A;  3V30 A;  2J49 A;  1GQ8 A;  2L6J A;  3RRM B;  3AG1 E;  4BET A;  2Y69 E;  3FUN A;  3RIQ A;  3AJI A;  3Q7F A;  5C1C A;  2CHW A;  4HWV A;  3LKU A;  3S7F A;  3ZUV B;  4UWH A;  3P1U A;  4XQF A;  3VSU A;  4HLE A;  3ZHE B;  1OFE A;  4YFO A;  4HNA D;  1KZO A;  2BX6 A;  3CVQ A;  3FUJ A;  2Y3A A;  4JHK A;  1K8F A;  3G2T A;  1KTW A;  4BTA A;  2FO1 E;  1SA4 A;  5G2N A;  3BUA A;  4LNG A;  2PEC A;  4YZ0 A;  2H6H A;  5ARG A;  4QQI A;  3FTS A;  3DWL G;  4EEC A;  3NOC D;  1N52 A;  2XHE A;  3L9T A;  1OFM A;  4QFV A;  5HRY A;  3QAR A;  4HOT A;  2F3L A;  4GTO A;  4DRX E;  3E33 A;  1OCZ E;  2V5I A;  4XNF A;  4XKB A;  3I3N A;  2RD0 A;  2KCV A;  1O1R A;  3FWV A;  4LRZ A;  1NHC A;  1MX4 A;  2OCC E;  5B1B E;  1N4R A;  3SFZ A;  2WXM A;  4G11 A;  4J7W A;  3CHM A;  4OYS A;  2XRZ A;  4JEH A;  3LYC A;  2ETC A;  1H6K A;  3B7R L;  1LF8 A;  3ABL E;  3SI5 A;  1H80 A;  1EDU A;  3L82 A;  4OAV B;  2O04 A;  2R02 A;  2CFU A;  1TNY A;  2R59 A;  4D10 C;  1OOC A;  4IYP A;  2FUL A;  3D9L A;  1IB4 A;  4V02 C;  4A3V A;  2DYS E;  3FDH A;  5D0O D;  4JXT A;  2M63 A;  3PUJ A;  3ZW3 A;  4HOU A;  4GA1 A;  5CEA A;  3ML8 A;  4CEM A;  4A63 B;  4ABN A;  3FH7 A;  2BSP A;  4N3A A;  3EHM A;  2OVB A;  3B7U X;  1HO8 A;  1GW6 A;  2JAB A;  3L6A A;  2V4H C;  4OZY A;  3UUX A;  3LJ3 A;  4JRA C;  2LAI A;  2QC9 A;  1BPO A;  5AYW D;  4K0R A;  1TNU A;  2VGE A;  2FBN A;  4WNF A;  1HG5 A;  2VTB A;  2IY0 C;  1S0P A;  3Q7A A;  3FTU A;  5BT1 A;  1BN8 A;  3LS8 A;  5C2Y A;  3UX4 A;  2NTP A;  1WMR A;  3FU6 A;  5AJD A;  2YHC A;  3DSV A;  3V2O A;  4BTB A;  3ZFW A;  3UTM A;  3HXC A;  1TN6 A;  2XPY A;  2NSZ A;  5G05 J;  4U95 D;  2ZXW E;  4UQZ A;  5EX3 A;  2XGM A;  2WXO A;  1UOH A;  2ETB A;  3S7B A;  4GA2 A;  1KCC A;  5G04 C;  2XEV A;  4UQX A;  2A5E A;  3PS6 A;  3D3M A;  1O8I A;  3TWX A;  3MKQ A;  2L0T B;  4FP7 A;  2BUG A;  3CVN A;  3FTZ A;  3U9W A;  3QC1 A;  4O60 A;  4K5C A;  4Z06 A;  2XT2 A;  3AG3 E;  4HOQ A;  1IQU A;  4DX7 D;  1HH8 A;  2G0Y A;  3CSF A;  4GB9 A;  2KM4 A;  1JWF A;  2LXM A;  3SZ7 A;  3KRG A;  2B0R A;  3E4B A;  4JA7 A;  1OT8 A;  4UWG A;  3QWW A;  3SY2 A;  3LPZ A;  5CER B;  2X6J A;  4N2Q A;  4I6E A;  2XT4 A;  1E90 A;  4N3C A;  3TGO A;  5CRU A;  4U4B A;  1XGW A;  4YND A;  4EZK A;  3PEV B;  1Z6T A;  4I2W A;  4IUL A;  5KNG A;  5ENQ D;  1AIR A;  1ZU2 A;  4I17 A;  3UPV A;  1ELK A;  2VSY A;  4MRU A;  5DBK A;  4BFR A;  4Q96 A;  3HVE A;  5LX8 A;  3IEG A;  3OXL A;  2FEZ A;  2FI7 A;  3NAW A;  3I4R B;  2VGY A;  4IRU A;  3MX3 A;  4RSY A;  1JRG A;  2GRO B;  1TNO A;  2UVE A;  3PRE A;  2WXL A;  2WQ6 A;  1ZBP A;  4JB8 P;  4ATZ D;  5AEN A;  2DIW A;  5H7P A;  3NOG D;  4U0Z A;  1OUV A;  2QYJ A;  5JHB A;  3UMV A;  3DRA A;  3VLE A;  1SZA A;  2INU A;  4YZA A;  3JUR A;  3NB2 A;  3UT7 A;  3ZXP A;  4DUI A;  2L6B A;  3EDT B;  4GTM A;  3GZ2 A;  3B7S A;  5ENT D;  2WXJ A;  3URZ A;  4YVO A;  3UKU G;  3FU3 A;  2NXP A;  3MV3 B;  1A5E A;  4W8R A;  3L22 A;  4RQI A;  1N4S A;  2LSU A;  3JX8 A;  3CHQ A;  1HF8 A;  4L23 A;  3KSQ A;  4DX1 A;  2YNQ A;  5CBN A;  3ZSC A;  2C0L A;  4HOR A;  3B7T A;  3AS8 A;  1WG0 A;  4RVB A;  1TSP A;  4NIK A;  1A17 A;  4N5C A;  2AW6 A;  1E7U A;  4KYO B;  5AN8 A;  3VST A;  1K8K G;  3UM2 A;  2VGX A;  4P29 A;  1TNZ A;  1IKN D;  2WXP A;  3T9K A;  5D0Q D;  3JQ0 A;  3SO8 A;  2C0M A;  4GZ6 A;  1RW2 A;  2PZI A;  3T8M A;  4XL9 A;  2J07 A;  2BM6 A;  5BV0 A;  3AG2 E;  1MX6 A;  2YQ8 A;  4U8Y D;  4ANW A;  3MJW A;  5ARF A;  4ILI A;  2F0Y A;  2J08 A;  4EHM A;  5LP0 A;  1KT1 A;  3ZN3 A;  3U66 A;  3HXF A;  1K4Z A;  4YDO A;  4GTV A;  4TXR A;  5EN5 D;  1KLX A;  3I5P A;  4MR0 A;  3CKC A;  3LCA A;  2B6C A;  2O0W A;  1HF2 A;  4RG9 A;  2A4Z A;  3ULE G;  1NFI E;  2I9C A;  2CHZ A;  1P5Q A;  1OWO A;  2OEW A;  4I1A A;  1QNF A;  4UI9 C;  4M3O A;  4OPW A;  3FY3 A;  2PQN A;  4NRH B;  4HRN A;  2J4D A;  3PZ3 A;  3C3O A;  3O4Z A;  2P9U G;  4UWF A;  1FT1 A;  4X8Q A;  5KJN A;  3W9G A;  3VTX A;  3LVQ E;  3LVR E;  4YDY A;  2VJI A;  3OXF A;  2JLB A;  4B94 A;  4JHJ A;  1NP7 A;  1K1B A;  1OWM A;  4AM9 A;  3FUH A;  3B13 A;  3UXG A;  5FQ8 A;  5FJY A;  2CFZ A;  4F1P A;  3D9I A;  4H7X A;  3NZS A;  1PLU A;  3FTW A;  4NUR A;  1JCS A;  1VBL A;  5EKQ D;  1QYM A;  5LCW C;  3TJP A;  1WM5 A;  3NF1 A;  2XZT G;  4PMH A;  3PZ4 A;  3CIA A;  4J6I A;  1EA0 A;  2NTB A;  2YHE A;  3ZGQ A;  2LXL A;  3EHN A;  4LCT A;  3TWU A;  4YEL A;  2J8K A;  2OND A;  3NZU A;  5CCL A;  2VTB B;  3JYS A;  2KAT A;  3APC A;  3EU5 A;  1N0Q A;  1INZ A;  3CLJ A;  1S63 A;  3FU0 A;  1YYH A;  2X3H A;  5FZQ A;  5D2M C;  3BEE A;  4DX6 D;  3UKR G;  3ZYM A;  5FQ4 A;  3RK6 A;  4LEU A;  4ACL A;  4G24 A;  3GZS A;  3VMW A;  3GQA A;  2AJA A;  2WMN A;  2WXI A;  3APF A;  3U64 A;  2IU1 A;  3L54 A;  1G3N B;  4XIF A;  2ZIR A;  4AV7 A;  1OWP A;  3FH8 A;  4AY5 A;  5JJ6 A;  3JXJ A;  3RIB A;  2HR2 A;  4G2V A;  4KVM A;  4I43 A;  3ZYK A;  1E96 B;  3S2A A;  2EIJ E;  3MKQ B;  5BXU A;  4XI0 A;  4XE0 A;  4U04 A;  4HLL A;  3DEO A;  5FZS A;  4TUU A;  3GZ1 A;  2EIL E;  1O5M A;  2JEK A;  2QYU A;  4TUM A;  1HX8 A;  1TYX A;  1DCE A;  5FQ7 A;  3K9I A;  1XG2 A;  1U2V G;  2ION A;  3PE3 A;  4A55 A;  1PE9 A;  1LLZ A;  1EF1 C;  4C9B B;  1O1T A;  3MKR A;  4JC8 A;  1IYG A;  2VBE A;  1MYO A;  4BWR A;  4ANU A;  3WG7 E;  3SBS A;  3UI2 A;  5KCM A;  1X0C A;  3B7B A;  4CYM D;  1QRB A;  1H6P A;  1DNP A;  2NYJ A;  4OM9 A;  4LER A;  4XLC A;  1YA0 A;  2KXP C;  4GTS A;  5KJK A;  3GQ8 A;  2E2E A;  4GMR A;  4C0M A;  3LYA A;  3L16 A;  2XPI A;  1KT0 A;  4GZC A;  5T4Y A;  1QQE A;  3PSS A;  5EYL A;  4DPR A;  3ONL A;  2Y4U A;  4FAD A;  1N94 A;  2NZM A;  2DZO A;  1NA3 A;  4UQY A;  3ULQ A;  3FP3 A;  4YZX A;  4WWP A;  3KSL A;  3EJN A;  3DXK G;  2IOS A;  3SFY A;  3SZE A;  1RU4 A;  4NK6 A;  4I84 A;  3ZPJ A;  4U07 A;  2KZT A;  2C2L A;  4N2S A;  2WQH A;  4ACK A;  4DK5 A;  1EZG A;  4KMO A;  4XEI G;  3EQO A;  3CK9 A;  4W9R A;  4UWK A;  3V31 A;  3ASG A;  3CVP A;  4NAC A;  1TNB A;  3O48 A;  2QY7 A;  3Q75 A;  2ETA A;  4OJ6 A;  3E32 A;  1WAO 1;  4HXI A;  3FH5 A;  5LOZ A;  2F8Y A;  3ZPP A;  2P9P G;  4F7A A;  1Z5S C;  4Q94 A;  4K03 A;  5D66 A;  5ENO D;  3LEW A;  3ZIM A;  1RWR A;  1LTX A;  3AU5 A;  4XLA A;  1QA2 A;  3ZRH A;  2DBA A;  3CST A;  1JTA A;  2GRQ B;  1QA3 A;  3EUV A;  3JUI A;  4PDX A;  4KZ0 A;  3FEY A;  1OCC E;  1TN7 A;  2ZIS A;  3KEZ A;  4N39 A;  4XOR A;  3PZ1 A;  4B8A A;  5BUZ A;  4GZ3 A;  2YIN A;  3PDN A;  3QNK A;  3SHF A;  3TWV A;  2CHX A;  2PYH A;  3TWQ A;  4B89 A;  3GQ9 A;  1HXI A;  2WXH A;  1MQS A;  1NI1 A;  5AQ9 A;  2O1D A;  1FVF A;  1K5C A;  3RAU A;  2VGX B; 
#chains in the Genus database with same CATH homology
 2J8K A;  3DU1 X;  4YDT A;  3PSS A;  3NAW A;  3SY2 A;  4YEI A;  3NB2 A;  2QYU A;  4YC5 A;  2XT4 A;  2O6W A;  4YFO A;  2QZA A;  4YCQ A;  2XTX A;  2XTW A;  2XT2 A;  2XTY A;  3PSZ A;  5DNS A;  3SQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...