3NB2A

Crystal structure of e. coli o157:h7 effector protein nlel
Total Genus 222
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
222
sequence length
612
structure length
612
Chain Sequence
QGRACLSKAELTADLIWLSANRTGEESAEELNYSGCDLSGLSLVGLNLSSVNFSGAVLDDTDLRMSDLSQAVLENCSFKNSILNECNFCYANLSNCIIRALFENSNFSNSNLKNASFKGSSYIQYPPILNEADLTGAIIIPGMVLSGAILGDVKELFSEKSNTINLGGCYIDLSDIQENILSVLDNYTKSNKSILLTMNTSDDKYNHDKVRAAEELIKKISLDELAAFRPYVKMSLADSFSIHPYLNNANIQQWLEPICDDFFDTIMSWFNNSIMMYMENGSLLQAGMYFERHPGAMVSYNSSFIQIVMNGSRRDGMQERFRELYEVYLKNEKVYPVTQQSDFGLCDGSGKPDWDDDSDLAYNWVLLSSQDDGMAMMCSLSHMVDMLSPNTSTNWMSFFLYKDGEVQNTFGYSLSNLFSESFPIFSIPYHKAFSQNFVSGILDILISDNELKERFIEALNSNKSDYKMIADDQQRKLACVWNPFLDGWELNAQHVDMIMGSHVLKDMPLRKQAEILFCLGGVFCKYSSSDMFGTEYDSPEILRRYANGLIEQAYKTDPQVFGSVYYYNDILDRLQGRNNVFTCTAVLTDMLTEHAKESFPEIFSLYYPVAWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Biochemical and Structural Studies of a HECT-like Ubiquitin Ligase from Escherichia coli O157:H7.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ligase
molecule keywords secreted effector protein
total genus 222
structure length 612
sequence length 612
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13979 SopA_C SopA-like catalytic domain
A PF13981 SopA SopA-like central domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.4140.10 Mainly Alpha Orthogonal Bundle effector protein (NleL) fold effector protein (NleL) 3nb2A04
1.25.40.300 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Putative secreted effector protein 3nb2A02
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 3nb2A01
3.40.1850.10 Alpha Beta 3-Layer(aba) Sandwich HECT-like ubiquitin ligase fold HECT-like ubiquitin ligase 3nb2A03
2XTWA 2XTYA 2XT4A 5DNSA 3SQVA 4YFOA 2QYUA 2XT2A 3PSZA 3NB2A 4YEIA 2J8KA 4YCQA 4YC5A 3SY2A 2XTXA 3DU1X 3NAWA 2O6WA 2QZAA 3PSSA 4YDTA
chains in the Genus database with same CATH superfamily
5FQ4A 4EHMA 2NT9A 1Z5SC 3AJIA 1PAQA 1JCRA 2LNIA 1OXJA 3Q47B 3CEQA 3CLJA 5LCWJ 3RKVA 5CMWA 1OWPA 4HB5A 4HRNA 4TUUA 2PYGA 2Y3AA 2NZMA 2MYOA 2KC7A 1E90A 1IHGA 2P58C 2BTDA 3EQNA 3IXEA 3CVUA 3ABLE 1VDYA 3S7BA 2XRYA 1E8YA 4BSXA 3NZSA 1A17A 4I2ZA 4QFVA 4U49A 1HZ4A 2V5FA 1QA1A 3KSLA 1O8FA 3UUXA 2XTWA 3ML9A 1KTWA 4YVQC 1N0RA 1O8KA 1ELKA 1N9AA 3GZSA 3RO2A 4RG9A 4LNBA 4K0RA 3ZRHA 3ZYMA 4HNAD 4TUMA 3SNXA 3NAWA 1BPOA 4LNGA 2RFMA 1D8EA 3JCKC 2XTYA 2I9CA 1DBGA 1N52A 1YCSB 4WUYA 2LXMA 2WVIA 4TXRA 2R59A 3L6AA 2LAHA 3PS6A 4UWHA 3WXXA 2A5EA 5D2MC 2MOWA 2BUGA 4GMLA 1IDJA 4CGWA 1QJVA 4V02C 3EHQA 4I6JA 3B7BA 1TN6A 4A1GA 4E6HA 2A5UA 3HVEB 4Z06A 4YNDA 5KJLA 4PH4B 3EHMA 2C2LA 4I9EA 1OGMX 2PQRA 3E32A 3OXFA 3NQPA 1P5QA 3J5QB 4W8QA 3OXGA 1DCQA 3L17A 2L6JA 3CK7A 4DI4A 1JCQA 5CRVA 3X2QE 3EQOA 3O4ZA 3NOCD 5EX3A 5AARA 3NB2A 4YEIA 4ATGA 3G2VA 4J6IA 5A6CA 4LRZA 2J49A 1TJFA 3TAXA 4KBQA 4U0ZA 1O5MA 4C0MA 2O04A 4BT8A 1TYXA 3ENEA 3EIJA 1OFEA 3MV2B 5CHEE 4GTQA 4K5CA 3L9TA 3RIBA 1OGOX 2XGSA 1YA0A 5AMVA 1S0PA 4GU5A 1X5BA 4N39A 4WNFA 1UG3A 2WXRA 4TV3A 2I2OA 2M63A 2EQXA 3MX3A 2WMNA 4ZFHA 3TG4A 1KT1A 3U3WA 2VSOE 2Y4TA 2GRQB 4XEIG 2L0TB 5FWQA 2PM7A 3GQ8A 5FQ7A 5BXUA 1QBQA 4AEZC 3FU0A 4NK8A 3ZYKA 4PS3A 4LNUD 5AJLA 3TXNA 4YZQA 1E7VA 4A1SA 2IQCA 3UM3A 4DRXE 3MZLB 3VTYA 1MQSA 3SY2A 2MRIA 1N4QA 5EILA 1IXVA 4DX6D 3CHPA 3VSTA 1RWRA 1TSPA 4GYWA 1MX6A 3ULYA 1DABA 4XM3A 3Q49B 2BKGA 4HI8A 5EIBE 4GZ6A 4U0UA 3SI5A 1XGWA 1UW4B 4ABNA 1WXRA 4C2LA 3LMWA 3MKQB 1H2VC 4U04A 4OZZA 2R2LA 2CG3A 4URRA 4L9PA 1LTXA 1X81A 4ANUA 2ZGGA 3RSEG 4A3VA 4IULA 4FU3A 3FTWA 4YEJA 2LO6A 2P2CP 3D9OA 1OWOA 4XOTA 4I9CA 1N4RA 4HFGA 5D0QD 3GQAA 2INUA 3TGOA 2FULA 3Q79A 4EZJA 2HR2A 2DBAA 3HG0D 1N4PA 5LP0A 3FUEA 5ENPD 5HRYA 4XMYA 5FINA 3S7DA 3ZXPA 2WXOA 3CVPA 5CRUA 4AV7A 2OVBA 4YDYA 3VTXA 4Z68A 3CIAA 2J8SD 3E37A 3WWGA 3CVXA 2RG8A 3PUJA 2JLBA 4N3AA 4GYOA 4EQFA 1EPUA 1KCDA 4OPWA 1WDYA 1OWNA 3LXUX 3IHVA 5FTPA 4XN3A 3ASGA 3PEVB 4AY5A 4L23A 1D9SA 4PS8A 2PQNA 1ZB1A 3QK0A 2IJGX 3HYMB 3NZUA 1QA3A 4XLHA 2LAIA 1TJCA 3AS5A 4AXHA 3BH7B 4HXIA 3ZIMA 1D8DA 2VYIA 2XT2A 4YZXA 3LVQE 3DWLG 3CHSA 4XQFA 4XNFA 1JRGA 5EX0A 1H0AA 5KJKA 3NF1A 3FUJA 3AAAC 1DCEA 4JA7A 1IQRA 3ABME 2O1DA 2GRPB 2LXLA 1WAO1 1JCSA 4GYYA 4KXKB 3ZU7B 2QY1A 3ESLA 2XCBA 1IYGA 2IY0C 4IRUA 4W9RA 3IKOB 4L7TA 3LY7A 4YDEA 4XN0A 1QQEA 3IBEA 4C0EA 2VFOA 4XLEA 2J4DA 3AG1E 1LLWA 4BX9A 3FUIA 1OWLA 2GGFA 4MS6A 5BXOA 1O1SA 4XLAA 4DLOA 3FFLA 4YDTA 3T5XA 3DEOA 3DSVA 1Z3YA 2QY7A 3KS2A 3AG4E 2X6JA 4FHJA 4GZ3A 5J90A 2IOLA 1N11A 2V4HC 1Z6TA 4AIFA 5D0OD 3DEPA 5A7DB 2XQ0A 3V2XA 5T8IA 2G0YA 3QC1A 4MR0A 1X0CA 3UI2A 1WG0A 1IQUA 4UQZA 5AYWD 1QCXA 4XLFA 2ETBA 3ZNGA 3SYJA 4UI9J 4N2QA 1CLWA 2XEHA 3UMVA 3DSUA 3FULA 4EBAG 1TR4A 1QNFA 4FULA 4RSYA 4YZ0A 1QRCA 1JWFA 1EA0A 4N3BA 4DX7D 2IQ7A 4EW9A 2EIJE 4BESA 5BT1A 4I2WA 1TNZA 4G25A 3D9IA 1B89A 4KZCA 4B8CB 4XI9A 4FJZA 3C3RA 3LCAA 5ENOD 2PNNA 2EINE 2L9BA 4J8SA 1JTAA 4EZLA 2HYZA 4CT4A 3KRGA 1WY6A 3CVLA 2FBNA 4XIFA 2I6HA 2J8KA 5J08A 3JUIA 3G2WA 3JXJA 5ENRD 4E85A 3FTSA 4YC5A 1UN8A 5G05C 2E0IA 3CHQA 4F7AA 3E4BA 3C3QA 5ENTD 3J5PA 1NZNA 1PE9A 3PE3A 3ZXSA 1OCRE 2DYRE 2ONDA 1XNFA 1O8EA 4JC8A 4OZYA 1TYUA 3B90A 3JYSA 1TYWA 3S7JA 3R9AB 3G2TA 2OEWA 2KZTB 2H6FA 5EIDA 3ULEG 4RG6A 4BERA 1TN8A 5BV1A 4IN3B 2BM4A 4L2LA 3OAWA 4AJWA 2VJIA 2AWIA 1RZ4A 3V2OA 1ZU2A 4XX5A 2O0VA 4UWFA 4ME2A 1QQ1A 1EZGA 1O8LA 3ZPPA 4FP7A 2F0YA 2VSYA 5CEDB 4N5CA 5DIZA 4G8LA 1Q2ZA 1ZBPA 1N95A 4LUNU 3D9LA 2UY1A 4GZDA 4FJYA 5KCMA 2ZXWE 3TWXA 4YELA 1FPPA 4GTSA 2XT4A 2XHEA 4R7LA 3N90A 1PXZA 2V4LA 3HIZA 1K1BA 4K5BA 3QWWA 3Q75A 3GZ2A 2OV8A 4L2YA 2PZIA 2YUHA 4GA0A 4X8QA 1TYVA 3SFYA 1DVPA 1RU4A 1LF8A 4G11A 4GTRA 3FUHA 4K5AB 2VFPA 1HE8A 1HF2A 2WXMA 3I4GA 4YDOA 2KCVA 1Z3XA 1H2UA 3GYZA 1SW6A 1HH8A 3ML3A 3ISMC 3KAEA 4EECA 4UWGA 4CCAA 1N4SA 1AIRA 2ILRA 1E7UA 3APCA 1N94A 2V5IA 3E30A 4F3VA 5JLVC 3SFXA 3DU1X 1BU9A 4OAVB 3HHMA 3LDZA 1K1AA 4GA2A 2RKKA 3V31A 4Z03A 4N5QA 4U7EB 3Q78A 1KZOA 1W3BA 5AQAA 3TWTA 1NHCA 1O8IA 2GRNB 2X38A 4J8DA 4JHKA 3G2SA 5CCMA 2BM5A 3MGBA 3PETA 4I17A 3CSFA 1OCCE 3FUMA 5C2YA 4GTPA 2VGXA 2WB2A 2XPZA 5FQ6A 2L6BA 2R05A 4D10C 1HU3A 1NA0A 3B8YA 2XENA 5FT9A 3UT4A 4G23A 2A4ZA 1HFAA 1HF8A 5HS0A 3VLFA 3CK9A 2O6WA 4ILGA 2E2EA 1LD7A 2ETAA 4HOUA 2HM8A 2IFUA 2XS8A 4HLLA 4ANXA 2IEJA 3I4RB 3HDXA 4HVBA 3IHYA 4YZAA 3IEGA 4BEPA 5C1CA 1AP7A 3APFA 5EKQD 2KCLA 2EIME 2CG2A 3D9PA 2PM6A 2VGEA 2ODLA 4AVZA 3TL5A 3LY8A 4J7WA 4HBDA 3Q4AB 2YNQA 3GZ1A 1HXIA 3L82A 3FU3A 3E34A 2XC1A 2C0LA 3VMWA 1S63A 2NSPA 4YVOA 4FADA 2AXVA 1GW6A 4O6FA 2J8IA 4C9BB 3NOGD 1BD8A 2XZTG 4XE0A 3CHRA 3KEZA 3PEUB 3W9GA 4V3IA 1OFLA 1EE6A 3RK6A 5KWDA 4DPRA 1EYHA 3MEKA 2INVA 5AN8A 2VFQA 4U4BA 4DLQA 4PS7A 4U8HA 5EDSA 2F8YA 1PC2A 2F8XK 4PUCA 4WWNA 2WXLA 3LJNA 3ASNE 5FJYA 3RRNB 3T8KA 2XEVA 2WXKA 4XONA 1U3DA 4XI0A 4I6EA 3AU5A 4BT9A 3FUDA 3ZPJA 3E33A 4HI9A 2RD0A 3IV0A 4U07A 4AM9A 3HXDA 1NL4A 3TWWA 4APFA 1O1RA 3UINC 4HLEA 3DSTA 3GQ9A 5LFAA 3Q5MA 2XS1A 2VTBB 2DZOA 5G2NA 2BF0X 2QFCA 4GZ5A 1VBLA 3DSXA 4L1BA 4U8YD 4HOQA 3FH8A 2O17A 4C48B 2X6HA 2X6IA 2AJAA 3DXKG 3JURA 4DX1A 3BH6B 4FLBA 4UWKA 1O8GA 2P9SG 3SFZA 1YMPA 2VSNA 3RJVA 3KD7A 2X6FA 1OT8A 2IONA 1UOHA 3TJPA 3BQOA 3C72A 3D3MA 4APOA 4YCQA 2IO3C 4BX8A 2Y69E 4EZKA 4OVVA 4LCTA 5B3SE 1O8JA 4A3TA 4GPMA 4FC8A 2NYJA 4GTVA 4GTOA 5CCLA 1BLXB 2AW6A 4U96D 2XRZA 4I1AA 1OCZE 5JMND 2FF4A 3B13A 3QOUA 3UXGA 4LG6A 2BX6A 1KPSB 3CHOA 4KVOA 3EJNA 5HKPA 5H7PA 3CVQA 2KXPC 4BTBA 4F1SA 4GCNA 5ARFA 1TEZA 3PDNA 3UT7A 4PDXA 4H7XA 2MHKA 3LJ3A 4J8YA 1IKND 2P9UG 3DRAA 2CFUA 3VMVA 4CYMD 4UWLA 5KNGA 4K03A 4OJ6A 4RLYA 2ZGDA 1QZ2A 4AY6A 1OFDA 2Y4UA 5B1AE 4U0SA 1IDKA 2PL2A 3JQ0A 4MKTA 3C98A 3PZ2A 1U2VG 2LSVA 1HO8A 2YINA 2WXFA 3CK8A 4GMJA 4ACLA 4OAUC 5FZRA 4HORA 5CBNA 3Q9NC 5ITZF 3SD5A 1K8FA 1MX4A 2L0IA 3LVRE 2JABA 3D9KA 1TN7A 4DJAA 2IOSA 3B4NA 5ARGA 4B89A 5CERB 4HS2A 3DPDA 5FIOA 3SO8A 3LEWA 2H6IA 5FZQA 3Q7AA 2IU1A 5M72A 3KEAA 1IB4A 1SQMA 2ZISA 4WWOA 3S7FA 3FDHA 3FU6A 2VJJA 5E75A 4TXQA 3R9MA 4M7CA 3EUVA 3ONKA 3QAQA 3JUEA 1N54A 2V5QC 1YYHA 3CGHA 1O8HA 3AG3E 3RRUA 2P9NG 3O48A 2DWZA 4UQYA 3T9GA 3JQ1A 1BI8B 1AWCB 1QA2A 1MX2A 4KMOA 4FLHA 1JWGA 1SA5A 2QZAA 2R02A 3AK5A 2CHZA 3GRHA 2GRLA 1SA4A 1CZFA 1XG2A 2WMOA 3PH0C 3HRAA 1RMGA 3DPYA 4JD2G 2WXIA 4G26A 2B6CA 3SGHA 3URZA 4MXNA 5E76A 2FEZA 1LLZA 3FTUA 4XKWA 5BNWA 3L08A 4AOFA 2DYSE 3UM0A 3UTMA 3ZYQA 2DCPA 5DNSA 2R17C 2NC9A 2NXPA 3BG1B 1V55E 4B94A 2DVWA 2AXZA 4G24A 4AVXA 2LUHA 4G1TA 5DBKA 4JPSA 4O60A 1FVFA 1OOCA 2ZU6B 4JEUA 3QKYA 5ENQD 5IY5E 4P29A 4HRMB 2H6GA 3FWVA 3FY4A 4JZYA 3R7RA 3CKCA 3DXMG 3PRZA 3SHFA 1K5CA 3QWPA 5AQ7A 4I6GA 3FUKA 3P4GA 3TWUA 3T9KA 3T5VA 3FEYA 4UUCA 3FY3A 4HQDA 4I1OB 3Q15A 3FH7A 1L5JA 2VFNA 3G2UA 3MCXA 4NQ0A 2F37A 4A55A 4W8RA 2DIWA 1JPLA 4GTTA 2WQHA 2XTXA 2VGYA 4NURA 4GA1A 4LEUA 3QDNA 3CVVA 1TNYA 4YFOA 3VSUA 3HXCA 2KBXA 2UVEA 3AU4A 1QYMA 1NA3A 3UM1A 4URKA 5KJMA 3SBSA 1LM1A 3UKRG 1HG5A 1S64A 4GPKA 4JL0A 1KLXA 3R7QA 3ONLA 1Y6IA 4I1MA 4GMRA 1IHBA 2XCCA 2FI7A 3TXMA 2XPIA 2XGOA 3C5RA 2WXNA 2CHXA 3ZHEA 4LSZE 2WQ6A 4BFRA 1E8XA 2GRMA 3ESKA 2J9QA 1FCHA 2V8SE 4U63A 1ELWA 2QC9A 3EIQC 4DX2A 2J08A 4OJ5A 1NFIE 4O1PA 4EBAA 1K3ZD 2IO2C 3GQ7A 4XKCA 4HOTA 5AAOA 1FVHA 3APDA 3HXBA 3CQGB 3SBTB 2FO7A 1L1IA 3V79K 2NTBA 4DUIA 4KVMA 5KBAA 1RW2A 2X3MA 4U8VD 5FZSA 2KATA 3L16A 4WAFA 2W7ZA 5G55A 4CRWA 1LD8A 3OXLA 3QNKA 2VFMA 5CBOA 2HE0A 3ASDA 3GW4A 3LS8A 3LJYA 5G05J 3BUAA 1WMRA 3W9FA 2J4BA 2FO1E 4CT0A 4O1OA 2OCCE 2CFZA 1TYQG 1K8KG 2WXHA 3PSZA 3CQCB 2VBKA 3F6QA 3JXIA 3QJZA 3HXEA 1K4ZA 2WM9A 3KSQA 2PECA 1E8WA 5EYPF 4CEMA 4CDMA 4GCOA 1SVXA 5AENA 3SUCA 4KYOB 2KZTA 4JW1A 5JHAA 4NIKA 1GQ8A 2JEKA 2KM4A 3UQ3A 3L22A 3FTYA 5BUZA 1MHQA 2VTBA 1V54E 2OEVA 4J8FA 1A5EA 2X6XA 3ZN3A 3TWSA 5JHBA 3HVEA 2GW1A 4PMHA 2R03A 4F6RD 1MJ0A 4B93B 4JHRA 3LPZA 5AJDA 2QX3A 5JJ6A 1PY1A 3UT8A 5JJ7A 3TWQA 1UN9A 3U4TA 4JEHA 2ETCA 4ANVA 3MKRA 3LY9A 3ZEFA 4G8KA 2I1KA 1OY3D 4G2VA 4N2SA 4QQIA 3FHEA 3ASOE 3N71A 2YQ8A 3D9JA 3MV3B 1O8DA 3MJWA 4DK5A 3VSVA 3SQVA 2WPVA 2XGMA 5JJTA 3B7SA 3Q7FA 4I84A 5BV0A 3FP3A 3ABKE 3B95A 5C1EA 3U64A 3UKUG 4CZ2D 5HQ8A 3CV0A 3BU8A 3UM2A 4J0UA 4EPZA 4WNDA 2BEDA 1INZA 3UIPC 3FTVA 4ANWA 4UI9C 4ZHBA 3PNLB 2KCKA 2P9KG 3Q73A 5LX8A 1JUQA 3QWVA 1NP7A 2Q7FA 4KT6B 4OJOA 4XKBA 2WXGA 3ASFA 3EHNA 4CDNA 3QARA 3ZGQA 2OOEA 1MZCA 5B1BE 3PZ4A 3PUKA 3B7UX 4WNEA 5JA4D 3BEEA 3DSSA 5AQBA 3AG2E 2UWJG 4B0ZA 1DC2A 1QRBA 1SZAA 2LSUA 2P9LG 3TH0A 2O0WA 3P2BA 2J09A 4Q96A 5T4YA 3PE4A 3PNTB 1OWMA 2X3HA 3QB2A 4MLPA 2IOUG 4NRHB 3ASHA 1EDUA 3TWVA 1H6KA 3CVYA 3BG0B 3ZFWA 5AIJA 2VBMA 4JB8P 1DNPA 3MA5A 4YDWA 4JVSA 3ZW3A 2P9PG 3DBSA 1BI7B 2X6WA 4KZ0A 3EDTB 3PZ1A 3JX8A 2BSPA 5ENNA 3PZ3A 2BM6A 3L13A 3I5PA 3RRMB 3DSWA 2DZNA 2EWEA 4JA9A 4OJPA 3CR3A 3ZSCA 3VLEA 5G04C 1BN8A 5FQ8A 1OUVA 4XLCA 4XL9A 1TNOA 2X6YA 3B7TA 3PVLA 1HS6A 4GB9A 1KZPA 4UQXA 1PLUA 4Y6CA 3WG7E 5T3RA 3D9NA 2F3LA 4ILHB 3I3NA 1KCCA 1HG8A 4HRLA 3TG5A 5LOZA 4XR6A 4RQIA 1KQ5A 2NSTA 5JMCB 2XPYA 3UX4A 4RVBA 5G04J 3AS8A 2R5SA 3U9WA 2V0PA 2WXPA 3CKBA 2UVFA 4BWRA 1FT2A 5KNHD 4A63B 5C1DA 3UPVA 4BETA 4GTMA 2QYUA 1U3CA 2C0MA 4JRAC 4I43A 2QXZA 3UIOC 2VSXE 3C3OA 4DX5D 3CSTA 4NK6A 2XZDG 3MKQA 4F53A 2YHEA 4KH3A 4Y6WA 2PYHA 1DBOA 2BM7A 1H19A 5AQ9A 4GAAA 2J07A 5CEAA 2GRRB 2B0OE 3VLDA 3Q9UC 1KT0A 3SF4A 3ZYLA 4CDRA 5ANRA 1UJJA 3CVWA 5CMYA 4GZCA 2WQ7A 3P1UA 3FH5A 1OCOE 2XEEA 4BY6A 5A23A 2BKKB 2YHCA 3T8MA 3V30A 4HWVA 4M3OA 2EIKE 2Z8GA 1O8MA 3AS4A 4N3CA 4W8TA 4IYPA 5BW8C 4XOPA 3RIQA 2NSZA 2ZIRA 3LYCA 3SZEA 4XORA 4HOSA 3D9MA 4ILIA 2P9IG 3EU5A 1N0QA 4WWPA 1UJKA 2HO1A 2X85A 3ULQA 2B0RA 2NTPA 4OYSA 5BPPA 4OVUA 3D9HA 3TWRA 3RAUA 4BTAA 2EILE 1HG2A 4B8AA 3PREA 4ATZD 1TNUA 2VQ2A 4Q94A 4TXPA 4AP2A 4NACA 4OM9A 2GROB 1BHEA 3CVNA 3NBNB 4TRQA 4UI9K 1EF1C 2VBEA 4DI3A 3LYAA 3RO3A 1O1TA 3MYVA 3CHMA 2AVPA 2QYJA 3FUFA 3ZKJA 3SZ7A 3PSSA 4JHJA 2CHWA 3ZVVA 4BSZB 3FEXA 1IA5A 1S70B 2IF4A 2WXQA 3PZDA 4U95D 2Y1LE 3ML8A 2VGXB 4F1PA 2Y0BG 2NT6A 1WM5A 3EHRA 4LERA 1TNBA 2VJ8A 4J8EA 5HI7A 3FUNA 3K9IA 4CGVA 5EYLA 5ANLA 3U66A 3H09A 4WNGA 2RFAA 4ACKA 5KJNA 3B7RL 3HXFA 4H7YA 3FTXA 1Y8MA 4Z05A 3L54A 2OVFA 4XZ4A 5CECB 1E8ZA 3FTZA 1H6PA 1G3NB 5LCWC 3FU5A 3OTNA 2NTQA 4JXTA 1SZ9A 1ELRA 1E96B 4FA6A 3S2AA 4MRUA 3ZUVB 4XKVA 2UY1B 2I1JA 3UW0A 5EN5D 1NI1A 3RU0A 1MYOA 3LKUA 1HX8A 2WXJA 4OJLA 1H6OA 3EU9A 5D66A 1FT1A 4MBGA 2AXUA 1OFMA 1H80A 4FHKA 5ENSD 3ZHEB 3N6ZA 2X6KA 2H6HA 4Q69A 1H2TC 4W8SA 1O88A
chains in the Genus database with same CATH topology
2XTWA 2XTYA 2XT4A 5DNSA 3SQVA 4YFOA 2QYUA 2XT2A 3PSZA 3NB2A 4YEIA 2J8KA 4YCQA 4YC5A 3SY2A 2XTXA 3DU1X 3NAWA 2O6WA 2QZAA 3PSSA 4YDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTW A;  2XTY A;  2XT4 A;  5DNS A;  3SQV A;  4YFO A;  2QYU A;  2XT2 A;  3PSZ A;  3NB2 A;  4YEI A;  2J8K A;  4YCQ A;  4YC5 A;  3SY2 A;  2XTX A;  3DU1 X;  3NAW A;  2O6W A;  2QZA A;  3PSS A;  4YDT A; 
#chains in the Genus database with same CATH topology
 5FQ4 A;  4EHM A;  2NT9 A;  1Z5S C;  3AJI A;  1PAQ A;  1JCR A;  2LNI A;  1OXJ A;  3Q47 B;  3CEQ A;  3CLJ A;  5LCW J;  3RKV A;  5CMW A;  1OWP A;  4HB5 A;  4HRN A;  4TUU A;  2PYG A;  2Y3A A;  2NZM A;  2MYO A;  2KC7 A;  1E90 A;  1IHG A;  2P58 C;  2BTD A;  3EQN A;  3IXE A;  3CVU A;  3ABL E;  1VDY A;  3S7B A;  2XRY A;  1E8Y A;  4BSX A;  3NZS A;  1A17 A;  4I2Z A;  4QFV A;  4U49 A;  1HZ4 A;  2V5F A;  1QA1 A;  3KSL A;  1O8F A;  3UUX A;  2XTW A;  3ML9 A;  1KTW A;  4YVQ C;  1N0R A;  1O8K A;  1ELK A;  1N9A A;  3GZS A;  3RO2 A;  4RG9 A;  4LNB A;  4K0R A;  3ZRH A;  3ZYM A;  4HNA D;  4TUM A;  3SNX A;  3NAW A;  1BPO A;  4LNG A;  2RFM A;  1D8E A;  3JCK C;  2XTY A;  2I9C A;  1DBG A;  1N52 A;  1YCS B;  4WUY A;  2LXM A;  2WVI A;  4TXR A;  2R59 A;  3L6A A;  2LAH A;  3PS6 A;  4UWH A;  3WXX A;  2A5E A;  5D2M C;  2MOW A;  2BUG A;  4GML A;  1IDJ A;  4CGW A;  1QJV A;  4V02 C;  3EHQ A;  4I6J A;  3B7B A;  1TN6 A;  4A1G A;  4E6H A;  2A5U A;  3HVE B;  4Z06 A;  4YND A;  5KJL A;  4PH4 B;  3EHM A;  2C2L A;  4I9E A;  1OGM X;  2PQR A;  3E32 A;  3OXF A;  3NQP A;  1P5Q A;  3J5Q B;  4W8Q A;  3OXG A;  1DCQ A;  3L17 A;  2L6J A;  3CK7 A;  4DI4 A;  1JCQ A;  5CRV A;  3X2Q E;  3EQO A;  3O4Z A;  3NOC D;  5EX3 A;  5AAR A;  3NB2 A;  4YEI A;  4ATG A;  3G2V A;  4J6I A;  5A6C A;  4LRZ A;  2J49 A;  1TJF A;  3TAX A;  4KBQ A;  4U0Z A;  1O5M A;  4C0M A;  2O04 A;  4BT8 A;  1TYX A;  3ENE A;  3EIJ A;  1OFE A;  3MV2 B;  5CHE E;  4GTQ A;  4K5C A;  3L9T A;  3RIB A;  1OGO X;  2XGS A;  1YA0 A;  5AMV A;  1S0P A;  4GU5 A;  1X5B A;  4N39 A;  4WNF A;  1UG3 A;  2WXR A;  4TV3 A;  2I2O A;  2M63 A;  2EQX A;  3MX3 A;  2WMN A;  4ZFH A;  3TG4 A;  1KT1 A;  3U3W A;  2VSO E;  2Y4T A;  2GRQ B;  4XEI G;  2L0T B;  5FWQ A;  2PM7 A;  3GQ8 A;  5FQ7 A;  5BXU A;  1QBQ A;  4AEZ C;  3FU0 A;  4NK8 A;  3ZYK A;  4PS3 A;  4LNU D;  5AJL A;  3TXN A;  4YZQ A;  1E7V A;  4A1S A;  2IQC A;  3UM3 A;  4DRX E;  3MZL B;  3VTY A;  1MQS A;  3SY2 A;  2MRI A;  1N4Q A;  5EIL A;  1IXV A;  4DX6 D;  3CHP A;  3VST A;  1RWR A;  1TSP A;  4GYW A;  1MX6 A;  3ULY A;  1DAB A;  4XM3 A;  3Q49 B;  2BKG A;  4HI8 A;  5EIB E;  4GZ6 A;  4U0U A;  3SI5 A;  1XGW A;  1UW4 B;  4ABN A;  1WXR A;  4C2L A;  3LMW A;  3MKQ B;  1H2V C;  4U04 A;  4OZZ A;  2R2L A;  2CG3 A;  4URR A;  4L9P A;  1LTX A;  1X81 A;  4ANU A;  2ZGG A;  3RSE G;  4A3V A;  4IUL A;  4FU3 A;  3FTW A;  4YEJ A;  2LO6 A;  2P2C P;  3D9O A;  1OWO A;  4XOT A;  4I9C A;  1N4R A;  4HFG A;  5D0Q D;  3GQA A;  2INU A;  3TGO A;  2FUL A;  3Q79 A;  4EZJ A;  2HR2 A;  2DBA A;  3HG0 D;  1N4P A;  5LP0 A;  3FUE A;  5ENP D;  5HRY A;  4XMY A;  5FIN A;  3S7D A;  3ZXP A;  2WXO A;  3CVP A;  5CRU A;  4AV7 A;  2OVB A;  4YDY A;  3VTX A;  4Z68 A;  3CIA A;  2J8S D;  3E37 A;  3WWG A;  3CVX A;  2RG8 A;  3PUJ A;  2JLB A;  4N3A A;  4GYO A;  4EQF A;  1EPU A;  1KCD A;  4OPW A;  1WDY A;  1OWN A;  3LXU X;  3IHV A;  5FTP A;  4XN3 A;  3ASG A;  3PEV B;  4AY5 A;  4L23 A;  1D9S A;  4PS8 A;  2PQN A;  1ZB1 A;  3QK0 A;  2IJG X;  3HYM B;  3NZU A;  1QA3 A;  4XLH A;  2LAI A;  1TJC A;  3AS5 A;  4AXH A;  3BH7 B;  4HXI A;  3ZIM A;  1D8D A;  2VYI A;  2XT2 A;  4YZX A;  3LVQ E;  3DWL G;  3CHS A;  4XQF A;  4XNF A;  1JRG A;  5EX0 A;  1H0A A;  5KJK A;  3NF1 A;  3FUJ A;  3AAA C;  1DCE A;  4JA7 A;  1IQR A;  3ABM E;  2O1D A;  2GRP B;  2LXL A;  1WAO 1;  1JCS A;  4GYY A;  4KXK B;  3ZU7 B;  2QY1 A;  3ESL A;  2XCB A;  1IYG A;  2IY0 C;  4IRU A;  4W9R A;  3IKO B;  4L7T A;  3LY7 A;  4YDE A;  4XN0 A;  1QQE A;  3IBE A;  4C0E A;  2VFO A;  4XLE A;  2J4D A;  3AG1 E;  1LLW A;  4BX9 A;  3FUI A;  1OWL A;  2GGF A;  4MS6 A;  5BXO A;  1O1S A;  4XLA A;  4DLO A;  3FFL A;  4YDT A;  3T5X A;  3DEO A;  3DSV A;  1Z3Y A;  2QY7 A;  3KS2 A;  3AG4 E;  2X6J A;  4FHJ A;  4GZ3 A;  5J90 A;  2IOL A;  1N11 A;  2V4H C;  1Z6T A;  4AIF A;  5D0O D;  3DEP A;  5A7D B;  2XQ0 A;  3V2X A;  5T8I A;  2G0Y A;  3QC1 A;  4MR0 A;  1X0C A;  3UI2 A;  1WG0 A;  1IQU A;  4UQZ A;  5AYW D;  1QCX A;  4XLF A;  2ETB A;  3ZNG A;  3SYJ A;  4UI9 J;  4N2Q A;  1CLW A;  2XEH A;  3UMV A;  3DSU A;  3FUL A;  4EBA G;  1TR4 A;  1QNF A;  4FUL A;  4RSY A;  4YZ0 A;  1QRC A;  1JWF A;  1EA0 A;  4N3B A;  4DX7 D;  2IQ7 A;  4EW9 A;  2EIJ E;  4BES A;  5BT1 A;  4I2W A;  1TNZ A;  4G25 A;  3D9I A;  1B89 A;  4KZC A;  4B8C B;  4XI9 A;  4FJZ A;  3C3R A;  3LCA A;  5ENO D;  2PNN A;  2EIN E;  2L9B A;  4J8S A;  1JTA A;  4EZL A;  2HYZ A;  4CT4 A;  3KRG A;  1WY6 A;  3CVL A;  2FBN A;  4XIF A;  2I6H A;  2J8K A;  5J08 A;  3JUI A;  3G2W A;  3JXJ A;  5ENR D;  4E85 A;  3FTS A;  4YC5 A;  1UN8 A;  5G05 C;  2E0I A;  3CHQ A;  4F7A A;  3E4B A;  3C3Q A;  5ENT D;  3J5P A;  1NZN A;  1PE9 A;  3PE3 A;  3ZXS A;  1OCR E;  2DYR E;  2OND A;  1XNF A;  1O8E A;  4JC8 A;  4OZY A;  1TYU A;  3B90 A;  3JYS A;  1TYW A;  3S7J A;  3R9A B;  3G2T A;  2OEW A;  2KZT B;  2H6F A;  5EID A;  3ULE G;  4RG6 A;  4BER A;  1TN8 A;  5BV1 A;  4IN3 B;  2BM4 A;  4L2L A;  3OAW A;  4AJW A;  2VJI A;  2AWI A;  1RZ4 A;  3V2O A;  1ZU2 A;  4XX5 A;  2O0V A;  4UWF A;  4ME2 A;  1QQ1 A;  1EZG A;  1O8L A;  3ZPP A;  4FP7 A;  2F0Y A;  2VSY A;  5CED B;  4N5C A;  5DIZ A;  4G8L A;  1Q2Z A;  1ZBP A;  1N95 A;  4LUN U;  3D9L A;  2UY1 A;  4GZD A;  4FJY A;  5KCM A;  2ZXW E;  3TWX A;  4YEL A;  1FPP A;  4GTS A;  2XT4 A;  2XHE A;  4R7L A;  3N90 A;  1PXZ A;  2V4L A;  3HIZ A;  1K1B A;  4K5B A;  3QWW A;  3Q75 A;  3GZ2 A;  2OV8 A;  4L2Y A;  2PZI A;  2YUH A;  4GA0 A;  4X8Q A;  1TYV A;  3SFY A;  1DVP A;  1RU4 A;  1LF8 A;  4G11 A;  4GTR A;  3FUH A;  4K5A B;  2VFP A;  1HE8 A;  1HF2 A;  2WXM A;  3I4G A;  4YDO A;  2KCV A;  1Z3X A;  1H2U A;  3GYZ A;  1SW6 A;  1HH8 A;  3ML3 A;  3ISM C;  3KAE A;  4EEC A;  4UWG A;  4CCA A;  1N4S A;  1AIR A;  2ILR A;  1E7U A;  3APC A;  1N94 A;  2V5I A;  3E30 A;  4F3V A;  5JLV C;  3SFX A;  3DU1 X;  1BU9 A;  4OAV B;  3HHM A;  3LDZ A;  1K1A A;  4GA2 A;  2RKK A;  3V31 A;  4Z03 A;  4N5Q A;  4U7E B;  3Q78 A;  1KZO A;  1W3B A;  5AQA A;  3TWT A;  1NHC A;  1O8I A;  2GRN B;  2X38 A;  4J8D A;  4JHK A;  3G2S A;  5CCM A;  2BM5 A;  3MGB A;  3PET A;  4I17 A;  3CSF A;  1OCC E;  3FUM A;  5C2Y A;  4GTP A;  2VGX A;  2WB2 A;  2XPZ A;  5FQ6 A;  2L6B A;  2R05 A;  4D10 C;  1HU3 A;  1NA0 A;  3B8Y A;  2XEN A;  5FT9 A;  3UT4 A;  4G23 A;  2A4Z A;  1HFA A;  1HF8 A;  5HS0 A;  3VLF A;  3CK9 A;  2O6W A;  4ILG A;  2E2E A;  1LD7 A;  2ETA A;  4HOU A;  2HM8 A;  2IFU A;  2XS8 A;  4HLL A;  4ANX A;  2IEJ A;  3I4R B;  3HDX A;  4HVB A;  3IHY A;  4YZA A;  3IEG A;  4BEP A;  5C1C A;  1AP7 A;  3APF A;  5EKQ D;  2KCL A;  2EIM E;  2CG2 A;  3D9P A;  2PM6 A;  2VGE A;  2ODL A;  4AVZ A;  3TL5 A;  3LY8 A;  4J7W A;  4HBD A;  3Q4A B;  2YNQ A;  3GZ1 A;  1HXI A;  3L82 A;  3FU3 A;  3E34 A;  2XC1 A;  2C0L A;  3VMW A;  1S63 A;  2NSP A;  4YVO A;  4FAD A;  2AXV A;  1GW6 A;  4O6F A;  2J8I A;  4C9B B;  3NOG D;  1BD8 A;  2XZT G;  4XE0 A;  3CHR A;  3KEZ A;  3PEU B;  3W9G A;  4V3I A;  1OFL A;  1EE6 A;  3RK6 A;  5KWD A;  4DPR A;  1EYH A;  3MEK A;  2INV A;  5AN8 A;  2VFQ A;  4U4B A;  4DLQ A;  4PS7 A;  4U8H A;  5EDS A;  2F8Y A;  1PC2 A;  2F8X K;  4PUC A;  4WWN A;  2WXL A;  3LJN A;  3ASN E;  5FJY A;  3RRN B;  3T8K A;  2XEV A;  2WXK A;  4XON A;  1U3D A;  4XI0 A;  4I6E A;  3AU5 A;  4BT9 A;  3FUD A;  3ZPJ A;  3E33 A;  4HI9 A;  2RD0 A;  3IV0 A;  4U07 A;  4AM9 A;  3HXD A;  1NL4 A;  3TWW A;  4APF A;  1O1R A;  3UIN C;  4HLE A;  3DST A;  3GQ9 A;  5LFA A;  3Q5M A;  2XS1 A;  2VTB B;  2DZO A;  5G2N A;  2BF0 X;  2QFC A;  4GZ5 A;  1VBL A;  3DSX A;  4L1B A;  4U8Y D;  4HOQ A;  3FH8 A;  2O17 A;  4C48 B;  2X6H A;  2X6I A;  2AJA A;  3DXK G;  3JUR A;  4DX1 A;  3BH6 B;  4FLB A;  4UWK A;  1O8G A;  2P9S G;  3SFZ A;  1YMP A;  2VSN A;  3RJV A;  3KD7 A;  2X6F A;  1OT8 A;  2ION A;  1UOH A;  3TJP A;  3BQO A;  3C72 A;  3D3M A;  4APO A;  4YCQ A;  2IO3 C;  4BX8 A;  2Y69 E;  4EZK A;  4OVV A;  4LCT A;  5B3S E;  1O8J A;  4A3T A;  4GPM A;  4FC8 A;  2NYJ A;  4GTV A;  4GTO A;  5CCL A;  1BLX B;  2AW6 A;  4U96 D;  2XRZ A;  4I1A A;  1OCZ E;  5JMN D;  2FF4 A;  3B13 A;  3QOU A;  3UXG A;  4LG6 A;  2BX6 A;  1KPS B;  3CHO A;  4KVO A;  3EJN A;  5HKP A;  5H7P A;  3CVQ A;  2KXP C;  4BTB A;  4F1S A;  4GCN A;  5ARF A;  1TEZ A;  3PDN A;  3UT7 A;  4PDX A;  4H7X A;  2MHK A;  3LJ3 A;  4J8Y A;  1IKN D;  2P9U G;  3DRA A;  2CFU A;  3VMV A;  4CYM D;  4UWL A;  5KNG A;  4K03 A;  4OJ6 A;  4RLY A;  2ZGD A;  1QZ2 A;  4AY6 A;  1OFD A;  2Y4U A;  5B1A E;  4U0S A;  1IDK A;  2PL2 A;  3JQ0 A;  4MKT A;  3C98 A;  3PZ2 A;  1U2V G;  2LSV A;  1HO8 A;  2YIN A;  2WXF A;  3CK8 A;  4GMJ A;  4ACL A;  4OAU C;  5FZR A;  4HOR A;  5CBN A;  3Q9N C;  5ITZ F;  3SD5 A;  1K8F A;  1MX4 A;  2L0I A;  3LVR E;  2JAB A;  3D9K A;  1TN7 A;  4DJA A;  2IOS A;  3B4N A;  5ARG A;  4B89 A;  5CER B;  4HS2 A;  3DPD A;  5FIO A;  3SO8 A;  3LEW A;  2H6I A;  5FZQ A;  3Q7A A;  2IU1 A;  5M72 A;  3KEA A;  1IB4 A;  1SQM A;  2ZIS A;  4WWO A;  3S7F A;  3FDH A;  3FU6 A;  2VJJ A;  5E75 A;  4TXQ A;  3R9M A;  4M7C A;  3EUV A;  3ONK A;  3QAQ A;  3JUE A;  1N54 A;  2V5Q C;  1YYH A;  3CGH A;  1O8H A;  3AG3 E;  3RRU A;  2P9N G;  3O48 A;  2DWZ A;  4UQY A;  3T9G A;  3JQ1 A;  1BI8 B;  1AWC B;  1QA2 A;  1MX2 A;  4KMO A;  4FLH A;  1JWG A;  1SA5 A;  2QZA A;  2R02 A;  3AK5 A;  2CHZ A;  3GRH A;  2GRL A;  1SA4 A;  1CZF A;  1XG2 A;  2WMO A;  3PH0 C;  3HRA A;  1RMG A;  3DPY A;  4JD2 G;  2WXI A;  4G26 A;  2B6C A;  3SGH A;  3URZ A;  4MXN A;  5E76 A;  2FEZ A;  1LLZ A;  3FTU A;  4XKW A;  5BNW A;  3L08 A;  4AOF A;  2DYS E;  3UM0 A;  3UTM A;  3ZYQ A;  2DCP A;  5DNS A;  2R17 C;  2NC9 A;  2NXP A;  3BG1 B;  1V55 E;  4B94 A;  2DVW A;  2AXZ A;  4G24 A;  4AVX A;  2LUH A;  4G1T A;  5DBK A;  4JPS A;  4O60 A;  1FVF A;  1OOC A;  2ZU6 B;  4JEU A;  3QKY A;  5ENQ D;  5IY5 E;  4P29 A;  4HRM B;  2H6G A;  3FWV A;  3FY4 A;  4JZY A;  3R7R A;  3CKC A;  3DXM G;  3PRZ A;  3SHF A;  1K5C A;  3QWP A;  5AQ7 A;  4I6G A;  3FUK A;  3P4G A;  3TWU A;  3T9K A;  3T5V A;  3FEY A;  4UUC A;  3FY3 A;  4HQD A;  4I1O B;  3Q15 A;  3FH7 A;  1L5J A;  2VFN A;  3G2U A;  3MCX A;  4NQ0 A;  2F37 A;  4A55 A;  4W8R A;  2DIW A;  1JPL A;  4GTT A;  2WQH A;  2XTX A;  2VGY A;  4NUR A;  4GA1 A;  4LEU A;  3QDN A;  3CVV A;  1TNY A;  4YFO A;  3VSU A;  3HXC A;  2KBX A;  2UVE A;  3AU4 A;  1QYM A;  1NA3 A;  3UM1 A;  4URK A;  5KJM A;  3SBS A;  1LM1 A;  3UKR G;  1HG5 A;  1S64 A;  4GPK A;  4JL0 A;  1KLX A;  3R7Q A;  3ONL A;  1Y6I A;  4I1M A;  4GMR A;  1IHB A;  2XCC A;  2FI7 A;  3TXM A;  2XPI A;  2XGO A;  3C5R A;  2WXN A;  2CHX A;  3ZHE A;  4LSZ E;  2WQ6 A;  4BFR A;  1E8X A;  2GRM A;  3ESK A;  2J9Q A;  1FCH A;  2V8S E;  4U63 A;  1ELW A;  2QC9 A;  3EIQ C;  4DX2 A;  2J08 A;  4OJ5 A;  1NFI E;  4O1P A;  4EBA A;  1K3Z D;  2IO2 C;  3GQ7 A;  4XKC A;  4HOT A;  5AAO A;  1FVH A;  3APD A;  3HXB A;  3CQG B;  3SBT B;  2FO7 A;  1L1I A;  3V79 K;  2NTB A;  4DUI A;  4KVM A;  5KBA A;  1RW2 A;  2X3M A;  4U8V D;  5FZS A;  2KAT A;  3L16 A;  4WAF A;  2W7Z A;  5G55 A;  4CRW A;  1LD8 A;  3OXL A;  3QNK A;  2VFM A;  5CBO A;  2HE0 A;  3ASD A;  3GW4 A;  3LS8 A;  3LJY A;  5G05 J;  3BUA A;  1WMR A;  3W9F A;  2J4B A;  2FO1 E;  4CT0 A;  4O1O A;  2OCC E;  2CFZ A;  1TYQ G;  1K8K G;  2WXH A;  3PSZ A;  3CQC B;  2VBK A;  3F6Q A;  3JXI A;  3QJZ A;  3HXE A;  1K4Z A;  2WM9 A;  3KSQ A;  2PEC A;  1E8W A;  5EYP F;  4CEM A;  4CDM A;  4GCO A;  1SVX A;  5AEN A;  3SUC A;  4KYO B;  2KZT A;  4JW1 A;  5JHA A;  4NIK A;  1GQ8 A;  2JEK A;  2KM4 A;  3UQ3 A;  3L22 A;  3FTY A;  5BUZ A;  1MHQ A;  2VTB A;  1V54 E;  2OEV A;  4J8F A;  1A5E A;  2X6X A;  3ZN3 A;  3TWS A;  5JHB A;  3HVE A;  2GW1 A;  4PMH A;  2R03 A;  4F6R D;  1MJ0 A;  4B93 B;  4JHR A;  3LPZ A;  5AJD A;  2QX3 A;  5JJ6 A;  1PY1 A;  3UT8 A;  5JJ7 A;  3TWQ A;  1UN9 A;  3U4T A;  4JEH A;  2ETC A;  4ANV A;  3MKR A;  3LY9 A;  3ZEF A;  4G8K A;  2I1K A;  1OY3 D;  4G2V A;  4N2S A;  4QQI A;  3FHE A;  3ASO E;  3N71 A;  2YQ8 A;  3D9J A;  3MV3 B;  1O8D A;  3MJW A;  4DK5 A;  3VSV A;  3SQV A;  2WPV A;  2XGM A;  5JJT A;  3B7S A;  3Q7F A;  4I84 A;  5BV0 A;  3FP3 A;  3ABK E;  3B95 A;  5C1E A;  3U64 A;  3UKU G;  4CZ2 D;  5HQ8 A;  3CV0 A;  3BU8 A;  3UM2 A;  4J0U A;  4EPZ A;  4WND A;  2BED A;  1INZ A;  3UIP C;  3FTV A;  4ANW A;  4UI9 C;  4ZHB A;  3PNL B;  2KCK A;  2P9K G;  3Q73 A;  5LX8 A;  1JUQ A;  3QWV A;  1NP7 A;  2Q7F A;  4KT6 B;  4OJO A;  4XKB A;  2WXG A;  3ASF A;  3EHN A;  4CDN A;  3QAR A;  3ZGQ A;  2OOE A;  1MZC A;  5B1B E;  3PZ4 A;  3PUK A;  3B7U X;  4WNE A;  5JA4 D;  3BEE A;  3DSS A;  5AQB A;  3AG2 E;  2UWJ G;  4B0Z A;  1DC2 A;  1QRB A;  1SZA A;  2LSU A;  2P9L G;  3TH0 A;  2O0W A;  3P2B A;  2J09 A;  4Q96 A;  5T4Y A;  3PE4 A;  3PNT B;  1OWM A;  2X3H A;  3QB2 A;  4MLP A;  2IOU G;  4NRH B;  3ASH A;  1EDU A;  3TWV A;  1H6K A;  3CVY A;  3BG0 B;  3ZFW A;  5AIJ A;  2VBM A;  4JB8 P;  1DNP A;  3MA5 A;  4YDW A;  4JVS A;  3ZW3 A;  2P9P G;  3DBS A;  1BI7 B;  2X6W A;  4KZ0 A;  3EDT B;  3PZ1 A;  3JX8 A;  2BSP A;  5ENN A;  3PZ3 A;  2BM6 A;  3L13 A;  3I5P A;  3RRM B;  3DSW A;  2DZN A;  2EWE A;  4JA9 A;  4OJP A;  3CR3 A;  3ZSC A;  3VLE A;  5G04 C;  1BN8 A;  5FQ8 A;  1OUV A;  4XLC A;  4XL9 A;  1TNO A;  2X6Y A;  3B7T A;  3PVL A;  1HS6 A;  4GB9 A;  1KZP A;  4UQX A;  1PLU A;  4Y6C A;  3WG7 E;  5T3R A;  3D9N A;  2F3L A;  4ILH B;  3I3N A;  1KCC A;  1HG8 A;  4HRL A;  3TG5 A;  5LOZ A;  4XR6 A;  4RQI A;  1KQ5 A;  2NST A;  5JMC B;  2XPY A;  3UX4 A;  4RVB A;  5G04 J;  3AS8 A;  2R5S A;  3U9W A;  2V0P A;  2WXP A;  3CKB A;  2UVF A;  4BWR A;  1FT2 A;  5KNH D;  4A63 B;  5C1D A;  3UPV A;  4BET A;  4GTM A;  2QYU A;  1U3C A;  2C0M A;  4JRA C;  4I43 A;  2QXZ A;  3UIO C;  2VSX E;  3C3O A;  4DX5 D;  3CST A;  4NK6 A;  2XZD G;  3MKQ A;  4F53 A;  2YHE A;  4KH3 A;  4Y6W A;  2PYH A;  1DBO A;  2BM7 A;  1H19 A;  5AQ9 A;  4GAA A;  2J07 A;  5CEA A;  2GRR B;  2B0O E;  3VLD A;  3Q9U C;  1KT0 A;  3SF4 A;  3ZYL A;  4CDR A;  5ANR A;  1UJJ A;  3CVW A;  5CMY A;  4GZC A;  2WQ7 A;  3P1U A;  3FH5 A;  1OCO E;  2XEE A;  4BY6 A;  5A23 A;  2BKK B;  2YHC A;  3T8M A;  3V30 A;  4HWV A;  4M3O A;  2EIK E;  2Z8G A;  1O8M A;  3AS4 A;  4N3C A;  4W8T A;  4IYP A;  5BW8 C;  4XOP A;  3RIQ A;  2NSZ A;  2ZIR A;  3LYC A;  3SZE A;  4XOR A;  4HOS A;  3D9M A;  4ILI A;  2P9I G;  3EU5 A;  1N0Q A;  4WWP A;  1UJK A;  2HO1 A;  2X85 A;  3ULQ A;  2B0R A;  2NTP A;  4OYS A;  5BPP A;  4OVU A;  3D9H A;  3TWR A;  3RAU A;  4BTA A;  2EIL E;  1HG2 A;  4B8A A;  3PRE A;  4ATZ D;  1TNU A;  2VQ2 A;  4Q94 A;  4TXP A;  4AP2 A;  4NAC A;  4OM9 A;  2GRO B;  1BHE A;  3CVN A;  3NBN B;  4TRQ A;  4UI9 K;  1EF1 C;  2VBE A;  4DI3 A;  3LYA A;  3RO3 A;  1O1T A;  3MYV A;  3CHM A;  2AVP A;  2QYJ A;  3FUF A;  3ZKJ A;  3SZ7 A;  3PSS A;  4JHJ A;  2CHW A;  3ZVV A;  4BSZ B;  3FEX A;  1IA5 A;  1S70 B;  2IF4 A;  2WXQ A;  3PZD A;  4U95 D;  2Y1L E;  3ML8 A;  2VGX B;  4F1P A;  2Y0B G;  2NT6 A;  1WM5 A;  3EHR A;  4LER A;  1TNB A;  2VJ8 A;  4J8E A;  5HI7 A;  3FUN A;  3K9I A;  4CGV A;  5EYL A;  5ANL A;  3U66 A;  3H09 A;  4WNG A;  2RFA A;  4ACK A;  5KJN A;  3B7R L;  3HXF A;  4H7Y A;  3FTX A;  1Y8M A;  4Z05 A;  3L54 A;  2OVF A;  4XZ4 A;  5CEC B;  1E8Z A;  3FTZ A;  1H6P A;  1G3N B;  5LCW C;  3FU5 A;  3OTN A;  2NTQ A;  4JXT A;  1SZ9 A;  1ELR A;  1E96 B;  4FA6 A;  3S2A A;  4MRU A;  3ZUV B;  4XKV A;  2UY1 B;  2I1J A;  3UW0 A;  5EN5 D;  1NI1 A;  3RU0 A;  1MYO A;  3LKU A;  1HX8 A;  2WXJ A;  4OJL A;  1H6O A;  3EU9 A;  5D66 A;  1FT1 A;  4MBG A;  2AXU A;  1OFM A;  1H80 A;  4FHK A;  5ENS D;  3ZHE B;  3N6Z A;  2X6K A;  2H6H A;  4Q69 A;  1H2T C;  4W8S A;  1O88 A; 
#chains in the Genus database with same CATH homology
 2XTW A;  2XTY A;  2XT4 A;  5DNS A;  3SQV A;  4YFO A;  2QYU A;  2XT2 A;  3PSZ A;  3NB2 A;  4YEI A;  2J8K A;  4YCQ A;  4YC5 A;  3SY2 A;  2XTX A;  3DU1 X;  3NAW A;  2O6W A;  2QZA A;  3PSS A;  4YDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...