3NB2A

Crystal structure of e. coli o157:h7 effector protein nlel
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
612
structure length
612
Chain Sequence
b'QGRACLSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGRNNVFTCTAVLTDMLTEHAKESFPEIFSLYYPVAWR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords secreted effector protein
publication title Biochemical and Structural Studies of a HECT-like Ubiquitin Ligase from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
total genus 222
structure length 612
sequence length 612
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3nb2A04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3nb2A02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3nb2A01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3nb2A03
5DNSA 3SQVA 4YEIA 4YCQA 3PSZA 4YDTA 2J8KA 4YFOA 2QYUA 2QZAA 2XT4A 2XTWA 2XTYA 2O6WA 2XTXA 3NAWA 2XT2A 3SY2A 3PSSA 3DU1X 3NB2A 4YC5A
chains in the Genus database with same CATH superfamily
4C2LA 4PDXA 1B89A 2X6JA 2V5FA 3HXCA 1QCXA 2L6BA 4J7WA 4GZ5A 1PE9A 2XTXA 4JXTA 2XT2A 3SD5A 3TXMA 3ZFWA 3TWTA 4CRWA 4Z06A 3CQCB 1O88A 2AXZA 4I84A 1E8WA 3BUAA 5BNWA 1O8FA 5B1BE 4AV7A 5JJ7A 5ANLA 2Q7FA 4XZ4A 1A5EA 3VSTA 3KSLA 5HQ8A 3BEEA 3SI5A 5G55A 2X6KA 4XORA 2IOUG 4K5AB 3SFZA 5C1CA 3HVEA 3W9FA 3FH8A 4LERA 3P2BA 1OCZE 2GRLA 4TV3A 3DBSA 1WG0A 4FJYA 2VJ8A 4F1SA 1HG2A 2RD0A 2P9PG 2P9UG 1GQ8A 4EHMA 3FEXA 4WNFA 2IOLA 3CKBA 3GW4A 4Q94A 5JJTA 3ONKA 3UUXA 2XT4A 3CLJA 5HRYA 1Y8MA 4YDOA 1V55E 4KBQA 1S70B 1W3BA 2OEWA 2PM6A 4J0UA 1CZFA 2ONDA 4G11A 3B7TA 3RK6A 3PVLA 4JVSA 2J09A 3D9IA 4XN0A 3MKRA 1KQ5A 4C0MA 4JB8P 3NZUA 2EIME 4V3IA 3G2SA 1JCQA 3JUIA 3AS5A 1DBOA 2Y0BG 4YC5A 3QWVA 3VMVA 2BM7A 5FZQA 4U95D 4F7AA 2P58C 3CVLA 3Q4AB 3L6AA 3ZKJA 4NACA 4CT4A 1E7UA 3EIJA 2CG3A 4GMJA 5AJLA 2WM9A 3TG5A 3QDNA 4WAFA 2LSVA 3UT8A 4GPMA 3HIZA 3QWWA 4J8EA 5IY5E 4JHRA 4URKA 1MQSA 1PC2A 3DSUA 4AY5A 4I2WA 4U0SA 3V31A 4JW1A 4APFA 5FQ8A 4I9EA 2BTDA 2WXRA 2OVBA 2XQ0A 5BUZA 3PZ3A 3SFXA 1OWPA 3J5PA 1FPPA 1OWNA 3JURA 2NC9A 2J4DA 3GQAA 4AXHA 3AG3E 3TWSA 4FJZA 2QY7A 4XKWA 2CFZA 2VGXA 4I6GA 1IHBA 4TXQA 4UI9K 1RWRA 3BU8A 2PQRA 2YQ8A 3MKQB 4N5QA 4B8AA 2WXHA 3DSVA 4U96D 3C5RA 4WWOA 5AQAA 2GRMA 3ASGA 4N39A 1H6KA 3L9TA 3ESLA 1KCDA 3QAQA 1N9AA 2VBMA 1OFDA 4C9BB 3Q47B 4MKTA 4OJ5A 3MYVA 5AJDA 1SQMA 2GGFA 4DI3A 4D10C 3Q9NC 4J8YA 3G2VA 1MX2A 4Q96A 2ETCA 4U7EB 4YNDA 3TWRA 3NOGD 2GRQB 4KZCA 3ZYKA 3HXFA 1SZ9A 2LUHA 3RRMB 1IQRA 3VLEA 3L54A 4GTPA 3ZSCA 3FU6A 4H7XA 2IQCA 4JD2G 3ONLA 4OVVA 3WXXA 2YHCA 4U4BA 3JXIA 3Q78A 2NSPA 3LS8A 3U64A 1TN8A 2R02A 2I1JA 4AY6A 3QJZA 2A5UA 1KT0A 3HXEA 3S7JA 3SO8A 4HFGA 2B0RA 4YZAA 4GCNA 2EIJE 1TYXA 2VBKA 3D9HA 1OCRE 3GRHA 1HS6A 5ENTD 2XHEA 3DWLG 4E6HA 5FQ6A 4L9PA 5FWQA 3ZYLA 1YCSB 4DX1A 4TUUA 4Z05A 3J5QB 4JPSA 5DBKA 3KEZA 4K5CA 2XPZA 2X3MA 5B3SE 1OGOX 3DRAA 3CVXA 4GYWA 4DX6D 1H6PA 2XGSA 1QJVA 5AQ9A 3K9IA 5JMND 4DLOA 2ETAA 1SVXA 5A23A 4OJLA 3HDXA 4GTMA 4LG6A 1TJFA 4CDRA 2M63A 2OV8A 2HR2A 3LVQE 2X85A 3LMWA 1LLZA 3FWVA 1PXZA 2O0WA 4HLLA 3CK7A 2UVEA 2RFMA 2VFMA 2LSUA 2LNIA 2QYJA 3CVWA 3T9KA 2BX6A 4YEJA 3GZ2A 2ZGDA 1Z3YA 4BWRA 4ILIA 4DX5D 1OWMA 1TNBA 5JA4D 4YZXA 1U2VG 1TYWA 5FQ7A 1OFMA 5M72A 3KD7A 2KZTB 4J8DA 1RZ4A 4MS6A 2VJJA 3WWGA 1H6OA 4TUMA 1H80A 3EDTB 2VFOA 2PNNA 4LSZE 1D9SA 1HF8A 3X2QE 3FUEA 3B90A 5AN8A 3D3MA 3UT7A 4Y6WA 4HXIA 1QRBA 2J08A 2CHXA 1UG3A 5EKQD 4OAVB 3ABME 2XPIA 4WNDA 1EDUA 1TR4A 1QBQA 1WM5A 3OXGA 3L82A 5CCLA 2V5IA 4XLFA 5JHBA 2PL2A 4HVBA 1S64A 4X8QA 5ITZF 4YZQA 4CEMA 2GRPB 4HORA 2XC1A 4FC8A 3ULYA 5J08A 1JPLA 2WXOA 4O1OA 3PNLB 1S63A 2VSYA 5ANRA 2J07A 2VFNA 2IOSA 2FEZA 2DZNA 3EQNA 1N94A 4HOUA 1K1BA 4LRZA 2PECA 5D66A 1AP7A 5AYWD 1ELRA 2XTWA 2INUA 1JWFA 3EU5A 3T9GA 2EIKE 3D9OA 2W7ZA 2VJIA 3ZHEB 3U66A 1EA0A 4I6JA 4C48B 3U3WA 3AS8A 1HE8A 5CBNA 1H2TC 4KMOA 4MXNA 4HNAD 4GPKA 3FUDA 2QY1A 2PM7A 2QZAA 3DPYA 1K5CA 5E76A 5KCMA 2UY1B 2UVFA 2IFUA 3FH7A 3PEUB 3ASHA 2NSZA 2LXMA 2FBNA 4UWHA 3JX8A 4BSXA 3R7QA 1LM1A 4NK6A 3OAWA 1N52A 4RG6A 2KM4A 1S0PA 3EUVA 3HXDA 1MJ0A 1SA4A 4XEIG 2ZGGA 1JCRA 1OFLA 3AU4A 5DNSA 3T8KA 2IO2C 3EIQC 5CMYA 1DABA 4HI8A 4ABNA 1TSPA 4I17A 4WNEA 2JLBA 3ABKE 4WWNA 3SFYA 1BI8B 3CVQA 2XPYA 5CRVA 2UY1A 4L2LA 4XLAA 3CR3A 4M3OA 2L6JA 4I6EA 4YVQC 4DJAA 3SHFA 3ASOE 3UIPC 2OOEA 1KT1A 3LJNA 4YDWA 1BN8A 1UOHA 5DIZA 3CV0A 3KSQA 1PAQA 3SY2A 2VSXE 5JHAA 4OM9A 4EQFA 2HE0A 3HVEB 1PY1A 2Y4UA 3U9WA 4FHKA 1JCSA 3EHNA 4XKCA 2DVWA 4GZ6A 5HI7A 5JMCB 4UUCA 4U0UA 3S7FA 3PZ2A 4JEUA 3DEOA 3RU0A 3EHMA 4UWFA 3LYCA 3EU9A 3T8MA 3HRAA 4OJ6A 1JRGA 3CHMA 4ZHBA 2OCCE 2V4LA 1HU3A 4GAAA 2F8YA 4CCAA 3CEQA 1FCHA 3QOUA 1OOCA 5JLVC 1CLWA 4MLPA 4XQFA 1WMRA 5AARA 4XI9A 3L13A 4AVZA 2C0MA 2FULA 1INZA 3V2OA 4EZLA 3TWQA 2WMOA 1IQUA 4HLEA 3TXNA 1X0CA 5BV0A 3KS2A 2HO1A 4Z03A 4XL9A 1WAO1 3FTSA 4BTAA 3FDHA 4EZJA 1BI7B 3SGHA 4I1AA 4GMRA 1U3CA 4WWPA 2NXPA 2DCPA 3FFLA 3VSVA 4GU5A 3ISMC 4I9CA 3O4ZA 2NT9A 2LAHA 1VBLA 2L0IA 4ANUA 1QRCA 4FHJA 4I1MA 2NT6A 2E2EA 4IRUA 5C1DA 4AVXA 1L5JA 1XNFA 4DI4A 4BERA 1SZAA 3HG0D 4YDYA 2KCKA 3QC1A 3Q9UC 2QYUA 2A4ZA 4U04A 2O6WA 3ZPJA 2QX3A 4YVOA 3ZEFA 3MEKA 5AIJA 1OWLA 2IF4A 5LX8A 4N3BA 4EW9A 4PMHA 1YYHA 3NQPA 3P4GA 3BQOA 4Z68A 4L2YA 3ZXSA 4YDTA 2V5QC 3FP3A 5AQ7A 3EQOA 3G2TA 2WQHA 3RIBA 3TH0A 4LNGA 3FY3A 2XGOA 2VGXB 3DU1X 5LCWC 3MJWA 1NHCA 5LP0A 4DX2A 4F1PA 4OAUC 1HX8A 3E37A 2P9SG 2V0PA 3NZSA 1MHQA 2XGMA 4FP7A 4FLBA 3ML3A 3AU5A 5CEDB 1O1TA 3C98A 5EYLA 2WPVA 3FUHA 3CSFA 2CFUA 4P29A 5BPPA 2R5SA 3JXJA 2X38A 4H7YA 3UM2A 4A1SA 4YELA 3B4NA 3UT4A 3UMVA 3FUMA 3DSTA 4BTBA 3LY7A 2I1KA 3CK8A 2BUGA 3VTXA 2P9KG 3PETA 4JL0A 1UN8A 5BXUA 1N0RA 4KT6B 4XOPA 2P9IG 5ENPD 4XOTA 2AJAA 3LKUA 3B13A 3TG4A 1O8IA 1X81A 4GB9A 2C2LA 1IXVA 1EPUA 4HI9A 5ENSD 4NURA 4DRXE 1E8XA 1HFAA 1G3NB 3FTVA 3DSXA 2WQ7A 1RMGA 4DUIA 4XR6A 3V79K 4W9RA 4CGWA 3U4TA 1IB4A 1K3ZD 2MRIA 2MOWA 1TNYA 1H19A 2PZIA 4OZZA 2IU1A 1IHGA 4EECA 5BXOA 3B7RL 2XZDG 4JZYA 2NZMA 3Q5MA 2VQ2A 2NTQA 2L9BA 2XEVA 5BW8C 4UQYA 3RSEG 4BETA 4AOFA 2FO1E 2H6GA 3GQ7A 4YFOA 2DZOA 1TNUA 3DEPA 3CIAA 5CECB 3MCXA 2IY0C 2P9LG 3E30A 4B94A 5AQBA 2H6IA 2CHWA 4HOTA 3C72A 5KNGA 4U8HA 5T3RA 1OT8A 3URZA 2NYJA 3R7RA 3HHMA 4LNBA 4ANWA 5KBAA 4O60A 3FTWA 3LJ3A 1DC2A 3CK9A 5EDSA 3AG2E 3CHRA 3TWVA 4Q69A 4FLHA 3LY8A 3LYAA 3PZDA 4G25A 1XG2A 5ENOD 2KATA 2EINE 1AWCB 1ZU2A 3IHYA 3ZNGA 2KCLA 5EX3A 3T5XA 1SA5A 2XS1A 4AP2A 4I43A 3FUIA 5J90A 4E85A 2J8KA 1UJJA 1LD8A 5G05C 2WXPA 4BESA 3DPDA 3TWWA 3PREA 1BLXB 5ARFA 4ZFHA 1N0QA 5LOZA 3B7UX 4XNFA 1KTWA 2A5EA 1D8DA 3S2AA 1H2UA 2YINA 5G2NA 4ILHB 1O8LA 5ENNA 1O8EA 1UJKA 2XCCA 4FULA 2MYOA 4RVBA 4CDMA 3ASNE 4KZ0A 3ML9A 3IV0A 4EPZA 3FTYA 1QA2A 1NA3A 2DYRE 1FVHA 2R2LA 1OUVA 3B7SA 4BSZB 3SNXA 1O8KA 3PSZA 4ANVA 3QKYA 3UM1A 3RJVA 2WXJA 4NIKA 5D0OD 3Q15A 4OPWA 3RRUA 1QQEA 5G04C 4OYSA 3OTNA 3H09A 4NQ0A 2WXIA 4AEZC 4ACLA 5EIDA 4GCOA 3PDNA 2RG8A 1KZPA 1NP7A 5JJ6A 4GA0A 1WY6A 1QQ1A 4GMLA 4PS3A 3DXKG 5E75A 4M7CA 2HYZA 3Q75A 2LXLA 2FI7A 3E34A 3ZPPA 3E4BA 3N71A 4PH4B 4GZ3A 4B89A 3L22A 3ML8A 4GTTA 3D9NA 3Q49B 2F0YA 1BU9A 2H6HA 3SBSA 3CQGB 1JTAA 4I1OB 3SYJA 4F6RD 4JC8A 5EYPF 3O48A 4PS7A 3QB2A 1UN9A 3ZU7B 1VDYA 1TNZA 2J9QA 2YNQA 4OVUA 3KEAA 4A55A 2RKKA 3NF1A 5CBOA 2P9NG 1WDYA 3GZ1A 1QA1A 3FUJA 4N2QA 1EE6A 4ILGA 3FY4A 3LDZA 4RQIA 4U49A 3N6ZA 1IYGA 3ZGQA 4G8KA 5HKPA 3JYSA 5FZSA 1HF2A 3EJNA 3EHQA 3ZW3A 1YA0A 2IO3C 1N4PA 2QFCA 5KJKA 4A3VA 2VTBB 1NFIE 4HS2A 4O6FA 3UTMA 4BFRA 2F8XK 1FT1A 4XMYA 4CYMD 4G23A 4XI0A 3PUKA 3FUKA 5T8IA 3FH5A 1MZCA 4XX5A 3LVRE 4B8CB 5KJMA 2KXPC 4F53A 4U0ZA 2XTYA 5D0QD 3TJPA 4LNUD 2FF4A 2VBEA 3CVUA 2AWIA 3UPVA 3CHSA 4N2SA 3PNTB 5FTPA 4BX9A 5FZRA 4FU3A 4L1BA 1TN6A 4HOQA 4HWVA 3CHOA 2BM4A 2HM8A 5HS0A 4K5BA 2EILE 5C1EA 2JABA 4N3AA 2INVA 2BM5A 3BG1B 4OZYA 2VTBA 1TJCA 2QXZA 4K0RA 5AMVA 1E8ZA 4GTSA 4UI9C 1L1IA 3KAEA 1O1SA 1K1AA 4G8LA 1ZB1A 1IDJA 1H2VC 3CVYA 3CKCA 3I4RB 3Q7FA 1OY3D 2NSTA 1EYHA 1TYQG 4N5CA 4L7TA 1ELWA 3NOCD 1IDKA 1O8GA 3IHVA 4WNGA 1PLUA 2Y4TA 2WXMA 3P1UA 2WXKA 3PSSA 5G04J 1D8EA 2WXQA 4MBGA 2DIWA 3L17A 2AXVA 4NK8A 5EILA 4XKBA 4AJWA 4CDNA 3SBTB 1TNOA 3FUFA 1DCEA 2J4BA 3Q79A 1E7VA 3GQ9A 3JUEA 3L08A 3LJYA 4HRLA 4GTVA 1H0AA 2QC9A 3NB2A 2X6YA 2NTBA 2ETBA 2GRNB 3CVNA 4JEHA 5FQ4A 1GW6A 3I5PA 1O8HA 1AIRA 1DCQA 1KZOA 4ANXA 4DK5A 3G2WA 4APOA 4W8RA 4U07A 1Q2ZA 2X6XA 2WVIA 4R7LA 5A7DB 3VMWA 3UW0A 1LF8A 2VYIA 3PZ1A 2JEKA 3AK5A 1QZ2A 2XCBA 1A17A 4CT0A 3JQ0A 2X3HA 3CHQA 4RG9A 4ACKA 4O1PA 3PZ4A 4ATZD 5BT1A 1RW2A 2F3LA 2BEDA 1DVPA 3UXGA 2WXFA 1V54E 1ZBPA 4RSYA 2WMNA 1N4QA 3V2XA 3OXFA 4W8QA 3VSUA 1QYMA 5LFAA 3MX3A 2G0YA 3RIQA 3QARA 3UM0A 3TWUA 2WXLA 1O5MA 4YCQA 2XS8A 1Z3XA 2I6HA 1HO8A 4N3CA 1LTXA 4UWLA 4KYOB 3C3RA 5FT9A 3RAUA 1QA3A 4JHJA 1P5QA 4MRUA 4PS8A 3AG1E 3D9JA 2BSPA 3ABLE 3IXEA 2KBXA 1N4SA 3ASDA 3ZIMA 3B8YA 5CCMA 3HXBA 1IKND 4XLEA 4C0EA 1NI1A 3TGOA 2I2OA 3V30A 5FIOA 4MR0A 4A3TA 3VLFA 4XLCA 1Y6IA 2BM6A 5D2MC 2V8SE 2X6FA 2O04A 2PYGA 3UIOC 2IEJA 2XRYA 1TYVA 3CSTA 3IKOB 4J8FA 3ASFA 3UM3A 5ARGA 2L0TB 2C0LA 3LY9A 1E90A 3UI2A 4GTQA 4GZDA 1Z6TA 1OCOE 4UI9J 3JCKC 4QFVA 5CRUA 5CEAA 4IYPA 1X5BA 3BH7B 2IQ7A 4UQZA 2GROB 3UINC 2V4HC 4A63B 3JQ1A 4JA7A 3AJIA 1JWGA 3ZXPA 3UKUG 3DSSA 3LPZA 1DNPA 2WXNA 3RO2A 1TN7A 2Z8GA 1K8FA 3WG7E 4XN3A 4KVOA 2WB2A 2KCVA 2O17A 3DXMG 1OXJA 2H6FA 2J49A 1U3DA 4XONA 4B93B 3GZSA 4ME2A 3S7DA 3TL5A 4GA1A 5C2YA 3MKQA 5AAOA 2EQXA 2IONA 4FADA 1JUQA 2X6WA 5EX0A 2WXGA 4XKVA 3SQVA 2GW1A 1Z5SC 1MX4A 1HG5A 3D9PA 3ZUVB 2ILRA 1N4RA 2RFAA 4W8SA 3CHPA 1TYUA 2PYHA 2VFQA 3MA5A 2F37A 4U8VD 1TEZA 4HB5A 4RLYA 3QWPA 3L16A 2LO6A 3RKVA 1K8KG 1OCCE 3ZN3A 4BX8A 2VSOE 3ESKA 2ZXWE 3D9KA 3FEYA 4Y6CA 3VLDA 5A6CA 2GRRB 5ENRD 4CGVA 4TXPA 5EN5D 4EBAG 3T5VA 2XENA 4KVMA 1N54A 3ENEA 3HYMB 5FINA 2DBAA 2IJGX 4CZ2D 3RRNB 3ZVVA 2ZU6B 4I2ZA 4UQXA 2DWZA 4IULA 2BKGA 1LLWA 4UWKA 4U8YD 1KPSB 5KNHD 4AIFA 4GA2A 4G2VA 2Y3AA 1HG8A 3KRGA 5BV1A 1E8YA 1NL4A 3Q73A 5LCWJ 1YMPA 3DSWA 1OFEA 4AM9A 3PEVB 4YDEA 2BKKB 3C3QA 4XM3A 3CVVA 4DPRA 3I3NA 3BG0B 4K03A 4GYOA 3PH0C 2J8IA 1SW6A 5CHEE 2CG2A 4KH3A 3FTXA 4LUNU 3QNKA 4B0ZA 2VGEA 4OJPA 2O1DA 1FVFA 4G24A 2X6HA 2UWJG 2AVPA 4G26A 2B0OE 2XEEA 1NA0A 5KJLA 3G2UA 2R59A 2OVFA 3MGBA 4JA9A 3E33A 2E0IA 2PQNA 3NAWA 3ULEG 2ZIRA 1N11A 2BF0X 3FTUA 1O8MA 4A1GA 3CVPA 2O0VA 3D9LA 3FU5A 2R03A 1NZNA 3IEGA 4HOSA 2B6CA 1HH8A 3PS6A 2Y1LE 5FJYA 3RO3A 3APFA 3LCAA 3UKRG 3D9MA 3R9AB 2EWEA 3ZRHA 4FA6A 1UW4B 2YUHA 3EHRA 3FU3A 1KCCA 4BEPA 1ELKA 4GYYA 4L23A 3MV2B 1BHEA 2Y69E 5H7PA 4EZKA 4DX7D 3R9MA 3TWXA 4HRNA 1IA5A 2KZTA 3CGHA 1WXRA 1EF1C 1O1RA 3FTZA 3OXLA 2FO7A 2KC7A 5CMWA 3ZYMA 2ZISA 3Q7AA 4HQDA 3BH6B 5T4YA 3UX4A 1BPOA 3SZEA 1RU4A 2ODLA 4HBDA 4XE0A 3NBNB 3SZ7A 2R17C 4J8SA 3B95A 5EIBE 3E32A 2J8SD 1OWOA 1QNFA 1N95A 4KXKB 1EZGA 2VFPA 3N90A 4BY6A 1XGWA 5B1AE 4EBAA 1OGMX 1HZ4A 1MYOA 3ZYQA 2VSNA 2CHZA 2YHEA 3SF4A 2XRZA 4QQIA 4GTOA 3QK0A 4U63A 4YZ0A 2OEVA 4XIFA 5KWDA 3FHEA 2X6IA 3C3OA 2MHKA 2DYSE 3APCA 3FU0A 1K4ZA 2XEHA 2AXUA 3MZLB 4J6IA 4DLQA 4GZCA 3VTYA 4JRAC 2P2CP 3S7BA 5AENA 4GTRA 1BD8A 4NRHB 3AS4A 3PRZA 5ENQD 2AW6A 4URRA 4BT9A 4F3VA 3PE3A 3F6QA 5KJNA 3ZHEA 4PUCA 3PE4A 4V02C 3UQ3A 3W9GA 4LEUA 4BT8A 4TRQA 1HXIA 4XLHA 3PUJA 3LEWA 3FUNA 1MX6A 4OJOA 4UWGA 2XZTG 3ULQA 3APDA 5CERB 3LXUX 4LCTA 1O8JA 5G05J 1E96B 2VGYA 3I4GA 4ATGA 2LAIA 4WUYA 2R05A 3GQ8A 3AAAC 1LD7A 3B7BA 1DBGA 4HRMB 3SUCA 4JHKA 1O8DA 4TXRA 1KLXA 4YEIA 2I9CA 3GYZA 3IBEA 4G1TA 3AG4E 4IN3B 3FULA 1FT2A 4W8TA 2WQ6A 2NTPA 3MV3B 3TAXA
chains in the Genus database with same CATH topology
5DNSA 3SQVA 4YEIA 4YCQA 3PSZA 4YDTA 2J8KA 4YFOA 2QYUA 2QZAA 2XT4A 2XTWA 2XTYA 2O6WA 2XTXA 3NAWA 2XT2A 3SY2A 3PSSA 3DU1X 3NB2A 4YC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNS A;  3SQV A;  4YEI A;  4YCQ A;  3PSZ A;  4YDT A;  2J8K A;  4YFO A;  2QYU A;  2QZA A;  2XT4 A;  2XTW A;  2XTY A;  2O6W A;  2XTX A;  3NAW A;  2XT2 A;  3SY2 A;  3PSS A;  3DU1 X;  3NB2 A;  4YC5 A; 
#chains in the Genus database with same CATH topology
 4C2L A;  4PDX A;  1B89 A;  2X6J A;  2V5F A;  3HXC A;  1QCX A;  2L6B A;  4J7W A;  4GZ5 A;  1PE9 A;  2XTX A;  4JXT A;  2XT2 A;  3SD5 A;  3TXM A;  3ZFW A;  3TWT A;  4CRW A;  4Z06 A;  3CQC B;  1O88 A;  2AXZ A;  4I84 A;  1E8W A;  3BUA A;  5BNW A;  1O8F A;  5B1B E;  4AV7 A;  5JJ7 A;  5ANL A;  2Q7F A;  4XZ4 A;  1A5E A;  3VST A;  3KSL A;  5HQ8 A;  3BEE A;  3SI5 A;  5G55 A;  2X6K A;  4XOR A;  2IOU G;  4K5A B;  3SFZ A;  5C1C A;  3HVE A;  3W9F A;  3FH8 A;  4LER A;  3P2B A;  1OCZ E;  2GRL A;  4TV3 A;  3DBS A;  1WG0 A;  4FJY A;  2VJ8 A;  4F1S A;  1HG2 A;  2RD0 A;  2P9P G;  2P9U G;  1GQ8 A;  4EHM A;  3FEX A;  4WNF A;  2IOL A;  3CKB A;  3GW4 A;  4Q94 A;  5JJT A;  3ONK A;  3UUX A;  2XT4 A;  3CLJ A;  5HRY A;  1Y8M A;  4YDO A;  1V55 E;  4KBQ A;  1S70 B;  1W3B A;  2OEW A;  2PM6 A;  4J0U A;  1CZF A;  2OND A;  4G11 A;  3B7T A;  3RK6 A;  3PVL A;  4JVS A;  2J09 A;  3D9I A;  4XN0 A;  3MKR A;  1KQ5 A;  4C0M A;  4JB8 P;  3NZU A;  2EIM E;  4V3I A;  3G2S A;  1JCQ A;  3JUI A;  3AS5 A;  1DBO A;  2Y0B G;  4YC5 A;  3QWV A;  3VMV A;  2BM7 A;  5FZQ A;  4U95 D;  4F7A A;  2P58 C;  3CVL A;  3Q4A B;  3L6A A;  3ZKJ A;  4NAC A;  4CT4 A;  1E7U A;  3EIJ A;  2CG3 A;  4GMJ A;  5AJL A;  2WM9 A;  3TG5 A;  3QDN A;  4WAF A;  2LSV A;  3UT8 A;  4GPM A;  3HIZ A;  3QWW A;  4J8E A;  5IY5 E;  4JHR A;  4URK A;  1MQS A;  1PC2 A;  3DSU A;  4AY5 A;  4I2W A;  4U0S A;  3V31 A;  4JW1 A;  4APF A;  5FQ8 A;  4I9E A;  2BTD A;  2WXR A;  2OVB A;  2XQ0 A;  5BUZ A;  3PZ3 A;  3SFX A;  1OWP A;  3J5P A;  1FPP A;  1OWN A;  3JUR A;  2NC9 A;  2J4D A;  3GQA A;  4AXH A;  3AG3 E;  3TWS A;  4FJZ A;  2QY7 A;  4XKW A;  2CFZ A;  2VGX A;  4I6G A;  1IHB A;  4TXQ A;  4UI9 K;  1RWR A;  3BU8 A;  2PQR A;  2YQ8 A;  3MKQ B;  4N5Q A;  4B8A A;  2WXH A;  3DSV A;  4U96 D;  3C5R A;  4WWO A;  5AQA A;  2GRM A;  3ASG A;  4N39 A;  1H6K A;  3L9T A;  3ESL A;  1KCD A;  3QAQ A;  1N9A A;  2VBM A;  1OFD A;  4C9B B;  3Q47 B;  4MKT A;  4OJ5 A;  3MYV A;  5AJD A;  1SQM A;  2GGF A;  4DI3 A;  4D10 C;  3Q9N C;  4J8Y A;  3G2V A;  1MX2 A;  4Q96 A;  2ETC A;  4U7E B;  4YND A;  3TWR A;  3NOG D;  2GRQ B;  4KZC A;  3ZYK A;  3HXF A;  1SZ9 A;  2LUH A;  3RRM B;  1IQR A;  3VLE A;  3L54 A;  4GTP A;  3ZSC A;  3FU6 A;  4H7X A;  2IQC A;  4JD2 G;  3ONL A;  4OVV A;  3WXX A;  2YHC A;  4U4B A;  3JXI A;  3Q78 A;  2NSP A;  3LS8 A;  3U64 A;  1TN8 A;  2R02 A;  2I1J A;  4AY6 A;  3QJZ A;  2A5U A;  1KT0 A;  3HXE A;  3S7J A;  3SO8 A;  4HFG A;  2B0R A;  4YZA A;  4GCN A;  2EIJ E;  1TYX A;  2VBK A;  3D9H A;  1OCR E;  3GRH A;  1HS6 A;  5ENT D;  2XHE A;  3DWL G;  4E6H A;  5FQ6 A;  4L9P A;  5FWQ A;  3ZYL A;  1YCS B;  4DX1 A;  4TUU A;  4Z05 A;  3J5Q B;  4JPS A;  5DBK A;  3KEZ A;  4K5C A;  2XPZ A;  2X3M A;  5B3S E;  1OGO X;  3DRA A;  3CVX A;  4GYW A;  4DX6 D;  1H6P A;  2XGS A;  1QJV A;  5AQ9 A;  3K9I A;  5JMN D;  4DLO A;  2ETA A;  1SVX A;  5A23 A;  4OJL A;  3HDX A;  4GTM A;  4LG6 A;  1TJF A;  4CDR A;  2M63 A;  2OV8 A;  2HR2 A;  3LVQ E;  2X85 A;  3LMW A;  1LLZ A;  3FWV A;  1PXZ A;  2O0W A;  4HLL A;  3CK7 A;  2UVE A;  2RFM A;  2VFM A;  2LSU A;  2LNI A;  2QYJ A;  3CVW A;  3T9K A;  2BX6 A;  4YEJ A;  3GZ2 A;  2ZGD A;  1Z3Y A;  4BWR A;  4ILI A;  4DX5 D;  1OWM A;  1TNB A;  5JA4 D;  4YZX A;  1U2V G;  1TYW A;  5FQ7 A;  1OFM A;  5M72 A;  3KD7 A;  2KZT B;  4J8D A;  1RZ4 A;  4MS6 A;  2VJJ A;  3WWG A;  1H6O A;  4TUM A;  1H80 A;  3EDT B;  2VFO A;  2PNN A;  4LSZ E;  1D9S A;  1HF8 A;  3X2Q E;  3FUE A;  3B90 A;  5AN8 A;  3D3M A;  3UT7 A;  4Y6W A;  4HXI A;  1QRB A;  2J08 A;  2CHX A;  1UG3 A;  5EKQ D;  4OAV B;  3ABM E;  2XPI A;  4WND A;  1EDU A;  1TR4 A;  1QBQ A;  1WM5 A;  3OXG A;  3L82 A;  5CCL A;  2V5I A;  4XLF A;  5JHB A;  2PL2 A;  4HVB A;  1S64 A;  4X8Q A;  5ITZ F;  4YZQ A;  4CEM A;  2GRP B;  4HOR A;  2XC1 A;  4FC8 A;  3ULY A;  5J08 A;  1JPL A;  2WXO A;  4O1O A;  3PNL B;  1S63 A;  2VSY A;  5ANR A;  2J07 A;  2VFN A;  2IOS A;  2FEZ A;  2DZN A;  3EQN A;  1N94 A;  4HOU A;  1K1B A;  4LRZ A;  2PEC A;  5D66 A;  1AP7 A;  5AYW D;  1ELR A;  2XTW A;  2INU A;  1JWF A;  3EU5 A;  3T9G A;  2EIK E;  3D9O A;  2W7Z A;  2VJI A;  3ZHE B;  3U66 A;  1EA0 A;  4I6J A;  4C48 B;  3U3W A;  3AS8 A;  1HE8 A;  5CBN A;  1H2T C;  4KMO A;  4MXN A;  4HNA D;  4GPK A;  3FUD A;  2QY1 A;  2PM7 A;  2QZA A;  3DPY A;  1K5C A;  5E76 A;  5KCM A;  2UY1 B;  2UVF A;  2IFU A;  3FH7 A;  3PEU B;  3ASH A;  2NSZ A;  2LXM A;  2FBN A;  4UWH A;  3JX8 A;  4BSX A;  3R7Q A;  1LM1 A;  4NK6 A;  3OAW A;  1N52 A;  4RG6 A;  2KM4 A;  1S0P A;  3EUV A;  3HXD A;  1MJ0 A;  1SA4 A;  4XEI G;  2ZGG A;  1JCR A;  1OFL A;  3AU4 A;  5DNS A;  3T8K A;  2IO2 C;  3EIQ C;  5CMY A;  1DAB A;  4HI8 A;  4ABN A;  1TSP A;  4I17 A;  4WNE A;  2JLB A;  3ABK E;  4WWN A;  3SFY A;  1BI8 B;  3CVQ A;  2XPY A;  5CRV A;  2UY1 A;  4L2L A;  4XLA A;  3CR3 A;  4M3O A;  2L6J A;  4I6E A;  4YVQ C;  4DJA A;  3SHF A;  3ASO E;  3UIP C;  2OOE A;  1KT1 A;  3LJN A;  4YDW A;  1BN8 A;  1UOH A;  5DIZ A;  3CV0 A;  3KSQ A;  1PAQ A;  3SY2 A;  2VSX E;  5JHA A;  4OM9 A;  4EQF A;  2HE0 A;  3HVE B;  1PY1 A;  2Y4U A;  3U9W A;  4FHK A;  1JCS A;  3EHN A;  4XKC A;  2DVW A;  4GZ6 A;  5HI7 A;  5JMC B;  4UUC A;  4U0U A;  3S7F A;  3PZ2 A;  4JEU A;  3DEO A;  3RU0 A;  3EHM A;  4UWF A;  3LYC A;  3EU9 A;  3T8M A;  3HRA A;  4OJ6 A;  1JRG A;  3CHM A;  4ZHB A;  2OCC E;  2V4L A;  1HU3 A;  4GAA A;  2F8Y A;  4CCA A;  3CEQ A;  1FCH A;  3QOU A;  1OOC A;  5JLV C;  1CLW A;  4MLP A;  4XQF A;  1WMR A;  5AAR A;  4XI9 A;  3L13 A;  4AVZ A;  2C0M A;  2FUL A;  1INZ A;  3V2O A;  4EZL A;  3TWQ A;  2WMO A;  1IQU A;  4HLE A;  3TXN A;  1X0C A;  5BV0 A;  3KS2 A;  2HO1 A;  4Z03 A;  4XL9 A;  1WAO 1;  3FTS A;  4BTA A;  3FDH A;  4EZJ A;  1BI7 B;  3SGH A;  4I1A A;  4GMR A;  1U3C A;  4WWP A;  2NXP A;  2DCP A;  3FFL A;  3VSV A;  4GU5 A;  3ISM C;  4I9C A;  3O4Z A;  2NT9 A;  2LAH A;  1VBL A;  2L0I A;  4ANU A;  1QRC A;  4FHJ A;  4I1M A;  2NT6 A;  2E2E A;  4IRU A;  5C1D A;  4AVX A;  1L5J A;  1XNF A;  4DI4 A;  4BER A;  1SZA A;  3HG0 D;  4YDY A;  2KCK A;  3QC1 A;  3Q9U C;  2QYU A;  2A4Z A;  4U04 A;  2O6W A;  3ZPJ A;  2QX3 A;  4YVO A;  3ZEF A;  3MEK A;  5AIJ A;  1OWL A;  2IF4 A;  5LX8 A;  4N3B A;  4EW9 A;  4PMH A;  1YYH A;  3NQP A;  3P4G A;  3BQO A;  4Z68 A;  4L2Y A;  3ZXS A;  4YDT A;  2V5Q C;  3FP3 A;  5AQ7 A;  3EQO A;  3G2T A;  2WQH A;  3RIB A;  3TH0 A;  4LNG A;  3FY3 A;  2XGO A;  2VGX B;  3DU1 X;  5LCW C;  3MJW A;  1NHC A;  5LP0 A;  4DX2 A;  4F1P A;  4OAU C;  1HX8 A;  3E37 A;  2P9S G;  2V0P A;  3NZS A;  1MHQ A;  2XGM A;  4FP7 A;  4FLB A;  3ML3 A;  3AU5 A;  5CED B;  1O1T A;  3C98 A;  5EYL A;  2WPV A;  3FUH A;  3CSF A;  2CFU A;  4P29 A;  5BPP A;  2R5S A;  3JXJ A;  2X38 A;  4H7Y A;  3UM2 A;  4A1S A;  4YEL A;  3B4N A;  3UT4 A;  3UMV A;  3FUM A;  3DST A;  4BTB A;  3LY7 A;  2I1K A;  3CK8 A;  2BUG A;  3VTX A;  2P9K G;  3PET A;  4JL0 A;  1UN8 A;  5BXU A;  1N0R A;  4KT6 B;  4XOP A;  2P9I G;  5ENP D;  4XOT A;  2AJA A;  3LKU A;  3B13 A;  3TG4 A;  1O8I A;  1X81 A;  4GB9 A;  2C2L A;  1IXV A;  1EPU A;  4HI9 A;  5ENS D;  4NUR A;  4DRX E;  1E8X A;  1HFA A;  1G3N B;  3FTV A;  3DSX A;  2WQ7 A;  1RMG A;  4DUI A;  4XR6 A;  3V79 K;  4W9R A;  4CGW A;  3U4T A;  1IB4 A;  1K3Z D;  2MRI A;  2MOW A;  1TNY A;  1H19 A;  2PZI A;  4OZZ A;  2IU1 A;  1IHG A;  4EEC A;  5BXO A;  3B7R L;  2XZD G;  4JZY A;  2NZM A;  3Q5M A;  2VQ2 A;  2NTQ A;  2L9B A;  2XEV A;  5BW8 C;  4UQY A;  3RSE G;  4BET A;  4AOF A;  2FO1 E;  2H6G A;  3GQ7 A;  4YFO A;  2DZO A;  1TNU A;  3DEP A;  3CIA A;  5CEC B;  3MCX A;  2IY0 C;  2P9L G;  3E30 A;  4B94 A;  5AQB A;  2H6I A;  2CHW A;  4HOT A;  3C72 A;  5KNG A;  4U8H A;  5T3R A;  1OT8 A;  3URZ A;  2NYJ A;  3R7R A;  3HHM A;  4LNB A;  4ANW A;  5KBA A;  4O60 A;  3FTW A;  3LJ3 A;  1DC2 A;  3CK9 A;  5EDS A;  3AG2 E;  3CHR A;  3TWV A;  4Q69 A;  4FLH A;  3LY8 A;  3LYA A;  3PZD A;  4G25 A;  1XG2 A;  5ENO D;  2KAT A;  2EIN E;  1AWC B;  1ZU2 A;  3IHY A;  3ZNG A;  2KCL A;  5EX3 A;  3T5X A;  1SA5 A;  2XS1 A;  4AP2 A;  4I43 A;  3FUI A;  5J90 A;  4E85 A;  2J8K A;  1UJJ A;  1LD8 A;  5G05 C;  2WXP A;  4BES A;  3DPD A;  3TWW A;  3PRE A;  1BLX B;  5ARF A;  4ZFH A;  1N0Q A;  5LOZ A;  3B7U X;  4XNF A;  1KTW A;  2A5E A;  1D8D A;  3S2A A;  1H2U A;  2YIN A;  5G2N A;  4ILH B;  1O8L A;  5ENN A;  1O8E A;  1UJK A;  2XCC A;  4FUL A;  2MYO A;  4RVB A;  4CDM A;  3ASN E;  4KZ0 A;  3ML9 A;  3IV0 A;  4EPZ A;  3FTY A;  1QA2 A;  1NA3 A;  2DYR E;  1FVH A;  2R2L A;  1OUV A;  3B7S A;  4BSZ B;  3SNX A;  1O8K A;  3PSZ A;  4ANV A;  3QKY A;  3UM1 A;  3RJV A;  2WXJ A;  4NIK A;  5D0O D;  3Q15 A;  4OPW A;  3RRU A;  1QQE A;  5G04 C;  4OYS A;  3OTN A;  3H09 A;  4NQ0 A;  2WXI A;  4AEZ C;  4ACL A;  5EID A;  4GCO A;  3PDN A;  2RG8 A;  1KZP A;  1NP7 A;  5JJ6 A;  4GA0 A;  1WY6 A;  1QQ1 A;  4GML A;  4PS3 A;  3DXK G;  5E75 A;  4M7C A;  2HYZ A;  3Q75 A;  2LXL A;  2FI7 A;  3E34 A;  3ZPP A;  3E4B A;  3N71 A;  4PH4 B;  4GZ3 A;  4B89 A;  3L22 A;  3ML8 A;  4GTT A;  3D9N A;  3Q49 B;  2F0Y A;  1BU9 A;  2H6H A;  3SBS A;  3CQG B;  1JTA A;  4I1O B;  3SYJ A;  4F6R D;  4JC8 A;  5EYP F;  3O48 A;  4PS7 A;  3QB2 A;  1UN9 A;  3ZU7 B;  1VDY A;  1TNZ A;  2J9Q A;  2YNQ A;  4OVU A;  3KEA A;  4A55 A;  2RKK A;  3NF1 A;  5CBO A;  2P9N G;  1WDY A;  3GZ1 A;  1QA1 A;  3FUJ A;  4N2Q A;  1EE6 A;  4ILG A;  3FY4 A;  3LDZ A;  4RQI A;  4U49 A;  3N6Z A;  1IYG A;  3ZGQ A;  4G8K A;  5HKP A;  3JYS A;  5FZS A;  1HF2 A;  3EJN A;  3EHQ A;  3ZW3 A;  1YA0 A;  2IO3 C;  1N4P A;  2QFC A;  5KJK A;  4A3V A;  2VTB B;  1NFI E;  4HS2 A;  4O6F A;  3UTM A;  4BFR A;  2F8X K;  1FT1 A;  4XMY A;  4CYM D;  4G23 A;  4XI0 A;  3PUK A;  3FUK A;  5T8I A;  3FH5 A;  1MZC A;  4XX5 A;  3LVR E;  4B8C B;  5KJM A;  2KXP C;  4F53 A;  4U0Z A;  2XTY A;  5D0Q D;  3TJP A;  4LNU D;  2FF4 A;  2VBE A;  3CVU A;  2AWI A;  3UPV A;  3CHS A;  4N2S A;  3PNT B;  5FTP A;  4BX9 A;  5FZR A;  4FU3 A;  4L1B A;  1TN6 A;  4HOQ A;  4HWV A;  3CHO A;  2BM4 A;  2HM8 A;  5HS0 A;  4K5B A;  2EIL E;  5C1E A;  2JAB A;  4N3A A;  2INV A;  2BM5 A;  3BG1 B;  4OZY A;  2VTB A;  1TJC A;  2QXZ A;  4K0R A;  5AMV A;  1E8Z A;  4GTS A;  4UI9 C;  1L1I A;  3KAE A;  1O1S A;  1K1A A;  4G8L A;  1ZB1 A;  1IDJ A;  1H2V C;  3CVY A;  3CKC A;  3I4R B;  3Q7F A;  1OY3 D;  2NST A;  1EYH A;  1TYQ G;  4N5C A;  4L7T A;  1ELW A;  3NOC D;  1IDK A;  1O8G A;  3IHV A;  4WNG A;  1PLU A;  2Y4T A;  2WXM A;  3P1U A;  2WXK A;  3PSS A;  5G04 J;  1D8E A;  2WXQ A;  4MBG A;  2DIW A;  3L17 A;  2AXV A;  4NK8 A;  5EIL A;  4XKB A;  4AJW A;  4CDN A;  3SBT B;  1TNO A;  3FUF A;  1DCE A;  2J4B A;  3Q79 A;  1E7V A;  3GQ9 A;  3JUE A;  3L08 A;  3LJY A;  4HRL A;  4GTV A;  1H0A A;  2QC9 A;  3NB2 A;  2X6Y A;  2NTB A;  2ETB A;  2GRN B;  3CVN A;  4JEH A;  5FQ4 A;  1GW6 A;  3I5P A;  1O8H A;  1AIR A;  1DCQ A;  1KZO A;  4ANX A;  4DK5 A;  3G2W A;  4APO A;  4W8R A;  4U07 A;  1Q2Z A;  2X6X A;  2WVI A;  4R7L A;  5A7D B;  3VMW A;  3UW0 A;  1LF8 A;  2VYI A;  3PZ1 A;  2JEK A;  3AK5 A;  1QZ2 A;  2XCB A;  1A17 A;  4CT0 A;  3JQ0 A;  2X3H A;  3CHQ A;  4RG9 A;  4ACK A;  4O1P A;  3PZ4 A;  4ATZ D;  5BT1 A;  1RW2 A;  2F3L A;  2BED A;  1DVP A;  3UXG A;  2WXF A;  1V54 E;  1ZBP A;  4RSY A;  2WMN A;  1N4Q A;  3V2X A;  3OXF A;  4W8Q A;  3VSU A;  1QYM A;  5LFA A;  3MX3 A;  2G0Y A;  3RIQ A;  3QAR A;  3UM0 A;  3TWU A;  2WXL A;  1O5M A;  4YCQ A;  2XS8 A;  1Z3X A;  2I6H A;  1HO8 A;  4N3C A;  1LTX A;  4UWL A;  4KYO B;  3C3R A;  5FT9 A;  3RAU A;  1QA3 A;  4JHJ A;  1P5Q A;  4MRU A;  4PS8 A;  3AG1 E;  3D9J A;  2BSP A;  3ABL E;  3IXE A;  2KBX A;  1N4S A;  3ASD A;  3ZIM A;  3B8Y A;  5CCM A;  3HXB A;  1IKN D;  4XLE A;  4C0E A;  1NI1 A;  3TGO A;  2I2O A;  3V30 A;  5FIO A;  4MR0 A;  4A3T A;  3VLF A;  4XLC A;  1Y6I A;  2BM6 A;  5D2M C;  2V8S E;  2X6F A;  2O04 A;  2PYG A;  3UIO C;  2IEJ A;  2XRY A;  1TYV A;  3CST A;  3IKO B;  4J8F A;  3ASF A;  3UM3 A;  5ARG A;  2L0T B;  2C0L A;  3LY9 A;  1E90 A;  3UI2 A;  4GTQ A;  4GZD A;  1Z6T A;  1OCO E;  4UI9 J;  3JCK C;  4QFV A;  5CRU A;  5CEA A;  4IYP A;  1X5B A;  3BH7 B;  2IQ7 A;  4UQZ A;  2GRO B;  3UIN C;  2V4H C;  4A63 B;  3JQ1 A;  4JA7 A;  3AJI A;  1JWG A;  3ZXP A;  3UKU G;  3DSS A;  3LPZ A;  1DNP A;  2WXN A;  3RO2 A;  1TN7 A;  2Z8G A;  1K8F A;  3WG7 E;  4XN3 A;  4KVO A;  2WB2 A;  2KCV A;  2O17 A;  3DXM G;  1OXJ A;  2H6F A;  2J49 A;  1U3D A;  4XON A;  4B93 B;  3GZS A;  4ME2 A;  3S7D A;  3TL5 A;  4GA1 A;  5C2Y A;  3MKQ A;  5AAO A;  2EQX A;  2ION A;  4FAD A;  1JUQ A;  2X6W A;  5EX0 A;  2WXG A;  4XKV A;  3SQV A;  2GW1 A;  1Z5S C;  1MX4 A;  1HG5 A;  3D9P A;  3ZUV B;  2ILR A;  1N4R A;  2RFA A;  4W8S A;  3CHP A;  1TYU A;  2PYH A;  2VFQ A;  3MA5 A;  2F37 A;  4U8V D;  1TEZ A;  4HB5 A;  4RLY A;  3QWP A;  3L16 A;  2LO6 A;  3RKV A;  1K8K G;  1OCC E;  3ZN3 A;  4BX8 A;  2VSO E;  3ESK A;  2ZXW E;  3D9K A;  3FEY A;  4Y6C A;  3VLD A;  5A6C A;  2GRR B;  5ENR D;  4CGV A;  4TXP A;  5EN5 D;  4EBA G;  3T5V A;  2XEN A;  4KVM A;  1N54 A;  3ENE A;  3HYM B;  5FIN A;  2DBA A;  2IJG X;  4CZ2 D;  3RRN B;  3ZVV A;  2ZU6 B;  4I2Z A;  4UQX A;  2DWZ A;  4IUL A;  2BKG A;  1LLW A;  4UWK A;  4U8Y D;  1KPS B;  5KNH D;  4AIF A;  4GA2 A;  4G2V A;  2Y3A A;  1HG8 A;  3KRG A;  5BV1 A;  1E8Y A;  1NL4 A;  3Q73 A;  5LCW J;  1YMP A;  3DSW A;  1OFE A;  4AM9 A;  3PEV B;  4YDE A;  2BKK B;  3C3Q A;  4XM3 A;  3CVV A;  4DPR A;  3I3N A;  3BG0 B;  4K03 A;  4GYO A;  3PH0 C;  2J8I A;  1SW6 A;  5CHE E;  2CG2 A;  4KH3 A;  3FTX A;  4LUN U;  3QNK A;  4B0Z A;  2VGE A;  4OJP A;  2O1D A;  1FVF A;  4G24 A;  2X6H A;  2UWJ G;  2AVP A;  4G26 A;  2B0O E;  2XEE A;  1NA0 A;  5KJL A;  3G2U A;  2R59 A;  2OVF A;  3MGB A;  4JA9 A;  3E33 A;  2E0I A;  2PQN A;  3NAW A;  3ULE G;  2ZIR A;  1N11 A;  2BF0 X;  3FTU A;  1O8M A;  4A1G A;  3CVP A;  2O0V A;  3D9L A;  3FU5 A;  2R03 A;  1NZN A;  3IEG A;  4HOS A;  2B6C A;  1HH8 A;  3PS6 A;  2Y1L E;  5FJY A;  3RO3 A;  3APF A;  3LCA A;  3UKR G;  3D9M A;  3R9A B;  2EWE A;  3ZRH A;  4FA6 A;  1UW4 B;  2YUH A;  3EHR A;  3FU3 A;  1KCC A;  4BEP A;  1ELK A;  4GYY A;  4L23 A;  3MV2 B;  1BHE A;  2Y69 E;  5H7P A;  4EZK A;  4DX7 D;  3R9M A;  3TWX A;  4HRN A;  1IA5 A;  2KZT A;  3CGH A;  1WXR A;  1EF1 C;  1O1R A;  3FTZ A;  3OXL A;  2FO7 A;  2KC7 A;  5CMW A;  3ZYM A;  2ZIS A;  3Q7A A;  4HQD A;  3BH6 B;  5T4Y A;  3UX4 A;  1BPO A;  3SZE A;  1RU4 A;  2ODL A;  4HBD A;  4XE0 A;  3NBN B;  3SZ7 A;  2R17 C;  4J8S A;  3B95 A;  5EIB E;  3E32 A;  2J8S D;  1OWO A;  1QNF A;  1N95 A;  4KXK B;  1EZG A;  2VFP A;  3N90 A;  4BY6 A;  1XGW A;  5B1A E;  4EBA A;  1OGM X;  1HZ4 A;  1MYO A;  3ZYQ A;  2VSN A;  2CHZ A;  2YHE A;  3SF4 A;  2XRZ A;  4QQI A;  4GTO A;  3QK0 A;  4U63 A;  4YZ0 A;  2OEV A;  4XIF A;  5KWD A;  3FHE A;  2X6I A;  3C3O A;  2MHK A;  2DYS E;  3APC A;  3FU0 A;  1K4Z A;  2XEH A;  2AXU A;  3MZL B;  4J6I A;  4DLQ A;  4GZC A;  3VTY A;  4JRA C;  2P2C P;  3S7B A;  5AEN A;  4GTR A;  1BD8 A;  4NRH B;  3AS4 A;  3PRZ A;  5ENQ D;  2AW6 A;  4URR A;  4BT9 A;  4F3V A;  3PE3 A;  3F6Q A;  5KJN A;  3ZHE A;  4PUC A;  3PE4 A;  4V02 C;  3UQ3 A;  3W9G A;  4LEU A;  4BT8 A;  4TRQ A;  1HXI A;  4XLH A;  3PUJ A;  3LEW A;  3FUN A;  1MX6 A;  4OJO A;  4UWG A;  2XZT G;  3ULQ A;  3APD A;  5CER B;  3LXU X;  4LCT A;  1O8J A;  5G05 J;  1E96 B;  2VGY A;  3I4G A;  4ATG A;  2LAI A;  4WUY A;  2R05 A;  3GQ8 A;  3AAA C;  1LD7 A;  3B7B A;  1DBG A;  4HRM B;  3SUC A;  4JHK A;  1O8D A;  4TXR A;  1KLX A;  4YEI A;  2I9C A;  3GYZ A;  3IBE A;  4G1T A;  3AG4 E;  4IN3 B;  3FUL A;  1FT2 A;  4W8T A;  2WQ6 A;  2NTP A;  3MV3 B;  3TAX A; 
#chains in the Genus database with same CATH homology
 5DNS A;  3SQV A;  4YEI A;  4YCQ A;  3PSZ A;  4YDT A;  2J8K A;  4YFO A;  2QYU A;  2QZA A;  2XT4 A;  2XTW A;  2XTY A;  2O6W A;  2XTX A;  3NAW A;  2XT2 A;  3SY2 A;  3PSS A;  3DU1 X;  3NB2 A;  4YC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...