3NBHB

Crystal structure of human rmi1c-rmi2 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
131
structure length
131
Chain Sequence
LPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of RMI1 and RMI2, Two OB-Fold Regulatory Subunits of the BLM Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords RecQ-mediated genome instability protein 1
total genus 28
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16100 RMI2 RecQ-mediated genome instability protein 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3nbhB00
4JYAQ 4P75A 3RN5A 4UP7A 1T9HA 2K5VA 1E3PA 2N3SA 2YTXA 4JI8L 3ULJA 5IP7G 1XPOA 1KQSA 4P74A 1MJCA 3S1QH 3UDFA 4BXXH 1LM0A 3HOUH 1KD1C 1Q1EA 1X3FA 2K5HA 3H0GH 1CUKA 1KRTA 1PFSA 4WJ3M 1HR0W 3M9BA 1UE5A 1V9PA 1HJPA 3M7NA 4DR6L 1P16A 4B3MQ 1X3EA 2KCTA 4A3CG 1J6QA 4JYAL 3PIPA 4POGA 3PCOB 3W5OA 5IWAQ 5M5YH 3GTLH 4JI2L 2JA7G 5LMUL 1OXTA 3AYHB 4OX9Q 1S72A 4QIWE 2AHOB 4YWMA 2QEXA 4A3LH 3I55A 4DUYL 2JEBI 4C2MH 4WJ4A 4JCVE 4OWWB 1IBLL 2Z6KA 5IP9G 4JI4Q 1ASZA 1VQKA 2UXBQ 2DUDA 2UU9L 3RZDH 4DV4Q 3KYHC 1VCIA 3CCRA 1YHBA 2I5HA 4X65Q 1O7IA 1VQPA 1PH1A 4APVA 3HOXH 4YHHQ 1S3OA 3CCJA 4YY3L 1XMQL 4YWLA 3CMAA 1OXSC 3A5ZB 2JJQA 1IXRA 3KLWA 1KIXA 3Q8DA 3BZCA 1YJ9A 1I94Q 3GTJH 2YU9H 2Z0SA 3BZKA 3F2DA 4IFDJ 2H5XA 3ULLA 1IL2A 4JI4L 4DV0Q 1IBMQ 1Q82C 3CCLA 3CCMA 1NMGA 4DV2L 4AQYL 2KENA 1TWAH 2PQAA 2CFMA 4B3ML 2JA8G 3PUZA 1Y1WH 1FGUA 3PF5A 1X54A 4DV5Q 2Z6KC 3KJOA 4LFCQ 1SN8A 2MO1A 3G4SA 4LF7Q 3HOYH 4C3HH 1VQ5A 3S14H 1Y14B 5C3EH 1PV4A 2R7ZG 2K14A 1HZBA 2NVXH 3S1RH 2IHEA 5AJ3L 1IBKQ 1Q86C 4DUZQ 1BBWA 2D0PA 3CCSA 1CKNB 1CSPA 1JE5A 1EFWA 4C3IH 4PZ8A 5IP7H 4KHPL 4GKJL 5GQOA 1SMXA 1FJGL 3GO5A 2EIFA 4HIKA 2ZTDA 2CQOA 4IOAA 5E7NA 2GVBA 4AYBG 3KOJA 1PH6A 4BY7H 2V1CC 2L15A 2R93G 3GDEA 1I5FA 3GTMH 1VQBA 3T1YQ 3H0GG 4P72A 5IYCH 3RNUA 2D0OA 3S15H 1YJWA 1G51A 2CKZB 4UP8A 4DV1L 2N49A 3D0FA 2YTVA 1VQIA 2A8VA 2Q2IA 4K0KQ 3AFPA 1QVCA 5IYBH 4DR5L 4GKKQ 1J5EQ 5JJLA 3F1ZA 2NZOA 2RHQB 3U58A 4LFCL 3HOYG 3CPFA 3HOWG 4GLXA 4BY1H 4X62Q 1XMOQ 1N33Q 2YTYA 4HIDA 4KHZA 1ASYA 1YVCA 1IBLQ 4LF6L 3M4QA 1Z47A 2VS1A 4YWKA 2HHHL 1JJGA 4B3SQ 2B29A 2MFIA 3J7ZC 1CKMA 1BVSA 2VUMH 3HOVG 2ZTCA 4YCUA 3IRBA 2MO0A 4LFBL 2JA9A 4DK6C 4GOPA 4L5SA 1GM5A 5FLXc 3RLFA 3SGIA 4AIMA 3BJUA 4YY3Q 2E5LQ 4L5TA 4B3RL 1L1OA 1A63A 1VQ8A 4X62L 2VY3A 3J80i 1L0WA 1WI5A 3OTOL 1Y1WG 4X66Q 1IZ6A 2Y0SE 2R93H 2D62A 3DM3A 2UUAQ 4NXNQ 2ATWA 1SROA 4GOPC 1I94L 3I4MH 1XNRL 2VNUD 4A3EH 3JC66 1VQHA 4JBWA 4DV2Q 4PZ6A 4LF4Q 1HZCA 3AQQA 3NENA 1D8LA 2K4KA 1C9OA 1WOCA 4XTCS 3I56A 4A3LG 1OTCA 3W1GA 3CF5A 3ERSX 1JT8A 5HY6A 1TWCH 1OXUA 2UUBQ 1IYJB 2IT1A 4LWCA 4IPHA 3HOXG 1X6OA 5C4XH 2K5NA 4P71A 4HJ5A 2I5LX 1PH8A 4KI0A 1EOVA 5FLMH 1EQQA 1AE3A 4JI7L 2UXCQ 1M90C 4Y52H 1LUZA 1SRUA 2OQ0A 3NELA 1JMCA 1YITA 1IBKL 4EQ5A 1XNQQ 1UWVA 1VQNA 2ASBA 1PA6A 3OW2A 1B70B 1EUJA 4K0KL 5ELOA 4A3KG 1WCMG 3S24A 2E2HH 4OONA 2E5LL 3S2DH 3K7UC 3J80c 4JBKA 3RR5A 1M1KC 4GLVB 1K8GA 3FHWA 2ALYB 3B6YA 2OWOA 4R4IA 3I4NH 4DPGA 4A3JG 3AFQA 3CPWA 2BH2A 5IYDH 1S40A 2ES2A 1EWIA 3A5UA 3FKIG 4DUYQ 1VQOA 1OXVA 3RZOH 2HHHQ 4DR6Q 3GTQH 4FDBA 1UE6A 4HJAA 3KJPA 2PI2A 1X55A 1Y1VH 3NEMA 1VQEA 1K0RA 4ALPA 4GKKL 2R92G 4YHHL 2JA5G 1K73C 4PMWA 1HNWL 2WB1E 4UPAA 2PNHA 4BA1I 1PH9A 4LF8L 3PF4A 1N33L 1WJJA 3U4VA 3PO3H 2K50A 3RN2A 4NXNL 4DV4L 2JA5H 4DUZL 1EQRA 2PI2E 4JC0A 1R9TH 4A3KH 3S17H 4DV5L 1GD7A 4B3SL 2JEAI 2IHFA 2DGYA 1PYBA 2WFWA 3S1NH 3LGJA 1H95A 4DK3C 4R4QA 4DR2L 2OTLA 1KC8C 1YEZA 5EAYA 1Q1BA 2R7ZH 1I3QH 5DLQE 5IT9c 4H02A 1I6HH 4JBMA 5JEAG 3GTKH 3W1BA 2UXDQ 2NVYH 3KF6A 3I7FA 4BBRH 4GS3A 1RIPA 5GAHC 1N9WA 4IPGA 4PG3A 3HOZG 3CC4A 1HR0L 4B3RQ 5GAEC 1MKHA 4LF7L 2UUBL 3TREA 2F3IA 3A0JA 1J5EL 3L7ZC 2HIXA 3KF8B 1N32L 2C35B 5IYCG 4DAMA 2ZM6L 4DR3Q 1X9NA 4POFA 2ZJQA 1VQ6A 3GTOH 4A3BH 2UXCL 3PV0A 3F2CA 1XNRQ 1KAWA 5LMNQ 4UY8C 3K7AH 4IJLA 3U4ZA 1SFOH 1YJNA 5IYBG 3ER0A 3T1HL 2JA8H 4R1JA 1JJ2A 5C4JH 2WB1G 3KDFB 5M5WH 3GD7A 2VQFL 5M5XH 1FL0A 5BR8L 3U50C 1MJEA 3T1YL 4X66L 3CP0A 3F8TA 3F2BA 4A3MH 4JBJA 2UU9Q 3M85A 4DV7L 1PH3A 1KHIA 3GTPH 4R4TA 3MEFA 3STBC 3TRZA 4IFDI 2ZJPA 4RG1A 1D7QA 1UE1A 3G48A 1AE2A 1G291 1U0LA 4LF5Q 2XGTA 4LFAL 3M4OH 4DR7L 4LW1A 2R92H 3CC7A 3HKZE 3CW2C 3I4OA 3OTOQ 1Q12A 1HNXQ 1CKNA 2OQKA 1VS0A 4R4OA 4DKAC 4BXXG 3ZJYC 1AH9A 2VUMG 3UDXA 2RCNA 3CCUA 1W2BA 3E0EA 1YIJA 1I50H 1XMOL 2EXDA 1Q46A 4DV0L 4A3FG 1VQGA 3NBHB 1IBML 4MNOA 4GKJQ 1YBYA 2ZTEA 4Y7NH 1B7YB 2KHJA 5M3FH 4A3CH 3MXNB 1GVPA 4LF5L 4DR7Q 3E9HA 2B63G 3J81j 4A3JH 3K81C 2LXKA 1VQFA 4ME3A 5C44G 5M3FG 2WP8J 4JI8Q 1L1OC 4OXPA 4NXML 1TWHH 1WFQA 2B3GA 2HT1A 1NBWA 2JK8A 4TVAB 1E22A 2VQFQ 4GNXC 2BA1A 2F4VQ 1MIUA 2NN6G 4IOCA 1VQ4A 4GNXB 1K9MC 1TXYA 1N32Q 5C3EG 1VQ9A 4DR2Q 1QVFA 3CCEA 3PUWA 4HJ9A 4LUVA 4QY7A 4YCVA 4X65L 1PH5A 1K8AC 1NE3A 1NMFA 4DAYB 1W3SA 4JI5L 4EX5A 4C3JH 3DLLA 1HNZL 4AYBE 5K36G 4HJ7A 4JI7Q 4NXMQ 4A3FH 1B8AA 1Q7YC 1HZ9A 3CCQA 4A76A 4A3DH 4QQBX 4RMFA 2RHSB 3EN2A 3PGZA 1V1QA 4A93H 4GOPB 4GN4B 2N78A 1E24A 3HKZG 4JI1L 4LNQA 1XNQL 3PIOA 3JAMc 1A62A 4P73A 4XIGS 1VQDA 2JQOA 4DR4Q 2UUCL 3ICEA 1JJCB 4JI0Q 1K83H 4LFAQ 1A0IA 1X65A 3G71A 1TWGH 4BY1G 1Z9FA 1K3RA 5FJ8H 4B3TQ 2F52A 4JI3Q 1BKBA 2E2JH 1TWFH 2OTJA 1QZGA 4TQUS 4KHPQ 5M3MG 4O0AA 1YI2A 4LF4L 2R7DA 1SLJA 2HQLA 2WAQE 1PYSB 4J15A 4JI6Q 1E1TA 1HR0Q 5FLMG 5C0XJ 4HJ8A 2JA6H 2KCMA 3E9IA 3PO3G 2FXQA 2LXJA 1SR3A 4A4IA 5C0XG 1KXLA 4JI5Q 1L1OB 1VQCA 4OX9L 4LF8Q 3H3VH 4BY7G 4DV6L 4X6AH 3UE0A 2JA6G 5GROA 5IY0A 4R4CA 4YCWA 4PZ7A 3HKSA 1UEBA 4JV5Q 1VQMA 2E8GA 5JEAJ 4LF9Q 1PVOA 2Q2HA 4A3IG 1C7YA 1G6PA 3BU2A 1WYDA 1E1OA 2CWAA 1VQAA 2I5MX 4LUOA 4DV3Q 5JJIA 3I4MG 3J81i 2K75A 5FJ8G 1CSQA 1P8LA 4JI0L 3HFZB 3S16H 3I4NG 2IX0A 1YHQA 3TEHB 4DV6Q 1VQ7A 1VQJA 5IYDG 2Q2TA 4MTNA 3H3VI 1HNWQ 5C4XG 2XTIA 3S2HH 1FVIA 4DR1L 1X56A 1NJIC 3K80C 2VW9A 1N34Q 2UXDL 5BR8Q 4QL5A 4JOIC 1UE7A 2VQEQ 2MQHA 3RLOA 3G6EA 2UXBL 5AJ3Q 5HGQA 3L2PA 2JE6I 1DGSA 1LTLA 1OXXK 4DV1Q 4IO9A 4A93G 1XTDA 3EIVA 1PH2A 4A3DG 3PSIA 4IPDA 1EYGA 4OO1I 2QGQA 1KL9A 1FJGQ 2PMZE 4X64L 4DR4L 1Q81C 5GADC 3TQYA 2BH8A 1XPRA 2B63H 2I0QA 4GN5A 3D31A 1YHAA 4JOIA 1C0AA 4QGUA 4AQYQ 2R6GA 5GAGC 2PQAB 1E7ZA 2WAQG 4LUZA 2GN5A 1WCMH 3L0OA 5J3BA 1KRSA 4GLAC 4OWTB 2MNAA 3H15A 3CXCA 4L5QA 3TS0A 2CCZA 2E2IH 1XPUA 3CC2A 3TS2A 4A3GH 1HNZQ 4IJHA 4DNIA 3KFUA 2AMCB 1N8RC 1PH4A 2NVTH 2QA4A 1N36L 2AWNA 1YNXA 2N8NA 3GTGH 3CQZH 3PUXA 3STBD 1A8VA 1QZHA 4BBSG 3J7A5 4GN3B 2OCEA 4GNXA 2RF4A 5IWAL 3EBEA 4HIOA 1XJVA 4LF6Q 3CD6A 1LYLA 2KBNA 2Y0SG 3M3YH 3HOUG 4HIMA 1BBUA 3S1MH 4IFDG 1HNXL 2EQSA 3CCVA 1X3GA 4OWXB 3PUYA 2UUCQ 4KLKA 2IX1A 4A3IH 4BA2I 5LMUQ 2A19A 2ZJRA 1QVGA 1HH2P 2LSSA 5JJKA 3FKIH 2ID0A 5C44H 2ZM6Q 4A3GG 2JA7H 1XMQQ 3FP9A 3CMEA 3HOWH 1NY4A 1HZAA 4O2DA 4NPSA 5ELNA 3RLNA 5LMNL 1N34L 4OO1G 4JI1Q 2KHIA 4LFBQ 4JI2Q 1NTGA 1PH7A 2F4VL 3PO2G 2Q2UA 5IP9H 4A3MG 4LF9L 1U5KA 5IE8A 4JI6L 4IPCA 2K52A 2YV5A 3ULPA 3HOVH 4AH6A 1Y1VG 3UDGA 5M3MH 3UE1A 1Q8KA 1QUQB 1QUQA 3UDIA 4DV3L 1JB7A 3AEVA 4NB3A 4X64Q 4UP9A 5H1SE 2CWPA 3WWVA 4B3TL 4A75A 4DR3L 2NN6I 1EIFA 1VQLA 4JV5L 2VZAA 3PUVA 5LMNW 1PHJA 2R7FA 3JAMi 2GVAA 1EIYB 4A3BG 3T1HQ 1V43A 4DR1Q 3A74A 2AWOA 2UUAL 4QJFA 3VDYA 2AKWB 4DR5Q 2NVQH 3OYYA 1CKOA 3CAMA 3KDFA 1GKHA 2VL6A 3K0XA 2HIVA 1YZ6A 3M4PA 3J81c 1RL2A 3I2ZA 4A3EG 1N36Q 1L2FA 2A1AA 4L5RC 4JG2A 3PO2H 2BA0A 1GO3E 2NZHA 1SE8A 2YYZA 5C0XI 3HOZH 2IY5B 4DV7Q 2VQEL 4JI3L 4BBSH 4BBRG 3KF6B 4MZ9A 3K8AA
chains in the Genus database with same CATH superfamily
4JYAQ 4P75A 4G7OC 2FMCA 2YTXA 2N3SA 4RWSC 1MJCA 3EJIA 3UDFA 4BXXH 1STBA 1HFNA 3HOUH 3H0GH 2K5HA 3S16B 1NR2A 1PFSA 4WJ3M 1HR0W 3E5SA 3G6JB 3M9BA 3HOWB 2Z4IA 2XIWA 4DR6L 2KCTA 4JYAL 1AN8A 3PIPA 3TBIB 5M3MB 1RODA 2JA5B 3HOVB 3AYHB 4OX9Q 4A3LH 1FNVA 1T5XD 4C2MH 3GV6A 5CORA 3QWNA 4JI4Q 1VQKA 2UXBQ 1SEBD 5JVG3 1VCIA 1EIGA 1YHBA 3BYYB 1DOMA 1RD9D 3CCJA 1YNND 1SNCA 3M7GA 4HCSA 1G8ZD 4YWLA 5HURA 1KIXA 2Z0SA 1IL2A 5IGEA 4JI4L 3JAML 3BYTB 3SXHA 4TRDA 4DV2L 1UAPA 4AQYL 2PQAA 3T4AC 3NTKA 3PUZA 1Y1WH 4FO2A 4DV5Q 4C3HH 3S14H 1Y14B 4KKUA 1HXYD 2B2VC 2IWHA 4FF3A 2QW7A 1IBKQ 1Q86C 2Z6BA 2D0PA 1CKNB 1JE5A 3S9WA 4EQPA 2JA7B 3GO5A 1LO5D 3SDZA 4BY7H 1M4VA 3GDEA 4CDCC 1TWFB 4BBRB 3J7YW 3T1YQ 2DNCA 4P72A 5IYCH 5CBEE 2TMPA 3RNUA 1HCZA 1YJWA 3VYTA 2NTTA 2OT2A 4UP8A 4K2LA 1EEFD 1VQIA 2Q2IA 3AFPA 1ENAA 3KK7A 3HOYG 3HOWG 4GLXA 1XMOQ 2R3ZA 5EQ0A 2IPKD 5EKLA 1ASYA 1CFMA 1EFID 4DAVA 3OWFA 3J7ZC 3E0JA 4N8FA 4R8NA 1XWEA 3HOVG 2F0JA 3IRBA 3A7AB 5KYIA 1KNAA 4M8AA 2Z8LA 5FLXc 3RLFA 2LY7A 3TP5A 4YY3Q 4C1NI 2E5LQ 3A8IE 4ODGA 1JR0D 1XMOL 3J80i 1WI5A 2R93H 1Y1WG 4X66Q 2Y0SE 4ZKCB 4MN3A 5E1FA 3MA2B 3MWYW 3CRLC 4GOPC 3I4MH 3MXPA 1XNRL 1Z6HA 1E0BA 1VQHA 4CJ2C 1EY0A 4OIKA 3I56A 4A3LG 2RDFA 2L55A 5BN5A 1ILQA 1JT8A 2IT1A 4LWCA 4A3KB 1LTGD 2HQEA 1YNNC 2K5NA 5C4XH 4HJ5A 1EOVA 2B8GA 2WV6D 3EFXD 2HDMA 1M90C 1LUZA 3NELA 4Y52H 5E4WC 3ITPA 2KEDA 1UWVA 1PA6A 4OIJA 2E5LL 2E2HH 3K7UC 4JBKA 2F0VA 2OWOA 4NW2A 1B3QA 4A3JG 2RDHA 1SE3A 1EY8A 3A5UA 2ES2A 4DR6Q 2VUMB 3NXWA 5EGTA 1EU3A 3LWUA 4HR7B 4HJAA 3KJPA 1K8MA 3NEMA 1JWSD 3KF8A 2EYFA 4CKBA 1BCPF 1VQEA 1S4ZA 4I7AA 2WACA 1B9NA 4GKKL 2WB1B 3PF4A 4LF8L 5DNFA 3C3LA 1N33L 1GUNA 4DUZL 1EQRA 3S17H 4DV5L 2JEAI 3J80L 4DK3C 4JK1C 4R4QA 1FR3A 2NB0A 3HEJA 1Q1BA 1JOOA 5DLQE 3GTKH 5JOBA 4QMGA 1N9WA 2F0MA 3DEPA 4PG3A 1WVLA 2GA4B 2EYOA 1AW7A 1RDPD 4XQNA 3TREA 1J5EL 1DYQA 1XX8A 2WAQB 2WINB 3S2DB 2BCOA 2C35B 2ZM6L 4K6DA 4POFA 1WTWA 2LKVA 1HPCA 5LMNQ 3U4ZA 1IW7D 1SBBB 1BCPD 5IYBG 3T1HL 2SOBA 2QCPX 3X3MA 1JJ2A 2WB1G 4BBSB 3GD7A 4QB4A 2VQFL 5M5XH 3MFYA 5IT9L 3T1YL 4DA2A 3QR8A 5AFWA 3MXGA 3STBC 3D3RA 3TRZA 4C3HG 5KYLA 2J4XA 2NWGA 4RKLA 4LW1A 3A55A 3I4OA 3MEHA 2A6EC 2AQ2B 2OQKA 2O4XA 2VUMG 2RCNA 1JB3A 3E0EA 2F0FA 1CQVA 4IFDH 4DV0L 3GQBA 1VQGA 4GKJQ 1YBYA 5C5LA 3KLSA 5FK9C 5M3FH 1HQRD 4ZCKA 5C3XA 2RSOA 3J81L 4IUVA 4OXPA 1ESRA 4N9PA 2VQFQ 2F4VQ 1IHZA 2K05A 2QKIC 2ZXOA 4IOCA 2N55A 4GNXB 1TXYA 5C3EG 2K01A 4XDXA 4DR2Q 3PUWA 1ENFA 2XNAC 4A3IB 1A3UA 1DJRD 4C3JH 5K36G 1HZ9A 1WD0A 3OMCA 4A3DH 4RMFA 3EN2A 3RMHA 2F0KA 4GOPB 4GN4B 2N78A 1XNQL 4RGTA 1LTSD 4ZRZA 1ET6A 1DZ1A 5FKAC 2CHBD 2B2UA 1A0IA 1O7ZA 1T5EA 4IUQA 1K3RA 5FJ8H 1OO9B 4JI3Q 4TQUS 3EQLC 4KHPQ 5A35A 1MHWC 4O0AA 2E2JB 5JVH3 1SLJA 2HQLA 5FLXL 1H9JA 1F2MA 3F2UA 4ID6A 4HJ8A 5C0XJ 4A4IA 1SR3A 2PW5A 1KXLA 3NWSA 1VQCA 1CQFA 1V8QA 2KJXA 4CDFC 1EY7A 5IY0A 3GTGB 4YCWA 3CKIB 1UEBA 3HKSA 4ZUIA 1GUOA 1ICWA 2CWAA 1GUWA 3I4MG 2NUCA 4MIUA 3J81i 1CSQA 4K6LA 1P8LA 3OWEB 2Z1CA 3I4NG 4IURA 1YHQA 2MHVA 1VQ7A 2B8FA 2EOTA 2KA7A 5IYDG 5E3FA 2Q2TA 1FD7D 5ISRA 1X56A 2DJFC 2ICEC 1CI3M 2KECA 3K80C 2B2YA 3OHXC 5BR8Q 4QL5A 4JOIC 1SAPA 2JE6I 4A3EB 1LTLA 4DV1Q 4K8JA 1ZKOA 4A93G 1XTDA 1IYUA 3EIVA 1PH2A 4OO1I 4DR4L 1Q81C 5ELDA 1I4RA 2A68C 5LL6X 3D31A 2B63H 2F4IA 4QGUA 3SR1A 2PQAB 4LUZA 3T51B 1WCMH 3J7AF 2JA8H 2CCZA 3CC2A 3TS2A 1CK1A 1RTNA 5A2QE 1EOTA 1TY2A 1PH4A 2NVTH 2QA4A 2AWNA 2O2LD 3HKZB 1EWCA 2N8NA 4Y7NB 4QUFA 4DFAA 3CQZH 3PUXA 3SHLA 3J7A5 4FXDA 1QE6A 5IT9E 3S1MH 4X3SA 3HOUG 2EDGA 2XN9C 4KLKA 2FFKB 2L4NA 1Y1VB 5LHY1 1HH2P 2ZXRA 3BG3A 1HHVA 2ID0A 4O2DA 3S1NB 4HEDA 2SDFA 2O5JC 2KEEA 5ELNA 4JI1Q 2KHIA 4LFBQ 1PH7A 3RD4A 2F4VL 2KCCA 2Q2UA 1U5KA 5IE8A 4JI6L 2YV5A 3ULPA 4AH6A 3UDGA 1Q8KA 3KBXA 3QO2A 5H1SE 4RH6A 3WWVA 1O78A 3RZDB 4B3TL 1IYVA 5EJWA 1VQLA 4JV5L 2VZAA 2DN8A 2R7FA 1W6JA 3BVGA 4L8JA 2EXZA 3KLSX 1EIYB 1CHQD 2Z9HA 3QOJA 5ELCA 2NVQH 2XWBB 1CKOA 1BUVT 1N36Q 2EE1A 3T13A 3QB3A 1LTRD 2B39A 4DAPA 4Q0FA 2A1AA 3HOZH 4JI3L 3KF6B 3TSSA 2RDGA 4UP7A 3VR2A 5IP7G 4JI8L 3IL8A 1PMRA 5CMDA 1XPOA 1KQSA 1ESFA 4P74A 1LM0A 1KD1C 3FKIB 1CUKA 1U4PA 1B2TA 2OXPA 3KUPA 3Q22A 2B2YC 4TKOB 1P16A 4B3MQ 1X3EA 3M4OB 4RGNA 4A3CG 5DM63 3PCOB 2PW7A 5M5YH 1DOKA 2B2TC 5LMUL 2JN4A 1PRTD 1H9KA 3DXJC 3HG9A 1EZ8A 2QF7A 4DV4Q 5DEHA 3E6ZX 1NR4A 2I5HA 4X65Q 1O7IA 1LT4D 3HOXH 1S3OA 2J7ZA 1SSOA 4X3TA 1IXRA 1F9PA 1CM9A 3Q8DA 2YU9H 1K0SA 3GTJH 3Q23A 4PV1C 2H5XA 3ULLA 1R4QB 2RKSA 1IBMQ 2A69D 3H94A 3K57A 2KENA 4B3ML 2L0CA 2JA8G 1FGUA 1DCZA 1X54A 2MGSA 3KJOA 2L11A 3G4SA 1KLGD 3HOYH 1CA6A 1SYCA 1RF2D 5ELEA 1PV4A 1U4RA 2K14A 4RGMA 3PQIA 1HZBA 1E2VA 3SK4A 3H0GB 1BBWA 2CH4W 3I73A 3NQTA 3NUCA 3T16A 1VF5C 1FJGL 1JICA 2ZTDA 4G7HC 2CQOA 2NVYB 5E7NA 4KJNA 1PZID 2GVBA 2V1CC 2R7ZB 1TWGB 4DAYA 1F9RA 2F0LA 3GTMH 4XXEA 1C4QA 5EBDA 3HP3A 3S15H 4PMCA 2A8VA 4RFBA 1XYIA 1PXUA 1G6ZA 4GKKQ 1PTOB 3F1ZA 2L9HA 4XYQA 5ELBA 1N33Q 2DJGC 5BN3A 1IBLQ 4LF6L 1JJGA 2MJ8A 1MI2A 1TWAB 4N8X1 4KN7C 1Y8PB 2MO0A 4LFBL 4GOPA 3S2HB 4XT1B 4KD4A 1GM5A 4L5SA 1HUNA 3SK6A 3SGIA 1L0WA 2EYMA 1TQOA 3S1RB 3H09A 5C0XH 2D62A 3OIQA 2R92B 1I94L 1SMYD 3TP6A 4DNTB 5IGDA 4LF4Q 5C3WA 3AQQA 3E3XA 3NENA 1U4MA 1D8LA 3W1GA 1TWCH 1FYCA 2AUJD 2X6LA 4IPHA 1EY9A 1X6OA 3Q6SA 4KD3A 1KAAA 4P71A 2I5LX 1PH8A 2F0WA 4KI0A 1D2BA 4HN7A 1CHPD 1D5ZC 4K5XA 1SRUA 1Y8NB 2OQ0A 1JMCA 1LT6D 1XNQQ 1IKMA 1HFGA 2LS01 1EUJA 3OW2A 2A69C 4OONA 3VYRA 3J80c 2K5QA 3RR5A 1SJHD 4GLVB 1QNKA 2ALYB 3B6YA 2BH2A 1S40A 2HHHQ 2EJGC 1JWUD 1U9RA 4ALPA 3S1MB 4ZKBB 1F9QA 1JQYD 5M5WB 2JA5G 1HNWL 2WB1E 4UPAA 1PH9A 5CBAE 1TVXA 1WJJA 3PO3H 2K50A 4DV4L 1SDFA 4DXGA 4JC0A 2CQAA 4F87A 4B3SL 3FDTA 2IHFA 2WFWA 1PYBA 2L12A 4E6IA 3S1NH 2PZWA 1EYAA 1D5XC 1YEZA 5EAYA 1BXTA 1ILPA 4NKLA 1I3QH 3I72A 3M4YA 5IT9c 1I6HH 2BOSA 1STYA 4GS3A 5GAHC 1CTMA 4IPGA 5FO9B 2E74C 1HR0L 1MSHA 5GAEC 1BNZA 3V05A 1NSNS 1X3PA 2UUBL 3A0JA 3VA7A 4CGYB 3TZUA 4ZUJA 5HGTA 4WRDA 5IYCG 2ZJQA 4C3JG 4DR3Q 1I4GA 2PZTA 4A3BH 2NTSA 2EY6A 1H9RA 3OOCA 4MTKA 2UXCL 3PV0A 3F2CA 1XNRQ 4UY8C 4IJLA 1SFOH 4R1JA 1SMYC 3BVZA 3AU7A 5C4JH 4U68A 5IGFA 3BVMA 5C4HA 1FL0A 4X66L 4A3MH 4OL7A 4DV7L 3GTPH 1PH3A 4R4TA 1D7QA 1UE1A 2L5TA 2BDNA 2NBFA 1YNJC 1K8OA 3CW2C 1SNPA 1LABA 5I2XA 3CCUA 1I50H 4ZYSA 3NBHB 3MAQA 4B08A 4Q5VA 4KHVA 1B7YB 3VR5A 1GVPA 4A3JH 2LXKA 5M3FG 2HCCA 1KDBA 2B3GA 3K5LA 4TVAB 4GNXC 2V4DA 1MIUA 4BWGB 1N32Q 1RCVD 1QVFA 3K7AB 5K36H 4LUVA 4QY7A 2JXMB 2E2DC 2DNEA 1ZYRD 4WORA 2M2LA 3K0YA 4A3FH 1Q7YC 1STAA 4LJZC 4WJWA 4H44C 4K14A 5IOCA 1EEID 1BDOA 5I9OA 1VQDA 3CRKC 3OMGA 2JQOA 2OEOA 2UUCL 4DR4Q 3ICEA 2RQXA 1K83H 4J6HA 1Q8IA 4LFAQ 4BY7B 3VR3A 1BKBA 1TWFH 2OTJA 4RHRA 1VMCA 3A7LA 2R7DA 4HTHA 1QJOA 1PYSB 1E1TA 3ND8A 5FLMG 3PO3G 2KCMA 2KUMA 2FXQA 2LXJA 4K5WA 1QG7A 2Q8RE 4IUUA 5D14A 1L1OB 3UI2A 1TWHB 3H3VH 2PZUA 4DV6L 5GROA 1UUPA 4ULLA 4KKSA 1F77A 1LTAD 1STEA 5I6WA 1HA6A 3BU2A 1WYDA 1VQAA 2I5MX 2NYZD 3HFZB 4DV6Q 1VQJA 1TY0A 2XTIA 3S2HH 4DR1L 1AEXA 1NJIC 2K5WA 2VQEQ 3RLOA 5HGQA 3QIAA 4A3DG 3PSIA 2F0GA 3DMUA 2PPBC 4LAAA 1KL9A 2CH4A 1IL8A 4C2MB 5C5MA 1B1ZA 1Y8OB 4UDUC 1A3VA 2I0QA 1LLRD 4O42A 5LL6S 2GN5A 3H15A 1KRSA 4IJHA 4DNIA 3KFUA 3K5OA 1X32A 1N36L 1F2ZA 2BDOA 3GTOB 4B9WA 3W3AA 1QZHA 5D3DA 4BBSG 4CDDC 3QJYA 2OCEA 4GNXA 1LYLA 5A2QL 1BBUA 1XXGA 3IFDA 3PUYA 4C3HB 3A8JE 4ILWA 1XMQQ 3CMEA 1HZAA 4NPSA 1PTOF 3RLNA 1R9TB 1N34L 1B9MA 4DNRB 1NTGA 3GTLB 5IP9H 4LF9L 4IPCA 2WKDA 1WTHA 1Y1VG 2EYPA 2M9VA 5D65A 5M3MH 3VYSA 3K59A 3NTHA 4DV3L 1CZGA 4NB3A 3PUVA 5LMNW 3JAMi 4OELB 2GVAA 4A3BG 1GOZA 3T1HQ 1V43A 3IAYA 2UUAL 4DR5Q 3BDCA 3M4PA 2VL6A 1C48A 1KABA 1TKWB 1YZ6A 2HIVA 3I2ZA 1WTRA 2F0HA 2YYZA 1BO0A 4B9XA 3R8BA 5IODA 1G91A 3RN5A 1T9HA 2K5VA 1E3PA 5EKIA 1Q1EA 1X3FA 5TSSA 1KRTA 5FLXE 5E4XA 4EQNA 3HOYB 1SNQA 1RHPA 1UE5A 1V9PA 1HJPA 2I46A 1J6QA 4POGA 3W5OA 5IIFA 3D6WA 2JA7G 3GTPB 2HUGA 4G4KA 1OXTA 2AHOB 1CT1D 2QEXA 2RVLA 4DUYL 4WJ4A 3K5MA 1BOSA 1UNSA 1DONA 3LX0A 2Z6KA 3I8ZA 1HQMC 3WDNA 1ASZA 2JA6B 2UU9L 4IUNA 3RZDH 1A2UA 1BF4A 3KYHC 4L63B 2QEJC 1VQPA 4QUCA 1I4XA 4APVA 1PH1A 2JA8B 3S15B 4YY3L 2P5ZX 5CV8A 1OXSC 3A5ZB 1SYBA 1I94Q 1YJ9A 2NVQB 3RZOB 3BZKA 3F2DA 4ZK9B 3PMFA 5CV7A 4F8MA 3OW7A 2K04A 3CCLA 3CCMA 1NMGA 2O5IC 1KTKA 3PIP3 2CFMA 3PF5A 2Z6KC 1SN8A 2MO1A 4A93B 5D3IB 4K5VA 2Z4HA 4LF7Q 1TT2A 2B2WC 1EYDA 4C3JB 5C3EH 2R7ZG 2R93B 2NVXH 2A74C 2IHEA 5AJ3L 4O1NA 4KHPL 4C3IH 4PZ8A 5IP7H 4GKJL 3HGBA 2BE5D 5CV4A 1I5FA 1A15A 1VQBA 1WTPA 3H0GG 2RBMA 4OGQC 3I90A 2B2WA 3D0FA 3MXUA 2YTVA 1GHKA 1QCBD 5IGCA 3H3VC 1QVCA 4G7ZC 4NMZA 2F0TA 4RAUC 1Y69U 1GUGA 1II3A 3J80E 5JJLA 3U58A 2SEBD 3NE5B 3CPFA 1Q3LA 4BY1H 2YTYA 4IZ8A 4KHZA 2HHHL 3NWTA 4B3SQ 4KK7A 2B29A 2MFIA 1CKMA 1BVSA 2ZTCA 4YCUA 2JA9A 4DK6C 1UEAB 1XTCD 4L5TA 3CU7A 1L1OA 4B3RL 3ONAB 3J81E 3OTOL 1IZ6A 1DOLA 4BS9A 4JPBW 1IW7C 5JEAH 2UUAQ 1CA5A 2VNUD 3NTIA 3JC66 1SYFA 4V190 4DV2Q 4JBWA 2NN6H 2PYKA 1F2LA 1C9OA 1OTCA 1G2SA 1JE4A 3ERQA 2E2IB 1IYJB 2OF1A 5J1ZA 1TS3A 4OO1H 3HOXG 5KNDA 2EJFC 3R3OA 1FGBD 1SJED 5FLMH 4OHJA 2KCNA 1EQQA 1VF7A 2A6ED 1MD2D 1I6HB 1PYWD 3D8GA 2ASBA 4K0KL 1B70B 4XQJA 5ELOA 1WCMG 3S24A 4MHEA 1EQTA 1M1KC 1K8GA 3CQZB 4R4IA 2PMZB 3I4NH 4DPGA 3CPWA 5IYDH 1PRTB 1EWIA 3FKIG 4DUYQ 1VQOA 1OXVA 3GTQH 4UHVA 4FDBA 1SNDA 1H9MA 1PFNA 2JP1A 1K0RA 2EYLA 1PZKD 4XYOA 4XT3B 1QILA 1K73C 5M5XB 2PNHA 4BA1I 1S5FD 3BDLA 2IJ0A 1LACA 1X3QA 3RN2A 1ET9A 2BE5C 4NXNL 5I6YA 2JA5H 1LTBD 1SYEA 2PI2E 1SE4A 1GD7A 2AQ1B 3P1HA 2DGYA 4YIJA 2RCFA 1VDZA 1KC8C 3R2IA 4JBMA 5JEAG 4CJ0B 3TMEA 2NVYH 3KF6A 4BBRH 2EZVA 2UXDQ 1RIPA 1SNMA 3HOZG 1O80A 3CC4A 1H9SB 2LMCB 4RKBA 2RSNA 2FMMA 4C3IG 1WCMB 3MTSA 1MKHA 3OIPA 4F7XA 4LF7L 1DD2A 1TIID 2F3IA 3L7ZC 4DXFA 2FJ2A 3KF8B 4A3JB 3ND9A 3SE0A 1N32L 1X9NA 1VQ6A 1KDAA 2Q8TA 5G3LF 4FP5D 1C8CA 5JJZA 4FVMA 2SNMA 3S1QB 1PDQA 2K6AA 1GXDC 1EU4A 5IGGA 2FHTA 3U50C 1MJEA 4QF4A 3CP0A 3F2BA 4JBJA 1MBYA 3NHHA 4A3FB 1ZEQX 4IFDI 3QG1A 3G48A 4LF5Q 4LFAL 2PQEA 3M4OH 2R92H 4J8QA 4KTAA 2F03A 3OTOQ 4N9TA 1VS0A 4BXXG 3ZJYC 1K83B 3UDXA 1W2BA 1YIJA 1Q46A 1TWCB 1IBML 3D4DA 3TN2A 3K6OA 3MXNB 4LF5L 2A68D 3E9HA 2A6HD 1SE2A 3J81j 2HDLA 3K81C 3GV3A 4ME3A 4J1MA 4JI8Q 2XSCA 4NXML 1LTID 1NBWA 2JK8A 1E22A 1FNWA 3T56B 1FNUA 2BA1A 2MP1A 3N52A 1K9MC 3DHQA 1ONLA 1VQ9A 4A3BB 3CCEA 4K2KA 1PH5A 1K8AC 5C44B 5EPKA 1NMFA 4DAYB 1W3SA 4EX5A 5IGBA 1S5DD 1HNZL 3I4MB 4HJ7A 4JI7Q 4NXMQ 1B8AA 1MGSA 4A76A 1SYDA 1V1PB 3PGZA 4A93H 2AUKA 3HKZG 2EJMA 4LNQA 1QB5D 3PIOA 4P73A 3P20A 4XIGS 1L0YB 1EY4A 4H7BA 3R93A 1JJCB 4IN3A 3PO3B 1X65A 3H6MA 3G71A 1O7LA 2VB2X 3N6RA 2JSOA 1KDCA 4FXKC 1LTTD 1QZGA 1WTXA 1I50B 5M3MG 5CV9A 1YI2A 1PTOD 1RKNA 2WAQE 4J15A 1HR0Q 1JCKB 3Q24A 4PNYA 2NVTB 1G2TA 4BY7G 5KNBA 3NBHA 1BCPC 2JA6G 5CR3A 3MXNA 4PZ7A 1BCPB 1VQMA 4LF9Q 2AQ3B 4I7ZC 1JOQA 2Q2HA 3D4RA 4A3IG 1C7YA 1E1OA 4LUOA 4DV3Q 1S5BD 3G7LA 3K58A 3HOUB 2K75A 5FJ8G 4KJOA 3S16H 2RA4A 2IX0A 5C4XG 4MTNA 1SFOB 3NP8A 1N34Q 2UXDL 2A73B 4HAEA 2VXWA 2IW3A 1WD1A 1OXXK 4IO9A 3H91A 1QNUA 4OEMB 4IPDA 2CVRA 1L0XB 1PFBA 1S5ED 2F0NA 2QGQA 1FJGQ 1TS5A 2PCFB 2VB3X 3TQYA 2BH8A 2B2TA 1HTPA 4CHTB 2F0QA 5DM73 2R6GA 1B3AA 1E7ZA 2E2JH 3RUZA 4GLAC 3CXCA 5CC4A 2E2IH 1XPUA 3TS0A 4GZYC 1I6VC 1Q90A 1N8RC 2QILA 3AB9A 1AFPA 1EYCA 3VR4A 1D6EC 3KLRA 3GTGH 4K8IA 1A8VA 3EROA 3EBEA 4HIOA 5JPMC 1XJVA 1B53A 2M00A 4LF6Q 3CD6A 1YNJD 2Y0SG 3M3YH 4HIMA 1TS4A 4IFDG 1HNXL 2EQSA 3CCVA 3TZDA 1U4LA 1X3GA 3I4NB 3DM1A 1EZ6A 2UUCQ 4A3IH 4BA2I 5LMUQ 1QVGA 3X3NA 2F3VA 3T53B 3I4LA 4IQZA 2LSSA 2JYOA 2ZM6Q 3WOFA 2JA7H 3HOWH 1NY4A 3GP7A 2G9DA 1ML0D 5LMNL 3PO2G 1EWHA 4A3MG 2B2UC 2K52A 1I4HA 3HOVH 4EVOA 2B63B 1QUQB 1PTOC 2PNRC 3VYUA 4A3GB 4X64Q 1GHJA 5M3FB 1B44D 3A56A 5C6AA 4A75A 4DR3L 1EIFA 4RCOA 3A54A 1RTOA 1EIHA 4DR1Q 3A74A 4UAIA 3VDYA 2AKWB 3HOXB 3ZYYX 3KDFA 3J81c 1GKHA 3WOEA 1CZWA 1RL2A 2KVMA 4A3EG 1J8IA 4IALA 3GTJB 4LMQD 3W2DA 1K3BC 3BDOA 4HMIA 2F1MA 3PO2H 2BA0A 1GO3E 2KQ3A 1SE8A 2NZHA 2XVSA 5T1GA 5C0XI 2IY5B 4DV7Q 2VQEL 2IL8A 3SEBA 1I4QA 3K8AA 1S5CD 1EY6A 1M8AA 2EY2A 4RGOS 3ULJA 2HCIA 2F0PA 3S1QH 5T1IA 2MPMA 4EGVA 1PLFA 4A3MB 3M7NA 4KN4C 5KIXA 2LFNA 4EQOA 3MZ5A 2R61A 5IWAQ 3GTLH 4JI2L 3EVQA 4DF7A 1S72A 4QIWE 4YWMA 5I2YA 3I55A 2JEBI 4U673 4JCVE 4OWWB 1IBLL 5IP9G 2DUDA 3HZXA 3CCRA 4RA8A 1I3QB 1PFMA 1BBXC 4YHHQ 1XMQL 4HSPA 2XRQD 1K28A 3CMAA 4XQQA 2JJQA 3KLWA 3EA6A 3BZCA 4V0BA 5CYUA 1AZQA 4IFDJ 1LT3D 4CBVA 2QDLA 3URYA 1D1KA 2D9UA 1BR9A 4DV0Q 3KBGA 1Q82C 1E2WA 1TWAH 3J7AV 4KY5A 5JPNC 5K5PA 3DWAA 3U9OA 4LFCQ 4HMJA 1VQ5A 3AMUA 4A3DB 1KLUD 3S1RH 1TS2A 4DUZQ 1GUTA 3CCSA 1WTOA 1EFWA 1CSPA 5GQOA 1SMXA 2K32A 2EIFA 4JW0A 4ZQ3A 4HIKA 3VA5A 2ZT9C 3KOJA 4H13C 4AYBG 1PH6A 2F3WA 2L15A 2R93G 3OPOA 1EQVA 2DY7A 2D0OA 2F0UA 1G51A 2MUYA 1LT5D 4CJ1B 2CKZB 1WTVA 4QCLA 4DV1L 2N49A 2I07B 3FRPB 4K0KQ 3FVQA 4DR5L 5IYBH 1J5EQ 1V1OA 2NZOA 2RHQB 3MC0B 4LFCL 2YU9B 4X62Q 3MHBA 4HIDA 1YVCA 3M4QA 1Z47A 3C1FA 2VS1A 4IUTA 4YWKA 1WTQA 1PRTF 3NK9A 4KY7A 1QOHA 2PO4A 2VUMH 4L6TB 5L37A 4F88A 2EPBA 4AIMA 2K5DA 3BJUA 5FO7B 1A63A 1VQ8A 4X62L 2VY3A 4C1NK 2FINB 3MFGA 5CGKA 3DM3A 1NAPA 3TP7A 3DWPA 5C3EB 4NXNQ 2ATWA 1SROA 4A3EH 3TDQA 1D5MC 3A8KE 3I3CA 4PZ6A 1HZCA 1J9OA 3NPPA 2K4KA 1WOCA 4I65A 3NBIA 2H1EA 4XTCS 1F2YA 3V2TA 1STGA 1BQQT 3CF5A 3ERSX 4FXGC 5HY6A 2UUBQ 1OXUA 1F9SA 4FYDA 1GJXA 1O7YA 4LK1C 5DAUA 4PQXA 1DM0B 4JI7L 3NSWA 1AE3A 5M9OA 2UXCQ 2WKCA 2F0IA 3O13A 1YITA 1IBKL 5C4ZA 4EQ5A 1VQNA 3Q0AA 4A3KG 4X3KA 3S2DH 3P7JA 4FF4A 3SK5A 4CKEA 4DK0A 3IKJA 2E76C 1I4PA 3FHWA 1KNEA 2WIIB 1NUCA 3AFQA 5KEEA 1GUSA 1IKLA 4JVZA 4AYBB 3RZOH 1JOKA 1ICFB 1MSGA 1UE6A 2PI2A 1X55A 1Y1VH 4H0LC 1JORA 3M3YB 2EY5A 3MVVA 2R92G 3NQIA 4DN4M 4YHHL 4PMWA 1ZYRC 3U4VA 4FF1A 1R9TH 4A3KH 2NVXB 4HCEA 1HA5A 3LGJA 1H95A 1AZPA 1STHA 5KRUA 4C3IB 4DR2L 2OTLA 5I4DA 1Z7TA 5F2DA 2R7ZH 5BN4A 1JC7A 4H02A 1E2ZA 3HS0C 3W1BA 3GTMB 3I7FA 1H9SA 2A5HA 4B3RQ 4DK1A 1TR5A 2J0TD 2N88A 1A2TA 4CKCA 2KHSA 2D2CC 1LV9A 2HIXA 2CW0C 2EY1A 3SVMA 4DAMA 2K7VA 3HOZB 3GTOH 4BY1B 1KAWA 1A6XA 3K7AH 1YJNA 4PMBA 3ER0A 3I70A 3PIO3 1TU2B 3KDFB 5M5WH 3I91A 5BR8L 5KGUA 3F8TA 4ME5A 4Z9CB 2UU9Q 3M85A 1KHIA 1NNXA 2C5CA 3MEFA 2ZJPA 2NZ1D 2F0DA 3FEWX 4RG1A 3U9SA 1AE2A 1G291 1U0LA 3TP8A 2XGTA 4DR7L 2X69A 3CC7A 3HKZE 5NUCA 4FNFA 1Q12A 3LWEA 1HNXQ 1CKNA 2ZXPA 4DKAC 4R4OA 1AH9A 1STNA 5I9PA 1PTOH 2EXDA 4A3FG 4MNOA 2ZTEA 4Y7NH 2KHJA 4A3CH 4DR7Q 3FPPA 2B63G 4ZAIA 1VQFA 3FMCA 2IX3A 4CDEC 5C44G 2WP8J 1L1OC 2F0EA 2TSSA 1TWHH 1WFQA 2HT1A 1Y1WB 2NN6G 2H4OA 1VQ4A 2K1BA 3JAME 3P75A 3S14B 3R2TA 4HJ9A 4YCVA 3VR6A 4X65L 3DWQA 1NE3A 4JI5L 4TSSA 3DLLA 4AYBE 3K5NA 3L3OC 3CCQA 4QQBX 2X6GA 2RHSB 1V1QA 1E24A 4JI1L 3JAMc 3V96A 1A62A 5COYA 4KKTA 2C9OA 2QDBA 4KV6A 4JI0Q 1QWYA 1TWGH 4BY1G 1Z9FA 4B3TQ 3BS1A 1HTLD 2F52A 3QOLA 5EPJA 2D5DA 2ENBA 4WFN3 5FO8B 3OSOA 1B4OA 5ELFA 4LF4L 2CW0D 2EYHA 4JI6Q 2Q8IB 5JAVA 4IOAA 2JA6H 3E9IA 4KMUC 5C0XG 3IFTA 4JI5Q 4OX9L 4LF8Q 4X6AH 3UE0A 2G9HD 2HD3A 3FPUB 3HRZC 2G5DA 3CHBD 4R4CA 4RCNA 4JV5Q 1PRTC 2E8GA 5JEAJ 1PVOA 1HRJA 1G6PA 3SK8A 1RJTA 2K03A 3C1EA 5JJIA 5KNCA 4JI0L 1DXMA 3TEHB 4C56C 3H3VI 1HNWQ 5C4JB 1FVIA 5CV6A 2L1BA 2VW9A 1UE7A 2MQHA 3G6EA 3C46A 2UXBL 4M1UB 5J22A 5AJ3Q 3L2PA 1DGSA 4R8IA 2F0SA 1EYGA 2XWJB 5C4XB 2PMZE 4X64L 5GADC 1EL0A 2K28A 3DUZA 1XPRA 2EYJA 4GN5A 1YHAA 4JOIA 3BZDB 1C0AA 4AQYQ 5GAGC 2WAQG 5EBCA 3L0OA 5J3BA 4DGZA 5J39A 4OWTB 2DY8A 2MNAA 4L5QA 4A3GH 1PZJD 2E2HB 1HNZQ 2KOLA 2Y0SB 2AMCB 5G3LD 2ICIA 4ZLTF 1YNXA 4G57A 4P2CB 3STBD 4GN3B 4ABNA 2RF4A 1NCVA 5IWAL 3L9AX 5EKKA 2XRSD 2KBNA 4NDXA 4S3SA 1SXTA 2SNSA 4RHSA 1B50A 2E75C 3PO2B 1VMPA 4OWXB 2IX1A 3GTQB 2A19A 2ZJRA 2B2VA 1AP0A 5JJKA 3FKIH 3D4WA 1V1PA 5C44H 1EY5A 4FF2A 4A3GG 4NP5A 3FP9A 1ZXTA 4HSVA 5FOBB 1W6KA 3S17B 2K33A 5EPLA 2A6HC 4X3UA 4OO1G 4IUPA 4JI2Q 5M5YB 3GTKB 3UE1A 5CV5A 1QUQA 3UDIA 3C2PA 1JB7A 3AEVA 1R4PB 4UP9A 2CWPA 1A3TA 2NN6I 1JWMD 4QIWB 1PHJA 4R9WA 1ENCA 3D6CA 1SNOA 2AWOA 4QJFA 4DU9A 1D1IA 3OYYA 1HUMA 3CAMA 3K0XA 1SYGA 4KY6A 3DEOA 1L2FA 3LNNA 4L5RC 4JG2A 2F0OA 2EVBA 4BBSH 4BBRG 4MZ9A
chains in the Genus database with same CATH topology
4JYAQ 4P75A 3RN5A 4UP7A 1T9HA 2K5VA 1E3PA 2N3SA 2YTXA 4JI8L 3ULJA 5IP7G 1XPOA 1KQSA 4P74A 1MJCA 3S1QH 3UDFA 4BXXH 1LM0A 3HOUH 1KD1C 1Q1EA 1X3FA 2K5HA 3H0GH 1CUKA 1KRTA 1PFSA 4WJ3M 1HR0W 3M9BA 1UE5A 1V9PA 1HJPA 3M7NA 4DR6L 1P16A 4B3MQ 1X3EA 2KCTA 4A3CG 1J6QA 4JYAL 3PIPA 4POGA 3PCOB 3W5OA 5IWAQ 5M5YH 3GTLH 4JI2L 2JA7G 5LMUL 1OXTA 3AYHB 4OX9Q 1S72A 4QIWE 2AHOB 4YWMA 2QEXA 4A3LH 3I55A 4DUYL 2JEBI 4C2MH 4WJ4A 4JCVE 4OWWB 1IBLL 2Z6KA 5IP9G 4JI4Q 1ASZA 1VQKA 2UXBQ 2DUDA 2UU9L 3RZDH 4DV4Q 3KYHC 1VCIA 3CCRA 1YHBA 2I5HA 4X65Q 1O7IA 1VQPA 1PH1A 4APVA 3HOXH 4YHHQ 1S3OA 3CCJA 4YY3L 1XMQL 4YWLA 3CMAA 1OXSC 3A5ZB 2JJQA 1IXRA 3KLWA 1KIXA 3Q8DA 3BZCA 1YJ9A 1I94Q 3GTJH 2YU9H 2Z0SA 3BZKA 3F2DA 4IFDJ 2H5XA 3ULLA 1IL2A 4JI4L 4DV0Q 1IBMQ 1Q82C 3CCLA 3CCMA 1NMGA 4DV2L 4AQYL 2KENA 1TWAH 2PQAA 2CFMA 4B3ML 2JA8G 3PUZA 1Y1WH 1FGUA 3PF5A 1X54A 4DV5Q 2Z6KC 3KJOA 4LFCQ 1SN8A 2MO1A 3G4SA 4LF7Q 3HOYH 4C3HH 1VQ5A 3S14H 1Y14B 5C3EH 1PV4A 2R7ZG 2K14A 1HZBA 2NVXH 3S1RH 2IHEA 5AJ3L 1IBKQ 1Q86C 4DUZQ 1BBWA 2D0PA 3CCSA 1CKNB 1CSPA 1JE5A 1EFWA 4C3IH 4PZ8A 5IP7H 4KHPL 4GKJL 5GQOA 1SMXA 1FJGL 3GO5A 2EIFA 4HIKA 2ZTDA 2CQOA 4IOAA 5E7NA 2GVBA 4AYBG 3KOJA 1PH6A 4BY7H 2V1CC 2L15A 2R93G 3GDEA 1I5FA 3GTMH 1VQBA 3T1YQ 3H0GG 4P72A 5IYCH 3RNUA 2D0OA 3S15H 1YJWA 1G51A 2CKZB 4UP8A 4DV1L 2N49A 3D0FA 2YTVA 1VQIA 2A8VA 2Q2IA 4K0KQ 3AFPA 1QVCA 5IYBH 4DR5L 4GKKQ 1J5EQ 5JJLA 3F1ZA 2NZOA 2RHQB 3U58A 4LFCL 3HOYG 3CPFA 3HOWG 4GLXA 4BY1H 4X62Q 1XMOQ 1N33Q 2YTYA 4HIDA 4KHZA 1ASYA 1YVCA 1IBLQ 4LF6L 3M4QA 1Z47A 2VS1A 4YWKA 2HHHL 1JJGA 4B3SQ 2B29A 2MFIA 3J7ZC 1CKMA 1BVSA 2VUMH 3HOVG 2ZTCA 4YCUA 3IRBA 2MO0A 4LFBL 2JA9A 4DK6C 4GOPA 4L5SA 1GM5A 5FLXc 3RLFA 3SGIA 4AIMA 3BJUA 4YY3Q 2E5LQ 4L5TA 4B3RL 1L1OA 1A63A 1VQ8A 4X62L 2VY3A 3J80i 1L0WA 1WI5A 3OTOL 1Y1WG 4X66Q 1IZ6A 2Y0SE 2R93H 2D62A 3DM3A 2UUAQ 4NXNQ 2ATWA 1SROA 4GOPC 1I94L 3I4MH 1XNRL 2VNUD 4A3EH 3JC66 1VQHA 4JBWA 4DV2Q 4PZ6A 4LF4Q 1HZCA 3AQQA 3NENA 1D8LA 2K4KA 1C9OA 1WOCA 4XTCS 3I56A 4A3LG 1OTCA 3W1GA 3CF5A 3ERSX 1JT8A 5HY6A 1TWCH 1OXUA 2UUBQ 1IYJB 2IT1A 4LWCA 4IPHA 3HOXG 1X6OA 5C4XH 2K5NA 4P71A 4HJ5A 2I5LX 1PH8A 4KI0A 1EOVA 5FLMH 1EQQA 1AE3A 4JI7L 2UXCQ 1M90C 4Y52H 1LUZA 1SRUA 2OQ0A 3NELA 1JMCA 1YITA 1IBKL 4EQ5A 1XNQQ 1UWVA 1VQNA 2ASBA 1PA6A 3OW2A 1B70B 1EUJA 4K0KL 5ELOA 4A3KG 1WCMG 3S24A 2E2HH 4OONA 2E5LL 3S2DH 3K7UC 3J80c 4JBKA 3RR5A 1M1KC 4GLVB 1K8GA 3FHWA 2ALYB 3B6YA 2OWOA 4R4IA 3I4NH 4DPGA 4A3JG 3AFQA 3CPWA 2BH2A 5IYDH 1S40A 2ES2A 1EWIA 3A5UA 3FKIG 4DUYQ 1VQOA 1OXVA 3RZOH 2HHHQ 4DR6Q 3GTQH 4FDBA 1UE6A 4HJAA 3KJPA 2PI2A 1X55A 1Y1VH 3NEMA 1VQEA 1K0RA 4ALPA 4GKKL 2R92G 4YHHL 2JA5G 1K73C 4PMWA 1HNWL 2WB1E 4UPAA 2PNHA 4BA1I 1PH9A 4LF8L 3PF4A 1N33L 1WJJA 3U4VA 3PO3H 2K50A 3RN2A 4NXNL 4DV4L 2JA5H 4DUZL 1EQRA 2PI2E 4JC0A 1R9TH 4A3KH 3S17H 4DV5L 1GD7A 4B3SL 2JEAI 2IHFA 2DGYA 1PYBA 2WFWA 3S1NH 3LGJA 1H95A 4DK3C 4R4QA 4DR2L 2OTLA 1KC8C 1YEZA 5EAYA 1Q1BA 2R7ZH 1I3QH 5DLQE 5IT9c 4H02A 1I6HH 4JBMA 5JEAG 3GTKH 3W1BA 2UXDQ 2NVYH 3KF6A 3I7FA 4BBRH 4GS3A 1RIPA 5GAHC 1N9WA 4IPGA 4PG3A 3HOZG 3CC4A 1HR0L 4B3RQ 5GAEC 1MKHA 4LF7L 2UUBL 3TREA 2F3IA 3A0JA 1J5EL 3L7ZC 2HIXA 3KF8B 1N32L 2C35B 5IYCG 4DAMA 2ZM6L 4DR3Q 1X9NA 4POFA 2ZJQA 1VQ6A 3GTOH 4A3BH 2UXCL 3PV0A 3F2CA 1XNRQ 1KAWA 5LMNQ 4UY8C 3K7AH 4IJLA 3U4ZA 1SFOH 1YJNA 5IYBG 3ER0A 3T1HL 2JA8H 4R1JA 1JJ2A 5C4JH 2WB1G 3KDFB 5M5WH 3GD7A 2VQFL 5M5XH 1FL0A 5BR8L 3U50C 1MJEA 3T1YL 4X66L 3CP0A 3F8TA 3F2BA 4A3MH 4JBJA 2UU9Q 3M85A 4DV7L 1PH3A 1KHIA 3GTPH 4R4TA 3MEFA 3STBC 3TRZA 4IFDI 2ZJPA 4RG1A 1D7QA 1UE1A 3G48A 1AE2A 1G291 1U0LA 4LF5Q 2XGTA 4LFAL 3M4OH 4DR7L 4LW1A 2R92H 3CC7A 3HKZE 3CW2C 3I4OA 3OTOQ 1Q12A 1HNXQ 1CKNA 2OQKA 1VS0A 4R4OA 4DKAC 4BXXG 3ZJYC 1AH9A 2VUMG 3UDXA 2RCNA 3CCUA 1W2BA 3E0EA 1YIJA 1I50H 1XMOL 2EXDA 1Q46A 4DV0L 4A3FG 1VQGA 3NBHB 1IBML 4MNOA 4GKJQ 1YBYA 2ZTEA 4Y7NH 1B7YB 2KHJA 5M3FH 4A3CH 3MXNB 1GVPA 4LF5L 4DR7Q 3E9HA 2B63G 3J81j 4A3JH 3K81C 2LXKA 1VQFA 4ME3A 5C44G 5M3FG 2WP8J 4JI8Q 1L1OC 4OXPA 4NXML 1TWHH 1WFQA 2B3GA 2HT1A 1NBWA 2JK8A 4TVAB 1E22A 2VQFQ 4GNXC 2BA1A 2F4VQ 1MIUA 2NN6G 4IOCA 1VQ4A 4GNXB 1K9MC 1TXYA 1N32Q 5C3EG 1VQ9A 4DR2Q 1QVFA 3CCEA 3PUWA 4HJ9A 4LUVA 4QY7A 4YCVA 4X65L 1PH5A 1K8AC 1NE3A 1NMFA 4DAYB 1W3SA 4JI5L 4EX5A 4C3JH 3DLLA 1HNZL 4AYBE 5K36G 4HJ7A 4JI7Q 4NXMQ 4A3FH 1B8AA 1Q7YC 1HZ9A 3CCQA 4A76A 4A3DH 4QQBX 4RMFA 2RHSB 3EN2A 3PGZA 1V1QA 4A93H 4GOPB 4GN4B 2N78A 1E24A 3HKZG 4JI1L 4LNQA 1XNQL 3PIOA 3JAMc 1A62A 4P73A 4XIGS 1VQDA 2JQOA 4DR4Q 2UUCL 3ICEA 1JJCB 4JI0Q 1K83H 4LFAQ 1A0IA 1X65A 3G71A 1TWGH 4BY1G 1Z9FA 1K3RA 5FJ8H 4B3TQ 2F52A 4JI3Q 1BKBA 2E2JH 1TWFH 2OTJA 1QZGA 4TQUS 4KHPQ 5M3MG 4O0AA 1YI2A 4LF4L 2R7DA 1SLJA 2HQLA 2WAQE 1PYSB 4J15A 4JI6Q 1E1TA 1HR0Q 5FLMG 5C0XJ 4HJ8A 2JA6H 2KCMA 3E9IA 3PO3G 2FXQA 2LXJA 1SR3A 4A4IA 5C0XG 1KXLA 4JI5Q 1L1OB 1VQCA 4OX9L 4LF8Q 3H3VH 4BY7G 4DV6L 4X6AH 3UE0A 2JA6G 5GROA 5IY0A 4R4CA 4YCWA 4PZ7A 3HKSA 1UEBA 4JV5Q 1VQMA 2E8GA 5JEAJ 4LF9Q 1PVOA 2Q2HA 4A3IG 1C7YA 1G6PA 3BU2A 1WYDA 1E1OA 2CWAA 1VQAA 2I5MX 4LUOA 4DV3Q 5JJIA 3I4MG 3J81i 2K75A 5FJ8G 1CSQA 1P8LA 4JI0L 3HFZB 3S16H 3I4NG 2IX0A 1YHQA 3TEHB 4DV6Q 1VQ7A 1VQJA 5IYDG 2Q2TA 4MTNA 3H3VI 1HNWQ 5C4XG 2XTIA 3S2HH 1FVIA 4DR1L 1X56A 1NJIC 3K80C 2VW9A 1N34Q 2UXDL 5BR8Q 4QL5A 4JOIC 1UE7A 2VQEQ 2MQHA 3RLOA 3G6EA 2UXBL 5AJ3Q 5HGQA 3L2PA 2JE6I 1DGSA 1LTLA 1OXXK 4DV1Q 4IO9A 4A93G 1XTDA 3EIVA 1PH2A 4A3DG 3PSIA 4IPDA 1EYGA 4OO1I 2QGQA 1KL9A 1FJGQ 2PMZE 4X64L 4DR4L 1Q81C 5GADC 3TQYA 2BH8A 1XPRA 2B63H 2I0QA 4GN5A 3D31A 1YHAA 4JOIA 1C0AA 4QGUA 4AQYQ 2R6GA 5GAGC 2PQAB 1E7ZA 2WAQG 4LUZA 2GN5A 1WCMH 3L0OA 5J3BA 1KRSA 4GLAC 4OWTB 2MNAA 3H15A 3CXCA 4L5QA 3TS0A 2CCZA 2E2IH 1XPUA 3CC2A 3TS2A 4A3GH 1HNZQ 4IJHA 4DNIA 3KFUA 2AMCB 1N8RC 1PH4A 2NVTH 2QA4A 1N36L 2AWNA 1YNXA 2N8NA 3GTGH 3CQZH 3PUXA 3STBD 1A8VA 1QZHA 4BBSG 3J7A5 4GN3B 2OCEA 4GNXA 2RF4A 5IWAL 3EBEA 4HIOA 1XJVA 4LF6Q 3CD6A 1LYLA 2KBNA 2Y0SG 3M3YH 3HOUG 4HIMA 1BBUA 3S1MH 4IFDG 1HNXL 2EQSA 3CCVA 1X3GA 4OWXB 3PUYA 2UUCQ 4KLKA 2IX1A 4A3IH 4BA2I 5LMUQ 2A19A 2ZJRA 1QVGA 1HH2P 2LSSA 5JJKA 3FKIH 2ID0A 5C44H 2ZM6Q 4A3GG 2JA7H 1XMQQ 3FP9A 3CMEA 3HOWH 1NY4A 1HZAA 4O2DA 4NPSA 5ELNA 3RLNA 5LMNL 1N34L 4OO1G 4JI1Q 2KHIA 4LFBQ 4JI2Q 1NTGA 1PH7A 2F4VL 3PO2G 2Q2UA 5IP9H 4A3MG 4LF9L 1U5KA 5IE8A 4JI6L 4IPCA 2K52A 2YV5A 3ULPA 3HOVH 4AH6A 1Y1VG 3UDGA 5M3MH 3UE1A 1Q8KA 1QUQB 1QUQA 3UDIA 4DV3L 1JB7A 3AEVA 4NB3A 4X64Q 4UP9A 5H1SE 2CWPA 3WWVA 4B3TL 4A75A 4DR3L 2NN6I 1EIFA 1VQLA 4JV5L 2VZAA 3PUVA 5LMNW 1PHJA 2R7FA 3JAMi 2GVAA 1EIYB 4A3BG 3T1HQ 1V43A 4DR1Q 3A74A 2AWOA 2UUAL 4QJFA 3VDYA 2AKWB 4DR5Q 2NVQH 3OYYA 1CKOA 3CAMA 3KDFA 1GKHA 2VL6A 3K0XA 2HIVA 1YZ6A 3M4PA 3J81c 1RL2A 3I2ZA 4A3EG 1N36Q 1L2FA 2A1AA 4L5RC 4JG2A 3PO2H 2BA0A 1GO3E 2NZHA 1SE8A 2YYZA 5C0XI 3HOZH 2IY5B 4DV7Q 2VQEL 4JI3L 4BBSH 4BBRG 3KF6B 4MZ9A 3K8AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA Q;  4P75 A;  3RN5 A;  4UP7 A;  1T9H A;  2K5V A;  1E3P A;  2N3S A;  2YTX A;  4JI8 L;  3ULJ A;  5IP7 G;  1XPO A;  1KQS A;  4P74 A;  1MJC A;  3S1Q H;  3UDF A;  4BXX H;  1LM0 A;  3HOU H;  1KD1 C;  1Q1E A;  1X3F A;  2K5H A;  3H0G H;  1CUK A;  1KRT A;  1PFS A;  4WJ3 M;  1HR0 W;  3M9B A;  1UE5 A;  1V9P A;  1HJP A;  3M7N A;  4DR6 L;  1P16 A;  4B3M Q;  1X3E A;  2KCT A;  4A3C G;  1J6Q A;  4JYA L;  3PIP A;  4POG A;  3PCO B;  3W5O A;  5IWA Q;  5M5Y H;  3GTL H;  4JI2 L;  2JA7 G;  5LMU L;  1OXT A;  3AYH B;  4OX9 Q;  1S72 A;  4QIW E;  2AHO B;  4YWM A;  2QEX A;  4A3L H;  3I55 A;  4DUY L;  2JEB I;  4C2M H;  4WJ4 A;  4JCV E;  4OWW B;  1IBL L;  2Z6K A;  5IP9 G;  4JI4 Q;  1ASZ A;  1VQK A;  2UXB Q;  2DUD A;  2UU9 L;  3RZD H;  4DV4 Q;  3KYH C;  1VCI A;  3CCR A;  1YHB A;  2I5H A;  4X65 Q;  1O7I A;  1VQP A;  1PH1 A;  4APV A;  3HOX H;  4YHH Q;  1S3O A;  3CCJ A;  4YY3 L;  1XMQ L;  4YWL A;  3CMA A;  1OXS C;  3A5Z B;  2JJQ A;  1IXR A;  3KLW A;  1KIX A;  3Q8D A;  3BZC A;  1YJ9 A;  1I94 Q;  3GTJ H;  2YU9 H;  2Z0S A;  3BZK A;  3F2D A;  4IFD J;  2H5X A;  3ULL A;  1IL2 A;  4JI4 L;  4DV0 Q;  1IBM Q;  1Q82 C;  3CCL A;  3CCM A;  1NMG A;  4DV2 L;  4AQY L;  2KEN A;  1TWA H;  2PQA A;  2CFM A;  4B3M L;  2JA8 G;  3PUZ A;  1Y1W H;  1FGU A;  3PF5 A;  1X54 A;  4DV5 Q;  2Z6K C;  3KJO A;  4LFC Q;  1SN8 A;  2MO1 A;  3G4S A;  4LF7 Q;  3HOY H;  4C3H H;  1VQ5 A;  3S14 H;  1Y14 B;  5C3E H;  1PV4 A;  2R7Z G;  2K14 A;  1HZB A;  2NVX H;  3S1R H;  2IHE A;  5AJ3 L;  1IBK Q;  1Q86 C;  4DUZ Q;  1BBW A;  2D0P A;  3CCS A;  1CKN B;  1CSP A;  1JE5 A;  1EFW A;  4C3I H;  4PZ8 A;  5IP7 H;  4KHP L;  4GKJ L;  5GQO A;  1SMX A;  1FJG L;  3GO5 A;  2EIF A;  4HIK A;  2ZTD A;  2CQO A;  4IOA A;  5E7N A;  2GVB A;  4AYB G;  3KOJ A;  1PH6 A;  4BY7 H;  2V1C C;  2L15 A;  2R93 G;  3GDE A;  1I5F A;  3GTM H;  1VQB A;  3T1Y Q;  3H0G G;  4P72 A;  5IYC H;  3RNU A;  2D0O A;  3S15 H;  1YJW A;  1G51 A;  2CKZ B;  4UP8 A;  4DV1 L;  2N49 A;  3D0F A;  2YTV A;  1VQI A;  2A8V A;  2Q2I A;  4K0K Q;  3AFP A;  1QVC A;  5IYB H;  4DR5 L;  4GKK Q;  1J5E Q;  5JJL A;  3F1Z A;  2NZO A;  2RHQ B;  3U58 A;  4LFC L;  3HOY G;  3CPF A;  3HOW G;  4GLX A;  4BY1 H;  4X62 Q;  1XMO Q;  1N33 Q;  2YTY A;  4HID A;  4KHZ A;  1ASY A;  1YVC A;  1IBL Q;  4LF6 L;  3M4Q A;  1Z47 A;  2VS1 A;  4YWK A;  2HHH L;  1JJG A;  4B3S Q;  2B29 A;  2MFI A;  3J7Z C;  1CKM A;  1BVS A;  2VUM H;  3HOV G;  2ZTC A;  4YCU A;  3IRB A;  2MO0 A;  4LFB L;  2JA9 A;  4DK6 C;  4GOP A;  4L5S A;  1GM5 A;  5FLX c;  3RLF A;  3SGI A;  4AIM A;  3BJU A;  4YY3 Q;  2E5L Q;  4L5T A;  4B3R L;  1L1O A;  1A63 A;  1VQ8 A;  4X62 L;  2VY3 A;  3J80 i;  1L0W A;  1WI5 A;  3OTO L;  1Y1W G;  4X66 Q;  1IZ6 A;  2Y0S E;  2R93 H;  2D62 A;  3DM3 A;  2UUA Q;  4NXN Q;  2ATW A;  1SRO A;  4GOP C;  1I94 L;  3I4M H;  1XNR L;  2VNU D;  4A3E H;  3JC6 6;  1VQH A;  4JBW A;  4DV2 Q;  4PZ6 A;  4LF4 Q;  1HZC A;  3AQQ A;  3NEN A;  1D8L A;  2K4K A;  1C9O A;  1WOC A;  4XTC S;  3I56 A;  4A3L G;  1OTC A;  3W1G A;  3CF5 A;  3ERS X;  1JT8 A;  5HY6 A;  1TWC H;  1OXU A;  2UUB Q;  1IYJ B;  2IT1 A;  4LWC A;  4IPH A;  3HOX G;  1X6O A;  5C4X H;  2K5N A;  4P71 A;  4HJ5 A;  2I5L X;  1PH8 A;  4KI0 A;  1EOV A;  5FLM H;  1EQQ A;  1AE3 A;  4JI7 L;  2UXC Q;  1M90 C;  4Y52 H;  1LUZ A;  1SRU A;  2OQ0 A;  3NEL A;  1JMC A;  1YIT A;  1IBK L;  4EQ5 A;  1XNQ Q;  1UWV A;  1VQN A;  2ASB A;  1PA6 A;  3OW2 A;  1B70 B;  1EUJ A;  4K0K L;  5ELO A;  4A3K G;  1WCM G;  3S24 A;  2E2H H;  4OON A;  2E5L L;  3S2D H;  3K7U C;  3J80 c;  4JBK A;  3RR5 A;  1M1K C;  4GLV B;  1K8G A;  3FHW A;  2ALY B;  3B6Y A;  2OWO A;  4R4I A;  3I4N H;  4DPG A;  4A3J G;  3AFQ A;  3CPW A;  2BH2 A;  5IYD H;  1S40 A;  2ES2 A;  1EWI A;  3A5U A;  3FKI G;  4DUY Q;  1VQO A;  1OXV A;  3RZO H;  2HHH Q;  4DR6 Q;  3GTQ H;  4FDB A;  1UE6 A;  4HJA A;  3KJP A;  2PI2 A;  1X55 A;  1Y1V H;  3NEM A;  1VQE A;  1K0R A;  4ALP A;  4GKK L;  2R92 G;  4YHH L;  2JA5 G;  1K73 C;  4PMW A;  1HNW L;  2WB1 E;  4UPA A;  2PNH A;  4BA1 I;  1PH9 A;  4LF8 L;  3PF4 A;  1N33 L;  1WJJ A;  3U4V A;  3PO3 H;  2K50 A;  3RN2 A;  4NXN L;  4DV4 L;  2JA5 H;  4DUZ L;  1EQR A;  2PI2 E;  4JC0 A;  1R9T H;  4A3K H;  3S17 H;  4DV5 L;  1GD7 A;  4B3S L;  2JEA I;  2IHF A;  2DGY A;  1PYB A;  2WFW A;  3S1N H;  3LGJ A;  1H95 A;  4DK3 C;  4R4Q A;  4DR2 L;  2OTL A;  1KC8 C;  1YEZ A;  5EAY A;  1Q1B A;  2R7Z H;  1I3Q H;  5DLQ E;  5IT9 c;  4H02 A;  1I6H H;  4JBM A;  5JEA G;  3GTK H;  3W1B A;  2UXD Q;  2NVY H;  3KF6 A;  3I7F A;  4BBR H;  4GS3 A;  1RIP A;  5GAH C;  1N9W A;  4IPG A;  4PG3 A;  3HOZ G;  3CC4 A;  1HR0 L;  4B3R Q;  5GAE C;  1MKH A;  4LF7 L;  2UUB L;  3TRE A;  2F3I A;  3A0J A;  1J5E L;  3L7Z C;  2HIX A;  3KF8 B;  1N32 L;  2C35 B;  5IYC G;  4DAM A;  2ZM6 L;  4DR3 Q;  1X9N A;  4POF A;  2ZJQ A;  1VQ6 A;  3GTO H;  4A3B H;  2UXC L;  3PV0 A;  3F2C A;  1XNR Q;  1KAW A;  5LMN Q;  4UY8 C;  3K7A H;  4IJL A;  3U4Z A;  1SFO H;  1YJN A;  5IYB G;  3ER0 A;  3T1H L;  2JA8 H;  4R1J A;  1JJ2 A;  5C4J H;  2WB1 G;  3KDF B;  5M5W H;  3GD7 A;  2VQF L;  5M5X H;  1FL0 A;  5BR8 L;  3U50 C;  1MJE A;  3T1Y L;  4X66 L;  3CP0 A;  3F8T A;  3F2B A;  4A3M H;  4JBJ A;  2UU9 Q;  3M85 A;  4DV7 L;  1PH3 A;  1KHI A;  3GTP H;  4R4T A;  3MEF A;  3STB C;  3TRZ A;  4IFD I;  2ZJP A;  4RG1 A;  1D7Q A;  1UE1 A;  3G48 A;  1AE2 A;  1G29 1;  1U0L A;  4LF5 Q;  2XGT A;  4LFA L;  3M4O H;  4DR7 L;  4LW1 A;  2R92 H;  3CC7 A;  3HKZ E;  3CW2 C;  3I4O A;  3OTO Q;  1Q12 A;  1HNX Q;  1CKN A;  2OQK A;  1VS0 A;  4R4O A;  4DKA C;  4BXX G;  3ZJY C;  1AH9 A;  2VUM G;  3UDX A;  2RCN A;  3CCU A;  1W2B A;  3E0E A;  1YIJ A;  1I50 H;  1XMO L;  2EXD A;  1Q46 A;  4DV0 L;  4A3F G;  1VQG A;  3NBH B;  1IBM L;  4MNO A;  4GKJ Q;  1YBY A;  2ZTE A;  4Y7N H;  1B7Y B;  2KHJ A;  5M3F H;  4A3C H;  3MXN B;  1GVP A;  4LF5 L;  4DR7 Q;  3E9H A;  2B63 G;  3J81 j;  4A3J H;  3K81 C;  2LXK A;  1VQF A;  4ME3 A;  5C44 G;  5M3F G;  2WP8 J;  4JI8 Q;  1L1O C;  4OXP A;  4NXM L;  1TWH H;  1WFQ A;  2B3G A;  2HT1 A;  1NBW A;  2JK8 A;  4TVA B;  1E22 A;  2VQF Q;  4GNX C;  2BA1 A;  2F4V Q;  1MIU A;  2NN6 G;  4IOC A;  1VQ4 A;  4GNX B;  1K9M C;  1TXY A;  1N32 Q;  5C3E G;  1VQ9 A;  4DR2 Q;  1QVF A;  3CCE A;  3PUW A;  4HJ9 A;  4LUV A;  4QY7 A;  4YCV A;  4X65 L;  1PH5 A;  1K8A C;  1NE3 A;  1NMF A;  4DAY B;  1W3S A;  4JI5 L;  4EX5 A;  4C3J H;  3DLL A;  1HNZ L;  4AYB E;  5K36 G;  4HJ7 A;  4JI7 Q;  4NXM Q;  4A3F H;  1B8A A;  1Q7Y C;  1HZ9 A;  3CCQ A;  4A76 A;  4A3D H;  4QQB X;  4RMF A;  2RHS B;  3EN2 A;  3PGZ A;  1V1Q A;  4A93 H;  4GOP B;  4GN4 B;  2N78 A;  1E24 A;  3HKZ G;  4JI1 L;  4LNQ A;  1XNQ L;  3PIO A;  3JAM c;  1A62 A;  4P73 A;  4XIG S;  1VQD A;  2JQO A;  4DR4 Q;  2UUC L;  3ICE A;  1JJC B;  4JI0 Q;  1K83 H;  4LFA Q;  1A0I A;  1X65 A;  3G71 A;  1TWG H;  4BY1 G;  1Z9F A;  1K3R A;  5FJ8 H;  4B3T Q;  2F52 A;  4JI3 Q;  1BKB A;  2E2J H;  1TWF H;  2OTJ A;  1QZG A;  4TQU S;  4KHP Q;  5M3M G;  4O0A A;  1YI2 A;  4LF4 L;  2R7D A;  1SLJ A;  2HQL A;  2WAQ E;  1PYS B;  4J15 A;  4JI6 Q;  1E1T A;  1HR0 Q;  5FLM G;  5C0X J;  4HJ8 A;  2JA6 H;  2KCM A;  3E9I A;  3PO3 G;  2FXQ A;  2LXJ A;  1SR3 A;  4A4I A;  5C0X G;  1KXL A;  4JI5 Q;  1L1O B;  1VQC A;  4OX9 L;  4LF8 Q;  3H3V H;  4BY7 G;  4DV6 L;  4X6A H;  3UE0 A;  2JA6 G;  5GRO A;  5IY0 A;  4R4C A;  4YCW A;  4PZ7 A;  3HKS A;  1UEB A;  4JV5 Q;  1VQM A;  2E8G A;  5JEA J;  4LF9 Q;  1PVO A;  2Q2H A;  4A3I G;  1C7Y A;  1G6P A;  3BU2 A;  1WYD A;  1E1O A;  2CWA A;  1VQA A;  2I5M X;  4LUO A;  4DV3 Q;  5JJI A;  3I4M G;  3J81 i;  2K75 A;  5FJ8 G;  1CSQ A;  1P8L A;  4JI0 L;  3HFZ B;  3S16 H;  3I4N G;  2IX0 A;  1YHQ A;  3TEH B;  4DV6 Q;  1VQ7 A;  1VQJ A;  5IYD G;  2Q2T A;  4MTN A;  3H3V I;  1HNW Q;  5C4X G;  2XTI A;  3S2H H;  1FVI A;  4DR1 L;  1X56 A;  1NJI C;  3K80 C;  2VW9 A;  1N34 Q;  2UXD L;  5BR8 Q;  4QL5 A;  4JOI C;  1UE7 A;  2VQE Q;  2MQH A;  3RLO A;  3G6E A;  2UXB L;  5AJ3 Q;  5HGQ A;  3L2P A;  2JE6 I;  1DGS A;  1LTL A;  1OXX K;  4DV1 Q;  4IO9 A;  4A93 G;  1XTD A;  3EIV A;  1PH2 A;  4A3D G;  3PSI A;  4IPD A;  1EYG A;  4OO1 I;  2QGQ A;  1KL9 A;  1FJG Q;  2PMZ E;  4X64 L;  4DR4 L;  1Q81 C;  5GAD C;  3TQY A;  2BH8 A;  1XPR A;  2B63 H;  2I0Q A;  4GN5 A;  3D31 A;  1YHA A;  4JOI A;  1C0A A;  4QGU A;  4AQY Q;  2R6G A;  5GAG C;  2PQA B;  1E7Z A;  2WAQ G;  4LUZ A;  2GN5 A;  1WCM H;  3L0O A;  5J3B A;  1KRS A;  4GLA C;  4OWT B;  2MNA A;  3H15 A;  3CXC A;  4L5Q A;  3TS0 A;  2CCZ A;  2E2I H;  1XPU A;  3CC2 A;  3TS2 A;  4A3G H;  1HNZ Q;  4IJH A;  4DNI A;  3KFU A;  2AMC B;  1N8R C;  1PH4 A;  2NVT H;  2QA4 A;  1N36 L;  2AWN A;  1YNX A;  2N8N A;  3GTG H;  3CQZ H;  3PUX A;  3STB D;  1A8V A;  1QZH A;  4BBS G;  3J7A 5;  4GN3 B;  2OCE A;  4GNX A;  2RF4 A;  5IWA L;  3EBE A;  4HIO A;  1XJV A;  4LF6 Q;  3CD6 A;  1LYL A;  2KBN A;  2Y0S G;  3M3Y H;  3HOU G;  4HIM A;  1BBU A;  3S1M H;  4IFD G;  1HNX L;  2EQS A;  3CCV A;  1X3G A;  4OWX B;  3PUY A;  2UUC Q;  4KLK A;  2IX1 A;  4A3I H;  4BA2 I;  5LMU Q;  2A19 A;  2ZJR A;  1QVG A;  1HH2 P;  2LSS A;  5JJK A;  3FKI H;  2ID0 A;  5C44 H;  2ZM6 Q;  4A3G G;  2JA7 H;  1XMQ Q;  3FP9 A;  3CME A;  3HOW H;  1NY4 A;  1HZA A;  4O2D A;  4NPS A;  5ELN A;  3RLN A;  5LMN L;  1N34 L;  4OO1 G;  4JI1 Q;  2KHI A;  4LFB Q;  4JI2 Q;  1NTG A;  1PH7 A;  2F4V L;  3PO2 G;  2Q2U A;  5IP9 H;  4A3M G;  4LF9 L;  1U5K A;  5IE8 A;  4JI6 L;  4IPC A;  2K52 A;  2YV5 A;  3ULP A;  3HOV H;  4AH6 A;  1Y1V G;  3UDG A;  5M3M H;  3UE1 A;  1Q8K A;  1QUQ B;  1QUQ A;  3UDI A;  4DV3 L;  1JB7 A;  3AEV A;  4NB3 A;  4X64 Q;  4UP9 A;  5H1S E;  2CWP A;  3WWV A;  4B3T L;  4A75 A;  4DR3 L;  2NN6 I;  1EIF A;  1VQL A;  4JV5 L;  2VZA A;  3PUV A;  5LMN W;  1PHJ A;  2R7F A;  3JAM i;  2GVA A;  1EIY B;  4A3B G;  3T1H Q;  1V43 A;  4DR1 Q;  3A74 A;  2AWO A;  2UUA L;  4QJF A;  3VDY A;  2AKW B;  4DR5 Q;  2NVQ H;  3OYY A;  1CKO A;  3CAM A;  3KDF A;  1GKH A;  2VL6 A;  3K0X A;  2HIV A;  1YZ6 A;  3M4P A;  3J81 c;  1RL2 A;  3I2Z A;  4A3E G;  1N36 Q;  1L2F A;  2A1A A;  4L5R C;  4JG2 A;  3PO2 H;  2BA0 A;  1GO3 E;  2NZH A;  1SE8 A;  2YYZ A;  5C0X I;  3HOZ H;  2IY5 B;  4DV7 Q;  2VQE L;  4JI3 L;  4BBS H;  4BBR G;  3KF6 B;  4MZ9 A;  3K8A A; 
#chains in the Genus database with same CATH topology
 4JYA Q;  4P75 A;  4G7O C;  2FMC A;  2YTX A;  2N3S A;  4RWS C;  1MJC A;  3EJI A;  3UDF A;  4BXX H;  1STB A;  1HFN A;  3HOU H;  3H0G H;  2K5H A;  3S16 B;  1NR2 A;  1PFS A;  4WJ3 M;  1HR0 W;  3E5S A;  3G6J B;  3M9B A;  3HOW B;  2Z4I A;  2XIW A;  4DR6 L;  2KCT A;  4JYA L;  1AN8 A;  3PIP A;  3TBI B;  5M3M B;  1ROD A;  2JA5 B;  3HOV B;  3AYH B;  4OX9 Q;  4A3L H;  1FNV A;  1T5X D;  4C2M H;  3GV6 A;  5COR A;  3QWN A;  4JI4 Q;  1VQK A;  2UXB Q;  1SEB D;  5JVG 3;  1VCI A;  1EIG A;  1YHB A;  3BYY B;  1DOM A;  1RD9 D;  3CCJ A;  1YNN D;  1SNC A;  3M7G A;  4HCS A;  1G8Z D;  4YWL A;  5HUR A;  1KIX A;  2Z0S A;  1IL2 A;  5IGE A;  4JI4 L;  3JAM L;  3BYT B;  3SXH A;  4TRD A;  4DV2 L;  1UAP A;  4AQY L;  2PQA A;  3T4A C;  3NTK A;  3PUZ A;  1Y1W H;  4FO2 A;  4DV5 Q;  4C3H H;  3S14 H;  1Y14 B;  4KKU A;  1HXY D;  2B2V C;  2IWH A;  4FF3 A;  2QW7 A;  1IBK Q;  1Q86 C;  2Z6B A;  2D0P A;  1CKN B;  1JE5 A;  3S9W A;  4EQP A;  2JA7 B;  3GO5 A;  1LO5 D;  3SDZ A;  4BY7 H;  1M4V A;  3GDE A;  4CDC C;  1TWF B;  4BBR B;  3J7Y W;  3T1Y Q;  2DNC A;  4P72 A;  5IYC H;  5CBE E;  2TMP A;  3RNU A;  1HCZ A;  1YJW A;  3VYT A;  2NTT A;  2OT2 A;  4UP8 A;  4K2L A;  1EEF D;  1VQI A;  2Q2I A;  3AFP A;  1ENA A;  3KK7 A;  3HOY G;  3HOW G;  4GLX A;  1XMO Q;  2R3Z A;  5EQ0 A;  2IPK D;  5EKL A;  1ASY A;  1CFM A;  1EFI D;  4DAV A;  3OWF A;  3J7Z C;  3E0J A;  4N8F A;  4R8N A;  1XWE A;  3HOV G;  2F0J A;  3IRB A;  3A7A B;  5KYI A;  1KNA A;  4M8A A;  2Z8L A;  5FLX c;  3RLF A;  2LY7 A;  3TP5 A;  4YY3 Q;  4C1N I;  2E5L Q;  3A8I E;  4ODG A;  1JR0 D;  1XMO L;  3J80 i;  1WI5 A;  2R93 H;  1Y1W G;  4X66 Q;  2Y0S E;  4ZKC B;  4MN3 A;  5E1F A;  3MA2 B;  3MWY W;  3CRL C;  4GOP C;  3I4M H;  3MXP A;  1XNR L;  1Z6H A;  1E0B A;  1VQH A;  4CJ2 C;  1EY0 A;  4OIK A;  3I56 A;  4A3L G;  2RDF A;  2L55 A;  5BN5 A;  1ILQ A;  1JT8 A;  2IT1 A;  4LWC A;  4A3K B;  1LTG D;  2HQE A;  1YNN C;  2K5N A;  5C4X H;  4HJ5 A;  1EOV A;  2B8G A;  2WV6 D;  3EFX D;  2HDM A;  1M90 C;  1LUZ A;  3NEL A;  4Y52 H;  5E4W C;  3ITP A;  2KED A;  1UWV A;  1PA6 A;  4OIJ A;  2E5L L;  2E2H H;  3K7U C;  4JBK A;  2F0V A;  2OWO A;  4NW2 A;  1B3Q A;  4A3J G;  2RDH A;  1SE3 A;  1EY8 A;  3A5U A;  2ES2 A;  4DR6 Q;  2VUM B;  3NXW A;  5EGT A;  1EU3 A;  3LWU A;  4HR7 B;  4HJA A;  3KJP A;  1K8M A;  3NEM A;  1JWS D;  3KF8 A;  2EYF A;  4CKB A;  1BCP F;  1VQE A;  1S4Z A;  4I7A A;  2WAC A;  1B9N A;  4GKK L;  2WB1 B;  3PF4 A;  4LF8 L;  5DNF A;  3C3L A;  1N33 L;  1GUN A;  4DUZ L;  1EQR A;  3S17 H;  4DV5 L;  2JEA I;  3J80 L;  4DK3 C;  4JK1 C;  4R4Q A;  1FR3 A;  2NB0 A;  3HEJ A;  1Q1B A;  1JOO A;  5DLQ E;  3GTK H;  5JOB A;  4QMG A;  1N9W A;  2F0M A;  3DEP A;  4PG3 A;  1WVL A;  2GA4 B;  2EYO A;  1AW7 A;  1RDP D;  4XQN A;  3TRE A;  1J5E L;  1DYQ A;  1XX8 A;  2WAQ B;  2WIN B;  3S2D B;  2BCO A;  2C35 B;  2ZM6 L;  4K6D A;  4POF A;  1WTW A;  2LKV A;  1HPC A;  5LMN Q;  3U4Z A;  1IW7 D;  1SBB B;  1BCP D;  5IYB G;  3T1H L;  2SOB A;  2QCP X;  3X3M A;  1JJ2 A;  2WB1 G;  4BBS B;  3GD7 A;  4QB4 A;  2VQF L;  5M5X H;  3MFY A;  5IT9 L;  3T1Y L;  4DA2 A;  3QR8 A;  5AFW A;  3MXG A;  3STB C;  3D3R A;  3TRZ A;  4C3H G;  5KYL A;  2J4X A;  2NWG A;  4RKL A;  4LW1 A;  3A55 A;  3I4O A;  3MEH A;  2A6E C;  2AQ2 B;  2OQK A;  2O4X A;  2VUM G;  2RCN A;  1JB3 A;  3E0E A;  2F0F A;  1CQV A;  4IFD H;  4DV0 L;  3GQB A;  1VQG A;  4GKJ Q;  1YBY A;  5C5L A;  3KLS A;  5FK9 C;  5M3F H;  1HQR D;  4ZCK A;  5C3X A;  2RSO A;  3J81 L;  4IUV A;  4OXP A;  1ESR A;  4N9P A;  2VQF Q;  2F4V Q;  1IHZ A;  2K05 A;  2QKI C;  2ZXO A;  4IOC A;  2N55 A;  4GNX B;  1TXY A;  5C3E G;  2K01 A;  4XDX A;  4DR2 Q;  3PUW A;  1ENF A;  2XNA C;  4A3I B;  1A3U A;  1DJR D;  4C3J H;  5K36 G;  1HZ9 A;  1WD0 A;  3OMC A;  4A3D H;  4RMF A;  3EN2 A;  3RMH A;  2F0K A;  4GOP B;  4GN4 B;  2N78 A;  1XNQ L;  4RGT A;  1LTS D;  4ZRZ A;  1ET6 A;  1DZ1 A;  5FKA C;  2CHB D;  2B2U A;  1A0I A;  1O7Z A;  1T5E A;  4IUQ A;  1K3R A;  5FJ8 H;  1OO9 B;  4JI3 Q;  4TQU S;  3EQL C;  4KHP Q;  5A35 A;  1MHW C;  4O0A A;  2E2J B;  5JVH 3;  1SLJ A;  2HQL A;  5FLX L;  1H9J A;  1F2M A;  3F2U A;  4ID6 A;  4HJ8 A;  5C0X J;  4A4I A;  1SR3 A;  2PW5 A;  1KXL A;  3NWS A;  1VQC A;  1CQF A;  1V8Q A;  2KJX A;  4CDF C;  1EY7 A;  5IY0 A;  3GTG B;  4YCW A;  3CKI B;  1UEB A;  3HKS A;  4ZUI A;  1GUO A;  1ICW A;  2CWA A;  1GUW A;  3I4M G;  2NUC A;  4MIU A;  3J81 i;  1CSQ A;  4K6L A;  1P8L A;  3OWE B;  2Z1C A;  3I4N G;  4IUR A;  1YHQ A;  2MHV A;  1VQ7 A;  2B8F A;  2EOT A;  2KA7 A;  5IYD G;  5E3F A;  2Q2T A;  1FD7 D;  5ISR A;  1X56 A;  2DJF C;  2ICE C;  1CI3 M;  2KEC A;  3K80 C;  2B2Y A;  3OHX C;  5BR8 Q;  4QL5 A;  4JOI C;  1SAP A;  2JE6 I;  4A3E B;  1LTL A;  4DV1 Q;  4K8J A;  1ZKO A;  4A93 G;  1XTD A;  1IYU A;  3EIV A;  1PH2 A;  4OO1 I;  4DR4 L;  1Q81 C;  5ELD A;  1I4R A;  2A68 C;  5LL6 X;  3D31 A;  2B63 H;  2F4I A;  4QGU A;  3SR1 A;  2PQA B;  4LUZ A;  3T51 B;  1WCM H;  3J7A F;  2JA8 H;  2CCZ A;  3CC2 A;  3TS2 A;  1CK1 A;  1RTN A;  5A2Q E;  1EOT A;  1TY2 A;  1PH4 A;  2NVT H;  2QA4 A;  2AWN A;  2O2L D;  3HKZ B;  1EWC A;  2N8N A;  4Y7N B;  4QUF A;  4DFA A;  3CQZ H;  3PUX A;  3SHL A;  3J7A 5;  4FXD A;  1QE6 A;  5IT9 E;  3S1M H;  4X3S A;  3HOU G;  2EDG A;  2XN9 C;  4KLK A;  2FFK B;  2L4N A;  1Y1V B;  5LHY 1;  1HH2 P;  2ZXR A;  3BG3 A;  1HHV A;  2ID0 A;  4O2D A;  3S1N B;  4HED A;  2SDF A;  2O5J C;  2KEE A;  5ELN A;  4JI1 Q;  2KHI A;  4LFB Q;  1PH7 A;  3RD4 A;  2F4V L;  2KCC A;  2Q2U A;  1U5K A;  5IE8 A;  4JI6 L;  2YV5 A;  3ULP A;  4AH6 A;  3UDG A;  1Q8K A;  3KBX A;  3QO2 A;  5H1S E;  4RH6 A;  3WWV A;  1O78 A;  3RZD B;  4B3T L;  1IYV A;  5EJW A;  1VQL A;  4JV5 L;  2VZA A;  2DN8 A;  2R7F A;  1W6J A;  3BVG A;  4L8J A;  2EXZ A;  3KLS X;  1EIY B;  1CHQ D;  2Z9H A;  3QOJ A;  5ELC A;  2NVQ H;  2XWB B;  1CKO A;  1BUV T;  1N36 Q;  2EE1 A;  3T13 A;  3QB3 A;  1LTR D;  2B39 A;  4DAP A;  4Q0F A;  2A1A A;  3HOZ H;  4JI3 L;  3KF6 B;  3TSS A;  2RDG A;  4UP7 A;  3VR2 A;  5IP7 G;  4JI8 L;  3IL8 A;  1PMR A;  5CMD A;  1XPO A;  1KQS A;  1ESF A;  4P74 A;  1LM0 A;  1KD1 C;  3FKI B;  1CUK A;  1U4P A;  1B2T A;  2OXP A;  3KUP A;  3Q22 A;  2B2Y C;  4TKO B;  1P16 A;  4B3M Q;  1X3E A;  3M4O B;  4RGN A;  4A3C G;  5DM6 3;  3PCO B;  2PW7 A;  5M5Y H;  1DOK A;  2B2T C;  5LMU L;  2JN4 A;  1PRT D;  1H9K A;  3DXJ C;  3HG9 A;  1EZ8 A;  2QF7 A;  4DV4 Q;  5DEH A;  3E6Z X;  1NR4 A;  2I5H A;  4X65 Q;  1O7I A;  1LT4 D;  3HOX H;  1S3O A;  2J7Z A;  1SSO A;  4X3T A;  1IXR A;  1F9P A;  1CM9 A;  3Q8D A;  2YU9 H;  1K0S A;  3GTJ H;  3Q23 A;  4PV1 C;  2H5X A;  3ULL A;  1R4Q B;  2RKS A;  1IBM Q;  2A69 D;  3H94 A;  3K57 A;  2KEN A;  4B3M L;  2L0C A;  2JA8 G;  1FGU A;  1DCZ A;  1X54 A;  2MGS A;  3KJO A;  2L11 A;  3G4S A;  1KLG D;  3HOY H;  1CA6 A;  1SYC A;  1RF2 D;  5ELE A;  1PV4 A;  1U4R A;  2K14 A;  4RGM A;  3PQI A;  1HZB A;  1E2V A;  3SK4 A;  3H0G B;  1BBW A;  2CH4 W;  3I73 A;  3NQT A;  3NUC A;  3T16 A;  1VF5 C;  1FJG L;  1JIC A;  2ZTD A;  4G7H C;  2CQO A;  2NVY B;  5E7N A;  4KJN A;  1PZI D;  2GVB A;  2V1C C;  2R7Z B;  1TWG B;  4DAY A;  1F9R A;  2F0L A;  3GTM H;  4XXE A;  1C4Q A;  5EBD A;  3HP3 A;  3S15 H;  4PMC A;  2A8V A;  4RFB A;  1XYI A;  1PXU A;  1G6Z A;  4GKK Q;  1PTO B;  3F1Z A;  2L9H A;  4XYQ A;  5ELB A;  1N33 Q;  2DJG C;  5BN3 A;  1IBL Q;  4LF6 L;  1JJG A;  2MJ8 A;  1MI2 A;  1TWA B;  4N8X 1;  4KN7 C;  1Y8P B;  2MO0 A;  4LFB L;  4GOP A;  3S2H B;  4XT1 B;  4KD4 A;  1GM5 A;  4L5S A;  1HUN A;  3SK6 A;  3SGI A;  1L0W A;  2EYM A;  1TQO A;  3S1R B;  3H09 A;  5C0X H;  2D62 A;  3OIQ A;  2R92 B;  1I94 L;  1SMY D;  3TP6 A;  4DNT B;  5IGD A;  4LF4 Q;  5C3W A;  3AQQ A;  3E3X A;  3NEN A;  1U4M A;  1D8L A;  3W1G A;  1TWC H;  1FYC A;  2AUJ D;  2X6L A;  4IPH A;  1EY9 A;  1X6O A;  3Q6S A;  4KD3 A;  1KAA A;  4P71 A;  2I5L X;  1PH8 A;  2F0W A;  4KI0 A;  1D2B A;  4HN7 A;  1CHP D;  1D5Z C;  4K5X A;  1SRU A;  1Y8N B;  2OQ0 A;  1JMC A;  1LT6 D;  1XNQ Q;  1IKM A;  1HFG A;  2LS0 1;  1EUJ A;  3OW2 A;  2A69 C;  4OON A;  3VYR A;  3J80 c;  2K5Q A;  3RR5 A;  1SJH D;  4GLV B;  1QNK A;  2ALY B;  3B6Y A;  2BH2 A;  1S40 A;  2HHH Q;  2EJG C;  1JWU D;  1U9R A;  4ALP A;  3S1M B;  4ZKB B;  1F9Q A;  1JQY D;  5M5W B;  2JA5 G;  1HNW L;  2WB1 E;  4UPA A;  1PH9 A;  5CBA E;  1TVX A;  1WJJ A;  3PO3 H;  2K50 A;  4DV4 L;  1SDF A;  4DXG A;  4JC0 A;  2CQA A;  4F87 A;  4B3S L;  3FDT A;  2IHF A;  2WFW A;  1PYB A;  2L12 A;  4E6I A;  3S1N H;  2PZW A;  1EYA A;  1D5X C;  1YEZ A;  5EAY A;  1BXT A;  1ILP A;  4NKL A;  1I3Q H;  3I72 A;  3M4Y A;  5IT9 c;  1I6H H;  2BOS A;  1STY A;  4GS3 A;  5GAH C;  1CTM A;  4IPG A;  5FO9 B;  2E74 C;  1HR0 L;  1MSH A;  5GAE C;  1BNZ A;  3V05 A;  1NSN S;  1X3P A;  2UUB L;  3A0J A;  3VA7 A;  4CGY B;  3TZU A;  4ZUJ A;  5HGT A;  4WRD A;  5IYC G;  2ZJQ A;  4C3J G;  4DR3 Q;  1I4G A;  2PZT A;  4A3B H;  2NTS A;  2EY6 A;  1H9R A;  3OOC A;  4MTK A;  2UXC L;  3PV0 A;  3F2C A;  1XNR Q;  4UY8 C;  4IJL A;  1SFO H;  4R1J A;  1SMY C;  3BVZ A;  3AU7 A;  5C4J H;  4U68 A;  5IGF A;  3BVM A;  5C4H A;  1FL0 A;  4X66 L;  4A3M H;  4OL7 A;  4DV7 L;  3GTP H;  1PH3 A;  4R4T A;  1D7Q A;  1UE1 A;  2L5T A;  2BDN A;  2NBF A;  1YNJ C;  1K8O A;  3CW2 C;  1SNP A;  1LAB A;  5I2X A;  3CCU A;  1I50 H;  4ZYS A;  3NBH B;  3MAQ A;  4B08 A;  4Q5V A;  4KHV A;  1B7Y B;  3VR5 A;  1GVP A;  4A3J H;  2LXK A;  5M3F G;  2HCC A;  1KDB A;  2B3G A;  3K5L A;  4TVA B;  4GNX C;  2V4D A;  1MIU A;  4BWG B;  1N32 Q;  1RCV D;  1QVF A;  3K7A B;  5K36 H;  4LUV A;  4QY7 A;  2JXM B;  2E2D C;  2DNE A;  1ZYR D;  4WOR A;  2M2L A;  3K0Y A;  4A3F H;  1Q7Y C;  1STA A;  4LJZ C;  4WJW A;  4H44 C;  4K14 A;  5IOC A;  1EEI D;  1BDO A;  5I9O A;  1VQD A;  3CRK C;  3OMG A;  2JQO A;  2OEO A;  2UUC L;  4DR4 Q;  3ICE A;  2RQX A;  1K83 H;  4J6H A;  1Q8I A;  4LFA Q;  4BY7 B;  3VR3 A;  1BKB A;  1TWF H;  2OTJ A;  4RHR A;  1VMC A;  3A7L A;  2R7D A;  4HTH A;  1QJO A;  1PYS B;  1E1T A;  3ND8 A;  5FLM G;  3PO3 G;  2KCM A;  2KUM A;  2FXQ A;  2LXJ A;  4K5W A;  1QG7 A;  2Q8R E;  4IUU A;  5D14 A;  1L1O B;  3UI2 A;  1TWH B;  3H3V H;  2PZU A;  4DV6 L;  5GRO A;  1UUP A;  4ULL A;  4KKS A;  1F77 A;  1LTA D;  1STE A;  5I6W A;  1HA6 A;  3BU2 A;  1WYD A;  1VQA A;  2I5M X;  2NYZ D;  3HFZ B;  4DV6 Q;  1VQJ A;  1TY0 A;  2XTI A;  3S2H H;  4DR1 L;  1AEX A;  1NJI C;  2K5W A;  2VQE Q;  3RLO A;  5HGQ A;  3QIA A;  4A3D G;  3PSI A;  2F0G A;  3DMU A;  2PPB C;  4LAA A;  1KL9 A;  2CH4 A;  1IL8 A;  4C2M B;  5C5M A;  1B1Z A;  1Y8O B;  4UDU C;  1A3V A;  2I0Q A;  1LLR D;  4O42 A;  5LL6 S;  2GN5 A;  3H15 A;  1KRS A;  4IJH A;  4DNI A;  3KFU A;  3K5O A;  1X32 A;  1N36 L;  1F2Z A;  2BDO A;  3GTO B;  4B9W A;  3W3A A;  1QZH A;  5D3D A;  4BBS G;  4CDD C;  3QJY A;  2OCE A;  4GNX A;  1LYL A;  5A2Q L;  1BBU A;  1XXG A;  3IFD A;  3PUY A;  4C3H B;  3A8J E;  4ILW A;  1XMQ Q;  3CME A;  1HZA A;  4NPS A;  1PTO F;  3RLN A;  1R9T B;  1N34 L;  1B9M A;  4DNR B;  1NTG A;  3GTL B;  5IP9 H;  4LF9 L;  4IPC A;  2WKD A;  1WTH A;  1Y1V G;  2EYP A;  2M9V A;  5D65 A;  5M3M H;  3VYS A;  3K59 A;  3NTH A;  4DV3 L;  1CZG A;  4NB3 A;  3PUV A;  5LMN W;  3JAM i;  4OEL B;  2GVA A;  4A3B G;  1GOZ A;  3T1H Q;  1V43 A;  3IAY A;  2UUA L;  4DR5 Q;  3BDC A;  3M4P A;  2VL6 A;  1C48 A;  1KAB A;  1TKW B;  1YZ6 A;  2HIV A;  3I2Z A;  1WTR A;  2F0H A;  2YYZ A;  1BO0 A;  4B9X A;  3R8B A;  5IOD A;  1G91 A;  3RN5 A;  1T9H A;  2K5V A;  1E3P A;  5EKI A;  1Q1E A;  1X3F A;  5TSS A;  1KRT A;  5FLX E;  5E4X A;  4EQN A;  3HOY B;  1SNQ A;  1RHP A;  1UE5 A;  1V9P A;  1HJP A;  2I46 A;  1J6Q A;  4POG A;  3W5O A;  5IIF A;  3D6W A;  2JA7 G;  3GTP B;  2HUG A;  4G4K A;  1OXT A;  2AHO B;  1CT1 D;  2QEX A;  2RVL A;  4DUY L;  4WJ4 A;  3K5M A;  1BOS A;  1UNS A;  1DON A;  3LX0 A;  2Z6K A;  3I8Z A;  1HQM C;  3WDN A;  1ASZ A;  2JA6 B;  2UU9 L;  4IUN A;  3RZD H;  1A2U A;  1BF4 A;  3KYH C;  4L63 B;  2QEJ C;  1VQP A;  4QUC A;  1I4X A;  4APV A;  1PH1 A;  2JA8 B;  3S15 B;  4YY3 L;  2P5Z X;  5CV8 A;  1OXS C;  3A5Z B;  1SYB A;  1I94 Q;  1YJ9 A;  2NVQ B;  3RZO B;  3BZK A;  3F2D A;  4ZK9 B;  3PMF A;  5CV7 A;  4F8M A;  3OW7 A;  2K04 A;  3CCL A;  3CCM A;  1NMG A;  2O5I C;  1KTK A;  3PIP 3;  2CFM A;  3PF5 A;  2Z6K C;  1SN8 A;  2MO1 A;  4A93 B;  5D3I B;  4K5V A;  2Z4H A;  4LF7 Q;  1TT2 A;  2B2W C;  1EYD A;  4C3J B;  5C3E H;  2R7Z G;  2R93 B;  2NVX H;  2A74 C;  2IHE A;  5AJ3 L;  4O1N A;  4KHP L;  4C3I H;  4PZ8 A;  5IP7 H;  4GKJ L;  3HGB A;  2BE5 D;  5CV4 A;  1I5F A;  1A15 A;  1VQB A;  1WTP A;  3H0G G;  2RBM A;  4OGQ C;  3I90 A;  2B2W A;  3D0F A;  3MXU A;  2YTV A;  1GHK A;  1QCB D;  5IGC A;  3H3V C;  1QVC A;  4G7Z C;  4NMZ A;  2F0T A;  4RAU C;  1Y69 U;  1GUG A;  1II3 A;  3J80 E;  5JJL A;  3U58 A;  2SEB D;  3NE5 B;  3CPF A;  1Q3L A;  4BY1 H;  2YTY A;  4IZ8 A;  4KHZ A;  2HHH L;  3NWT A;  4B3S Q;  4KK7 A;  2B29 A;  2MFI A;  1CKM A;  1BVS A;  2ZTC A;  4YCU A;  2JA9 A;  4DK6 C;  1UEA B;  1XTC D;  4L5T A;  3CU7 A;  1L1O A;  4B3R L;  3ONA B;  3J81 E;  3OTO L;  1IZ6 A;  1DOL A;  4BS9 A;  4JPB W;  1IW7 C;  5JEA H;  2UUA Q;  1CA5 A;  2VNU D;  3NTI A;  3JC6 6;  1SYF A;  4V19 0;  4DV2 Q;  4JBW A;  2NN6 H;  2PYK A;  1F2L A;  1C9O A;  1OTC A;  1G2S A;  1JE4 A;  3ERQ A;  2E2I B;  1IYJ B;  2OF1 A;  5J1Z A;  1TS3 A;  4OO1 H;  3HOX G;  5KND A;  2EJF C;  3R3O A;  1FGB D;  1SJE D;  5FLM H;  4OHJ A;  2KCN A;  1EQQ A;  1VF7 A;  2A6E D;  1MD2 D;  1I6H B;  1PYW D;  3D8G A;  2ASB A;  4K0K L;  1B70 B;  4XQJ A;  5ELO A;  1WCM G;  3S24 A;  4MHE A;  1EQT A;  1M1K C;  1K8G A;  3CQZ B;  4R4I A;  2PMZ B;  3I4N H;  4DPG A;  3CPW A;  5IYD H;  1PRT B;  1EWI A;  3FKI G;  4DUY Q;  1VQO A;  1OXV A;  3GTQ H;  4UHV A;  4FDB A;  1SND A;  1H9M A;  1PFN A;  2JP1 A;  1K0R A;  2EYL A;  1PZK D;  4XYO A;  4XT3 B;  1QIL A;  1K73 C;  5M5X B;  2PNH A;  4BA1 I;  1S5F D;  3BDL A;  2IJ0 A;  1LAC A;  1X3Q A;  3RN2 A;  1ET9 A;  2BE5 C;  4NXN L;  5I6Y A;  2JA5 H;  1LTB D;  1SYE A;  2PI2 E;  1SE4 A;  1GD7 A;  2AQ1 B;  3P1H A;  2DGY A;  4YIJ A;  2RCF A;  1VDZ A;  1KC8 C;  3R2I A;  4JBM A;  5JEA G;  4CJ0 B;  3TME A;  2NVY H;  3KF6 A;  4BBR H;  2EZV A;  2UXD Q;  1RIP A;  1SNM A;  3HOZ G;  1O80 A;  3CC4 A;  1H9S B;  2LMC B;  4RKB A;  2RSN A;  2FMM A;  4C3I G;  1WCM B;  3MTS A;  1MKH A;  3OIP A;  4F7X A;  4LF7 L;  1DD2 A;  1TII D;  2F3I A;  3L7Z C;  4DXF A;  2FJ2 A;  3KF8 B;  4A3J B;  3ND9 A;  3SE0 A;  1N32 L;  1X9N A;  1VQ6 A;  1KDA A;  2Q8T A;  5G3L F;  4FP5 D;  1C8C A;  5JJZ A;  4FVM A;  2SNM A;  3S1Q B;  1PDQ A;  2K6A A;  1GXD C;  1EU4 A;  5IGG A;  2FHT A;  3U50 C;  1MJE A;  4QF4 A;  3CP0 A;  3F2B A;  4JBJ A;  1MBY A;  3NHH A;  4A3F B;  1ZEQ X;  4IFD I;  3QG1 A;  3G48 A;  4LF5 Q;  4LFA L;  2PQE A;  3M4O H;  2R92 H;  4J8Q A;  4KTA A;  2F03 A;  3OTO Q;  4N9T A;  1VS0 A;  4BXX G;  3ZJY C;  1K83 B;  3UDX A;  1W2B A;  1YIJ A;  1Q46 A;  1TWC B;  1IBM L;  3D4D A;  3TN2 A;  3K6O A;  3MXN B;  4LF5 L;  2A68 D;  3E9H A;  2A6H D;  1SE2 A;  3J81 j;  2HDL A;  3K81 C;  3GV3 A;  4ME3 A;  4J1M A;  4JI8 Q;  2XSC A;  4NXM L;  1LTI D;  1NBW A;  2JK8 A;  1E22 A;  1FNW A;  3T56 B;  1FNU A;  2BA1 A;  2MP1 A;  3N52 A;  1K9M C;  3DHQ A;  1ONL A;  1VQ9 A;  4A3B B;  3CCE A;  4K2K A;  1PH5 A;  1K8A C;  5C44 B;  5EPK A;  1NMF A;  4DAY B;  1W3S A;  4EX5 A;  5IGB A;  1S5D D;  1HNZ L;  3I4M B;  4HJ7 A;  4JI7 Q;  4NXM Q;  1B8A A;  1MGS A;  4A76 A;  1SYD A;  1V1P B;  3PGZ A;  4A93 H;  2AUK A;  3HKZ G;  2EJM A;  4LNQ A;  1QB5 D;  3PIO A;  4P73 A;  3P20 A;  4XIG S;  1L0Y B;  1EY4 A;  4H7B A;  3R93 A;  1JJC B;  4IN3 A;  3PO3 B;  1X65 A;  3H6M A;  3G71 A;  1O7L A;  2VB2 X;  3N6R A;  2JSO A;  1KDC A;  4FXK C;  1LTT D;  1QZG A;  1WTX A;  1I50 B;  5M3M G;  5CV9 A;  1YI2 A;  1PTO D;  1RKN A;  2WAQ E;  4J15 A;  1HR0 Q;  1JCK B;  3Q24 A;  4PNY A;  2NVT B;  1G2T A;  4BY7 G;  5KNB A;  3NBH A;  1BCP C;  2JA6 G;  5CR3 A;  3MXN A;  4PZ7 A;  1BCP B;  1VQM A;  4LF9 Q;  2AQ3 B;  4I7Z C;  1JOQ A;  2Q2H A;  3D4R A;  4A3I G;  1C7Y A;  1E1O A;  4LUO A;  4DV3 Q;  1S5B D;  3G7L A;  3K58 A;  3HOU B;  2K75 A;  5FJ8 G;  4KJO A;  3S16 H;  2RA4 A;  2IX0 A;  5C4X G;  4MTN A;  1SFO B;  3NP8 A;  1N34 Q;  2UXD L;  2A73 B;  4HAE A;  2VXW A;  2IW3 A;  1WD1 A;  1OXX K;  4IO9 A;  3H91 A;  1QNU A;  4OEM B;  4IPD A;  2CVR A;  1L0X B;  1PFB A;  1S5E D;  2F0N A;  2QGQ A;  1FJG Q;  1TS5 A;  2PCF B;  2VB3 X;  3TQY A;  2BH8 A;  2B2T A;  1HTP A;  4CHT B;  2F0Q A;  5DM7 3;  2R6G A;  1B3A A;  1E7Z A;  2E2J H;  3RUZ A;  4GLA C;  3CXC A;  5CC4 A;  2E2I H;  1XPU A;  3TS0 A;  4GZY C;  1I6V C;  1Q90 A;  1N8R C;  2QIL A;  3AB9 A;  1AFP A;  1EYC A;  3VR4 A;  1D6E C;  3KLR A;  3GTG H;  4K8I A;  1A8V A;  3ERO A;  3EBE A;  4HIO A;  5JPM C;  1XJV A;  1B53 A;  2M00 A;  4LF6 Q;  3CD6 A;  1YNJ D;  2Y0S G;  3M3Y H;  4HIM A;  1TS4 A;  4IFD G;  1HNX L;  2EQS A;  3CCV A;  3TZD A;  1U4L A;  1X3G A;  3I4N B;  3DM1 A;  1EZ6 A;  2UUC Q;  4A3I H;  4BA2 I;  5LMU Q;  1QVG A;  3X3N A;  2F3V A;  3T53 B;  3I4L A;  4IQZ A;  2LSS A;  2JYO A;  2ZM6 Q;  3WOF A;  2JA7 H;  3HOW H;  1NY4 A;  3GP7 A;  2G9D A;  1ML0 D;  5LMN L;  3PO2 G;  1EWH A;  4A3M G;  2B2U C;  2K52 A;  1I4H A;  3HOV H;  4EVO A;  2B63 B;  1QUQ B;  1PTO C;  2PNR C;  3VYU A;  4A3G B;  4X64 Q;  1GHJ A;  5M3F B;  1B44 D;  3A56 A;  5C6A A;  4A75 A;  4DR3 L;  1EIF A;  4RCO A;  3A54 A;  1RTO A;  1EIH A;  4DR1 Q;  3A74 A;  4UAI A;  3VDY A;  2AKW B;  3HOX B;  3ZYY X;  3KDF A;  3J81 c;  1GKH A;  3WOE A;  1CZW A;  1RL2 A;  2KVM A;  4A3E G;  1J8I A;  4IAL A;  3GTJ B;  4LMQ D;  3W2D A;  1K3B C;  3BDO A;  4HMI A;  2F1M A;  3PO2 H;  2BA0 A;  1GO3 E;  2KQ3 A;  1SE8 A;  2NZH A;  2XVS A;  5T1G A;  5C0X I;  2IY5 B;  4DV7 Q;  2VQE L;  2IL8 A;  3SEB A;  1I4Q A;  3K8A A;  1S5C D;  1EY6 A;  1M8A A;  2EY2 A;  4RGO S;  3ULJ A;  2HCI A;  2F0P A;  3S1Q H;  5T1I A;  2MPM A;  4EGV A;  1PLF A;  4A3M B;  3M7N A;  4KN4 C;  5KIX A;  2LFN A;  4EQO A;  3MZ5 A;  2R61 A;  5IWA Q;  3GTL H;  4JI2 L;  3EVQ A;  4DF7 A;  1S72 A;  4QIW E;  4YWM A;  5I2Y A;  3I55 A;  2JEB I;  4U67 3;  4JCV E;  4OWW B;  1IBL L;  5IP9 G;  2DUD A;  3HZX A;  3CCR A;  4RA8 A;  1I3Q B;  1PFM A;  1BBX C;  4YHH Q;  1XMQ L;  4HSP A;  2XRQ D;  1K28 A;  3CMA A;  4XQQ A;  2JJQ A;  3KLW A;  3EA6 A;  3BZC A;  4V0B A;  5CYU A;  1AZQ A;  4IFD J;  1LT3 D;  4CBV A;  2QDL A;  3URY A;  1D1K A;  2D9U A;  1BR9 A;  4DV0 Q;  3KBG A;  1Q82 C;  1E2W A;  1TWA H;  3J7A V;  4KY5 A;  5JPN C;  5K5P A;  3DWA A;  3U9O A;  4LFC Q;  4HMJ A;  1VQ5 A;  3AMU A;  4A3D B;  1KLU D;  3S1R H;  1TS2 A;  4DUZ Q;  1GUT A;  3CCS A;  1WTO A;  1EFW A;  1CSP A;  5GQO A;  1SMX A;  2K32 A;  2EIF A;  4JW0 A;  4ZQ3 A;  4HIK A;  3VA5 A;  2ZT9 C;  3KOJ A;  4H13 C;  4AYB G;  1PH6 A;  2F3W A;  2L15 A;  2R93 G;  3OPO A;  1EQV A;  2DY7 A;  2D0O A;  2F0U A;  1G51 A;  2MUY A;  1LT5 D;  4CJ1 B;  2CKZ B;  1WTV A;  4QCL A;  4DV1 L;  2N49 A;  2I07 B;  3FRP B;  4K0K Q;  3FVQ A;  4DR5 L;  5IYB H;  1J5E Q;  1V1O A;  2NZO A;  2RHQ B;  3MC0 B;  4LFC L;  2YU9 B;  4X62 Q;  3MHB A;  4HID A;  1YVC A;  3M4Q A;  1Z47 A;  3C1F A;  2VS1 A;  4IUT A;  4YWK A;  1WTQ A;  1PRT F;  3NK9 A;  4KY7 A;  1QOH A;  2PO4 A;  2VUM H;  4L6T B;  5L37 A;  4F88 A;  2EPB A;  4AIM A;  2K5D A;  3BJU A;  5FO7 B;  1A63 A;  1VQ8 A;  4X62 L;  2VY3 A;  4C1N K;  2FIN B;  3MFG A;  5CGK A;  3DM3 A;  1NAP A;  3TP7 A;  3DWP A;  5C3E B;  4NXN Q;  2ATW A;  1SRO A;  4A3E H;  3TDQ A;  1D5M C;  3A8K E;  3I3C A;  4PZ6 A;  1HZC A;  1J9O A;  3NPP A;  2K4K A;  1WOC A;  4I65 A;  3NBI A;  2H1E A;  4XTC S;  1F2Y A;  3V2T A;  1STG A;  1BQQ T;  3CF5 A;  3ERS X;  4FXG C;  5HY6 A;  2UUB Q;  1OXU A;  1F9S A;  4FYD A;  1GJX A;  1O7Y A;  4LK1 C;  5DAU A;  4PQX A;  1DM0 B;  4JI7 L;  3NSW A;  1AE3 A;  5M9O A;  2UXC Q;  2WKC A;  2F0I A;  3O13 A;  1YIT A;  1IBK L;  5C4Z A;  4EQ5 A;  1VQN A;  3Q0A A;  4A3K G;  4X3K A;  3S2D H;  3P7J A;  4FF4 A;  3SK5 A;  4CKE A;  4DK0 A;  3IKJ A;  2E76 C;  1I4P A;  3FHW A;  1KNE A;  2WII B;  1NUC A;  3AFQ A;  5KEE A;  1GUS A;  1IKL A;  4JVZ A;  4AYB B;  3RZO H;  1JOK A;  1ICF B;  1MSG A;  1UE6 A;  2PI2 A;  1X55 A;  1Y1V H;  4H0L C;  1JOR A;  3M3Y B;  2EY5 A;  3MVV A;  2R92 G;  3NQI A;  4DN4 M;  4YHH L;  4PMW A;  1ZYR C;  3U4V A;  4FF1 A;  1R9T H;  4A3K H;  2NVX B;  4HCE A;  1HA5 A;  3LGJ A;  1H95 A;  1AZP A;  1STH A;  5KRU A;  4C3I B;  4DR2 L;  2OTL A;  5I4D A;  1Z7T A;  5F2D A;  2R7Z H;  5BN4 A;  1JC7 A;  4H02 A;  1E2Z A;  3HS0 C;  3W1B A;  3GTM B;  3I7F A;  1H9S A;  2A5H A;  4B3R Q;  4DK1 A;  1TR5 A;  2J0T D;  2N88 A;  1A2T A;  4CKC A;  2KHS A;  2D2C C;  1LV9 A;  2HIX A;  2CW0 C;  2EY1 A;  3SVM A;  4DAM A;  2K7V A;  3HOZ B;  3GTO H;  4BY1 B;  1KAW A;  1A6X A;  3K7A H;  1YJN A;  4PMB A;  3ER0 A;  3I70 A;  3PIO 3;  1TU2 B;  3KDF B;  5M5W H;  3I91 A;  5BR8 L;  5KGU A;  3F8T A;  4ME5 A;  4Z9C B;  2UU9 Q;  3M85 A;  1KHI A;  1NNX A;  2C5C A;  3MEF A;  2ZJP A;  2NZ1 D;  2F0D A;  3FEW X;  4RG1 A;  3U9S A;  1AE2 A;  1G29 1;  1U0L A;  3TP8 A;  2XGT A;  4DR7 L;  2X69 A;  3CC7 A;  3HKZ E;  5NUC A;  4FNF A;  1Q12 A;  3LWE A;  1HNX Q;  1CKN A;  2ZXP A;  4DKA C;  4R4O A;  1AH9 A;  1STN A;  5I9P A;  1PTO H;  2EXD A;  4A3F G;  4MNO A;  2ZTE A;  4Y7N H;  2KHJ A;  4A3C H;  4DR7 Q;  3FPP A;  2B63 G;  4ZAI A;  1VQF A;  3FMC A;  2IX3 A;  4CDE C;  5C44 G;  2WP8 J;  1L1O C;  2F0E A;  2TSS A;  1TWH H;  1WFQ A;  2HT1 A;  1Y1W B;  2NN6 G;  2H4O A;  1VQ4 A;  2K1B A;  3JAM E;  3P75 A;  3S14 B;  3R2T A;  4HJ9 A;  4YCV A;  3VR6 A;  4X65 L;  3DWQ A;  1NE3 A;  4JI5 L;  4TSS A;  3DLL A;  4AYB E;  3K5N A;  3L3O C;  3CCQ A;  4QQB X;  2X6G A;  2RHS B;  1V1Q A;  1E24 A;  4JI1 L;  3JAM c;  3V96 A;  1A62 A;  5COY A;  4KKT A;  2C9O A;  2QDB A;  4KV6 A;  4JI0 Q;  1QWY A;  1TWG H;  4BY1 G;  1Z9F A;  4B3T Q;  3BS1 A;  1HTL D;  2F52 A;  3QOL A;  5EPJ A;  2D5D A;  2ENB A;  4WFN 3;  5FO8 B;  3OSO A;  1B4O A;  5ELF A;  4LF4 L;  2CW0 D;  2EYH A;  4JI6 Q;  2Q8I B;  5JAV A;  4IOA A;  2JA6 H;  3E9I A;  4KMU C;  5C0X G;  3IFT A;  4JI5 Q;  4OX9 L;  4LF8 Q;  4X6A H;  3UE0 A;  2G9H D;  2HD3 A;  3FPU B;  3HRZ C;  2G5D A;  3CHB D;  4R4C A;  4RCN A;  4JV5 Q;  1PRT C;  2E8G A;  5JEA J;  1PVO A;  1HRJ A;  1G6P A;  3SK8 A;  1RJT A;  2K03 A;  3C1E A;  5JJI A;  5KNC A;  4JI0 L;  1DXM A;  3TEH B;  4C56 C;  3H3V I;  1HNW Q;  5C4J B;  1FVI A;  5CV6 A;  2L1B A;  2VW9 A;  1UE7 A;  2MQH A;  3G6E A;  3C46 A;  2UXB L;  4M1U B;  5J22 A;  5AJ3 Q;  3L2P A;  1DGS A;  4R8I A;  2F0S A;  1EYG A;  2XWJ B;  5C4X B;  2PMZ E;  4X64 L;  5GAD C;  1EL0 A;  2K28 A;  3DUZ A;  1XPR A;  2EYJ A;  4GN5 A;  1YHA A;  4JOI A;  3BZD B;  1C0A A;  4AQY Q;  5GAG C;  2WAQ G;  5EBC A;  3L0O A;  5J3B A;  4DGZ A;  5J39 A;  4OWT B;  2DY8 A;  2MNA A;  4L5Q A;  4A3G H;  1PZJ D;  2E2H B;  1HNZ Q;  2KOL A;  2Y0S B;  2AMC B;  5G3L D;  2ICI A;  4ZLT F;  1YNX A;  4G57 A;  4P2C B;  3STB D;  4GN3 B;  4ABN A;  2RF4 A;  1NCV A;  5IWA L;  3L9A X;  5EKK A;  2XRS D;  2KBN A;  4NDX A;  4S3S A;  1SXT A;  2SNS A;  4RHS A;  1B50 A;  2E75 C;  3PO2 B;  1VMP A;  4OWX B;  2IX1 A;  3GTQ B;  2A19 A;  2ZJR A;  2B2V A;  1AP0 A;  5JJK A;  3FKI H;  3D4W A;  1V1P A;  5C44 H;  1EY5 A;  4FF2 A;  4A3G G;  4NP5 A;  3FP9 A;  1ZXT A;  4HSV A;  5FOB B;  1W6K A;  3S17 B;  2K33 A;  5EPL A;  2A6H C;  4X3U A;  4OO1 G;  4IUP A;  4JI2 Q;  5M5Y B;  3GTK B;  3UE1 A;  5CV5 A;  1QUQ A;  3UDI A;  3C2P A;  1JB7 A;  3AEV A;  1R4P B;  4UP9 A;  2CWP A;  1A3T A;  2NN6 I;  1JWM D;  4QIW B;  1PHJ A;  4R9W A;  1ENC A;  3D6C A;  1SNO A;  2AWO A;  4QJF A;  4DU9 A;  1D1I A;  3OYY A;  1HUM A;  3CAM A;  3K0X A;  1SYG A;  4KY6 A;  3DEO A;  1L2F A;  3LNN A;  4L5R C;  4JG2 A;  2F0O A;  2EVB A;  4BBS H;  4BBR G;  4MZ9 A; 
#chains in the Genus database with same CATH homology
 4JYA Q;  4P75 A;  3RN5 A;  4UP7 A;  1T9H A;  2K5V A;  1E3P A;  2N3S A;  2YTX A;  4JI8 L;  3ULJ A;  5IP7 G;  1XPO A;  1KQS A;  4P74 A;  1MJC A;  3S1Q H;  3UDF A;  4BXX H;  1LM0 A;  3HOU H;  1KD1 C;  1Q1E A;  1X3F A;  2K5H A;  3H0G H;  1CUK A;  1KRT A;  1PFS A;  4WJ3 M;  1HR0 W;  3M9B A;  1UE5 A;  1V9P A;  1HJP A;  3M7N A;  4DR6 L;  1P16 A;  4B3M Q;  1X3E A;  2KCT A;  4A3C G;  1J6Q A;  4JYA L;  3PIP A;  4POG A;  3PCO B;  3W5O A;  5IWA Q;  5M5Y H;  3GTL H;  4JI2 L;  2JA7 G;  5LMU L;  1OXT A;  3AYH B;  4OX9 Q;  1S72 A;  4QIW E;  2AHO B;  4YWM A;  2QEX A;  4A3L H;  3I55 A;  4DUY L;  2JEB I;  4C2M H;  4WJ4 A;  4JCV E;  4OWW B;  1IBL L;  2Z6K A;  5IP9 G;  4JI4 Q;  1ASZ A;  1VQK A;  2UXB Q;  2DUD A;  2UU9 L;  3RZD H;  4DV4 Q;  3KYH C;  1VCI A;  3CCR A;  1YHB A;  2I5H A;  4X65 Q;  1O7I A;  1VQP A;  1PH1 A;  4APV A;  3HOX H;  4YHH Q;  1S3O A;  3CCJ A;  4YY3 L;  1XMQ L;  4YWL A;  3CMA A;  1OXS C;  3A5Z B;  2JJQ A;  1IXR A;  3KLW A;  1KIX A;  3Q8D A;  3BZC A;  1YJ9 A;  1I94 Q;  3GTJ H;  2YU9 H;  2Z0S A;  3BZK A;  3F2D A;  4IFD J;  2H5X A;  3ULL A;  1IL2 A;  4JI4 L;  4DV0 Q;  1IBM Q;  1Q82 C;  3CCL A;  3CCM A;  1NMG A;  4DV2 L;  4AQY L;  2KEN A;  1TWA H;  2PQA A;  2CFM A;  4B3M L;  2JA8 G;  3PUZ A;  1Y1W H;  1FGU A;  3PF5 A;  1X54 A;  4DV5 Q;  2Z6K C;  3KJO A;  4LFC Q;  1SN8 A;  2MO1 A;  3G4S A;  4LF7 Q;  3HOY H;  4C3H H;  1VQ5 A;  3S14 H;  1Y14 B;  5C3E H;  1PV4 A;  2R7Z G;  2K14 A;  1HZB A;  2NVX H;  3S1R H;  2IHE A;  5AJ3 L;  1IBK Q;  1Q86 C;  4DUZ Q;  1BBW A;  2D0P A;  3CCS A;  1CKN B;  1CSP A;  1JE5 A;  1EFW A;  4C3I H;  4PZ8 A;  5IP7 H;  4KHP L;  4GKJ L;  5GQO A;  1SMX A;  1FJG L;  3GO5 A;  2EIF A;  4HIK A;  2ZTD A;  2CQO A;  4IOA A;  5E7N A;  2GVB A;  4AYB G;  3KOJ A;  1PH6 A;  4BY7 H;  2V1C C;  2L15 A;  2R93 G;  3GDE A;  1I5F A;  3GTM H;  1VQB A;  3T1Y Q;  3H0G G;  4P72 A;  5IYC H;  3RNU A;  2D0O A;  3S15 H;  1YJW A;  1G51 A;  2CKZ B;  4UP8 A;  4DV1 L;  2N49 A;  3D0F A;  2YTV A;  1VQI A;  2A8V A;  2Q2I A;  4K0K Q;  3AFP A;  1QVC A;  5IYB H;  4DR5 L;  4GKK Q;  1J5E Q;  5JJL A;  3F1Z A;  2NZO A;  2RHQ B;  3U58 A;  4LFC L;  3HOY G;  3CPF A;  3HOW G;  4GLX A;  4BY1 H;  4X62 Q;  1XMO Q;  1N33 Q;  2YTY A;  4HID A;  4KHZ A;  1ASY A;  1YVC A;  1IBL Q;  4LF6 L;  3M4Q A;  1Z47 A;  2VS1 A;  4YWK A;  2HHH L;  1JJG A;  4B3S Q;  2B29 A;  2MFI A;  3J7Z C;  1CKM A;  1BVS A;  2VUM H;  3HOV G;  2ZTC A;  4YCU A;  3IRB A;  2MO0 A;  4LFB L;  2JA9 A;  4DK6 C;  4GOP A;  4L5S A;  1GM5 A;  5FLX c;  3RLF A;  3SGI A;  4AIM A;  3BJU A;  4YY3 Q;  2E5L Q;  4L5T A;  4B3R L;  1L1O A;  1A63 A;  1VQ8 A;  4X62 L;  2VY3 A;  3J80 i;  1L0W A;  1WI5 A;  3OTO L;  1Y1W G;  4X66 Q;  1IZ6 A;  2Y0S E;  2R93 H;  2D62 A;  3DM3 A;  2UUA Q;  4NXN Q;  2ATW A;  1SRO A;  4GOP C;  1I94 L;  3I4M H;  1XNR L;  2VNU D;  4A3E H;  3JC6 6;  1VQH A;  4JBW A;  4DV2 Q;  4PZ6 A;  4LF4 Q;  1HZC A;  3AQQ A;  3NEN A;  1D8L A;  2K4K A;  1C9O A;  1WOC A;  4XTC S;  3I56 A;  4A3L G;  1OTC A;  3W1G A;  3CF5 A;  3ERS X;  1JT8 A;  5HY6 A;  1TWC H;  1OXU A;  2UUB Q;  1IYJ B;  2IT1 A;  4LWC A;  4IPH A;  3HOX G;  1X6O A;  5C4X H;  2K5N A;  4P71 A;  4HJ5 A;  2I5L X;  1PH8 A;  4KI0 A;  1EOV A;  5FLM H;  1EQQ A;  1AE3 A;  4JI7 L;  2UXC Q;  1M90 C;  4Y52 H;  1LUZ A;  1SRU A;  2OQ0 A;  3NEL A;  1JMC A;  1YIT A;  1IBK L;  4EQ5 A;  1XNQ Q;  1UWV A;  1VQN A;  2ASB A;  1PA6 A;  3OW2 A;  1B70 B;  1EUJ A;  4K0K L;  5ELO A;  4A3K G;  1WCM G;  3S24 A;  2E2H H;  4OON A;  2E5L L;  3S2D H;  3K7U C;  3J80 c;  4JBK A;  3RR5 A;  1M1K C;  4GLV B;  1K8G A;  3FHW A;  2ALY B;  3B6Y A;  2OWO A;  4R4I A;  3I4N H;  4DPG A;  4A3J G;  3AFQ A;  3CPW A;  2BH2 A;  5IYD H;  1S40 A;  2ES2 A;  1EWI A;  3A5U A;  3FKI G;  4DUY Q;  1VQO A;  1OXV A;  3RZO H;  2HHH Q;  4DR6 Q;  3GTQ H;  4FDB A;  1UE6 A;  4HJA A;  3KJP A;  2PI2 A;  1X55 A;  1Y1V H;  3NEM A;  1VQE A;  1K0R A;  4ALP A;  4GKK L;  2R92 G;  4YHH L;  2JA5 G;  1K73 C;  4PMW A;  1HNW L;  2WB1 E;  4UPA A;  2PNH A;  4BA1 I;  1PH9 A;  4LF8 L;  3PF4 A;  1N33 L;  1WJJ A;  3U4V A;  3PO3 H;  2K50 A;  3RN2 A;  4NXN L;  4DV4 L;  2JA5 H;  4DUZ L;  1EQR A;  2PI2 E;  4JC0 A;  1R9T H;  4A3K H;  3S17 H;  4DV5 L;  1GD7 A;  4B3S L;  2JEA I;  2IHF A;  2DGY A;  1PYB A;  2WFW A;  3S1N H;  3LGJ A;  1H95 A;  4DK3 C;  4R4Q A;  4DR2 L;  2OTL A;  1KC8 C;  1YEZ A;  5EAY A;  1Q1B A;  2R7Z H;  1I3Q H;  5DLQ E;  5IT9 c;  4H02 A;  1I6H H;  4JBM A;  5JEA G;  3GTK H;  3W1B A;  2UXD Q;  2NVY H;  3KF6 A;  3I7F A;  4BBR H;  4GS3 A;  1RIP A;  5GAH C;  1N9W A;  4IPG A;  4PG3 A;  3HOZ G;  3CC4 A;  1HR0 L;  4B3R Q;  5GAE C;  1MKH A;  4LF7 L;  2UUB L;  3TRE A;  2F3I A;  3A0J A;  1J5E L;  3L7Z C;  2HIX A;  3KF8 B;  1N32 L;  2C35 B;  5IYC G;  4DAM A;  2ZM6 L;  4DR3 Q;  1X9N A;  4POF A;  2ZJQ A;  1VQ6 A;  3GTO H;  4A3B H;  2UXC L;  3PV0 A;  3F2C A;  1XNR Q;  1KAW A;  5LMN Q;  4UY8 C;  3K7A H;  4IJL A;  3U4Z A;  1SFO H;  1YJN A;  5IYB G;  3ER0 A;  3T1H L;  2JA8 H;  4R1J A;  1JJ2 A;  5C4J H;  2WB1 G;  3KDF B;  5M5W H;  3GD7 A;  2VQF L;  5M5X H;  1FL0 A;  5BR8 L;  3U50 C;  1MJE A;  3T1Y L;  4X66 L;  3CP0 A;  3F8T A;  3F2B A;  4A3M H;  4JBJ A;  2UU9 Q;  3M85 A;  4DV7 L;  1PH3 A;  1KHI A;  3GTP H;  4R4T A;  3MEF A;  3STB C;  3TRZ A;  4IFD I;  2ZJP A;  4RG1 A;  1D7Q A;  1UE1 A;  3G48 A;  1AE2 A;  1G29 1;  1U0L A;  4LF5 Q;  2XGT A;  4LFA L;  3M4O H;  4DR7 L;  4LW1 A;  2R92 H;  3CC7 A;  3HKZ E;  3CW2 C;  3I4O A;  3OTO Q;  1Q12 A;  1HNX Q;  1CKN A;  2OQK A;  1VS0 A;  4R4O A;  4DKA C;  4BXX G;  3ZJY C;  1AH9 A;  2VUM G;  3UDX A;  2RCN A;  3CCU A;  1W2B A;  3E0E A;  1YIJ A;  1I50 H;  1XMO L;  2EXD A;  1Q46 A;  4DV0 L;  4A3F G;  1VQG A;  3NBH B;  1IBM L;  4MNO A;  4GKJ Q;  1YBY A;  2ZTE A;  4Y7N H;  1B7Y B;  2KHJ A;  5M3F H;  4A3C H;  3MXN B;  1GVP A;  4LF5 L;  4DR7 Q;  3E9H A;  2B63 G;  3J81 j;  4A3J H;  3K81 C;  2LXK A;  1VQF A;  4ME3 A;  5C44 G;  5M3F G;  2WP8 J;  4JI8 Q;  1L1O C;  4OXP A;  4NXM L;  1TWH H;  1WFQ A;  2B3G A;  2HT1 A;  1NBW A;  2JK8 A;  4TVA B;  1E22 A;  2VQF Q;  4GNX C;  2BA1 A;  2F4V Q;  1MIU A;  2NN6 G;  4IOC A;  1VQ4 A;  4GNX B;  1K9M C;  1TXY A;  1N32 Q;  5C3E G;  1VQ9 A;  4DR2 Q;  1QVF A;  3CCE A;  3PUW A;  4HJ9 A;  4LUV A;  4QY7 A;  4YCV A;  4X65 L;  1PH5 A;  1K8A C;  1NE3 A;  1NMF A;  4DAY B;  1W3S A;  4JI5 L;  4EX5 A;  4C3J H;  3DLL A;  1HNZ L;  4AYB E;  5K36 G;  4HJ7 A;  4JI7 Q;  4NXM Q;  4A3F H;  1B8A A;  1Q7Y C;  1HZ9 A;  3CCQ A;  4A76 A;  4A3D H;  4QQB X;  4RMF A;  2RHS B;  3EN2 A;  3PGZ A;  1V1Q A;  4A93 H;  4GOP B;  4GN4 B;  2N78 A;  1E24 A;  3HKZ G;  4JI1 L;  4LNQ A;  1XNQ L;  3PIO A;  3JAM c;  1A62 A;  4P73 A;  4XIG S;  1VQD A;  2JQO A;  4DR4 Q;  2UUC L;  3ICE A;  1JJC B;  4JI0 Q;  1K83 H;  4LFA Q;  1A0I A;  1X65 A;  3G71 A;  1TWG H;  4BY1 G;  1Z9F A;  1K3R A;  5FJ8 H;  4B3T Q;  2F52 A;  4JI3 Q;  1BKB A;  2E2J H;  1TWF H;  2OTJ A;  1QZG A;  4TQU S;  4KHP Q;  5M3M G;  4O0A A;  1YI2 A;  4LF4 L;  2R7D A;  1SLJ A;  2HQL A;  2WAQ E;  1PYS B;  4J15 A;  4JI6 Q;  1E1T A;  1HR0 Q;  5FLM G;  5C0X J;  4HJ8 A;  2JA6 H;  2KCM A;  3E9I A;  3PO3 G;  2FXQ A;  2LXJ A;  1SR3 A;  4A4I A;  5C0X G;  1KXL A;  4JI5 Q;  1L1O B;  1VQC A;  4OX9 L;  4LF8 Q;  3H3V H;  4BY7 G;  4DV6 L;  4X6A H;  3UE0 A;  2JA6 G;  5GRO A;  5IY0 A;  4R4C A;  4YCW A;  4PZ7 A;  3HKS A;  1UEB A;  4JV5 Q;  1VQM A;  2E8G A;  5JEA J;  4LF9 Q;  1PVO A;  2Q2H A;  4A3I G;  1C7Y A;  1G6P A;  3BU2 A;  1WYD A;  1E1O A;  2CWA A;  1VQA A;  2I5M X;  4LUO A;  4DV3 Q;  5JJI A;  3I4M G;  3J81 i;  2K75 A;  5FJ8 G;  1CSQ A;  1P8L A;  4JI0 L;  3HFZ B;  3S16 H;  3I4N G;  2IX0 A;  1YHQ A;  3TEH B;  4DV6 Q;  1VQ7 A;  1VQJ A;  5IYD G;  2Q2T A;  4MTN A;  3H3V I;  1HNW Q;  5C4X G;  2XTI A;  3S2H H;  1FVI A;  4DR1 L;  1X56 A;  1NJI C;  3K80 C;  2VW9 A;  1N34 Q;  2UXD L;  5BR8 Q;  4QL5 A;  4JOI C;  1UE7 A;  2VQE Q;  2MQH A;  3RLO A;  3G6E A;  2UXB L;  5AJ3 Q;  5HGQ A;  3L2P A;  2JE6 I;  1DGS A;  1LTL A;  1OXX K;  4DV1 Q;  4IO9 A;  4A93 G;  1XTD A;  3EIV A;  1PH2 A;  4A3D G;  3PSI A;  4IPD A;  1EYG A;  4OO1 I;  2QGQ A;  1KL9 A;  1FJG Q;  2PMZ E;  4X64 L;  4DR4 L;  1Q81 C;  5GAD C;  3TQY A;  2BH8 A;  1XPR A;  2B63 H;  2I0Q A;  4GN5 A;  3D31 A;  1YHA A;  4JOI A;  1C0A A;  4QGU A;  4AQY Q;  2R6G A;  5GAG C;  2PQA B;  1E7Z A;  2WAQ G;  4LUZ A;  2GN5 A;  1WCM H;  3L0O A;  5J3B A;  1KRS A;  4GLA C;  4OWT B;  2MNA A;  3H15 A;  3CXC A;  4L5Q A;  3TS0 A;  2CCZ A;  2E2I H;  1XPU A;  3CC2 A;  3TS2 A;  4A3G H;  1HNZ Q;  4IJH A;  4DNI A;  3KFU A;  2AMC B;  1N8R C;  1PH4 A;  2NVT H;  2QA4 A;  1N36 L;  2AWN A;  1YNX A;  2N8N A;  3GTG H;  3CQZ H;  3PUX A;  3STB D;  1A8V A;  1QZH A;  4BBS G;  3J7A 5;  4GN3 B;  2OCE A;  4GNX A;  2RF4 A;  5IWA L;  3EBE A;  4HIO A;  1XJV A;  4LF6 Q;  3CD6 A;  1LYL A;  2KBN A;  2Y0S G;  3M3Y H;  3HOU G;  4HIM A;  1BBU A;  3S1M H;  4IFD G;  1HNX L;  2EQS A;  3CCV A;  1X3G A;  4OWX B;  3PUY A;  2UUC Q;  4KLK A;  2IX1 A;  4A3I H;  4BA2 I;  5LMU Q;  2A19 A;  2ZJR A;  1QVG A;  1HH2 P;  2LSS A;  5JJK A;  3FKI H;  2ID0 A;  5C44 H;  2ZM6 Q;  4A3G G;  2JA7 H;  1XMQ Q;  3FP9 A;  3CME A;  3HOW H;  1NY4 A;  1HZA A;  4O2D A;  4NPS A;  5ELN A;  3RLN A;  5LMN L;  1N34 L;  4OO1 G;  4JI1 Q;  2KHI A;  4LFB Q;  4JI2 Q;  1NTG A;  1PH7 A;  2F4V L;  3PO2 G;  2Q2U A;  5IP9 H;  4A3M G;  4LF9 L;  1U5K A;  5IE8 A;  4JI6 L;  4IPC A;  2K52 A;  2YV5 A;  3ULP A;  3HOV H;  4AH6 A;  1Y1V G;  3UDG A;  5M3M H;  3UE1 A;  1Q8K A;  1QUQ B;  1QUQ A;  3UDI A;  4DV3 L;  1JB7 A;  3AEV A;  4NB3 A;  4X64 Q;  4UP9 A;  5H1S E;  2CWP A;  3WWV A;  4B3T L;  4A75 A;  4DR3 L;  2NN6 I;  1EIF A;  1VQL A;  4JV5 L;  2VZA A;  3PUV A;  5LMN W;  1PHJ A;  2R7F A;  3JAM i;  2GVA A;  1EIY B;  4A3B G;  3T1H Q;  1V43 A;  4DR1 Q;  3A74 A;  2AWO A;  2UUA L;  4QJF A;  3VDY A;  2AKW B;  4DR5 Q;  2NVQ H;  3OYY A;  1CKO A;  3CAM A;  3KDF A;  1GKH A;  2VL6 A;  3K0X A;  2HIV A;  1YZ6 A;  3M4P A;  3J81 c;  1RL2 A;  3I2Z A;  4A3E G;  1N36 Q;  1L2F A;  2A1A A;  4L5R C;  4JG2 A;  3PO2 H;  2BA0 A;  1GO3 E;  2NZH A;  1SE8 A;  2YYZ A;  5C0X I;  3HOZ H;  2IY5 B;  4DV7 Q;  2VQE L;  4JI3 L;  4BBS H;  4BBR G;  3KF6 B;  4MZ9 A;  3K8A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...