3NBHB

Crystal structure of human rmi1c-rmi2 complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
131
structure length
131
Chain Sequence
LPRSPPLKVLAEQLRRDAEGGPGAWRLSRAAAGRGPLDLAAVWMQGRVVMADRGEARLRDPSGDFSVRGLERVPRGRPCLVPGKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of RMI1 and RMI2, Two OB-Fold Regulatory Subunits of the BLM Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords RecQ-mediated genome instability protein 1
total genus 28
structure length 131
sequence length 131
ec nomenclature
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16100 RMI2 RecQ-mediated genome instability protein 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3nbhB00
1CKOA 2QGQA 4RMFA 4DV2L 3A5UA 4PZ7A 3HKZE 1JB7A 4DV7L 2KBNA 1B70B 1KAWA 2BH8A 2ES2A 3I56A 2ZM6L 1XMQL 2DGYA 3E9IA 1LYLA 1E24A 3CC4A 1KRSA 2VNUD 3OTOQ 4Y52H 5M5YH 2NN6I 4LFCL 1P8LA 2A1AA 4AQYQ 3HOUG 1YJNA 1VQKA 1B7YB 1HNXQ 5HY6A 1WJJA 4AYBG 5LMNW 1X55A 1BBUA 2UUCL 5IWAQ 4UY8C 1O7IA 4JC0A 1J5EQ 4LF5L 2WAQG 3BJUA 1VQCA 2RF4A 4DAMA 4POFA 1NMGA 4IPDA 2CQOA 4X64Q 2VQEQ 2JQOA 1N33L 4DR7Q 5K36G 2N49A 4K0KQ 5J3BA 1VQ8A 5JEAJ 4EX5A 3M4QA 3JAMi 3CD6A 1EQRA 4DR2L 5JJLA 1NJIC 5ELOA 3DLLA 2FXQA 1PFSA 5IYBG 3CCUA 1J6QA 4DR5Q 4LNQA 1I6HH 2LSSA 3NELA 4GN4B 4LWCA 4BY7G 4OXPA 3CF5A 3NEMA 1TWFH 5LMUL 3HOZH 2ID0A 1WCMH 3UDIA 1IXRA 1WYDA 3D0FA 5C3EH 1XPOA 1S40A 3KF6A 4LFAL 4KI0A 5H1SE 2ZTCA 3VDYA 4A3MG 3CC2A 2XTIA 2ZJPA 4A3FG 4A3KH 1NTGA 1RIPA 3RR5A 2ZTDA 1VQ6A 1K8AC 2VS1A 3CPFA 2R7ZG 3PUZA 3CCRA 1XMOL 5IY0A 2HIVA 2IX0A 2UUBQ 2ZJQA 1QVFA 2UXBQ 1J5EL 1Q12A 3I55A 4LF5Q 4NXMQ 3PO2H 1N8RC 4A3IH 2JEBI 4GLXA 1JMCA 4A3DG 3H0GH 1PVOA 2UXDQ 3PUWA 3J80i 1AE2A 1OXUA 1M1KC 3HOWH 2MO1A 2HIXA 1GVPA 4XTCS 5HGQA 3S2HH 4YHHQ 4B3RL 4KHZA 4JI0L 4GKJQ 1KHIA 1KQSA 4A3JG 3PUVA 3NENA 2N3SA 3T1HL 4YWMA 3I7FA 1YIJA 2E2HH 3PUXA 4JI2Q 3JAMc 3RLOA 4A3KG 4JI4Q 2HHHQ 1Q86C 4JV5Q 1CKNB 3S1NH 5IE8A 2KCMA 4HJAA 2CCZA 3KJPA 3FHWA 2Z6KC 2R92H 4DV1L 4YCVA 1TWGH 2Y0SE 2QEXA 4HIMA 2I0QA 2B63H 3G6EA 1PYBA 1VQFA 3L0OA 3A5ZB 4BY1G 3J81j 3M85A 4AQYL 5AJ3L 2UXBL 4PMWA 1BBWA 4KHPQ 2H5XA 1E22A 3ULLA 3F2DA 4PZ8A 2UUCQ 4NXML 3KDFB 4LUOA 3RNUA 4L5QA 4JI1Q 2YTXA 3K8AA 3T1YL 5M3MG 3CCVA 1PH2A 4X64L 2GVAA 3OW2A 1P16A 2IHFA 4GOPA 4WJ3M 2UUAQ 4DUZQ 1LTLA 1VS0A 4QQBX 4AH6A 1FVIA 4JI8L 5GROA 1GKHA 4GOPC 2AWNA 3ULPA 4JBWA 1YI2A 2GN5A 2RHSB 3K80C 2B63G 3PUYA 1EOVA 4B3TQ 3CCEA 2UXCQ 5C3EG 1V1QA 4R4TA 1Q1EA 3GTMH 3PF4A 1N36L 4HJ9A 4A3MH 3L2PA 2VL6A 1OXSC 4JYAQ 3SGIA 4GN3B 3J7A5 2K4KA 4WJ4A 1JT8A 3J81i 4LF8L 3S17H 2NVXH 4ME3A 1N34L 3GTPH 1Y1WH 4GKKL 3K81C 1EWIA 1Q46A 4UPAA 3GD7A 4DV1Q 4A3GH 3J80c 2A8VA 1UE1A 4JI5L 4MNOA 4A3EG 4LF4Q 1VQNA 1PHJA 3M9BA 3H3VH 1YBYA 2UUAL 1IBKL 1TXYA 1AH9A 4DV6Q 1Q7YC 1XNRQ 2JA9A 1X3GA 2E2JH 1CUKA 4NB3A 4BBRG 5C4XH 1PH4A 1L1OB 1B8AA 3ICEA 4DV3Q 1OXVA 4X65L 3GTGH 3RLFA 5IP7G 4GNXB 3HOYG 4J15A 1I5FA 1X54A 1GO3E 2OTJA 1XPUA 4A3CG 2IY5B 1X6OA 1Y1WG 1W3SA 3KFUA 2LXKA 3RZDH 3WWVA 2VQFQ 1LM0A 3S1RH 2UXDL 4DKAC 3MXNB 1A63A 1VQLA 1K3RA 4A4IA 4YY3Q 1JE5A 3A74A 3G71A 2KCTA 1I94L 4LFBL 1R9TH 3TQYA 4IFDG 4OWTB 1K0RA 3RN5A 5FLXc 4JI2L 3RLNA 2WAQE 1SLJA 1V43A 4C3HH 1HNXL 1U0LA 1EFWA 4LF8Q 1IYJB 3S16H 1SROA 4NPSA 4GKKQ 3UDXA 4HJ7A 2EXDA 4TQUS 2MQHA 5IP7H 3PV0A 5FLMG 3UDFA 1VQ4A 4LF6L 3D31A 1C0AA 3AEVA 1HNWQ 1N32L 4P72A 2PMZE 2VQEL 3JC66 3I4NH 1E7ZA 3U50C 4K0KL 4DR6Q 4QIWE 5AJ3Q 2WFWA 4X66L 4O2DA 3CC7A 1WI5A 1Z9FA 2IT1A 4ALPA 1OTCA 1A0IA 2CWAA 2OTLA 3K7AH 1HH2P 1Z47A 4JI6Q 3RZOH 4BBSH 1SRUA 2ZTEA 1S3OA 3GTJH 2UXCL 2JA8G 1MKHA 1PH9A 2MO0A 4YCUA 4DUZL 4B3SQ 4X65Q 4X62Q 4JCVE 4DV5L 2JA7H 2OQKA 4A3GG 1U5KA 1A62A 2ZJRA 3CCJA 2D0PA 1RL2A 4IPHA 4DR3Q 4A3EH 4JBMA 3H3VI 4P74A 2VUMH 5C0XJ 4C3IH 3S1QH 1EIYB 5JEAG 1XMQQ 2IHEA 2F52A 3E0EA 4A75A 1YHQA 5FJ8G 4JBJA 3CMAA 4BBRH 3S24A 3PO3G 5GADC 3CXCA 5IT9c 5C4XG 1VQHA 4DV7Q 3M3YH 1WFQA 1IZ6A 4OWXB 3F1ZA 4UP8A 1E1OA 4IPGA 2VW9A 4DR1L 4A93H 4YWLA 4XIGS 4LF7L 4UP9A 2PQAB 1AE3A 1G291 4R4OA 3GTKH 1KD1C 1CSQA 1MIUA 4DAYB 4DV0Q 1HJPA 1VQ7A 3E9HA 3CCSA 2XGTA 3TREA 3HOUH 2CFMA 4GOPB 2Q2IA 5BR8L 5C44G 2ASBA 2HT1A 4BA1I 2WB1E 4BXXH 3T1HQ 4A3DH 3H0GG 2YTVA 5IYDH 4DV5Q 4OO1G 2PI2A 5M3FG 1UWVA 3UE1A 4A93G 4LFAQ 1PH1A 3I4NG 2R6GA 4IO9A 4P73A 4GN5A 4JI7Q 1UE7A 1VQBA 4O0AA 1GM5A 3STBC 2MNAA 1E3PA 1NBWA 1E1TA 1XNQL 1TWHH 2N8NA 1IL2A 2GVBA 3S1MH 1W2BA 1K8GA 2JA6G 5M5WH 1FL0A 2WP8J 1XJVA 4DR6L 1UE6A 2V1CC 3GTLH 5C4JH 5JJKA 1C7YA 2YV5A 1JJCB 1EUJA 4HIDA 1HNZL 3S2DH 4DK6C 4C2MH 3PGZA 5M3FH 3PIOA 1C9OA 2LXJA 2JA7G 3F2CA 4A3FH 3I4MH 2E5LL 3KOJA 5IYCG 1QZHA 1YJWA 2VUMG 2L15A 3FKIH 4NXNL 2R7ZH 1LUZA 4B3TL 2KENA 4BY7H 2UU9L 2ZM6Q 3ERSX 1G6PA 4YHHL 1SE8A 2JA6H 4QL5A 2PQAA 1T9HA 3HOWG 5JJIA 2K52A 1D7QA 4LFCQ 2F4VQ 1L2FA 3A0JA 4X62L 3GTQH 4QGUA 3CPWA 4JV5L 1YNXA 3KJOA 1N9WA 2AKWB 1HR0W 3ER0A 2NVQH 3UDGA 1HNZQ 1X3EA 4P71A 3F2BA 3W5OA 1YHAA 2OWOA 2B29A 3FKIG 3PIPA 4IFDI 4AIMA 3AFQA 2BH2A 1HZCA 3U4VA 5IYBH 4DV6L 2YU9H 3CCMA 2I5LX 3M4PA 5LMNL 2D0OA 5C44H 2R92G 3BZCA 3M4OH 4DR4Q 4IJLA 1QZGA 4JOIC 1KIXA 1QVCA 4BXXG 4DR1Q 2NZHA 1HR0Q 4JBKA 4R4CA 4APVA 1IBLL 4DPGA 1KL9A 1M90C 4KLKA 1CKNA 2R7DA 5DLQE 3W1GA 5LMUQ 3G48A 4HJ5A 1HZAA 2RHQB 3CW2C 1VQAA 3TRZA 3HOVH 2JJQA 2BA1A 2VQFL 4JI8Q 3U4ZA 4IOAA 2JEAI 1OXTA 1A8VA 3AYHB 2UU9Q 2AWOA 2K75A 3NBHB 1YEZA 4GLAC 4JI7L 1I50H 1N32Q 2K5NA 4DK3C 3KDFA 1Q1BA 2JE6I 1Q82C 4PG3A 1X3FA 3TEHB 1ASZA 2QA4A 5M5XH 1PV4A 4IJHA 3CCQA 4A3JH 3CQZH 4GS3A 4B3MQ 1VQEA 5IYCH 2OCEA 1K73C 1XMOQ 1XNQQ 4B3RQ 5FLMH 1L1OA 2B3GA 1MJCA 2Z6KA 3STBD 1VQIA 2JA5H 1VQ9A 1CSPA 2C35B 1IBKQ 4EQ5A 4DNIA 1Y1VH 2E5LQ 3GDEA 4LUVA 4C3JH 4JI6L 3HOVG 1TWAH 2RCNA 5IP9G 1X65A 3HOZG 2AMCB 4MZ9A 2ALYB 3PF5A 2MFIA 5C0XI 4X6AH 4BY1H 4OWWB 1V9PA 4YY3L 3F8TA 4RG1A 4LF9L 1NE3A 3FP9A 3BZKA 2PI2E 1FGUA 2EIFA 2VY3A 1X9NA 2HHHL 1Q81C 3TS2A 3L7ZC 1EIFA 1NY4A 5E7NA 1H95A 2JA8H 4NXNQ 1IBMQ 1ASYA 4JI3Q 5M3MH 3GTOH 2Q2TA 4BA2I 4KHPL 2Z0SA 2JA5G 4A76A 1PA6A 4OX9Q 1FJGQ 5GAHC 1EYGA 4DV4Q 3HFZB 3RN2A 1Y1VG 4UP7A 1L1OC 2KHJA 4R1JA 3CMEA 2HQLA 2K50A 4FDBA 1WOCA 1L0WA 1YITA 3CCLA 5IP9H 1X56A 1SR3A 4GLVB 3UE0A 4X66Q 1PH6A 5C0XG 4LF7Q 3CAMA 4YCWA 3LGJA 4B3ML 3PO3H 1UE5A 3PSIA 2F3IA 3OYYA 4YWKA 2AHOB 1HNWL 5BR8Q 1VQJA 2DUDA 3S15H 1SMXA 3KLWA 2NN6G 4LF9Q 3TS0A 4A3LG 1OXXK 3KF6B 2KHIA 4Y7NH 3GO5A 1VCIA 4AYBE 4JI4L 4GNXA 3HOXH 1HR0L 1VQDA 2E8GA 2I5MX 4H02A 1VQOA 4L5RC 2CKZB 1PH3A 4DR3L 4OX9L 4QY7A 5GAGC 2IX1A 4JI0Q 4GKJL 3S14H 4DV4L 1D8LA 1PH8A 4JI5Q 4BBSG 2K5HA 2R93G 4IPCA 2N78A 1QUQA 3MEFA 3J81c 1N34Q 1DGSA 1G51A 1I3QH 1FJGL 5IYDG 4JOIA 2PNHA 4HIOA 4A3LH 1KXLA 1TWCH 4LF4L 3B6YA 4DV3L 4TVAB 4JI1L 5GQOA 1BKBA 3W1BA 3ZJYC 2D62A 4OONA 1YZ6A 3I4OA 4R4IA 3HOXG 2Q2HA 5IWAL 3U58A 1KRTA 4IOCA 3M7NA 3KYHC 1QUQB 3IRBA 4DV0L 1CKMA 4L5SA 1PYSB 4R4QA 2Q2UA 3K0XA 5GAEC 1EQQA 1KC8C 3T1YQ 2R93H 2OQ0A 3J7ZC 1SFOH 1K9MC 1VQMA 2K14A 4DUYL 4P75A 1N36Q 2I5HA 2YYZA 1BVSA 1Y14B 4DV2Q 1Q8KA 3AQQA 4QJFA 4POGA 4DR5L 1PH7A 3I4MG 1HZ9A 3CP0A 2A19A 1JJGA 1I94Q 4LFBQ 1GD7A 3I2ZA 1VQ5A 1UEBA 2BA0A 3Q8DA 4LF6Q 2NZOA 4MTNA 1XPRA 2NVTH 2F4VL 2CWPA 4A3BH 2K5VA 3AFPA 2VZAA 3K7UC 4OO1I 1YVCA 5EAYA 4JYAL 2ATWA 2R7FA 3HKZG 4JI3L 1IBML 5ELNA 1WCMG 1NMFA 3DM3A 4JG2A 4HIKA 4L5TA 3HOYH 1S72A 4A3CH 3BU2A 1VQPA 3OTOL 3HKSA 4PZ6A 3H15A 1IBLQ 2EQSA 2E2IH 3EN2A 2UUBL 3PCOB 1YHBA 5LMNQ 4HJ8A 4DR4L 1XTDA 1QVGA 4DUYQ 1VQGA 4IFDJ 1XNRL 4B3SL 1JJ2A 3EBEA 4GNXC 1YJ9A 1MJEA 2Y0SG 4DR2Q 4A3BG 5FJ8H 1K83H 3ULJA 3PO2G 3G4SA 2WB1G 2NVYH 1N33Q 4A3IG 3KF8B 3EIVA 4DR7L 1SN8A 4LUZA 4LW1A 2JK8A 2YTYA 1PH5A 1HZBA
chains in the Genus database with same CATH superfamily
1CKOA 4RMFA 3A5UA 1NSNS 3JAML 1B70B 2MUYA 1ICWA 3I56A 3CC4A 1E24A 2RDFA 3HOUG 2A1AA 5FO8B 1SEBD 4AYBG 1X55A 2JP1A 2WAQG 1TWHB 3BJUA 2RF4A 4POFA 1A3VA 2FJ2A 5EKKA 5C3XA 1QWYA 4DR7Q 3NQTA 1ZYRD 4K0KQ 3A7LA 3PMFA 5J3BA 5JEAJ 4EX5A 5TSSA 1EY4A 1EQRA 5JJLA 4C3IG 2X69A 2FXQA 5IYBG 1LT3D 4DR5Q 1D1KA 4A3FB 2LSSA 1JCKB 4OXPA 1TY0A 1TWFH 3HOZH 3A54A 2ID0A 1WCMH 3UDIA 3IFDA 1WYDA 2KECA 2QF7A 1LT5D 3VDYA 1WCMB 3CC2A 3V2TA 1RIPA 4A3KH 2ZTDA 3U9SA 2A69C 2VS1A 3FRPB 3MFYA 3SK4A 2PNRC 2HIVA 2IX0A 2ZJQA 1EU4A 3DM1A 4KKSA 2EYMA 2R92B 3NTHA 3M4YA 3D6WA 4GLXA 3H0GH 3I4MB 1OXUA 1STBA 4JVZA 1TQOA 3S2HH 4KHZA 5M5WB 3T1HL 4DFAA 1NR2A 3QOLA 4A3KG 2F1MA 1Y8NB 2SNSA 5F2DA 1F2MA 4RGNA 3BVZA 1DCZA 2Z6KC 2XRQD 4YCVA 4HIMA 2F03A 3C3LA 2B63H 5D65A 1IYVA 4R8IA 1PYBA 1PTOC 1I4PA 4PZ8A 2UUCQ 2XRSD 4L5QA 2PPBC 5BN3A 4FO2A 2UUAQ 1I3QB 5E4XA 1LTLA 1FVIA 4JI8L 4GOPC 1PZJD 4ULLA 3ULPA 3AB9A 3K80C 2E2IB 4B3TQ 5C3EG 4HMJA 1Q1EA 1CZWA 2ZXOA 3PF4A 1HRJA 3BDOA 3OIPA 1MSGA 3L2PA 2VL6A 1OXSC 4JYAQ 4QB4A 2FFKB 2F0PA 2OF1A 4IUNA 5C4JB 5KGUA 4JI5L 1VQNA 1PHJA 2K1BA 3M9BA 5JPMC 1Q7YC 2EDGA 4K2KA 1CA6A 4NB3A 3I73A 3W3AA 2F0GA 2F0QA 3ICEA 5I2YA 2K5QA 1E0BA 3SK5A 1YNNC 2IY5B 4J15A 1IYUA 2B2VC 1X6OA 2A69D 1EWCA 1W3SA 1C48A 2LXKA 3RZDH 4WRDA 3KF8A 4L6TB 4IUQA 4H0LC 4A4IA 3G71A 3MC0B 2E75C 4OWTB 5JAVA 5FLXc 1MHWC 2RVLA 2WAQE 4IFDI 4C3HH 1HNXL 1GOZA 5JVH3 3MHBA 1HXYD 1TY2A 5DEHA 3MTSA 3BG3A 1VQ4A 1H9MA 5IGFA 1ENCA 3JC66 2F3VA 1E7ZA 4C56C 3S2HB 4O2DA 2IT1A 1CT1D 2CWAA 2OTLA 2OEOA 3C1EA 1SRUA 1BO0A 1PH9A 1B50A 2N55A 3HOVB 4X65Q 4BY1B 4LMQD 4DV5L 2G5DA 4A3GG 1U5KA 4A3KB 1H9SB 4WJWA 3CCJA 4JBMA 2D0PA 5E3FA 4K8IA 5J1ZA 4P74A 3WOFA 1EQVA 5CGKA 4RGTA 3KLRA 1EIYB 3E0EA 3GV3A 5C4XG 2QCPX 5GADC 1VQHA 3T56B 1WFQA 1F9RA 3M3YH 5K5PA 1I4RA 1HQRD 2VW9A 4LK1C 4YWLA 1SXTA 4XIGS 4LF7L 1HTLD 1AE3A 1SNCA 3BYTB 2GA4B 1KD1C 1CSQA 1MIUA 2H1EA 4DAYB 1HJPA 2A73B 2NWGA 2I07B 3S9WA 3HOUH 2EOTA 3AMUA 2Q2IA 4QIWB 4BA1I 1JICA 3CQZB 1DM0B 5KNDA 4A3DH 1YNND 3VR2A 5T1GA 2ZXPA 3OW7A 3R2TA 2WV6D 4IO9A 3A8JE 4P73A 2NTSA 4ZKCB 1VQBA 1E3PA 4ZCKA 1TWHH 3ND9A 2N8NA 1IL2A 3S1MH 1W2BA 2P5ZX 2K01A 1NNXA 2WP8J 4DR6L 2K5DA 3GTLH 1CTMA 2MP1A 5C4JH 1LTTD 1HNZL 4KK7A 5CBAE 3F2CA 4DF7A 4PMBA 2E5LL 2MHVA 5C6AA 2BDNA 1XXGA 3FKIH 2R7ZH 2AQ2B 3ERSX 3IL8A 4QL5A 1BBXC 5C4HA 1T9HA 1ONLA 4BWGB 4K14A 1GHJA 3CPWA 4TRDA 1XYIA 1HNZQ 2QILA 4P71A 3F2BA 3A8KE 1I6HB 2K04A 4DV6L 2YU9H 2R92G 2I5LX 3M4PA 4DR4Q 3VYSA 3BZCA 4NP5A 1KIXA 1QVCA 2DNEA 3NP8A 2NVTB 3I3CA 4R4CA 1IBLL 4DPGA 4HJ5A 2R7DA 3W1GA 3P75A 1VQAA 1RODA 5M5YB 1LO5D 4JI8Q 2JEAI 4IUVA 2UU9Q 4GLAC 4N8FA 2F3WA 1N32Q 1H9SA 4Q0FA 4R8NA 2D9UA 1H9KA 4IJHA 3CCQA 5EPJA 1TS2A 2B3GA 1MJCA 3OMCA 4ODGA 2LY7A 1TWFB 1Y1VH 2PW7A 1PRTD 2NTTA 5IP9G 2ALYB 2K33A 4OWWB 4RG1A 1NE3A 3FP9A 2EIFA 5BN4A 3VYUA 1Q81C 1AZPA 5E7NA 1EIFA 3TS2A 1H95A 4KMUC 4NXNQ 1IBMQ 5M3MH 2Z0SA 4QMGA 2JA5G 1FD7D 4OX9Q 2WB1B 1EYGA 4DV4Q 3URYA 1Y1VG 3SE0A 2F0VA 5FOBB 2ZT9C 3HOVH 2HQLA 1LACA 1YITA 1T5XD 5IP9H 5JEAH 2HDLA 2R61A 4X66Q 3GTKB 1V8QA 3PSIA 4IQZA 5BN5A 2A68C 1HNWL 5BR8Q 1KNAA 1RTNA 3N52A 4FYDA 3HOYB 4XQQA 4AYBE 4PQXA 1PTOH 3HS0C 2B2UA 2M2LA 1SYEA 1ZKOA 1VF5C 4JI5Q 2XN9C 1EFID 2Z1CA 4IPCA 3H3VC 3S14B 1DGSA 2ZXRA 4HIOA 4HSPA 1TWCH 4EQOA 1KXLA 2E74C 5GQOA 1BKBA 3W1BA 3ZJYC 3K57A 4OONA 4EQNA 5IWAL 3K0YA 1KRTA 3IRBA 3K0XA 1EQQA 4KV6A 2RDGA 2IW3A 4G7ZC 4XT1B 2K6AA 1A3TA 2YYZA 3UI2A 3MWYW 4PMCA 4XXEA 1Q8KA 4DV2Q 4UHVA 3I4MG 1JJGA 3X3MA 4LFBQ 1PRTC 1GD7A 3I2ZA 2B39A 2BA0A 3FVQA 1VQ5A 1XPRA 3AFPA 3K7UC 4OO1I 1YVCA 1SNQA 2R7FA 4MN3A 2WIIB 1WCMG 2EJFC 1I6VC 1S72A 3TMEA 3J7AF 3DXJC 2K05A 3H15A 4DK1A 4DAVA 4ID6A 2SOBA 4GNXC 2Y0SG 4DNRB 3TSSA 1RKNA 4KD4A 1B44D 4A3IG 3KF8B 1N33Q 4K5VA 2A68D 2YTYA 1HA6A 3PUVA 3H0GB 4DV2L 3HKZE 1JB7A 3IAYA 2KBNA 1G2SA 1KAWA 1SJHD 2PZWA 1JWUD 1B3QA 2DGYA 1U4LA 1SNOA 4ZUJA 1P8LA 3S1NB 2B2YC 1VQKA 1B7YB 1HNXQ 4BY7H 3SXHA 2UUCL 5IWAQ 4JC0A 4ZYSA 4RKBA 1J5EQ 5I9PA 1LTBD 4KY6A 4IPDA 2CQOA 3TP5A 4CDFC 5I9OA 2NUCA 1VQ8A 4RGMA 4OIJA 2BE5D 5DM63 3CD6A 5ELOA 1I6HH 4GN4B 4LWCA 4C2MB 2C5CA 3D0FA 5C3EH 1S40A 1HPCA 4LAAA 4KI0A 5H1SE 3NWTA 4CDEC 5JPNC 2XTIA 1PRTF 3RR5A 3K59A 5A35A 2NYZD 1VQ6A 1HFNA 3PUZA 3CCRA 1XMOL 5IY0A 2H4OA 3FKIB 1J5EL 1Q12A 3I55A 4A3IH 2JXMB 2JN4A 2NZ1D 2UXDQ 5A2QL 2HIXA 4XTCS 2D5DA 1KQSA 2O5IC 3NTKA 2BCOA 2I46A 2D2CC 4K6DA 4X3KA 4R9WA 3KJPA 2PZUA 4CKCA 1TWGH 1JOQA 3K5NA 2C9OA 1IL8A 2E2DC 1VQFA 3L0OA 4BY1G 2UXBL 4HR7B 3J81j 3M85A 4ZAIA 4PMWA 1BBWA 4KHPQ 1E22A 4NXML 2IWHA 3RNUA 3T1YL 2HCCA 1PH2A 3CCVA 5JVG3 1BDOA 1P16A 3RD4A 5FLXE 2Z4HA 2RSOA 1VS0A 3MAQA 1RTOA 4AH6A 5GROA 2RHSB 1SNMA 1EOVA 3QOJA 3CCEA 5AFWA 2UXCQ 1V1QA 4XYOA 1JC7A 3OPOA 4WORA 1HUNA 4FF3A 1U4PA 1JB3A 4A3MH 1X3QA 4A3GB 1JT8A 2X6LA 1D5ZC 1Y69U 3QO2A 1JR0D 1DXMA 1CHPD 1UE1A 4MNOA 4A3EG 1K83B 2KA7A 3J80L 2UUAL 4HTHA 4DV6Q 2JA9A 2L1BA 4IFDH 2PO4A 4KKUA 3HZXA 3MZ5A 2RSNA 4QUFA 3GTGH 3HOYG 2V4DA 3P7JA 1TU2B 2L9HA 1CQFA 5D3IB 5FO7B 1VF7A 1Z6HA 1LM0A 2PQEA 3S1RH 1ZXTA 1MD2D 1WD1A 4YY3Q 1FGBD 4NKLA 3S16B 4LFBL 3ITPA 5CV8A 1R9TH 3TQYA 3WDNA 1WTVA 4E6IA 1V43A 2EY1A 3TZDA 4LF8Q 2DJFC 2PCFB 3S16H 3HKZB 4NPSA 1HHVA 3UDXA 3X3NA 2IL8A 4NW2A 5IP7H 3I72A 1AW7A 2A6HD 2KCCA 3LWEA 1PZID 1C0AA 2PMZE 2VQEL 3I4NH 2R93B 1I4GA 1GUWA 4DR6Q 1KABA 5AJ3Q 3S17B 4X66L 4P2CB 1WI5A 3GTGB 1Z47A 1E2WA 4X3SA 1HCZA 5C44B 1NUCA 2UXCL 3RUZA 1QG7A 3SK6A 1FR3A 1ZYRC 3T13A 4X62Q 1ILPA 4JCVE 4FF1A 5KEEA 1A62A 4DR3Q 1RL2A 4A3EH 1R4QB 2JA5B 4C3IH 1ILQA 2QDLA 4A75A 2F52A 1SAPA 1YHQA 4JBJA 3CMAA 4BBRH 3MA2B 3CXCA 1H9RA 3E5SA 4UP8A 1E1OA 4IPGA 3MFGA 4DR1L 1Q3LA 4C1NK 4UP9A 1A3UA 1G291 4R4OA 4CBVA 2EYHA 4DV0Q 4O42A 2XWJB 2XGTA 1XX8A 2VB2X 4C1NI 5BR8L 5C44G 3T16A 1V1PA 3T1HQ 3H0GG 4CKBA 4DV5Q 3UE1A 4EGVA 2EXZA 1IHZA 4LFAQ 3M4OB 4CGYB 2IJ0A 2B63B 2R6GA 1GUTA 4GN5A 1UE7A 3STBC 1E1TA 4HCEA 2RKSA 2GVBA 3A55A 1I4QA 1O7YA 1FL0A 2ENBA 1WTWA 2DN8A 1J8IA 2YV5A 3K5LA 3S2DH 3PGZA 1BCPB 2JA7G 2EY5A 3I4MH 5ELFA 5IYCG 4KTAA 4QCLA 1F2LA 3BS1A 2WACA 1LUZA 2WINB 3HRZC 2KENA 1K8OA 1STGA 2ZM6Q 1G6PA 2Q8RE 2PQAA 3Q6SA 5IOCA 4QF4A 3HOWG 2K52A 4LFCQ 1L2FA 4C3IB 1N9WA 2NVQH 3UDGA 1X3EA 1W6JA 3W5OA 2OXPA 2VXWA 3FKIG 3PIPA 3MXPA 4N9TA 3CCMA 2D0OA 5C44H 1AP0A 1QZGA 4JOIC 3M7GA 1HR0Q 1K28A 1F77A 3KLSX 1KL9A 5C0XH 5DLQE 2XSCA 2RHQB 3T53B 2VQFL 1DD2A 4OGQC 3U4ZA 4IOAA 1KLGD 3AYHB 3FDTA 2AWOA 1EY0A 3NBHB 4NDXA 1I50H 3MXGA 2B8FA 4DK3C 3CHBD 1Q1BA 2JE6I 1RDPD 1X3FA 3TEHB 1ASZA 1PV4A 4S3SA 5DAUA 1VQEA 4B3RQ 3VYTA 3STBD 1VQIA 1IBKQ 1DJRD 3VR4A 4DNIA 2E5LQ 3GDEA 4LUVA 3HOVG 4JI6L 1JORA 3A7AB 1X3PA 4DXFA 1TWAH 1OO9B 2CH4A 2RCNA 4XQJA 3J7YW 2AMCB 2A74C 3PF5A 1SE4A 4X6AH 2MFIA 2JA7B 1EY7A 1EEFD 1U4MA 1EY9A 2PI2E 1M8AA 4DAYA 1EZ6A 1Y8PB 3EA6A 2JSOA 4A76A 2XIWA 2IX3A 4HN7A 1L1OC 2KHJA 2AQ3B 2PZTA 1L0WA 4HCSA 2B2WC 1X56A 1SR3A 2EE1A 4GLVB 2MJ8A 1HTPA 3PO3H 4Z9CB 4B3ML 1UE5A 4YWKA 5G3LF 4CJ0B 3E3XA 2CVRA 4KN4C 3KLWA 4A3LG 3KF6B 2F0FA 5LL6X 2NVYB 3GO5A 1KNEA 1A2TA 4JI4L 1HR0L 2E8GA 4H02A 2CKZB 4UAIA 5GAGC 4N9PA 2IX1A 4JI0Q 4GKJL 3F2UA 3S14H 1TT2A 3U9OA 1SE3A 4A3EB 4V0BA 5C4XB 3MEFA 4ZUIA 1N34Q 1I3QH 3I70A 1FJGL 1LT4D 2F0EA 2KEEA 2PNHA 3OSOA 1G6ZA 1DZ1A 2D62A 3SEBA 2KCNA 1YZ6A 2EZVA 3U58A 2AQ1B 4RWSC 4K6LA 4IOCA 3M7NA 1M4VA 1QUQB 2HUGA 4L5SA 4R4QA 5GAEC 3CRKC 2R93H 3J7ZC 4RHSA 2RCFA 1SFOH 1MGSA 1K9MC 3MEHA 4DUYL 4P75A 1N36Q 4F87A 1BVSA 3D4DA 2F0LA 4DR5L 1LTAD 1HZ9A 3CP0A 3J80E 3EQLC 1UEBA 3Q8DA 3NPPA 3Q24A 4XQNA 2AUKA 3OWFA 1G8ZD 2VZAA 2HQEA 5EAYA 3NBHA 3HOXB 1IBML 1GXDC 5I6WA 1II3A 3KBGA 3D4RA 4OO1H 3OTOL 3HKSA 4C3HB 2UUBL 4J8QA 1YHBA 5LMNQ 1VQGA 4B3SL 3EBEA 5IGGA 1YJ9A 2F0OA 3V05A 1K83H 3K5OA 3OMGA 2L5TA 3PO2G 4JK1C 1SN8A 3GV6A 1ET6A 4X65L 1PH5A 3EVQA 1RCVD 4PZ7A 4DV7L 1O80A 1K8MA 3DWQA 2BH8A 3CRLC 4A3MB 2ES2A 3MXUA 1XMQL 4L8JA 3E9IA 1LYLA 1KRSA 2VNUD 3OTOQ 4Y52H 4H13C 5M5YH 2NN6I 4AQYQ 3HGBA 4UY8C 1WJJA 4RKLA 3E6ZX 5JJZA 5HURA 4DAMA 1NMGA 2VQEQ 2JQOA 1N33L 1EY8A 5K36G 1B3AA 1TIID 1J9OA 2TMPA 3OWEB 3TZUA 3JAMi 4ILWA 1NJIC 3DLLA 5KNCA 4WFN3 1PFSA 4J6HA 1QNKA 1AZQA 1ENFA 4BY7G 4ZKBB 3CF5A 5LMUL 5C5MA 1E2VA 3QG1A 4LFAL 1QE6A 2ZTCA 1HUMA 5I6YA 4A3MG 2ZJPA 3MVVA 1NTGA 1EY6A 3R3OA 3CPFA 2R7ZG 2UXBQ 1EYAA 3GTJB 4LJZC 2O5JC 1EL0A 4K8JA 5T1IA 1BNZA 3O13A 3DEOA 3J80i 3HOWH 1GVPA 4HMIA 4O1NA 1I4HA 3NUCA 1SJED 4YHHQ 4JI0L 4GKJQ 4ZQ3A 4A3JG 2KQ3A 2N3SA 1YIJA 3I7FA 4JI2Q 1B1ZA 3RLOA 4JI4Q 1WVLA 4JV5Q 1CKNB 4NMZA 5IE8A 2KCMA 5ELEA 5IGCA 2CCZA 3I4LA 3FHWA 2HCIA 2R92H 2SDFA 4DV1L 1WTQA 3A5ZB 3KLSA 3QR8A 4AQYL 5AJ3L 4ME5A 3FPPA 3R8BA 1MI2A 4LUOA 4BBRB 4A3BB 3M3YB 3GTQB 4DU9A 1CZGA 2IHFA 4EVOA 4GOPA 1LTRD 4DUZQ 4FXKC 1O7LA 1GKHA 1UEAB 4JBWA 5I4DA 2GN5A 3PUYA 4R4TA 5CYUA 3VA5A 1WTRA 4HJ9A 2Q8IB 3J7A5 4WJ4A 2K4KA 4LF8L 3S17H 4FF4A 3GTPH 1Y1WH 4GKKL 3K81C 4JPBW 1Q46A 4TSSA 3GD7A 4UPAA 1JQYD 4DV1Q 3J80c 1PXUA 4LF4Q 1XWEA 2CW0D 1YBYA 3PQIA 5M9OA 1XNRQ 1SNDA 1X3GA 1EOTA 2E2JH 4FXGC 4BBRG 2LS01 1L1OB 2QEJC 5J39A 2WKCA 3WOEA 1I5FA 1X54A 4A3CG 1Y1WG 3WWVA 2VQFQ 2UXDL 3QJYA 4DKAC 2J7ZA 1QILA 1VQLA 1K3RA 4QUCA 3KUPA 2KCTA 1I94L 4IFDG 3RLNA 1ENAA 1QOHA 4M1UB 1U0LA 1IYJB 1HFGA 1SROA 1EYCA 3A56A 5G3LD 2KOLA 3EROA 4HJ7A 4RA8A 4TQUS 3PV0A 2OT2A 4LF6L 3D31A 1HNWQ 1N32L 3G6JB 4P72A 5IT9E 4KHVA 4K0KL 4QIWE 5NUCA 2WFWA 1VQ9A 1OTCA 1LTSD 2K28A 1Z9FA 3CC7A 1SDFA 5EKIA 4BBSH 1AFPA 2ZTEA 1S3OA 4H44C 4YIJA 3GTJH 1PDQA 4YCUA 4DUZL 1QNUA 1MBYA 1TS5A 2JA7H 2ZJRA 5C4ZA 1BUVT 2VUMH 3GTOB 3K5MA 1XMQQ 2IHEA 3NSWA 2NVXB 4DV7Q 3T4AC 4OWXB 1EYDA 2QDBA 4K5XA 1BXTA 1K3BC 4A93H 4CDCC 4U68A 1BCPD 1SBBB 2PQAB 1PFBA 3QB3A 5C3WA 3GTKH 3DMUA 4RAUC 2CW0C 3E9HA 3TREA 2CFMA 4GOPB 3T51B 3TP7A 2G9DA 3Q23A 4Y7NB 4PNYA 1Y1WB 1IKMA 3GTPB 4OO1G 2PI2A 5M3FG 4A93G 1SYGA 1PH1A 5J22A 3ZYYX 4O0AA 3TP6A 2MNAA 1NBWA 3N6RA 5E4WC 1XNQL 4F8MA 3J7AV 2F0TA 4ZLTF 5M5WH 2B2VA 2KJXA 1XJVA 1UE6A 5JJKA 1C7YA 4I65A 3LX0A 1JJCB 5CV7A 1B53A 4DK6C 4C2MH 4IUUA 1C9OA 5CV5A 1MSHA 4ZRZA 3KOJA 1QZHA 1YJWA 2VUMG 1QCBD 2L15A 1A6XA 1NAPA 4B3TL 3R2IA 1SMYC 2NBFA 5ELCA 5JJIA 2L0CA 1GUGA 1D7QA 2F4VQ 4B08A 3A0JA 3GP7A 3GTQH 1YNXA 3KJOA 1G2TA 3CU7A 3ER0A 5FO9B 2KEDA 3OIQA 3C2PA 5C5LA 2FMCA 5IIFA 2F0NA 4AIMA 3U4VA 3DEPA 5LMNL 1F9PA 5A2QE 4IJLA 3GQBA 4BXXG 2K03A 4JBKA 1BQQT 4U673 4APVA 1TS4A 1CKNA 5LMUQ 3G48A 1HZAA 3CW2C 1BCPC 2PW5A 2BA1A 3NXWA 2F0DA 2K75A 1H9JA 1B2TA 2F0WA 1YEZA 2KUMA 2EY6A 1SYFA 4DK0A 2K5NA 3K7AB 1FNUA 4A93B 1Q82C 2R7ZB 4PG3A 2F4IA 4B9XA 5ELBA 1LLRD 5KIXA 5M5XH 2L55A 2PMZB 4A3JH 3NTIA 1EQTA 1XNQQ 2OCEA 3ND8A 1XMOQ 1K73C 2A6HC 1V1OA 1SE2A 2B2YA 2C35B 4EQ5A 4C3JH 4UDUC 3C1FA 1X65A 4EQPA 3FPUB 4F7XA 4MZ9A 5C0XI 4YY3L 3F8TA 4LF9L 3KBXA 5CR3A 1S4ZA 2VY3A 2HHHL 4FXDA 1NY4A 1RD9D 2JA8H 3GTOH 4BA2I 4KHPL 2ICEC 2Q2TA 1FJGQ 3RN2A 3D4WA 4R1JA 3CMEA 4FDBA 2XNAC 3PO3B 1WOCA 2DY7A 1Y8OB 1SMYD 2F0HA 3I91A 1B9NA 4RCNA 3HOUB 5E1FA 4KN7C 1AEXA 3UE0A 4YCWA 1BOSA 5EKLA 2F3IA 2AHOB 1QB5D 1VQJA 1U9RA 1SMXA 1E2ZA 2NN6G 4X3UA 3TS0A 1JWMD 3HG9A 2KHIA 4MHEA 3SHLA 5IT9L 1RJTA 4GNXA 3HOXH 1VQDA 2I5MX 1VQOA 1PH3A 4DR3L 2Q8TA 3NQIA 2L11A 2VB3X 4DV4L 1PTOD 1QJOA 4BBSG 1UNSA 1Q90A 4IUTA 2E2JB 4G7HC 2HDMA 3J81c 1G51A 3NE5B 1SYBA 1R9TB 1GUSA 4A3LH 1F2ZA 3B6YA 5EQ0A 1JE4A 3I4OA 1IW7D 2N88A 2Q2HA 1S5DD 3E0JA 3S1RB 3FEWX 5ISRA 1RF2D 1JWSD 1CKMA 1LT6D 1I50B 3T1YQ 1UAPA 2K14A 1A2UA 2I5HA 3VA7A 1PZKD 1Y14B 3AQQA 4POGA 2E2HB 1SNPA 2LKVA 1PFMA 3P20A 2CWPA 4A3BH 2K32A 1O7ZA 2F0SA 4JYAL 4CDDC 5CBEE 4JI3L 2EPBA 1NMFA 4JG2A 4HIKA 4L5TA 1EU3A 2NB0A 4DN4M 1VQPA 2TSSA 1IBLQ 2EQSA 3EN2A 2L4NA 3PCOB 1C4QA 2B2TA 4HJ8A 2F0UA 1XTDA 3IFTA 1QVGA 5EBDA 1I4XA 2DJGC 4A3BG 3D3RA 3ULJA 1SYDA 1D5XC 2NVYH 4DR7L 1CFMA 4GZYC 3EIVA 4OEMB 4A3JB 4LW1A 2JK8A 4DAPA 5CC4A 3HOWB 1HZBA 2QGQA 3L9AX 4H7BA 2CQAA 2YU9B 2ZM6L 4X3TA 3HP3A 2L12A 4L63B 4LFCL 5IODA 4I7ZC 1HA5A 1YJNA 5HY6A 3NK9A 2J4XA 1BBUA 1O78A 5LMNW 1F9QA 1O7IA 4LF5L 1D2BA 4FF2A 2F0KA 2J0TD 5EGTA 1PRTB 1DOKA 1VQCA 4X64Q 5HGTA 1AN8A 2N49A 3MXNA 5KNBA 4J1MA 3M4QA 4KJOA 1FYCA 2LFNA 4DR2L 1ML0D 1IW7C 3BZDB 1KDCA 3CCUA 1J6QA 1Z7TA 4LNQA 3NELA 3PIO3 3NEMA 3SK8A 3D6CA 1EZ8A 1IXRA 1XPOA 2FMMA 3KF6A 3J81E 1RHPA 3S1MB 4A3FG 2K5WA 2HD3A 1Q8IA 1K8AC 2B2TC 2FHTA 1GHKA 1L0YB 2UUBQ 1QVFA 1ZEQX 4DXGA 4LF5Q 5L37A 4NXMQ 3PO2H 3H6MA 1N8RC 4IN3A 2JEBI 1JMCA 4A3DG 1PVOA 4CHTB 3PUWA 1M1KC 1AE2A 2MO1A 5HGQA 4B3RL 1KHIA 4ABNA 1S5FD 4V190 2E2HH 3NENA 4YWMA 2Z8LA 3BVMA 3PUXA 3J81L 2NVQB 3JAMc 2HHHQ 1Q86C 3S1NH 4HJAA 2Y0SE 2QEXA 2I0QA 2B8GA 3G6EA 1VDZA 4XYQA 2G9HD 2H5XA 1TVXA 3TP8A 3TBIB 3ULLA 3F2DA 3FMCA 3KDFB 5K36H 4XT3B 4JI1Q 1S5ED 2F0IA 2YTXA 3K8AA 5M3MG 4DNTB 4X64L 2GVAA 3OW2A 4WJ3M 3S2DB 1PTOF 1SSOA 1STNA 1X32A 4QQBX 2AWNA 1KLUD 1EWHA 1YI2A 1WD0A 5EJWA 2B63G 1NR4A 5DNFA 5CV6A 3GTMH 1N36L 5EBCA 5D14A 5IGDA 3SGIA 4GN3B 4CKEA 2F0JA 3J81i 5KYLA 4TKOB 2NVXH 3H94A 4ME3A 1N34L 3P1HA 4HEDA 1EWIA 4A3GH 1GJXA 1STAA 2A8VA 1DONA 3BDLA 4RHRA 2EJGC 2QW7A 2EVBA 3H3VH 1PYWD 2SEBD 1IBKL 1TXYA 1SFOB 1TWCB 1U4RA 3K58A 1AH9A 3ERQA 4MTKA 1CUKA 5C4XH 1PH4A 3VR6A 1B8AA 4DV3Q 1OXVA 3SDZA 3RLFA 1PLFA 2K7VA 2Z4IA 5IP7G 4GNXB 2OTJA 1GO3E 1XPUA 1W6KA 2KHSA 1ICFB 3KFUA 1R4PB 1DOLA 3MXNB 2QKIC 4CJ2C 1A63A 3LWUA 1JE5A 3NWSA 3A74A 1VMCA 1CM9A 1XTCD 2F0MA 1G91A 1K0RA 3RN5A 1EIGA 4JI2L 5CORA 1SLJA 2BOSA 5FLXL 1EFWA 5JOBA 1SYCA 2EJMA 4GKKQ 2EXDA 2RQXA 2MQHA 2EYLA 2O2LD 5FLMG 4FP5D 3UDFA 5IGEA 2DNCA 3AEVA 3U50C 5M5XB 4IALA 4ALPA 1BR9A 1A0IA 2EYJA 2WAQB 3TN2A 3K7AH 1HH2P 2CH4W 4JI6Q 3RZOH 5M3MB 5CMDA 4N8X1 2BDOA 3K6OA 1MKHA 2JA8G 2MO0A 5ELDA 4XDXA 1STHA 1TWAB 1PFNA 4B3SQ 2LMCB 2OQKA 5KRUA 2RA4A 3H3VI 1LABA 4IPHA 2CHBD 1IKLA 1D6EC 5C0XJ 3Q0AA 3S1QH 1B4OA 2IPKD 5JEAG 4FVMA 1FNWA 5FJ8G 4ZK9B 5DM73 3S24A 3PO3G 5IT9c 2JA6B 1NCVA 1IZ6A 1F2YA 3F1ZA 1D5MC 5COYA 2Y0SB 4KD3A 4I7AA 3S15B 2KVMA 4IURA 3DHQA 5KYIA 5M3FB 1VQ7A 3CCSA 1ET9A 4Q5VA 3C46A 2ASBA 2HT1A 2WB1E 1KDAA 4IZ8A 4C3HG 4BXXH 4BY7B 4IUPA 2YTVA 5IYDH 1UWVA 2MGSA 2SNMA 3I4NG 4JI7Q 3PO2B 4RCOA 1GM5A 4BS9A 1V1PB 5CV4A 1K8GA 2JA6G 1A15A 2V1CC 4AYBB 2M9VA 5LHY1 2M00A 3VR3A 3Q22A 1EUJA 4HIDA 3HOZB 5M3FH 3PIOA 2LXJA 4DGZA 3DWPA 4A3FH 3OHXC 2B2WA 2A6ED 1YNJC 3NHHA 4NXNL 2UU9L 1TWGB 4YHHL 1LTID 1SE8A 2JA6H 2EYOA 4M8AA 3G7LA 4KJNA 4X62L 1KAAA 4KKTA 3VYRA 3S1QB 4OELB 4QGUA 2RDHA 3CKIB 5CV9A 4JV5L 2AKWB 1HR0W 3L3OC 4B9WA 2A5HA 4MIUA 1YHAA 3OOCA 2OWOA 2B29A 4KY7A 4JW0A 3I90A 3AFQA 2BH2A 1HZCA 5IYBH 1JOKA 1BCPF 3M4OH 4DR1Q 2NZHA 3W2DA 1C8CA 1M90C 3EFXD 2ICIA 4KLKA 1ESRA 5I2XA 3A8IE 3IKJA 5LL6S 3TRZA 1EEID 2FINB 2JJQA 3AU7A 1T5EA 1OXTA 1A8VA 5C3EB 3BYYB 3H91A 4A3IB 5FKAC 4JI7L 1F9SA 4BBSB 3JAME 3KDFA 1WTPA 3PIP3 1S5BD 1UUPA 2QA4A 1TKWB 1DYQA 1DOMA 3CQZH 4GS3A 4A3DB 4B3MQ 5IYCH 2E76C 5FLMH 1L1OA 2BE5C 2Z6KA 2JA5H 1VMPA 1CSPA 3LNNA 3V96A 1ESFA 5IGBA 3HOZG 2O4XA 3QWNA 1BF4A 4BY1H 1V9PA 1WTXA 2DY8A 3BVGA 1FGUA 3BZKA 1X9NA 1KTKA 1TR5A 3KK7A 3L7ZC 1STYA 5FK9C 2B2UC 1LV9A 1EY5A 2A6EC 1ASYA 4JI3Q 1YNJD 4RH6A 1STEA 1PA6A 5GAHC 3I4NB 2EY2A 3HFZB 4UP7A 2EYPA 4C3JG 2K50A 2RBMA 3CCLA 3GTMB 1GUOA 4HSVA 1B9MA 3D8GA 3EJIA 4RFBA 1PH6A 5C0XG 4LF7Q 3CAMA 3LGJA 3OYYA 1Y1VB 1GUNA 2DUDA 3S15H 1CHQD 4LF9Q 1OXXK 2MPMA 5D3DA 4Y7NH 1VCIA 4L5RC 4OL7A 4OX9L 4QY7A 4OHJA 3SR1A 1D8LA 1WTOA 1PH8A 2K5HA 2R93G 3R93A 2WKDA 2JYOA 2R3ZA 2N78A 1QUQA 5IYDG 4JOIA 1K0SA 2NN6H 1FNVA 4RGOS 4LF4L 4DV3L 1CQVA 4TVAB 4JI1L 1L0XB 3RMHA 3HOXG 1HQMC 4R4IA 3RZOB 4G57A 3RZDB 3SVMA 3H09A 3KYHC 4DV0L 1PYSB 2VUMB 2Q2UA 2XVSA 2AUJD 4CJ1B 1KC8C 2JA8B 2OQ0A 3ONAB 5EPLA 3QIAA 1VQMA 1JOOA 1CI3M 2XWBB 2Z6BA 4KY5A 3HEJA 2EYFA 4K5WA 4FNFA 4QJFA 1PH7A 4G7OC 2X6GA 3VR5A 2A19A 1EIHA 1I94Q 4LF6Q 4F88A 1WTHA 2NZOA 4MTNA 2NVTH 2F4VL 3TDQA 2K5VA 1PTOB 4OIKA 3I8ZA 2ATWA 3HKZG 3NBIA 5ELNA 3DM3A 5EPKA 3HOYH 1D1IA 3BU2A 4A3CH 4C3JB 4PZ6A 3DWAA 2E2IH 4K2LA 4DA2A 3BDCA 4G4KA 4DR4L 1LTGD 4PV1C 4DUYQ 4IFDJ 1XNRL 1JJ2A 1MJEA 1CA5A 4DR2Q 1S5CD 3DUZA 1CK1A 5FJ8H 3GTLB 1TS3A 1KDBA 3G4SA 2WB1G 4HAEA 2PYKA 2Z9HA 4LUZA 1PMRA
chains in the Genus database with same CATH topology
1CKOA 2QGQA 4RMFA 4DV2L 3A5UA 4PZ7A 3HKZE 1JB7A 4DV7L 2KBNA 1B70B 1KAWA 2BH8A 2ES2A 3I56A 2ZM6L 1XMQL 2DGYA 3E9IA 1LYLA 1E24A 3CC4A 1KRSA 2VNUD 3OTOQ 4Y52H 5M5YH 2NN6I 4LFCL 1P8LA 2A1AA 4AQYQ 3HOUG 1YJNA 1VQKA 1B7YB 1HNXQ 5HY6A 1WJJA 4AYBG 5LMNW 1X55A 1BBUA 2UUCL 5IWAQ 4UY8C 1O7IA 4JC0A 1J5EQ 4LF5L 2WAQG 3BJUA 1VQCA 2RF4A 4DAMA 4POFA 1NMGA 4IPDA 2CQOA 4X64Q 2VQEQ 2JQOA 1N33L 4DR7Q 5K36G 2N49A 4K0KQ 5J3BA 1VQ8A 5JEAJ 4EX5A 3M4QA 3JAMi 3CD6A 1EQRA 4DR2L 5JJLA 1NJIC 5ELOA 3DLLA 2FXQA 1PFSA 5IYBG 3CCUA 1J6QA 4DR5Q 4LNQA 1I6HH 2LSSA 3NELA 4GN4B 4LWCA 4BY7G 4OXPA 3CF5A 3NEMA 1TWFH 5LMUL 3HOZH 2ID0A 1WCMH 3UDIA 1IXRA 1WYDA 3D0FA 5C3EH 1XPOA 1S40A 3KF6A 4LFAL 4KI0A 5H1SE 2ZTCA 3VDYA 4A3MG 3CC2A 2XTIA 2ZJPA 4A3FG 4A3KH 1NTGA 1RIPA 3RR5A 2ZTDA 1VQ6A 1K8AC 2VS1A 3CPFA 2R7ZG 3PUZA 3CCRA 1XMOL 5IY0A 2HIVA 2IX0A 2UUBQ 2ZJQA 1QVFA 2UXBQ 1J5EL 1Q12A 3I55A 4LF5Q 4NXMQ 3PO2H 1N8RC 4A3IH 2JEBI 4GLXA 1JMCA 4A3DG 3H0GH 1PVOA 2UXDQ 3PUWA 3J80i 1AE2A 1OXUA 1M1KC 3HOWH 2MO1A 2HIXA 1GVPA 4XTCS 5HGQA 3S2HH 4YHHQ 4B3RL 4KHZA 4JI0L 4GKJQ 1KHIA 1KQSA 4A3JG 3PUVA 3NENA 2N3SA 3T1HL 4YWMA 3I7FA 1YIJA 2E2HH 3PUXA 4JI2Q 3JAMc 3RLOA 4A3KG 4JI4Q 2HHHQ 1Q86C 4JV5Q 1CKNB 3S1NH 5IE8A 2KCMA 4HJAA 2CCZA 3KJPA 3FHWA 2Z6KC 2R92H 4DV1L 4YCVA 1TWGH 2Y0SE 2QEXA 4HIMA 2I0QA 2B63H 3G6EA 1PYBA 1VQFA 3L0OA 3A5ZB 4BY1G 3J81j 3M85A 4AQYL 5AJ3L 2UXBL 4PMWA 1BBWA 4KHPQ 2H5XA 1E22A 3ULLA 3F2DA 4PZ8A 2UUCQ 4NXML 3KDFB 4LUOA 3RNUA 4L5QA 4JI1Q 2YTXA 3K8AA 3T1YL 5M3MG 3CCVA 1PH2A 4X64L 2GVAA 3OW2A 1P16A 2IHFA 4GOPA 4WJ3M 2UUAQ 4DUZQ 1LTLA 1VS0A 4QQBX 4AH6A 1FVIA 4JI8L 5GROA 1GKHA 4GOPC 2AWNA 3ULPA 4JBWA 1YI2A 2GN5A 2RHSB 3K80C 2B63G 3PUYA 1EOVA 4B3TQ 3CCEA 2UXCQ 5C3EG 1V1QA 4R4TA 1Q1EA 3GTMH 3PF4A 1N36L 4HJ9A 4A3MH 3L2PA 2VL6A 1OXSC 4JYAQ 3SGIA 4GN3B 3J7A5 2K4KA 4WJ4A 1JT8A 3J81i 4LF8L 3S17H 2NVXH 4ME3A 1N34L 3GTPH 1Y1WH 4GKKL 3K81C 1EWIA 1Q46A 4UPAA 3GD7A 4DV1Q 4A3GH 3J80c 2A8VA 1UE1A 4JI5L 4MNOA 4A3EG 4LF4Q 1VQNA 1PHJA 3M9BA 3H3VH 1YBYA 2UUAL 1IBKL 1TXYA 1AH9A 4DV6Q 1Q7YC 1XNRQ 2JA9A 1X3GA 2E2JH 1CUKA 4NB3A 4BBRG 5C4XH 1PH4A 1L1OB 1B8AA 3ICEA 4DV3Q 1OXVA 4X65L 3GTGH 3RLFA 5IP7G 4GNXB 3HOYG 4J15A 1I5FA 1X54A 1GO3E 2OTJA 1XPUA 4A3CG 2IY5B 1X6OA 1Y1WG 1W3SA 3KFUA 2LXKA 3RZDH 3WWVA 2VQFQ 1LM0A 3S1RH 2UXDL 4DKAC 3MXNB 1A63A 1VQLA 1K3RA 4A4IA 4YY3Q 1JE5A 3A74A 3G71A 2KCTA 1I94L 4LFBL 1R9TH 3TQYA 4IFDG 4OWTB 1K0RA 3RN5A 5FLXc 4JI2L 3RLNA 2WAQE 1SLJA 1V43A 4C3HH 1HNXL 1U0LA 1EFWA 4LF8Q 1IYJB 3S16H 1SROA 4NPSA 4GKKQ 3UDXA 4HJ7A 2EXDA 4TQUS 2MQHA 5IP7H 3PV0A 5FLMG 3UDFA 1VQ4A 4LF6L 3D31A 1C0AA 3AEVA 1HNWQ 1N32L 4P72A 2PMZE 2VQEL 3JC66 3I4NH 1E7ZA 3U50C 4K0KL 4DR6Q 4QIWE 5AJ3Q 2WFWA 4X66L 4O2DA 3CC7A 1WI5A 1Z9FA 2IT1A 4ALPA 1OTCA 1A0IA 2CWAA 2OTLA 3K7AH 1HH2P 1Z47A 4JI6Q 3RZOH 4BBSH 1SRUA 2ZTEA 1S3OA 3GTJH 2UXCL 2JA8G 1MKHA 1PH9A 2MO0A 4YCUA 4DUZL 4B3SQ 4X65Q 4X62Q 4JCVE 4DV5L 2JA7H 2OQKA 4A3GG 1U5KA 1A62A 2ZJRA 3CCJA 2D0PA 1RL2A 4IPHA 4DR3Q 4A3EH 4JBMA 3H3VI 4P74A 2VUMH 5C0XJ 4C3IH 3S1QH 1EIYB 5JEAG 1XMQQ 2IHEA 2F52A 3E0EA 4A75A 1YHQA 5FJ8G 4JBJA 3CMAA 4BBRH 3S24A 3PO3G 5GADC 3CXCA 5IT9c 5C4XG 1VQHA 4DV7Q 3M3YH 1WFQA 1IZ6A 4OWXB 3F1ZA 4UP8A 1E1OA 4IPGA 2VW9A 4DR1L 4A93H 4YWLA 4XIGS 4LF7L 4UP9A 2PQAB 1AE3A 1G291 4R4OA 3GTKH 1KD1C 1CSQA 1MIUA 4DAYB 4DV0Q 1HJPA 1VQ7A 3E9HA 3CCSA 2XGTA 3TREA 3HOUH 2CFMA 4GOPB 2Q2IA 5BR8L 5C44G 2ASBA 2HT1A 4BA1I 2WB1E 4BXXH 3T1HQ 4A3DH 3H0GG 2YTVA 5IYDH 4DV5Q 4OO1G 2PI2A 5M3FG 1UWVA 3UE1A 4A93G 4LFAQ 1PH1A 3I4NG 2R6GA 4IO9A 4P73A 4GN5A 4JI7Q 1UE7A 1VQBA 4O0AA 1GM5A 3STBC 2MNAA 1E3PA 1NBWA 1E1TA 1XNQL 1TWHH 2N8NA 1IL2A 2GVBA 3S1MH 1W2BA 1K8GA 2JA6G 5M5WH 1FL0A 2WP8J 1XJVA 4DR6L 1UE6A 2V1CC 3GTLH 5C4JH 5JJKA 1C7YA 2YV5A 1JJCB 1EUJA 4HIDA 1HNZL 3S2DH 4DK6C 4C2MH 3PGZA 5M3FH 3PIOA 1C9OA 2LXJA 2JA7G 3F2CA 4A3FH 3I4MH 2E5LL 3KOJA 5IYCG 1QZHA 1YJWA 2VUMG 2L15A 3FKIH 4NXNL 2R7ZH 1LUZA 4B3TL 2KENA 4BY7H 2UU9L 2ZM6Q 3ERSX 1G6PA 4YHHL 1SE8A 2JA6H 4QL5A 2PQAA 1T9HA 3HOWG 5JJIA 2K52A 1D7QA 4LFCQ 2F4VQ 1L2FA 3A0JA 4X62L 3GTQH 4QGUA 3CPWA 4JV5L 1YNXA 3KJOA 1N9WA 2AKWB 1HR0W 3ER0A 2NVQH 3UDGA 1HNZQ 1X3EA 4P71A 3F2BA 3W5OA 1YHAA 2OWOA 2B29A 3FKIG 3PIPA 4IFDI 4AIMA 3AFQA 2BH2A 1HZCA 3U4VA 5IYBH 4DV6L 2YU9H 3CCMA 2I5LX 3M4PA 5LMNL 2D0OA 5C44H 2R92G 3BZCA 3M4OH 4DR4Q 4IJLA 1QZGA 4JOIC 1KIXA 1QVCA 4BXXG 4DR1Q 2NZHA 1HR0Q 4JBKA 4R4CA 4APVA 1IBLL 4DPGA 1KL9A 1M90C 4KLKA 1CKNA 2R7DA 5DLQE 3W1GA 5LMUQ 3G48A 4HJ5A 1HZAA 2RHQB 3CW2C 1VQAA 3TRZA 3HOVH 2JJQA 2BA1A 2VQFL 4JI8Q 3U4ZA 4IOAA 2JEAI 1OXTA 1A8VA 3AYHB 2UU9Q 2AWOA 2K75A 3NBHB 1YEZA 4GLAC 4JI7L 1I50H 1N32Q 2K5NA 4DK3C 3KDFA 1Q1BA 2JE6I 1Q82C 4PG3A 1X3FA 3TEHB 1ASZA 2QA4A 5M5XH 1PV4A 4IJHA 3CCQA 4A3JH 3CQZH 4GS3A 4B3MQ 1VQEA 5IYCH 2OCEA 1K73C 1XMOQ 1XNQQ 4B3RQ 5FLMH 1L1OA 2B3GA 1MJCA 2Z6KA 3STBD 1VQIA 2JA5H 1VQ9A 1CSPA 2C35B 1IBKQ 4EQ5A 4DNIA 1Y1VH 2E5LQ 3GDEA 4LUVA 4C3JH 4JI6L 3HOVG 1TWAH 2RCNA 5IP9G 1X65A 3HOZG 2AMCB 4MZ9A 2ALYB 3PF5A 2MFIA 5C0XI 4X6AH 4BY1H 4OWWB 1V9PA 4YY3L 3F8TA 4RG1A 4LF9L 1NE3A 3FP9A 3BZKA 2PI2E 1FGUA 2EIFA 2VY3A 1X9NA 2HHHL 1Q81C 3TS2A 3L7ZC 1EIFA 1NY4A 5E7NA 1H95A 2JA8H 4NXNQ 1IBMQ 1ASYA 4JI3Q 5M3MH 3GTOH 2Q2TA 4BA2I 4KHPL 2Z0SA 2JA5G 4A76A 1PA6A 4OX9Q 1FJGQ 5GAHC 1EYGA 4DV4Q 3HFZB 3RN2A 1Y1VG 4UP7A 1L1OC 2KHJA 4R1JA 3CMEA 2HQLA 2K50A 4FDBA 1WOCA 1L0WA 1YITA 3CCLA 5IP9H 1X56A 1SR3A 4GLVB 3UE0A 4X66Q 1PH6A 5C0XG 4LF7Q 3CAMA 4YCWA 3LGJA 4B3ML 3PO3H 1UE5A 3PSIA 2F3IA 3OYYA 4YWKA 2AHOB 1HNWL 5BR8Q 1VQJA 2DUDA 3S15H 1SMXA 3KLWA 2NN6G 4LF9Q 3TS0A 4A3LG 1OXXK 3KF6B 2KHIA 4Y7NH 3GO5A 1VCIA 4AYBE 4JI4L 4GNXA 3HOXH 1HR0L 1VQDA 2E8GA 2I5MX 4H02A 1VQOA 4L5RC 2CKZB 1PH3A 4DR3L 4OX9L 4QY7A 5GAGC 2IX1A 4JI0Q 4GKJL 3S14H 4DV4L 1D8LA 1PH8A 4JI5Q 4BBSG 2K5HA 2R93G 4IPCA 2N78A 1QUQA 3MEFA 3J81c 1N34Q 1DGSA 1G51A 1I3QH 1FJGL 5IYDG 4JOIA 2PNHA 4HIOA 4A3LH 1KXLA 1TWCH 4LF4L 3B6YA 4DV3L 4TVAB 4JI1L 5GQOA 1BKBA 3W1BA 3ZJYC 2D62A 4OONA 1YZ6A 3I4OA 4R4IA 3HOXG 2Q2HA 5IWAL 3U58A 1KRTA 4IOCA 3M7NA 3KYHC 1QUQB 3IRBA 4DV0L 1CKMA 4L5SA 1PYSB 4R4QA 2Q2UA 3K0XA 5GAEC 1EQQA 1KC8C 3T1YQ 2R93H 2OQ0A 3J7ZC 1SFOH 1K9MC 1VQMA 2K14A 4DUYL 4P75A 1N36Q 2I5HA 2YYZA 1BVSA 1Y14B 4DV2Q 1Q8KA 3AQQA 4QJFA 4POGA 4DR5L 1PH7A 3I4MG 1HZ9A 3CP0A 2A19A 1JJGA 1I94Q 4LFBQ 1GD7A 3I2ZA 1VQ5A 1UEBA 2BA0A 3Q8DA 4LF6Q 2NZOA 4MTNA 1XPRA 2NVTH 2F4VL 2CWPA 4A3BH 2K5VA 3AFPA 2VZAA 3K7UC 4OO1I 1YVCA 5EAYA 4JYAL 2ATWA 2R7FA 3HKZG 4JI3L 1IBML 5ELNA 1WCMG 1NMFA 3DM3A 4JG2A 4HIKA 4L5TA 3HOYH 1S72A 4A3CH 3BU2A 1VQPA 3OTOL 3HKSA 4PZ6A 3H15A 1IBLQ 2EQSA 2E2IH 3EN2A 2UUBL 3PCOB 1YHBA 5LMNQ 4HJ8A 4DR4L 1XTDA 1QVGA 4DUYQ 1VQGA 4IFDJ 1XNRL 4B3SL 1JJ2A 3EBEA 4GNXC 1YJ9A 1MJEA 2Y0SG 4DR2Q 4A3BG 5FJ8H 1K83H 3ULJA 3PO2G 3G4SA 2WB1G 2NVYH 1N33Q 4A3IG 3KF8B 3EIVA 4DR7L 1SN8A 4LUZA 4LW1A 2JK8A 2YTYA 1PH5A 1HZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKO A;  2QGQ A;  4RMF A;  4DV2 L;  3A5U A;  4PZ7 A;  3HKZ E;  1JB7 A;  4DV7 L;  2KBN A;  1B70 B;  1KAW A;  2BH8 A;  2ES2 A;  3I56 A;  2ZM6 L;  1XMQ L;  2DGY A;  3E9I A;  1LYL A;  1E24 A;  3CC4 A;  1KRS A;  2VNU D;  3OTO Q;  4Y52 H;  5M5Y H;  2NN6 I;  4LFC L;  1P8L A;  2A1A A;  4AQY Q;  3HOU G;  1YJN A;  1VQK A;  1B7Y B;  1HNX Q;  5HY6 A;  1WJJ A;  4AYB G;  5LMN W;  1X55 A;  1BBU A;  2UUC L;  5IWA Q;  4UY8 C;  1O7I A;  4JC0 A;  1J5E Q;  4LF5 L;  2WAQ G;  3BJU A;  1VQC A;  2RF4 A;  4DAM A;  4POF A;  1NMG A;  4IPD A;  2CQO A;  4X64 Q;  2VQE Q;  2JQO A;  1N33 L;  4DR7 Q;  5K36 G;  2N49 A;  4K0K Q;  5J3B A;  1VQ8 A;  5JEA J;  4EX5 A;  3M4Q A;  3JAM i;  3CD6 A;  1EQR A;  4DR2 L;  5JJL A;  1NJI C;  5ELO A;  3DLL A;  2FXQ A;  1PFS A;  5IYB G;  3CCU A;  1J6Q A;  4DR5 Q;  4LNQ A;  1I6H H;  2LSS A;  3NEL A;  4GN4 B;  4LWC A;  4BY7 G;  4OXP A;  3CF5 A;  3NEM A;  1TWF H;  5LMU L;  3HOZ H;  2ID0 A;  1WCM H;  3UDI A;  1IXR A;  1WYD A;  3D0F A;  5C3E H;  1XPO A;  1S40 A;  3KF6 A;  4LFA L;  4KI0 A;  5H1S E;  2ZTC A;  3VDY A;  4A3M G;  3CC2 A;  2XTI A;  2ZJP A;  4A3F G;  4A3K H;  1NTG A;  1RIP A;  3RR5 A;  2ZTD A;  1VQ6 A;  1K8A C;  2VS1 A;  3CPF A;  2R7Z G;  3PUZ A;  3CCR A;  1XMO L;  5IY0 A;  2HIV A;  2IX0 A;  2UUB Q;  2ZJQ A;  1QVF A;  2UXB Q;  1J5E L;  1Q12 A;  3I55 A;  4LF5 Q;  4NXM Q;  3PO2 H;  1N8R C;  4A3I H;  2JEB I;  4GLX A;  1JMC A;  4A3D G;  3H0G H;  1PVO A;  2UXD Q;  3PUW A;  3J80 i;  1AE2 A;  1OXU A;  1M1K C;  3HOW H;  2MO1 A;  2HIX A;  1GVP A;  4XTC S;  5HGQ A;  3S2H H;  4YHH Q;  4B3R L;  4KHZ A;  4JI0 L;  4GKJ Q;  1KHI A;  1KQS A;  4A3J G;  3PUV A;  3NEN A;  2N3S A;  3T1H L;  4YWM A;  3I7F A;  1YIJ A;  2E2H H;  3PUX A;  4JI2 Q;  3JAM c;  3RLO A;  4A3K G;  4JI4 Q;  2HHH Q;  1Q86 C;  4JV5 Q;  1CKN B;  3S1N H;  5IE8 A;  2KCM A;  4HJA A;  2CCZ A;  3KJP A;  3FHW A;  2Z6K C;  2R92 H;  4DV1 L;  4YCV A;  1TWG H;  2Y0S E;  2QEX A;  4HIM A;  2I0Q A;  2B63 H;  3G6E A;  1PYB A;  1VQF A;  3L0O A;  3A5Z B;  4BY1 G;  3J81 j;  3M85 A;  4AQY L;  5AJ3 L;  2UXB L;  4PMW A;  1BBW A;  4KHP Q;  2H5X A;  1E22 A;  3ULL A;  3F2D A;  4PZ8 A;  2UUC Q;  4NXM L;  3KDF B;  4LUO A;  3RNU A;  4L5Q A;  4JI1 Q;  2YTX A;  3K8A A;  3T1Y L;  5M3M G;  3CCV A;  1PH2 A;  4X64 L;  2GVA A;  3OW2 A;  1P16 A;  2IHF A;  4GOP A;  4WJ3 M;  2UUA Q;  4DUZ Q;  1LTL A;  1VS0 A;  4QQB X;  4AH6 A;  1FVI A;  4JI8 L;  5GRO A;  1GKH A;  4GOP C;  2AWN A;  3ULP A;  4JBW A;  1YI2 A;  2GN5 A;  2RHS B;  3K80 C;  2B63 G;  3PUY A;  1EOV A;  4B3T Q;  3CCE A;  2UXC Q;  5C3E G;  1V1Q A;  4R4T A;  1Q1E A;  3GTM H;  3PF4 A;  1N36 L;  4HJ9 A;  4A3M H;  3L2P A;  2VL6 A;  1OXS C;  4JYA Q;  3SGI A;  4GN3 B;  3J7A 5;  2K4K A;  4WJ4 A;  1JT8 A;  3J81 i;  4LF8 L;  3S17 H;  2NVX H;  4ME3 A;  1N34 L;  3GTP H;  1Y1W H;  4GKK L;  3K81 C;  1EWI A;  1Q46 A;  4UPA A;  3GD7 A;  4DV1 Q;  4A3G H;  3J80 c;  2A8V A;  1UE1 A;  4JI5 L;  4MNO A;  4A3E G;  4LF4 Q;  1VQN A;  1PHJ A;  3M9B A;  3H3V H;  1YBY A;  2UUA L;  1IBK L;  1TXY A;  1AH9 A;  4DV6 Q;  1Q7Y C;  1XNR Q;  2JA9 A;  1X3G A;  2E2J H;  1CUK A;  4NB3 A;  4BBR G;  5C4X H;  1PH4 A;  1L1O B;  1B8A A;  3ICE A;  4DV3 Q;  1OXV A;  4X65 L;  3GTG H;  3RLF A;  5IP7 G;  4GNX B;  3HOY G;  4J15 A;  1I5F A;  1X54 A;  1GO3 E;  2OTJ A;  1XPU A;  4A3C G;  2IY5 B;  1X6O A;  1Y1W G;  1W3S A;  3KFU A;  2LXK A;  3RZD H;  3WWV A;  2VQF Q;  1LM0 A;  3S1R H;  2UXD L;  4DKA C;  3MXN B;  1A63 A;  1VQL A;  1K3R A;  4A4I A;  4YY3 Q;  1JE5 A;  3A74 A;  3G71 A;  2KCT A;  1I94 L;  4LFB L;  1R9T H;  3TQY A;  4IFD G;  4OWT B;  1K0R A;  3RN5 A;  5FLX c;  4JI2 L;  3RLN A;  2WAQ E;  1SLJ A;  1V43 A;  4C3H H;  1HNX L;  1U0L A;  1EFW A;  4LF8 Q;  1IYJ B;  3S16 H;  1SRO A;  4NPS A;  4GKK Q;  3UDX A;  4HJ7 A;  2EXD A;  4TQU S;  2MQH A;  5IP7 H;  3PV0 A;  5FLM G;  3UDF A;  1VQ4 A;  4LF6 L;  3D31 A;  1C0A A;  3AEV A;  1HNW Q;  1N32 L;  4P72 A;  2PMZ E;  2VQE L;  3JC6 6;  3I4N H;  1E7Z A;  3U50 C;  4K0K L;  4DR6 Q;  4QIW E;  5AJ3 Q;  2WFW A;  4X66 L;  4O2D A;  3CC7 A;  1WI5 A;  1Z9F A;  2IT1 A;  4ALP A;  1OTC A;  1A0I A;  2CWA A;  2OTL A;  3K7A H;  1HH2 P;  1Z47 A;  4JI6 Q;  3RZO H;  4BBS H;  1SRU A;  2ZTE A;  1S3O A;  3GTJ H;  2UXC L;  2JA8 G;  1MKH A;  1PH9 A;  2MO0 A;  4YCU A;  4DUZ L;  4B3S Q;  4X65 Q;  4X62 Q;  4JCV E;  4DV5 L;  2JA7 H;  2OQK A;  4A3G G;  1U5K A;  1A62 A;  2ZJR A;  3CCJ A;  2D0P A;  1RL2 A;  4IPH A;  4DR3 Q;  4A3E H;  4JBM A;  3H3V I;  4P74 A;  2VUM H;  5C0X J;  4C3I H;  3S1Q H;  1EIY B;  5JEA G;  1XMQ Q;  2IHE A;  2F52 A;  3E0E A;  4A75 A;  1YHQ A;  5FJ8 G;  4JBJ A;  3CMA A;  4BBR H;  3S24 A;  3PO3 G;  5GAD C;  3CXC A;  5IT9 c;  5C4X G;  1VQH A;  4DV7 Q;  3M3Y H;  1WFQ A;  1IZ6 A;  4OWX B;  3F1Z A;  4UP8 A;  1E1O A;  4IPG A;  2VW9 A;  4DR1 L;  4A93 H;  4YWL A;  4XIG S;  4LF7 L;  4UP9 A;  2PQA B;  1AE3 A;  1G29 1;  4R4O A;  3GTK H;  1KD1 C;  1CSQ A;  1MIU A;  4DAY B;  4DV0 Q;  1HJP A;  1VQ7 A;  3E9H A;  3CCS A;  2XGT A;  3TRE A;  3HOU H;  2CFM A;  4GOP B;  2Q2I A;  5BR8 L;  5C44 G;  2ASB A;  2HT1 A;  4BA1 I;  2WB1 E;  4BXX H;  3T1H Q;  4A3D H;  3H0G G;  2YTV A;  5IYD H;  4DV5 Q;  4OO1 G;  2PI2 A;  5M3F G;  1UWV A;  3UE1 A;  4A93 G;  4LFA Q;  1PH1 A;  3I4N G;  2R6G A;  4IO9 A;  4P73 A;  4GN5 A;  4JI7 Q;  1UE7 A;  1VQB A;  4O0A A;  1GM5 A;  3STB C;  2MNA A;  1E3P A;  1NBW A;  1E1T A;  1XNQ L;  1TWH H;  2N8N A;  1IL2 A;  2GVB A;  3S1M H;  1W2B A;  1K8G A;  2JA6 G;  5M5W H;  1FL0 A;  2WP8 J;  1XJV A;  4DR6 L;  1UE6 A;  2V1C C;  3GTL H;  5C4J H;  5JJK A;  1C7Y A;  2YV5 A;  1JJC B;  1EUJ A;  4HID A;  1HNZ L;  3S2D H;  4DK6 C;  4C2M H;  3PGZ A;  5M3F H;  3PIO A;  1C9O A;  2LXJ A;  2JA7 G;  3F2C A;  4A3F H;  3I4M H;  2E5L L;  3KOJ A;  5IYC G;  1QZH A;  1YJW A;  2VUM G;  2L15 A;  3FKI H;  4NXN L;  2R7Z H;  1LUZ A;  4B3T L;  2KEN A;  4BY7 H;  2UU9 L;  2ZM6 Q;  3ERS X;  1G6P A;  4YHH L;  1SE8 A;  2JA6 H;  4QL5 A;  2PQA A;  1T9H A;  3HOW G;  5JJI A;  2K52 A;  1D7Q A;  4LFC Q;  2F4V Q;  1L2F A;  3A0J A;  4X62 L;  3GTQ H;  4QGU A;  3CPW A;  4JV5 L;  1YNX A;  3KJO A;  1N9W A;  2AKW B;  1HR0 W;  3ER0 A;  2NVQ H;  3UDG A;  1HNZ Q;  1X3E A;  4P71 A;  3F2B A;  3W5O A;  1YHA A;  2OWO A;  2B29 A;  3FKI G;  3PIP A;  4IFD I;  4AIM A;  3AFQ A;  2BH2 A;  1HZC A;  3U4V A;  5IYB H;  4DV6 L;  2YU9 H;  3CCM A;  2I5L X;  3M4P A;  5LMN L;  2D0O A;  5C44 H;  2R92 G;  3BZC A;  3M4O H;  4DR4 Q;  4IJL A;  1QZG A;  4JOI C;  1KIX A;  1QVC A;  4BXX G;  4DR1 Q;  2NZH A;  1HR0 Q;  4JBK A;  4R4C A;  4APV A;  1IBL L;  4DPG A;  1KL9 A;  1M90 C;  4KLK A;  1CKN A;  2R7D A;  5DLQ E;  3W1G A;  5LMU Q;  3G48 A;  4HJ5 A;  1HZA A;  2RHQ B;  3CW2 C;  1VQA A;  3TRZ A;  3HOV H;  2JJQ A;  2BA1 A;  2VQF L;  4JI8 Q;  3U4Z A;  4IOA A;  2JEA I;  1OXT A;  1A8V A;  3AYH B;  2UU9 Q;  2AWO A;  2K75 A;  3NBH B;  1YEZ A;  4GLA C;  4JI7 L;  1I50 H;  1N32 Q;  2K5N A;  4DK3 C;  3KDF A;  1Q1B A;  2JE6 I;  1Q82 C;  4PG3 A;  1X3F A;  3TEH B;  1ASZ A;  2QA4 A;  5M5X H;  1PV4 A;  4IJH A;  3CCQ A;  4A3J H;  3CQZ H;  4GS3 A;  4B3M Q;  1VQE A;  5IYC H;  2OCE A;  1K73 C;  1XMO Q;  1XNQ Q;  4B3R Q;  5FLM H;  1L1O A;  2B3G A;  1MJC A;  2Z6K A;  3STB D;  1VQI A;  2JA5 H;  1VQ9 A;  1CSP A;  2C35 B;  1IBK Q;  4EQ5 A;  4DNI A;  1Y1V H;  2E5L Q;  3GDE A;  4LUV A;  4C3J H;  4JI6 L;  3HOV G;  1TWA H;  2RCN A;  5IP9 G;  1X65 A;  3HOZ G;  2AMC B;  4MZ9 A;  2ALY B;  3PF5 A;  2MFI A;  5C0X I;  4X6A H;  4BY1 H;  4OWW B;  1V9P A;  4YY3 L;  3F8T A;  4RG1 A;  4LF9 L;  1NE3 A;  3FP9 A;  3BZK A;  2PI2 E;  1FGU A;  2EIF A;  2VY3 A;  1X9N A;  2HHH L;  1Q81 C;  3TS2 A;  3L7Z C;  1EIF A;  1NY4 A;  5E7N A;  1H95 A;  2JA8 H;  4NXN Q;  1IBM Q;  1ASY A;  4JI3 Q;  5M3M H;  3GTO H;  2Q2T A;  4BA2 I;  4KHP L;  2Z0S A;  2JA5 G;  4A76 A;  1PA6 A;  4OX9 Q;  1FJG Q;  5GAH C;  1EYG A;  4DV4 Q;  3HFZ B;  3RN2 A;  1Y1V G;  4UP7 A;  1L1O C;  2KHJ A;  4R1J A;  3CME A;  2HQL A;  2K50 A;  4FDB A;  1WOC A;  1L0W A;  1YIT A;  3CCL A;  5IP9 H;  1X56 A;  1SR3 A;  4GLV B;  3UE0 A;  4X66 Q;  1PH6 A;  5C0X G;  4LF7 Q;  3CAM A;  4YCW A;  3LGJ A;  4B3M L;  3PO3 H;  1UE5 A;  3PSI A;  2F3I A;  3OYY A;  4YWK A;  2AHO B;  1HNW L;  5BR8 Q;  1VQJ A;  2DUD A;  3S15 H;  1SMX A;  3KLW A;  2NN6 G;  4LF9 Q;  3TS0 A;  4A3L G;  1OXX K;  3KF6 B;  2KHI A;  4Y7N H;  3GO5 A;  1VCI A;  4AYB E;  4JI4 L;  4GNX A;  3HOX H;  1HR0 L;  1VQD A;  2E8G A;  2I5M X;  4H02 A;  1VQO A;  4L5R C;  2CKZ B;  1PH3 A;  4DR3 L;  4OX9 L;  4QY7 A;  5GAG C;  2IX1 A;  4JI0 Q;  4GKJ L;  3S14 H;  4DV4 L;  1D8L A;  1PH8 A;  4JI5 Q;  4BBS G;  2K5H A;  2R93 G;  4IPC A;  2N78 A;  1QUQ A;  3MEF A;  3J81 c;  1N34 Q;  1DGS A;  1G51 A;  1I3Q H;  1FJG L;  5IYD G;  4JOI A;  2PNH A;  4HIO A;  4A3L H;  1KXL A;  1TWC H;  4LF4 L;  3B6Y A;  4DV3 L;  4TVA B;  4JI1 L;  5GQO A;  1BKB A;  3W1B A;  3ZJY C;  2D62 A;  4OON A;  1YZ6 A;  3I4O A;  4R4I A;  3HOX G;  2Q2H A;  5IWA L;  3U58 A;  1KRT A;  4IOC A;  3M7N A;  3KYH C;  1QUQ B;  3IRB A;  4DV0 L;  1CKM A;  4L5S A;  1PYS B;  4R4Q A;  2Q2U A;  3K0X A;  5GAE C;  1EQQ A;  1KC8 C;  3T1Y Q;  2R93 H;  2OQ0 A;  3J7Z C;  1SFO H;  1K9M C;  1VQM A;  2K14 A;  4DUY L;  4P75 A;  1N36 Q;  2I5H A;  2YYZ A;  1BVS A;  1Y14 B;  4DV2 Q;  1Q8K A;  3AQQ A;  4QJF A;  4POG A;  4DR5 L;  1PH7 A;  3I4M G;  1HZ9 A;  3CP0 A;  2A19 A;  1JJG A;  1I94 Q;  4LFB Q;  1GD7 A;  3I2Z A;  1VQ5 A;  1UEB A;  2BA0 A;  3Q8D A;  4LF6 Q;  2NZO A;  4MTN A;  1XPR A;  2NVT H;  2F4V L;  2CWP A;  4A3B H;  2K5V A;  3AFP A;  2VZA A;  3K7U C;  4OO1 I;  1YVC A;  5EAY A;  4JYA L;  2ATW A;  2R7F A;  3HKZ G;  4JI3 L;  1IBM L;  5ELN A;  1WCM G;  1NMF A;  3DM3 A;  4JG2 A;  4HIK A;  4L5T A;  3HOY H;  1S72 A;  4A3C H;  3BU2 A;  1VQP A;  3OTO L;  3HKS A;  4PZ6 A;  3H15 A;  1IBL Q;  2EQS A;  2E2I H;  3EN2 A;  2UUB L;  3PCO B;  1YHB A;  5LMN Q;  4HJ8 A;  4DR4 L;  1XTD A;  1QVG A;  4DUY Q;  1VQG A;  4IFD J;  1XNR L;  4B3S L;  1JJ2 A;  3EBE A;  4GNX C;  1YJ9 A;  1MJE A;  2Y0S G;  4DR2 Q;  4A3B G;  5FJ8 H;  1K83 H;  3ULJ A;  3PO2 G;  3G4S A;  2WB1 G;  2NVY H;  1N33 Q;  4A3I G;  3KF8 B;  3EIV A;  4DR7 L;  1SN8 A;  4LUZ A;  4LW1 A;  2JK8 A;  2YTY A;  1PH5 A;  1HZB A; 
#chains in the Genus database with same CATH topology
 1CKO A;  4RMF A;  3A5U A;  1NSN S;  3JAM L;  1B70 B;  2MUY A;  1ICW A;  3I56 A;  3CC4 A;  1E24 A;  2RDF A;  3HOU G;  2A1A A;  5FO8 B;  1SEB D;  4AYB G;  1X55 A;  2JP1 A;  2WAQ G;  1TWH B;  3BJU A;  2RF4 A;  4POF A;  1A3V A;  2FJ2 A;  5EKK A;  5C3X A;  1QWY A;  4DR7 Q;  3NQT A;  1ZYR D;  4K0K Q;  3A7L A;  3PMF A;  5J3B A;  5JEA J;  4EX5 A;  5TSS A;  1EY4 A;  1EQR A;  5JJL A;  4C3I G;  2X69 A;  2FXQ A;  5IYB G;  1LT3 D;  4DR5 Q;  1D1K A;  4A3F B;  2LSS A;  1JCK B;  4OXP A;  1TY0 A;  1TWF H;  3HOZ H;  3A54 A;  2ID0 A;  1WCM H;  3UDI A;  3IFD A;  1WYD A;  2KEC A;  2QF7 A;  1LT5 D;  3VDY A;  1WCM B;  3CC2 A;  3V2T A;  1RIP A;  4A3K H;  2ZTD A;  3U9S A;  2A69 C;  2VS1 A;  3FRP B;  3MFY A;  3SK4 A;  2PNR C;  2HIV A;  2IX0 A;  2ZJQ A;  1EU4 A;  3DM1 A;  4KKS A;  2EYM A;  2R92 B;  3NTH A;  3M4Y A;  3D6W A;  4GLX A;  3H0G H;  3I4M B;  1OXU A;  1STB A;  4JVZ A;  1TQO A;  3S2H H;  4KHZ A;  5M5W B;  3T1H L;  4DFA A;  1NR2 A;  3QOL A;  4A3K G;  2F1M A;  1Y8N B;  2SNS A;  5F2D A;  1F2M A;  4RGN A;  3BVZ A;  1DCZ A;  2Z6K C;  2XRQ D;  4YCV A;  4HIM A;  2F03 A;  3C3L A;  2B63 H;  5D65 A;  1IYV A;  4R8I A;  1PYB A;  1PTO C;  1I4P A;  4PZ8 A;  2UUC Q;  2XRS D;  4L5Q A;  2PPB C;  5BN3 A;  4FO2 A;  2UUA Q;  1I3Q B;  5E4X A;  1LTL A;  1FVI A;  4JI8 L;  4GOP C;  1PZJ D;  4ULL A;  3ULP A;  3AB9 A;  3K80 C;  2E2I B;  4B3T Q;  5C3E G;  4HMJ A;  1Q1E A;  1CZW A;  2ZXO A;  3PF4 A;  1HRJ A;  3BDO A;  3OIP A;  1MSG A;  3L2P A;  2VL6 A;  1OXS C;  4JYA Q;  4QB4 A;  2FFK B;  2F0P A;  2OF1 A;  4IUN A;  5C4J B;  5KGU A;  4JI5 L;  1VQN A;  1PHJ A;  2K1B A;  3M9B A;  5JPM C;  1Q7Y C;  2EDG A;  4K2K A;  1CA6 A;  4NB3 A;  3I73 A;  3W3A A;  2F0G A;  2F0Q A;  3ICE A;  5I2Y A;  2K5Q A;  1E0B A;  3SK5 A;  1YNN C;  2IY5 B;  4J15 A;  1IYU A;  2B2V C;  1X6O A;  2A69 D;  1EWC A;  1W3S A;  1C48 A;  2LXK A;  3RZD H;  4WRD A;  3KF8 A;  4L6T B;  4IUQ A;  4H0L C;  4A4I A;  3G71 A;  3MC0 B;  2E75 C;  4OWT B;  5JAV A;  5FLX c;  1MHW C;  2RVL A;  2WAQ E;  4IFD I;  4C3H H;  1HNX L;  1GOZ A;  5JVH 3;  3MHB A;  1HXY D;  1TY2 A;  5DEH A;  3MTS A;  3BG3 A;  1VQ4 A;  1H9M A;  5IGF A;  1ENC A;  3JC6 6;  2F3V A;  1E7Z A;  4C56 C;  3S2H B;  4O2D A;  2IT1 A;  1CT1 D;  2CWA A;  2OTL A;  2OEO A;  3C1E A;  1SRU A;  1BO0 A;  1PH9 A;  1B50 A;  2N55 A;  3HOV B;  4X65 Q;  4BY1 B;  4LMQ D;  4DV5 L;  2G5D A;  4A3G G;  1U5K A;  4A3K B;  1H9S B;  4WJW A;  3CCJ A;  4JBM A;  2D0P A;  5E3F A;  4K8I A;  5J1Z A;  4P74 A;  3WOF A;  1EQV A;  5CGK A;  4RGT A;  3KLR A;  1EIY B;  3E0E A;  3GV3 A;  5C4X G;  2QCP X;  5GAD C;  1VQH A;  3T56 B;  1WFQ A;  1F9R A;  3M3Y H;  5K5P A;  1I4R A;  1HQR D;  2VW9 A;  4LK1 C;  4YWL A;  1SXT A;  4XIG S;  4LF7 L;  1HTL D;  1AE3 A;  1SNC A;  3BYT B;  2GA4 B;  1KD1 C;  1CSQ A;  1MIU A;  2H1E A;  4DAY B;  1HJP A;  2A73 B;  2NWG A;  2I07 B;  3S9W A;  3HOU H;  2EOT A;  3AMU A;  2Q2I A;  4QIW B;  4BA1 I;  1JIC A;  3CQZ B;  1DM0 B;  5KND A;  4A3D H;  1YNN D;  3VR2 A;  5T1G A;  2ZXP A;  3OW7 A;  3R2T A;  2WV6 D;  4IO9 A;  3A8J E;  4P73 A;  2NTS A;  4ZKC B;  1VQB A;  1E3P A;  4ZCK A;  1TWH H;  3ND9 A;  2N8N A;  1IL2 A;  3S1M H;  1W2B A;  2P5Z X;  2K01 A;  1NNX A;  2WP8 J;  4DR6 L;  2K5D A;  3GTL H;  1CTM A;  2MP1 A;  5C4J H;  1LTT D;  1HNZ L;  4KK7 A;  5CBA E;  3F2C A;  4DF7 A;  4PMB A;  2E5L L;  2MHV A;  5C6A A;  2BDN A;  1XXG A;  3FKI H;  2R7Z H;  2AQ2 B;  3ERS X;  3IL8 A;  4QL5 A;  1BBX C;  5C4H A;  1T9H A;  1ONL A;  4BWG B;  4K14 A;  1GHJ A;  3CPW A;  4TRD A;  1XYI A;  1HNZ Q;  2QIL A;  4P71 A;  3F2B A;  3A8K E;  1I6H B;  2K04 A;  4DV6 L;  2YU9 H;  2R92 G;  2I5L X;  3M4P A;  4DR4 Q;  3VYS A;  3BZC A;  4NP5 A;  1KIX A;  1QVC A;  2DNE A;  3NP8 A;  2NVT B;  3I3C A;  4R4C A;  1IBL L;  4DPG A;  4HJ5 A;  2R7D A;  3W1G A;  3P75 A;  1VQA A;  1ROD A;  5M5Y B;  1LO5 D;  4JI8 Q;  2JEA I;  4IUV A;  2UU9 Q;  4GLA C;  4N8F A;  2F3W A;  1N32 Q;  1H9S A;  4Q0F A;  4R8N A;  2D9U A;  1H9K A;  4IJH A;  3CCQ A;  5EPJ A;  1TS2 A;  2B3G A;  1MJC A;  3OMC A;  4ODG A;  2LY7 A;  1TWF B;  1Y1V H;  2PW7 A;  1PRT D;  2NTT A;  5IP9 G;  2ALY B;  2K33 A;  4OWW B;  4RG1 A;  1NE3 A;  3FP9 A;  2EIF A;  5BN4 A;  3VYU A;  1Q81 C;  1AZP A;  5E7N A;  1EIF A;  3TS2 A;  1H95 A;  4KMU C;  4NXN Q;  1IBM Q;  5M3M H;  2Z0S A;  4QMG A;  2JA5 G;  1FD7 D;  4OX9 Q;  2WB1 B;  1EYG A;  4DV4 Q;  3URY A;  1Y1V G;  3SE0 A;  2F0V A;  5FOB B;  2ZT9 C;  3HOV H;  2HQL A;  1LAC A;  1YIT A;  1T5X D;  5IP9 H;  5JEA H;  2HDL A;  2R61 A;  4X66 Q;  3GTK B;  1V8Q A;  3PSI A;  4IQZ A;  5BN5 A;  2A68 C;  1HNW L;  5BR8 Q;  1KNA A;  1RTN A;  3N52 A;  4FYD A;  3HOY B;  4XQQ A;  4AYB E;  4PQX A;  1PTO H;  3HS0 C;  2B2U A;  2M2L A;  1SYE A;  1ZKO A;  1VF5 C;  4JI5 Q;  2XN9 C;  1EFI D;  2Z1C A;  4IPC A;  3H3V C;  3S14 B;  1DGS A;  2ZXR A;  4HIO A;  4HSP A;  1TWC H;  4EQO A;  1KXL A;  2E74 C;  5GQO A;  1BKB A;  3W1B A;  3ZJY C;  3K57 A;  4OON A;  4EQN A;  5IWA L;  3K0Y A;  1KRT A;  3IRB A;  3K0X A;  1EQQ A;  4KV6 A;  2RDG A;  2IW3 A;  4G7Z C;  4XT1 B;  2K6A A;  1A3T A;  2YYZ A;  3UI2 A;  3MWY W;  4PMC A;  4XXE A;  1Q8K A;  4DV2 Q;  4UHV A;  3I4M G;  1JJG A;  3X3M A;  4LFB Q;  1PRT C;  1GD7 A;  3I2Z A;  2B39 A;  2BA0 A;  3FVQ A;  1VQ5 A;  1XPR A;  3AFP A;  3K7U C;  4OO1 I;  1YVC A;  1SNQ A;  2R7F A;  4MN3 A;  2WII B;  1WCM G;  2EJF C;  1I6V C;  1S72 A;  3TME A;  3J7A F;  3DXJ C;  2K05 A;  3H15 A;  4DK1 A;  4DAV A;  4ID6 A;  2SOB A;  4GNX C;  2Y0S G;  4DNR B;  3TSS A;  1RKN A;  4KD4 A;  1B44 D;  4A3I G;  3KF8 B;  1N33 Q;  4K5V A;  2A68 D;  2YTY A;  1HA6 A;  3PUV A;  3H0G B;  4DV2 L;  3HKZ E;  1JB7 A;  3IAY A;  2KBN A;  1G2S A;  1KAW A;  1SJH D;  2PZW A;  1JWU D;  1B3Q A;  2DGY A;  1U4L A;  1SNO A;  4ZUJ A;  1P8L A;  3S1N B;  2B2Y C;  1VQK A;  1B7Y B;  1HNX Q;  4BY7 H;  3SXH A;  2UUC L;  5IWA Q;  4JC0 A;  4ZYS A;  4RKB A;  1J5E Q;  5I9P A;  1LTB D;  4KY6 A;  4IPD A;  2CQO A;  3TP5 A;  4CDF C;  5I9O A;  2NUC A;  1VQ8 A;  4RGM A;  4OIJ A;  2BE5 D;  5DM6 3;  3CD6 A;  5ELO A;  1I6H H;  4GN4 B;  4LWC A;  4C2M B;  2C5C A;  3D0F A;  5C3E H;  1S40 A;  1HPC A;  4LAA A;  4KI0 A;  5H1S E;  3NWT A;  4CDE C;  5JPN C;  2XTI A;  1PRT F;  3RR5 A;  3K59 A;  5A35 A;  2NYZ D;  1VQ6 A;  1HFN A;  3PUZ A;  3CCR A;  1XMO L;  5IY0 A;  2H4O A;  3FKI B;  1J5E L;  1Q12 A;  3I55 A;  4A3I H;  2JXM B;  2JN4 A;  2NZ1 D;  2UXD Q;  5A2Q L;  2HIX A;  4XTC S;  2D5D A;  1KQS A;  2O5I C;  3NTK A;  2BCO A;  2I46 A;  2D2C C;  4K6D A;  4X3K A;  4R9W A;  3KJP A;  2PZU A;  4CKC A;  1TWG H;  1JOQ A;  3K5N A;  2C9O A;  1IL8 A;  2E2D C;  1VQF A;  3L0O A;  4BY1 G;  2UXB L;  4HR7 B;  3J81 j;  3M85 A;  4ZAI A;  4PMW A;  1BBW A;  4KHP Q;  1E22 A;  4NXM L;  2IWH A;  3RNU A;  3T1Y L;  2HCC A;  1PH2 A;  3CCV A;  5JVG 3;  1BDO A;  1P16 A;  3RD4 A;  5FLX E;  2Z4H A;  2RSO A;  1VS0 A;  3MAQ A;  1RTO A;  4AH6 A;  5GRO A;  2RHS B;  1SNM A;  1EOV A;  3QOJ A;  3CCE A;  5AFW A;  2UXC Q;  1V1Q A;  4XYO A;  1JC7 A;  3OPO A;  4WOR A;  1HUN A;  4FF3 A;  1U4P A;  1JB3 A;  4A3M H;  1X3Q A;  4A3G B;  1JT8 A;  2X6L A;  1D5Z C;  1Y69 U;  3QO2 A;  1JR0 D;  1DXM A;  1CHP D;  1UE1 A;  4MNO A;  4A3E G;  1K83 B;  2KA7 A;  3J80 L;  2UUA L;  4HTH A;  4DV6 Q;  2JA9 A;  2L1B A;  4IFD H;  2PO4 A;  4KKU A;  3HZX A;  3MZ5 A;  2RSN A;  4QUF A;  3GTG H;  3HOY G;  2V4D A;  3P7J A;  1TU2 B;  2L9H A;  1CQF A;  5D3I B;  5FO7 B;  1VF7 A;  1Z6H A;  1LM0 A;  2PQE A;  3S1R H;  1ZXT A;  1MD2 D;  1WD1 A;  4YY3 Q;  1FGB D;  4NKL A;  3S16 B;  4LFB L;  3ITP A;  5CV8 A;  1R9T H;  3TQY A;  3WDN A;  1WTV A;  4E6I A;  1V43 A;  2EY1 A;  3TZD A;  4LF8 Q;  2DJF C;  2PCF B;  3S16 H;  3HKZ B;  4NPS A;  1HHV A;  3UDX A;  3X3N A;  2IL8 A;  4NW2 A;  5IP7 H;  3I72 A;  1AW7 A;  2A6H D;  2KCC A;  3LWE A;  1PZI D;  1C0A A;  2PMZ E;  2VQE L;  3I4N H;  2R93 B;  1I4G A;  1GUW A;  4DR6 Q;  1KAB A;  5AJ3 Q;  3S17 B;  4X66 L;  4P2C B;  1WI5 A;  3GTG B;  1Z47 A;  1E2W A;  4X3S A;  1HCZ A;  5C44 B;  1NUC A;  2UXC L;  3RUZ A;  1QG7 A;  3SK6 A;  1FR3 A;  1ZYR C;  3T13 A;  4X62 Q;  1ILP A;  4JCV E;  4FF1 A;  5KEE A;  1A62 A;  4DR3 Q;  1RL2 A;  4A3E H;  1R4Q B;  2JA5 B;  4C3I H;  1ILQ A;  2QDL A;  4A75 A;  2F52 A;  1SAP A;  1YHQ A;  4JBJ A;  3CMA A;  4BBR H;  3MA2 B;  3CXC A;  1H9R A;  3E5S A;  4UP8 A;  1E1O A;  4IPG A;  3MFG A;  4DR1 L;  1Q3L A;  4C1N K;  4UP9 A;  1A3U A;  1G29 1;  4R4O A;  4CBV A;  2EYH A;  4DV0 Q;  4O42 A;  2XWJ B;  2XGT A;  1XX8 A;  2VB2 X;  4C1N I;  5BR8 L;  5C44 G;  3T16 A;  1V1P A;  3T1H Q;  3H0G G;  4CKB A;  4DV5 Q;  3UE1 A;  4EGV A;  2EXZ A;  1IHZ A;  4LFA Q;  3M4O B;  4CGY B;  2IJ0 A;  2B63 B;  2R6G A;  1GUT A;  4GN5 A;  1UE7 A;  3STB C;  1E1T A;  4HCE A;  2RKS A;  2GVB A;  3A55 A;  1I4Q A;  1O7Y A;  1FL0 A;  2ENB A;  1WTW A;  2DN8 A;  1J8I A;  2YV5 A;  3K5L A;  3S2D H;  3PGZ A;  1BCP B;  2JA7 G;  2EY5 A;  3I4M H;  5ELF A;  5IYC G;  4KTA A;  4QCL A;  1F2L A;  3BS1 A;  2WAC A;  1LUZ A;  2WIN B;  3HRZ C;  2KEN A;  1K8O A;  1STG A;  2ZM6 Q;  1G6P A;  2Q8R E;  2PQA A;  3Q6S A;  5IOC A;  4QF4 A;  3HOW G;  2K52 A;  4LFC Q;  1L2F A;  4C3I B;  1N9W A;  2NVQ H;  3UDG A;  1X3E A;  1W6J A;  3W5O A;  2OXP A;  2VXW A;  3FKI G;  3PIP A;  3MXP A;  4N9T A;  3CCM A;  2D0O A;  5C44 H;  1AP0 A;  1QZG A;  4JOI C;  3M7G A;  1HR0 Q;  1K28 A;  1F77 A;  3KLS X;  1KL9 A;  5C0X H;  5DLQ E;  2XSC A;  2RHQ B;  3T53 B;  2VQF L;  1DD2 A;  4OGQ C;  3U4Z A;  4IOA A;  1KLG D;  3AYH B;  3FDT A;  2AWO A;  1EY0 A;  3NBH B;  4NDX A;  1I50 H;  3MXG A;  2B8F A;  4DK3 C;  3CHB D;  1Q1B A;  2JE6 I;  1RDP D;  1X3F A;  3TEH B;  1ASZ A;  1PV4 A;  4S3S A;  5DAU A;  1VQE A;  4B3R Q;  3VYT A;  3STB D;  1VQI A;  1IBK Q;  1DJR D;  3VR4 A;  4DNI A;  2E5L Q;  3GDE A;  4LUV A;  3HOV G;  4JI6 L;  1JOR A;  3A7A B;  1X3P A;  4DXF A;  1TWA H;  1OO9 B;  2CH4 A;  2RCN A;  4XQJ A;  3J7Y W;  2AMC B;  2A74 C;  3PF5 A;  1SE4 A;  4X6A H;  2MFI A;  2JA7 B;  1EY7 A;  1EEF D;  1U4M A;  1EY9 A;  2PI2 E;  1M8A A;  4DAY A;  1EZ6 A;  1Y8P B;  3EA6 A;  2JSO A;  4A76 A;  2XIW A;  2IX3 A;  4HN7 A;  1L1O C;  2KHJ A;  2AQ3 B;  2PZT A;  1L0W A;  4HCS A;  2B2W C;  1X56 A;  1SR3 A;  2EE1 A;  4GLV B;  2MJ8 A;  1HTP A;  3PO3 H;  4Z9C B;  4B3M L;  1UE5 A;  4YWK A;  5G3L F;  4CJ0 B;  3E3X A;  2CVR A;  4KN4 C;  3KLW A;  4A3L G;  3KF6 B;  2F0F A;  5LL6 X;  2NVY B;  3GO5 A;  1KNE A;  1A2T A;  4JI4 L;  1HR0 L;  2E8G A;  4H02 A;  2CKZ B;  4UAI A;  5GAG C;  4N9P A;  2IX1 A;  4JI0 Q;  4GKJ L;  3F2U A;  3S14 H;  1TT2 A;  3U9O A;  1SE3 A;  4A3E B;  4V0B A;  5C4X B;  3MEF A;  4ZUI A;  1N34 Q;  1I3Q H;  3I70 A;  1FJG L;  1LT4 D;  2F0E A;  2KEE A;  2PNH A;  3OSO A;  1G6Z A;  1DZ1 A;  2D62 A;  3SEB A;  2KCN A;  1YZ6 A;  2EZV A;  3U58 A;  2AQ1 B;  4RWS C;  4K6L A;  4IOC A;  3M7N A;  1M4V A;  1QUQ B;  2HUG A;  4L5S A;  4R4Q A;  5GAE C;  3CRK C;  2R93 H;  3J7Z C;  4RHS A;  2RCF A;  1SFO H;  1MGS A;  1K9M C;  3MEH A;  4DUY L;  4P75 A;  1N36 Q;  4F87 A;  1BVS A;  3D4D A;  2F0L A;  4DR5 L;  1LTA D;  1HZ9 A;  3CP0 A;  3J80 E;  3EQL C;  1UEB A;  3Q8D A;  3NPP A;  3Q24 A;  4XQN A;  2AUK A;  3OWF A;  1G8Z D;  2VZA A;  2HQE A;  5EAY A;  3NBH A;  3HOX B;  1IBM L;  1GXD C;  5I6W A;  1II3 A;  3KBG A;  3D4R A;  4OO1 H;  3OTO L;  3HKS A;  4C3H B;  2UUB L;  4J8Q A;  1YHB A;  5LMN Q;  1VQG A;  4B3S L;  3EBE A;  5IGG A;  1YJ9 A;  2F0O A;  3V05 A;  1K83 H;  3K5O A;  3OMG A;  2L5T A;  3PO2 G;  4JK1 C;  1SN8 A;  3GV6 A;  1ET6 A;  4X65 L;  1PH5 A;  3EVQ A;  1RCV D;  4PZ7 A;  4DV7 L;  1O80 A;  1K8M A;  3DWQ A;  2BH8 A;  3CRL C;  4A3M B;  2ES2 A;  3MXU A;  1XMQ L;  4L8J A;  3E9I A;  1LYL A;  1KRS A;  2VNU D;  3OTO Q;  4Y52 H;  4H13 C;  5M5Y H;  2NN6 I;  4AQY Q;  3HGB A;  4UY8 C;  1WJJ A;  4RKL A;  3E6Z X;  5JJZ A;  5HUR A;  4DAM A;  1NMG A;  2VQE Q;  2JQO A;  1N33 L;  1EY8 A;  5K36 G;  1B3A A;  1TII D;  1J9O A;  2TMP A;  3OWE B;  3TZU A;  3JAM i;  4ILW A;  1NJI C;  3DLL A;  5KNC A;  4WFN 3;  1PFS A;  4J6H A;  1QNK A;  1AZQ A;  1ENF A;  4BY7 G;  4ZKB B;  3CF5 A;  5LMU L;  5C5M A;  1E2V A;  3QG1 A;  4LFA L;  1QE6 A;  2ZTC A;  1HUM A;  5I6Y A;  4A3M G;  2ZJP A;  3MVV A;  1NTG A;  1EY6 A;  3R3O A;  3CPF A;  2R7Z G;  2UXB Q;  1EYA A;  3GTJ B;  4LJZ C;  2O5J C;  1EL0 A;  4K8J A;  5T1I A;  1BNZ A;  3O13 A;  3DEO A;  3J80 i;  3HOW H;  1GVP A;  4HMI A;  4O1N A;  1I4H A;  3NUC A;  1SJE D;  4YHH Q;  4JI0 L;  4GKJ Q;  4ZQ3 A;  4A3J G;  2KQ3 A;  2N3S A;  1YIJ A;  3I7F A;  4JI2 Q;  1B1Z A;  3RLO A;  4JI4 Q;  1WVL A;  4JV5 Q;  1CKN B;  4NMZ A;  5IE8 A;  2KCM A;  5ELE A;  5IGC A;  2CCZ A;  3I4L A;  3FHW A;  2HCI A;  2R92 H;  2SDF A;  4DV1 L;  1WTQ A;  3A5Z B;  3KLS A;  3QR8 A;  4AQY L;  5AJ3 L;  4ME5 A;  3FPP A;  3R8B A;  1MI2 A;  4LUO A;  4BBR B;  4A3B B;  3M3Y B;  3GTQ B;  4DU9 A;  1CZG A;  2IHF A;  4EVO A;  4GOP A;  1LTR D;  4DUZ Q;  4FXK C;  1O7L A;  1GKH A;  1UEA B;  4JBW A;  5I4D A;  2GN5 A;  3PUY A;  4R4T A;  5CYU A;  3VA5 A;  1WTR A;  4HJ9 A;  2Q8I B;  3J7A 5;  4WJ4 A;  2K4K A;  4LF8 L;  3S17 H;  4FF4 A;  3GTP H;  1Y1W H;  4GKK L;  3K81 C;  4JPB W;  1Q46 A;  4TSS A;  3GD7 A;  4UPA A;  1JQY D;  4DV1 Q;  3J80 c;  1PXU A;  4LF4 Q;  1XWE A;  2CW0 D;  1YBY A;  3PQI A;  5M9O A;  1XNR Q;  1SND A;  1X3G A;  1EOT A;  2E2J H;  4FXG C;  4BBR G;  2LS0 1;  1L1O B;  2QEJ C;  5J39 A;  2WKC A;  3WOE A;  1I5F A;  1X54 A;  4A3C G;  1Y1W G;  3WWV A;  2VQF Q;  2UXD L;  3QJY A;  4DKA C;  2J7Z A;  1QIL A;  1VQL A;  1K3R A;  4QUC A;  3KUP A;  2KCT A;  1I94 L;  4IFD G;  3RLN A;  1ENA A;  1QOH A;  4M1U B;  1U0L A;  1IYJ B;  1HFG A;  1SRO A;  1EYC A;  3A56 A;  5G3L D;  2KOL A;  3ERO A;  4HJ7 A;  4RA8 A;  4TQU S;  3PV0 A;  2OT2 A;  4LF6 L;  3D31 A;  1HNW Q;  1N32 L;  3G6J B;  4P72 A;  5IT9 E;  4KHV A;  4K0K L;  4QIW E;  5NUC A;  2WFW A;  1VQ9 A;  1OTC A;  1LTS D;  2K28 A;  1Z9F A;  3CC7 A;  1SDF A;  5EKI A;  4BBS H;  1AFP A;  2ZTE A;  1S3O A;  4H44 C;  4YIJ A;  3GTJ H;  1PDQ A;  4YCU A;  4DUZ L;  1QNU A;  1MBY A;  1TS5 A;  2JA7 H;  2ZJR A;  5C4Z A;  1BUV T;  2VUM H;  3GTO B;  3K5M A;  1XMQ Q;  2IHE A;  3NSW A;  2NVX B;  4DV7 Q;  3T4A C;  4OWX B;  1EYD A;  2QDB A;  4K5X A;  1BXT A;  1K3B C;  4A93 H;  4CDC C;  4U68 A;  1BCP D;  1SBB B;  2PQA B;  1PFB A;  3QB3 A;  5C3W A;  3GTK H;  3DMU A;  4RAU C;  2CW0 C;  3E9H A;  3TRE A;  2CFM A;  4GOP B;  3T51 B;  3TP7 A;  2G9D A;  3Q23 A;  4Y7N B;  4PNY A;  1Y1W B;  1IKM A;  3GTP B;  4OO1 G;  2PI2 A;  5M3F G;  4A93 G;  1SYG A;  1PH1 A;  5J22 A;  3ZYY X;  4O0A A;  3TP6 A;  2MNA A;  1NBW A;  3N6R A;  5E4W C;  1XNQ L;  4F8M A;  3J7A V;  2F0T A;  4ZLT F;  5M5W H;  2B2V A;  2KJX A;  1XJV A;  1UE6 A;  5JJK A;  1C7Y A;  4I65 A;  3LX0 A;  1JJC B;  5CV7 A;  1B53 A;  4DK6 C;  4C2M H;  4IUU A;  1C9O A;  5CV5 A;  1MSH A;  4ZRZ A;  3KOJ A;  1QZH A;  1YJW A;  2VUM G;  1QCB D;  2L15 A;  1A6X A;  1NAP A;  4B3T L;  3R2I A;  1SMY C;  2NBF A;  5ELC A;  5JJI A;  2L0C A;  1GUG A;  1D7Q A;  2F4V Q;  4B08 A;  3A0J A;  3GP7 A;  3GTQ H;  1YNX A;  3KJO A;  1G2T A;  3CU7 A;  3ER0 A;  5FO9 B;  2KED A;  3OIQ A;  3C2P A;  5C5L A;  2FMC A;  5IIF A;  2F0N A;  4AIM A;  3U4V A;  3DEP A;  5LMN L;  1F9P A;  5A2Q E;  4IJL A;  3GQB A;  4BXX G;  2K03 A;  4JBK A;  1BQQ T;  4U67 3;  4APV A;  1TS4 A;  1CKN A;  5LMU Q;  3G48 A;  1HZA A;  3CW2 C;  1BCP C;  2PW5 A;  2BA1 A;  3NXW A;  2F0D A;  2K75 A;  1H9J A;  1B2T A;  2F0W A;  1YEZ A;  2KUM A;  2EY6 A;  1SYF A;  4DK0 A;  2K5N A;  3K7A B;  1FNU A;  4A93 B;  1Q82 C;  2R7Z B;  4PG3 A;  2F4I A;  4B9X A;  5ELB A;  1LLR D;  5KIX A;  5M5X H;  2L55 A;  2PMZ B;  4A3J H;  3NTI A;  1EQT A;  1XNQ Q;  2OCE A;  3ND8 A;  1XMO Q;  1K73 C;  2A6H C;  1V1O A;  1SE2 A;  2B2Y A;  2C35 B;  4EQ5 A;  4C3J H;  4UDU C;  3C1F A;  1X65 A;  4EQP A;  3FPU B;  4F7X A;  4MZ9 A;  5C0X I;  4YY3 L;  3F8T A;  4LF9 L;  3KBX A;  5CR3 A;  1S4Z A;  2VY3 A;  2HHH L;  4FXD A;  1NY4 A;  1RD9 D;  2JA8 H;  3GTO H;  4BA2 I;  4KHP L;  2ICE C;  2Q2T A;  1FJG Q;  3RN2 A;  3D4W A;  4R1J A;  3CME A;  4FDB A;  2XNA C;  3PO3 B;  1WOC A;  2DY7 A;  1Y8O B;  1SMY D;  2F0H A;  3I91 A;  1B9N A;  4RCN A;  3HOU B;  5E1F A;  4KN7 C;  1AEX A;  3UE0 A;  4YCW A;  1BOS A;  5EKL A;  2F3I A;  2AHO B;  1QB5 D;  1VQJ A;  1U9R A;  1SMX A;  1E2Z A;  2NN6 G;  4X3U A;  3TS0 A;  1JWM D;  3HG9 A;  2KHI A;  4MHE A;  3SHL A;  5IT9 L;  1RJT A;  4GNX A;  3HOX H;  1VQD A;  2I5M X;  1VQO A;  1PH3 A;  4DR3 L;  2Q8T A;  3NQI A;  2L11 A;  2VB3 X;  4DV4 L;  1PTO D;  1QJO A;  4BBS G;  1UNS A;  1Q90 A;  4IUT A;  2E2J B;  4G7H C;  2HDM A;  3J81 c;  1G51 A;  3NE5 B;  1SYB A;  1R9T B;  1GUS A;  4A3L H;  1F2Z A;  3B6Y A;  5EQ0 A;  1JE4 A;  3I4O A;  1IW7 D;  2N88 A;  2Q2H A;  1S5D D;  3E0J A;  3S1R B;  3FEW X;  5ISR A;  1RF2 D;  1JWS D;  1CKM A;  1LT6 D;  1I50 B;  3T1Y Q;  1UAP A;  2K14 A;  1A2U A;  2I5H A;  3VA7 A;  1PZK D;  1Y14 B;  3AQQ A;  4POG A;  2E2H B;  1SNP A;  2LKV A;  1PFM A;  3P20 A;  2CWP A;  4A3B H;  2K32 A;  1O7Z A;  2F0S A;  4JYA L;  4CDD C;  5CBE E;  4JI3 L;  2EPB A;  1NMF A;  4JG2 A;  4HIK A;  4L5T A;  1EU3 A;  2NB0 A;  4DN4 M;  1VQP A;  2TSS A;  1IBL Q;  2EQS A;  3EN2 A;  2L4N A;  3PCO B;  1C4Q A;  2B2T A;  4HJ8 A;  2F0U A;  1XTD A;  3IFT A;  1QVG A;  5EBD A;  1I4X A;  2DJG C;  4A3B G;  3D3R A;  3ULJ A;  1SYD A;  1D5X C;  2NVY H;  4DR7 L;  1CFM A;  4GZY C;  3EIV A;  4OEM B;  4A3J B;  4LW1 A;  2JK8 A;  4DAP A;  5CC4 A;  3HOW B;  1HZB A;  2QGQ A;  3L9A X;  4H7B A;  2CQA A;  2YU9 B;  2ZM6 L;  4X3T A;  3HP3 A;  2L12 A;  4L63 B;  4LFC L;  5IOD A;  4I7Z C;  1HA5 A;  1YJN A;  5HY6 A;  3NK9 A;  2J4X A;  1BBU A;  1O78 A;  5LMN W;  1F9Q A;  1O7I A;  4LF5 L;  1D2B A;  4FF2 A;  2F0K A;  2J0T D;  5EGT A;  1PRT B;  1DOK A;  1VQC A;  4X64 Q;  5HGT A;  1AN8 A;  2N49 A;  3MXN A;  5KNB A;  4J1M A;  3M4Q A;  4KJO A;  1FYC A;  2LFN A;  4DR2 L;  1ML0 D;  1IW7 C;  3BZD B;  1KDC A;  3CCU A;  1J6Q A;  1Z7T A;  4LNQ A;  3NEL A;  3PIO 3;  3NEM A;  3SK8 A;  3D6C A;  1EZ8 A;  1IXR A;  1XPO A;  2FMM A;  3KF6 A;  3J81 E;  1RHP A;  3S1M B;  4A3F G;  2K5W A;  2HD3 A;  1Q8I A;  1K8A C;  2B2T C;  2FHT A;  1GHK A;  1L0Y B;  2UUB Q;  1QVF A;  1ZEQ X;  4DXG A;  4LF5 Q;  5L37 A;  4NXM Q;  3PO2 H;  3H6M A;  1N8R C;  4IN3 A;  2JEB I;  1JMC A;  4A3D G;  1PVO A;  4CHT B;  3PUW A;  1M1K C;  1AE2 A;  2MO1 A;  5HGQ A;  4B3R L;  1KHI A;  4ABN A;  1S5F D;  4V19 0;  2E2H H;  3NEN A;  4YWM A;  2Z8L A;  3BVM A;  3PUX A;  3J81 L;  2NVQ B;  3JAM c;  2HHH Q;  1Q86 C;  3S1N H;  4HJA A;  2Y0S E;  2QEX A;  2I0Q A;  2B8G A;  3G6E A;  1VDZ A;  4XYQ A;  2G9H D;  2H5X A;  1TVX A;  3TP8 A;  3TBI B;  3ULL A;  3F2D A;  3FMC A;  3KDF B;  5K36 H;  4XT3 B;  4JI1 Q;  1S5E D;  2F0I A;  2YTX A;  3K8A A;  5M3M G;  4DNT B;  4X64 L;  2GVA A;  3OW2 A;  4WJ3 M;  3S2D B;  1PTO F;  1SSO A;  1STN A;  1X32 A;  4QQB X;  2AWN A;  1KLU D;  1EWH A;  1YI2 A;  1WD0 A;  5EJW A;  2B63 G;  1NR4 A;  5DNF A;  5CV6 A;  3GTM H;  1N36 L;  5EBC A;  5D14 A;  5IGD A;  3SGI A;  4GN3 B;  4CKE A;  2F0J A;  3J81 i;  5KYL A;  4TKO B;  2NVX H;  3H94 A;  4ME3 A;  1N34 L;  3P1H A;  4HED A;  1EWI A;  4A3G H;  1GJX A;  1STA A;  2A8V A;  1DON A;  3BDL A;  4RHR A;  2EJG C;  2QW7 A;  2EVB A;  3H3V H;  1PYW D;  2SEB D;  1IBK L;  1TXY A;  1SFO B;  1TWC B;  1U4R A;  3K58 A;  1AH9 A;  3ERQ A;  4MTK A;  1CUK A;  5C4X H;  1PH4 A;  3VR6 A;  1B8A A;  4DV3 Q;  1OXV A;  3SDZ A;  3RLF A;  1PLF A;  2K7V A;  2Z4I A;  5IP7 G;  4GNX B;  2OTJ A;  1GO3 E;  1XPU A;  1W6K A;  2KHS A;  1ICF B;  3KFU A;  1R4P B;  1DOL A;  3MXN B;  2QKI C;  4CJ2 C;  1A63 A;  3LWU A;  1JE5 A;  3NWS A;  3A74 A;  1VMC A;  1CM9 A;  1XTC D;  2F0M A;  1G91 A;  1K0R A;  3RN5 A;  1EIG A;  4JI2 L;  5COR A;  1SLJ A;  2BOS A;  5FLX L;  1EFW A;  5JOB A;  1SYC A;  2EJM A;  4GKK Q;  2EXD A;  2RQX A;  2MQH A;  2EYL A;  2O2L D;  5FLM G;  4FP5 D;  3UDF A;  5IGE A;  2DNC A;  3AEV A;  3U50 C;  5M5X B;  4IAL A;  4ALP A;  1BR9 A;  1A0I A;  2EYJ A;  2WAQ B;  3TN2 A;  3K7A H;  1HH2 P;  2CH4 W;  4JI6 Q;  3RZO H;  5M3M B;  5CMD A;  4N8X 1;  2BDO A;  3K6O A;  1MKH A;  2JA8 G;  2MO0 A;  5ELD A;  4XDX A;  1STH A;  1TWA B;  1PFN A;  4B3S Q;  2LMC B;  2OQK A;  5KRU A;  2RA4 A;  3H3V I;  1LAB A;  4IPH A;  2CHB D;  1IKL A;  1D6E C;  5C0X J;  3Q0A A;  3S1Q H;  1B4O A;  2IPK D;  5JEA G;  4FVM A;  1FNW A;  5FJ8 G;  4ZK9 B;  5DM7 3;  3S24 A;  3PO3 G;  5IT9 c;  2JA6 B;  1NCV A;  1IZ6 A;  1F2Y A;  3F1Z A;  1D5M C;  5COY A;  2Y0S B;  4KD3 A;  4I7A A;  3S15 B;  2KVM A;  4IUR A;  3DHQ A;  5KYI A;  5M3F B;  1VQ7 A;  3CCS A;  1ET9 A;  4Q5V A;  3C46 A;  2ASB A;  2HT1 A;  2WB1 E;  1KDA A;  4IZ8 A;  4C3H G;  4BXX H;  4BY7 B;  4IUP A;  2YTV A;  5IYD H;  1UWV A;  2MGS A;  2SNM A;  3I4N G;  4JI7 Q;  3PO2 B;  4RCO A;  1GM5 A;  4BS9 A;  1V1P B;  5CV4 A;  1K8G A;  2JA6 G;  1A15 A;  2V1C C;  4AYB B;  2M9V A;  5LHY 1;  2M00 A;  3VR3 A;  3Q22 A;  1EUJ A;  4HID A;  3HOZ B;  5M3F H;  3PIO A;  2LXJ A;  4DGZ A;  3DWP A;  4A3F H;  3OHX C;  2B2W A;  2A6E D;  1YNJ C;  3NHH A;  4NXN L;  2UU9 L;  1TWG B;  4YHH L;  1LTI D;  1SE8 A;  2JA6 H;  2EYO A;  4M8A A;  3G7L A;  4KJN A;  4X62 L;  1KAA A;  4KKT A;  3VYR A;  3S1Q B;  4OEL B;  4QGU A;  2RDH A;  3CKI B;  5CV9 A;  4JV5 L;  2AKW B;  1HR0 W;  3L3O C;  4B9W A;  2A5H A;  4MIU A;  1YHA A;  3OOC A;  2OWO A;  2B29 A;  4KY7 A;  4JW0 A;  3I90 A;  3AFQ A;  2BH2 A;  1HZC A;  5IYB H;  1JOK A;  1BCP F;  3M4O H;  4DR1 Q;  2NZH A;  3W2D A;  1C8C A;  1M90 C;  3EFX D;  2ICI A;  4KLK A;  1ESR A;  5I2X A;  3A8I E;  3IKJ A;  5LL6 S;  3TRZ A;  1EEI D;  2FIN B;  2JJQ A;  3AU7 A;  1T5E A;  1OXT A;  1A8V A;  5C3E B;  3BYY B;  3H91 A;  4A3I B;  5FKA C;  4JI7 L;  1F9S A;  4BBS B;  3JAM E;  3KDF A;  1WTP A;  3PIP 3;  1S5B D;  1UUP A;  2QA4 A;  1TKW B;  1DYQ A;  1DOM A;  3CQZ H;  4GS3 A;  4A3D B;  4B3M Q;  5IYC H;  2E76 C;  5FLM H;  1L1O A;  2BE5 C;  2Z6K A;  2JA5 H;  1VMP A;  1CSP A;  3LNN A;  3V96 A;  1ESF A;  5IGB A;  3HOZ G;  2O4X A;  3QWN A;  1BF4 A;  4BY1 H;  1V9P A;  1WTX A;  2DY8 A;  3BVG A;  1FGU A;  3BZK A;  1X9N A;  1KTK A;  1TR5 A;  3KK7 A;  3L7Z C;  1STY A;  5FK9 C;  2B2U C;  1LV9 A;  1EY5 A;  2A6E C;  1ASY A;  4JI3 Q;  1YNJ D;  4RH6 A;  1STE A;  1PA6 A;  5GAH C;  3I4N B;  2EY2 A;  3HFZ B;  4UP7 A;  2EYP A;  4C3J G;  2K50 A;  2RBM A;  3CCL A;  3GTM B;  1GUO A;  4HSV A;  1B9M A;  3D8G A;  3EJI A;  4RFB A;  1PH6 A;  5C0X G;  4LF7 Q;  3CAM A;  3LGJ A;  3OYY A;  1Y1V B;  1GUN A;  2DUD A;  3S15 H;  1CHQ D;  4LF9 Q;  1OXX K;  2MPM A;  5D3D A;  4Y7N H;  1VCI A;  4L5R C;  4OL7 A;  4OX9 L;  4QY7 A;  4OHJ A;  3SR1 A;  1D8L A;  1WTO A;  1PH8 A;  2K5H A;  2R93 G;  3R93 A;  2WKD A;  2JYO A;  2R3Z A;  2N78 A;  1QUQ A;  5IYD G;  4JOI A;  1K0S A;  2NN6 H;  1FNV A;  4RGO S;  4LF4 L;  4DV3 L;  1CQV A;  4TVA B;  4JI1 L;  1L0X B;  3RMH A;  3HOX G;  1HQM C;  4R4I A;  3RZO B;  4G57 A;  3RZD B;  3SVM A;  3H09 A;  3KYH C;  4DV0 L;  1PYS B;  2VUM B;  2Q2U A;  2XVS A;  2AUJ D;  4CJ1 B;  1KC8 C;  2JA8 B;  2OQ0 A;  3ONA B;  5EPL A;  3QIA A;  1VQM A;  1JOO A;  1CI3 M;  2XWB B;  2Z6B A;  4KY5 A;  3HEJ A;  2EYF A;  4K5W A;  4FNF A;  4QJF A;  1PH7 A;  4G7O C;  2X6G A;  3VR5 A;  2A19 A;  1EIH A;  1I94 Q;  4LF6 Q;  4F88 A;  1WTH A;  2NZO A;  4MTN A;  2NVT H;  2F4V L;  3TDQ A;  2K5V A;  1PTO B;  4OIK A;  3I8Z A;  2ATW A;  3HKZ G;  3NBI A;  5ELN A;  3DM3 A;  5EPK A;  3HOY H;  1D1I A;  3BU2 A;  4A3C H;  4C3J B;  4PZ6 A;  3DWA A;  2E2I H;  4K2L A;  4DA2 A;  3BDC A;  4G4K A;  4DR4 L;  1LTG D;  4PV1 C;  4DUY Q;  4IFD J;  1XNR L;  1JJ2 A;  1MJE A;  1CA5 A;  4DR2 Q;  1S5C D;  3DUZ A;  1CK1 A;  5FJ8 H;  3GTL B;  1TS3 A;  1KDB A;  3G4S A;  2WB1 G;  4HAE A;  2PYK A;  2Z9H A;  4LUZ A;  1PMR A; 
#chains in the Genus database with same CATH homology
 1CKO A;  2QGQ A;  4RMF A;  4DV2 L;  3A5U A;  4PZ7 A;  3HKZ E;  1JB7 A;  4DV7 L;  2KBN A;  1B70 B;  1KAW A;  2BH8 A;  2ES2 A;  3I56 A;  2ZM6 L;  1XMQ L;  2DGY A;  3E9I A;  1LYL A;  1E24 A;  3CC4 A;  1KRS A;  2VNU D;  3OTO Q;  4Y52 H;  5M5Y H;  2NN6 I;  4LFC L;  1P8L A;  2A1A A;  4AQY Q;  3HOU G;  1YJN A;  1VQK A;  1B7Y B;  1HNX Q;  5HY6 A;  1WJJ A;  4AYB G;  5LMN W;  1X55 A;  1BBU A;  2UUC L;  5IWA Q;  4UY8 C;  1O7I A;  4JC0 A;  1J5E Q;  4LF5 L;  2WAQ G;  3BJU A;  1VQC A;  2RF4 A;  4DAM A;  4POF A;  1NMG A;  4IPD A;  2CQO A;  4X64 Q;  2VQE Q;  2JQO A;  1N33 L;  4DR7 Q;  5K36 G;  2N49 A;  4K0K Q;  5J3B A;  1VQ8 A;  5JEA J;  4EX5 A;  3M4Q A;  3JAM i;  3CD6 A;  1EQR A;  4DR2 L;  5JJL A;  1NJI C;  5ELO A;  3DLL A;  2FXQ A;  1PFS A;  5IYB G;  3CCU A;  1J6Q A;  4DR5 Q;  4LNQ A;  1I6H H;  2LSS A;  3NEL A;  4GN4 B;  4LWC A;  4BY7 G;  4OXP A;  3CF5 A;  3NEM A;  1TWF H;  5LMU L;  3HOZ H;  2ID0 A;  1WCM H;  3UDI A;  1IXR A;  1WYD A;  3D0F A;  5C3E H;  1XPO A;  1S40 A;  3KF6 A;  4LFA L;  4KI0 A;  5H1S E;  2ZTC A;  3VDY A;  4A3M G;  3CC2 A;  2XTI A;  2ZJP A;  4A3F G;  4A3K H;  1NTG A;  1RIP A;  3RR5 A;  2ZTD A;  1VQ6 A;  1K8A C;  2VS1 A;  3CPF A;  2R7Z G;  3PUZ A;  3CCR A;  1XMO L;  5IY0 A;  2HIV A;  2IX0 A;  2UUB Q;  2ZJQ A;  1QVF A;  2UXB Q;  1J5E L;  1Q12 A;  3I55 A;  4LF5 Q;  4NXM Q;  3PO2 H;  1N8R C;  4A3I H;  2JEB I;  4GLX A;  1JMC A;  4A3D G;  3H0G H;  1PVO A;  2UXD Q;  3PUW A;  3J80 i;  1AE2 A;  1OXU A;  1M1K C;  3HOW H;  2MO1 A;  2HIX A;  1GVP A;  4XTC S;  5HGQ A;  3S2H H;  4YHH Q;  4B3R L;  4KHZ A;  4JI0 L;  4GKJ Q;  1KHI A;  1KQS A;  4A3J G;  3PUV A;  3NEN A;  2N3S A;  3T1H L;  4YWM A;  3I7F A;  1YIJ A;  2E2H H;  3PUX A;  4JI2 Q;  3JAM c;  3RLO A;  4A3K G;  4JI4 Q;  2HHH Q;  1Q86 C;  4JV5 Q;  1CKN B;  3S1N H;  5IE8 A;  2KCM A;  4HJA A;  2CCZ A;  3KJP A;  3FHW A;  2Z6K C;  2R92 H;  4DV1 L;  4YCV A;  1TWG H;  2Y0S E;  2QEX A;  4HIM A;  2I0Q A;  2B63 H;  3G6E A;  1PYB A;  1VQF A;  3L0O A;  3A5Z B;  4BY1 G;  3J81 j;  3M85 A;  4AQY L;  5AJ3 L;  2UXB L;  4PMW A;  1BBW A;  4KHP Q;  2H5X A;  1E22 A;  3ULL A;  3F2D A;  4PZ8 A;  2UUC Q;  4NXM L;  3KDF B;  4LUO A;  3RNU A;  4L5Q A;  4JI1 Q;  2YTX A;  3K8A A;  3T1Y L;  5M3M G;  3CCV A;  1PH2 A;  4X64 L;  2GVA A;  3OW2 A;  1P16 A;  2IHF A;  4GOP A;  4WJ3 M;  2UUA Q;  4DUZ Q;  1LTL A;  1VS0 A;  4QQB X;  4AH6 A;  1FVI A;  4JI8 L;  5GRO A;  1GKH A;  4GOP C;  2AWN A;  3ULP A;  4JBW A;  1YI2 A;  2GN5 A;  2RHS B;  3K80 C;  2B63 G;  3PUY A;  1EOV A;  4B3T Q;  3CCE A;  2UXC Q;  5C3E G;  1V1Q A;  4R4T A;  1Q1E A;  3GTM H;  3PF4 A;  1N36 L;  4HJ9 A;  4A3M H;  3L2P A;  2VL6 A;  1OXS C;  4JYA Q;  3SGI A;  4GN3 B;  3J7A 5;  2K4K A;  4WJ4 A;  1JT8 A;  3J81 i;  4LF8 L;  3S17 H;  2NVX H;  4ME3 A;  1N34 L;  3GTP H;  1Y1W H;  4GKK L;  3K81 C;  1EWI A;  1Q46 A;  4UPA A;  3GD7 A;  4DV1 Q;  4A3G H;  3J80 c;  2A8V A;  1UE1 A;  4JI5 L;  4MNO A;  4A3E G;  4LF4 Q;  1VQN A;  1PHJ A;  3M9B A;  3H3V H;  1YBY A;  2UUA L;  1IBK L;  1TXY A;  1AH9 A;  4DV6 Q;  1Q7Y C;  1XNR Q;  2JA9 A;  1X3G A;  2E2J H;  1CUK A;  4NB3 A;  4BBR G;  5C4X H;  1PH4 A;  1L1O B;  1B8A A;  3ICE A;  4DV3 Q;  1OXV A;  4X65 L;  3GTG H;  3RLF A;  5IP7 G;  4GNX B;  3HOY G;  4J15 A;  1I5F A;  1X54 A;  1GO3 E;  2OTJ A;  1XPU A;  4A3C G;  2IY5 B;  1X6O A;  1Y1W G;  1W3S A;  3KFU A;  2LXK A;  3RZD H;  3WWV A;  2VQF Q;  1LM0 A;  3S1R H;  2UXD L;  4DKA C;  3MXN B;  1A63 A;  1VQL A;  1K3R A;  4A4I A;  4YY3 Q;  1JE5 A;  3A74 A;  3G71 A;  2KCT A;  1I94 L;  4LFB L;  1R9T H;  3TQY A;  4IFD G;  4OWT B;  1K0R A;  3RN5 A;  5FLX c;  4JI2 L;  3RLN A;  2WAQ E;  1SLJ A;  1V43 A;  4C3H H;  1HNX L;  1U0L A;  1EFW A;  4LF8 Q;  1IYJ B;  3S16 H;  1SRO A;  4NPS A;  4GKK Q;  3UDX A;  4HJ7 A;  2EXD A;  4TQU S;  2MQH A;  5IP7 H;  3PV0 A;  5FLM G;  3UDF A;  1VQ4 A;  4LF6 L;  3D31 A;  1C0A A;  3AEV A;  1HNW Q;  1N32 L;  4P72 A;  2PMZ E;  2VQE L;  3JC6 6;  3I4N H;  1E7Z A;  3U50 C;  4K0K L;  4DR6 Q;  4QIW E;  5AJ3 Q;  2WFW A;  4X66 L;  4O2D A;  3CC7 A;  1WI5 A;  1Z9F A;  2IT1 A;  4ALP A;  1OTC A;  1A0I A;  2CWA A;  2OTL A;  3K7A H;  1HH2 P;  1Z47 A;  4JI6 Q;  3RZO H;  4BBS H;  1SRU A;  2ZTE A;  1S3O A;  3GTJ H;  2UXC L;  2JA8 G;  1MKH A;  1PH9 A;  2MO0 A;  4YCU A;  4DUZ L;  4B3S Q;  4X65 Q;  4X62 Q;  4JCV E;  4DV5 L;  2JA7 H;  2OQK A;  4A3G G;  1U5K A;  1A62 A;  2ZJR A;  3CCJ A;  2D0P A;  1RL2 A;  4IPH A;  4DR3 Q;  4A3E H;  4JBM A;  3H3V I;  4P74 A;  2VUM H;  5C0X J;  4C3I H;  3S1Q H;  1EIY B;  5JEA G;  1XMQ Q;  2IHE A;  2F52 A;  3E0E A;  4A75 A;  1YHQ A;  5FJ8 G;  4JBJ A;  3CMA A;  4BBR H;  3S24 A;  3PO3 G;  5GAD C;  3CXC A;  5IT9 c;  5C4X G;  1VQH A;  4DV7 Q;  3M3Y H;  1WFQ A;  1IZ6 A;  4OWX B;  3F1Z A;  4UP8 A;  1E1O A;  4IPG A;  2VW9 A;  4DR1 L;  4A93 H;  4YWL A;  4XIG S;  4LF7 L;  4UP9 A;  2PQA B;  1AE3 A;  1G29 1;  4R4O A;  3GTK H;  1KD1 C;  1CSQ A;  1MIU A;  4DAY B;  4DV0 Q;  1HJP A;  1VQ7 A;  3E9H A;  3CCS A;  2XGT A;  3TRE A;  3HOU H;  2CFM A;  4GOP B;  2Q2I A;  5BR8 L;  5C44 G;  2ASB A;  2HT1 A;  4BA1 I;  2WB1 E;  4BXX H;  3T1H Q;  4A3D H;  3H0G G;  2YTV A;  5IYD H;  4DV5 Q;  4OO1 G;  2PI2 A;  5M3F G;  1UWV A;  3UE1 A;  4A93 G;  4LFA Q;  1PH1 A;  3I4N G;  2R6G A;  4IO9 A;  4P73 A;  4GN5 A;  4JI7 Q;  1UE7 A;  1VQB A;  4O0A A;  1GM5 A;  3STB C;  2MNA A;  1E3P A;  1NBW A;  1E1T A;  1XNQ L;  1TWH H;  2N8N A;  1IL2 A;  2GVB A;  3S1M H;  1W2B A;  1K8G A;  2JA6 G;  5M5W H;  1FL0 A;  2WP8 J;  1XJV A;  4DR6 L;  1UE6 A;  2V1C C;  3GTL H;  5C4J H;  5JJK A;  1C7Y A;  2YV5 A;  1JJC B;  1EUJ A;  4HID A;  1HNZ L;  3S2D H;  4DK6 C;  4C2M H;  3PGZ A;  5M3F H;  3PIO A;  1C9O A;  2LXJ A;  2JA7 G;  3F2C A;  4A3F H;  3I4M H;  2E5L L;  3KOJ A;  5IYC G;  1QZH A;  1YJW A;  2VUM G;  2L15 A;  3FKI H;  4NXN L;  2R7Z H;  1LUZ A;  4B3T L;  2KEN A;  4BY7 H;  2UU9 L;  2ZM6 Q;  3ERS X;  1G6P A;  4YHH L;  1SE8 A;  2JA6 H;  4QL5 A;  2PQA A;  1T9H A;  3HOW G;  5JJI A;  2K52 A;  1D7Q A;  4LFC Q;  2F4V Q;  1L2F A;  3A0J A;  4X62 L;  3GTQ H;  4QGU A;  3CPW A;  4JV5 L;  1YNX A;  3KJO A;  1N9W A;  2AKW B;  1HR0 W;  3ER0 A;  2NVQ H;  3UDG A;  1HNZ Q;  1X3E A;  4P71 A;  3F2B A;  3W5O A;  1YHA A;  2OWO A;  2B29 A;  3FKI G;  3PIP A;  4IFD I;  4AIM A;  3AFQ A;  2BH2 A;  1HZC A;  3U4V A;  5IYB H;  4DV6 L;  2YU9 H;  3CCM A;  2I5L X;  3M4P A;  5LMN L;  2D0O A;  5C44 H;  2R92 G;  3BZC A;  3M4O H;  4DR4 Q;  4IJL A;  1QZG A;  4JOI C;  1KIX A;  1QVC A;  4BXX G;  4DR1 Q;  2NZH A;  1HR0 Q;  4JBK A;  4R4C A;  4APV A;  1IBL L;  4DPG A;  1KL9 A;  1M90 C;  4KLK A;  1CKN A;  2R7D A;  5DLQ E;  3W1G A;  5LMU Q;  3G48 A;  4HJ5 A;  1HZA A;  2RHQ B;  3CW2 C;  1VQA A;  3TRZ A;  3HOV H;  2JJQ A;  2BA1 A;  2VQF L;  4JI8 Q;  3U4Z A;  4IOA A;  2JEA I;  1OXT A;  1A8V A;  3AYH B;  2UU9 Q;  2AWO A;  2K75 A;  3NBH B;  1YEZ A;  4GLA C;  4JI7 L;  1I50 H;  1N32 Q;  2K5N A;  4DK3 C;  3KDF A;  1Q1B A;  2JE6 I;  1Q82 C;  4PG3 A;  1X3F A;  3TEH B;  1ASZ A;  2QA4 A;  5M5X H;  1PV4 A;  4IJH A;  3CCQ A;  4A3J H;  3CQZ H;  4GS3 A;  4B3M Q;  1VQE A;  5IYC H;  2OCE A;  1K73 C;  1XMO Q;  1XNQ Q;  4B3R Q;  5FLM H;  1L1O A;  2B3G A;  1MJC A;  2Z6K A;  3STB D;  1VQI A;  2JA5 H;  1VQ9 A;  1CSP A;  2C35 B;  1IBK Q;  4EQ5 A;  4DNI A;  1Y1V H;  2E5L Q;  3GDE A;  4LUV A;  4C3J H;  4JI6 L;  3HOV G;  1TWA H;  2RCN A;  5IP9 G;  1X65 A;  3HOZ G;  2AMC B;  4MZ9 A;  2ALY B;  3PF5 A;  2MFI A;  5C0X I;  4X6A H;  4BY1 H;  4OWW B;  1V9P A;  4YY3 L;  3F8T A;  4RG1 A;  4LF9 L;  1NE3 A;  3FP9 A;  3BZK A;  2PI2 E;  1FGU A;  2EIF A;  2VY3 A;  1X9N A;  2HHH L;  1Q81 C;  3TS2 A;  3L7Z C;  1EIF A;  1NY4 A;  5E7N A;  1H95 A;  2JA8 H;  4NXN Q;  1IBM Q;  1ASY A;  4JI3 Q;  5M3M H;  3GTO H;  2Q2T A;  4BA2 I;  4KHP L;  2Z0S A;  2JA5 G;  4A76 A;  1PA6 A;  4OX9 Q;  1FJG Q;  5GAH C;  1EYG A;  4DV4 Q;  3HFZ B;  3RN2 A;  1Y1V G;  4UP7 A;  1L1O C;  2KHJ A;  4R1J A;  3CME A;  2HQL A;  2K50 A;  4FDB A;  1WOC A;  1L0W A;  1YIT A;  3CCL A;  5IP9 H;  1X56 A;  1SR3 A;  4GLV B;  3UE0 A;  4X66 Q;  1PH6 A;  5C0X G;  4LF7 Q;  3CAM A;  4YCW A;  3LGJ A;  4B3M L;  3PO3 H;  1UE5 A;  3PSI A;  2F3I A;  3OYY A;  4YWK A;  2AHO B;  1HNW L;  5BR8 Q;  1VQJ A;  2DUD A;  3S15 H;  1SMX A;  3KLW A;  2NN6 G;  4LF9 Q;  3TS0 A;  4A3L G;  1OXX K;  3KF6 B;  2KHI A;  4Y7N H;  3GO5 A;  1VCI A;  4AYB E;  4JI4 L;  4GNX A;  3HOX H;  1HR0 L;  1VQD A;  2E8G A;  2I5M X;  4H02 A;  1VQO A;  4L5R C;  2CKZ B;  1PH3 A;  4DR3 L;  4OX9 L;  4QY7 A;  5GAG C;  2IX1 A;  4JI0 Q;  4GKJ L;  3S14 H;  4DV4 L;  1D8L A;  1PH8 A;  4JI5 Q;  4BBS G;  2K5H A;  2R93 G;  4IPC A;  2N78 A;  1QUQ A;  3MEF A;  3J81 c;  1N34 Q;  1DGS A;  1G51 A;  1I3Q H;  1FJG L;  5IYD G;  4JOI A;  2PNH A;  4HIO A;  4A3L H;  1KXL A;  1TWC H;  4LF4 L;  3B6Y A;  4DV3 L;  4TVA B;  4JI1 L;  5GQO A;  1BKB A;  3W1B A;  3ZJY C;  2D62 A;  4OON A;  1YZ6 A;  3I4O A;  4R4I A;  3HOX G;  2Q2H A;  5IWA L;  3U58 A;  1KRT A;  4IOC A;  3M7N A;  3KYH C;  1QUQ B;  3IRB A;  4DV0 L;  1CKM A;  4L5S A;  1PYS B;  4R4Q A;  2Q2U A;  3K0X A;  5GAE C;  1EQQ A;  1KC8 C;  3T1Y Q;  2R93 H;  2OQ0 A;  3J7Z C;  1SFO H;  1K9M C;  1VQM A;  2K14 A;  4DUY L;  4P75 A;  1N36 Q;  2I5H A;  2YYZ A;  1BVS A;  1Y14 B;  4DV2 Q;  1Q8K A;  3AQQ A;  4QJF A;  4POG A;  4DR5 L;  1PH7 A;  3I4M G;  1HZ9 A;  3CP0 A;  2A19 A;  1JJG A;  1I94 Q;  4LFB Q;  1GD7 A;  3I2Z A;  1VQ5 A;  1UEB A;  2BA0 A;  3Q8D A;  4LF6 Q;  2NZO A;  4MTN A;  1XPR A;  2NVT H;  2F4V L;  2CWP A;  4A3B H;  2K5V A;  3AFP A;  2VZA A;  3K7U C;  4OO1 I;  1YVC A;  5EAY A;  4JYA L;  2ATW A;  2R7F A;  3HKZ G;  4JI3 L;  1IBM L;  5ELN A;  1WCM G;  1NMF A;  3DM3 A;  4JG2 A;  4HIK A;  4L5T A;  3HOY H;  1S72 A;  4A3C H;  3BU2 A;  1VQP A;  3OTO L;  3HKS A;  4PZ6 A;  3H15 A;  1IBL Q;  2EQS A;  2E2I H;  3EN2 A;  2UUB L;  3PCO B;  1YHB A;  5LMN Q;  4HJ8 A;  4DR4 L;  1XTD A;  1QVG A;  4DUY Q;  1VQG A;  4IFD J;  1XNR L;  4B3S L;  1JJ2 A;  3EBE A;  4GNX C;  1YJ9 A;  1MJE A;  2Y0S G;  4DR2 Q;  4A3B G;  5FJ8 H;  1K83 H;  3ULJ A;  3PO2 G;  3G4S A;  2WB1 G;  2NVY H;  1N33 Q;  4A3I G;  3KF8 B;  3EIV A;  4DR7 L;  1SN8 A;  4LUZ A;  4LW1 A;  2JK8 A;  2YTY A;  1PH5 A;  1HZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...