3NBIA

Crystal structure of human rmi1 n-terminus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
203
structure length
193
Chain Sequence
NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RecQ-mediated genome instability protein 1
publication title Crystal Structures of RMI1 and RMI2, Two OB-Fold Regulatory Subunits of the BLM Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 44
structure length 193
sequence length 203
ec nomenclature
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3nbiA01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nbiA02
4CHTB 3NBIA 4CGYB
chains in the Genus database with same CATH superfamily
2XWBB 3LNNA 4POFA 4LY6A 1S5FD 4BBRH 4QIWB 4RGOS 1HZ9A 4A3GB 1WCMH 1RCVD 5T1IA 3HHZA 1AFPA 1GVNA 3A56A 1NY4A 1SE8A 1B2TA 1SXJE 1ZXTA 1PFBA 5KQ8A 2YNMD 3B6YA 3ULPA 4LF8M 2R92H 1S5BD 5FTNA 3HOXB 3DZDA 3CC4A 3AMUA 1Z59A 1K73C 4LF5Q 2FHTA 1MJEA 3FUXA 1VMCA 5JJZA 1KTKA 2IL8A 3VYSA 1Y8GA 4MHEA 2OTLA 4AQYQ 5H37D 4P16A 3T13A 4K8JA 1N32L 3M9BA 3QOLA 1WJJA 3KYHC 3K7UC 1D2BA 2X8AA 4C2MH 3CF0A 2RGOA 2A69C 4OWTB 5IP9G 3J81E 1V34A 3U4VA 1BCPB 4IBGA 4MNOA 4AG6A 4PDIA 2F0DA 4FF4A 4DV6L 1VQ1A 2EYOA 1GKIA 1K9MC 2Y0SE 4B3TM 3CTWB 3TP6A 4DR2Q 5C0XH 3U50C 5EJCA 2A68D 5ELDA 1IFYA 1KQSA 1SG9A 5E6JA 1XMOQ 1NHGC 2CWBA 1ILPA 2YYZA 1I3QH 1IBMM 1PA6A 1NV8A 2JEBI 3PGZA 2QKIC 4L6TB 2KCMA 1KYIA 1L0WA 4DV7Q 1LTTD 3FPPA 1EEFD 4UN2B 1JQJC 4ZLTF 2JA6H 1GJTA 2AQ2B 2KJXA 4LFCL 4DR4L 1O7YA 1HNZL 1C8CA 3ERSX 1HNXQ 2Z4RA 4P74A 3GLFB 2MO0A 3OYYA 4IN3A 3Q24A 3C46A 1FNVA 1K3WA 4DV2Q 1SBBB 2CHVA 5KRUA 1WTRA 3HOVH 2O25A 3KLWA 1J5EQ 5BPVA 3VYTA 3QB3A 3H3VH 4FXGC 1EEID 3VK7A 3RN2A 1X3EA 4IUVA 5H1SE 1NNXA 3H6MA 3LCVB 4DK6C 4FF1A 4GHLA 2TMPA 3HOYH 3T1YM 4KY6A 1WHCA 2NWGA 4GLVB 1Y1VH 3SK6A 1JJGA 1IBLM 1OO9B 1A62A 4HJAA 4CKEA 2A68C 3L2AA 1Y8NB 4HIKA 2WINB 1IBKM 1SE3A 4AYBG 3Q0AA 4YIJA 1PZJD 4F1IA 1TXYA 1GJSA 2RQXA 4GOPB 3SATA 2HAKA 1VQMA 4L15A 2L5TA 2XWJB 3ICEA 4PMCA 2QENA 3HGBA 5IP7G 1SYEA 3HS0C 1RIPA 3VYUA 2JA5H 1Z6HA 3S1RB 1I4HA 3PO3G 2QP9X 4EIWA 1K8MA 2QGQA 4NOOB 1IYVA 1DM0B 3GPXA 2XGTA 1G4AE 2JA2A 4LJAA 2NZHA 3CCEA 3I70A 1FNWA 2B2WC 4AQYL 4RG1A 1PJTA 3KVWA 3L9AX 3PQIA 5F2DA 1EU3A 4BXXH 5IYBG 1CM9A 3R8FA 3VKGA 3JR5A 4HR7B 3TQYA 1WIVA 4BBRB 4DR3Q 4RGTA 2V1CA 3J7YW 1HQMC 3KBXA 3KF6A 3K9PA 2R65A 2E2JH 3HZJA 4F2LA 1K0RA 3LX0A 4DR2L 1DGBA 3W68A 3HGIA 1TWAH 2WSEF 1TWGH 4HJ9A 5JI2E 1XMOL 3A42A 2L9HA 1IY0A 4GLXA 3FKIB 1SDFA 1JE5A 1BF4A 1Q3LA 4DV7L 4M9SA 3SARA 4JBKA 4A3IG 3TRZA 1OXVA 4IFDJ 3URYA 3F2CA 1VQ8A 2F4VQ 1E2ZA 2WAQE 3I01M 4OELB 2FH0A 4DR5L 1SYFA 3J27B 1HNXL 1HR0L 1JOQA 3U6LA 2A19A 1ZYRC 4OIJA 1K83H 1JJCB 1SROA 4H7BA 5JAVA 4DV2L 4V190 2PQAA 3FEWX 4I7ZC 2WP8J 1SXJA 4A3MG 4QCLA 2KECA 1C0AA 1JR0D 3KLRA 4OO1G 4JI6Q 4X66M 5GADC 3RE8A 4BS9A 3ER0A 4Z6YA 4RKBA 3H09A 5DNFA 3BXWA 3EROA 3WHKA 1KRTA 1VQFA 1I3QB 3IG5A 3CCLA 4HEOA 1TU2B 2OEOA 2M2LA 5GAGC 1ML0D 3HOUG 1Z5AA 2FS1A 3K1JA 1Y1WG 1G6ZA 4CJ2C 5FTLA 1TWFH 2B2YA 2UUCL 3WOFA 3HG9A 2D5DA 1DGHB 3RZOB 4FCVA 2XEPA 2RA4A 4G4OA 2B2UA 1L1TA 2CV2A 4KTAA 4NMZA 5D3DA 3J81L 4CIZA 2O5IC 3MXPA 5ITQA 1S3SA 2LXEA 3SXHA 1D6EC 4A3LG 1EYAA 1HZCA 4FWHA 1NUCA 1I4RA 4FDBA 3UK6A 2ZT9C 4EGVA 3A45A 2XRQD 1WJ7A 2KNZA 3HOYB 1RHPA 4H0LC 3OSOA 3WWVA 4A3EG 2ZJQA 4WJ4A 5CC4A 3NHHA 1Y1VB 2EO2A 1V92A 5M9OA 2OWOA 3T4AC 3G71A 3GTPH 1D0LA 5C44G 4FD2A 2KVMA 3AL0C 3HKPA 1HTPA 3VR5A 4DV3M 4KKTA 1N77A 4B3RM 2DVWB 2ZAOA 2MR9A 1ZKOA 2XZFA 4LF9M 1DO0A 3DOAA 3GPUA 2VQEQ 3AB9A 1AUAA 1SSOA 2TSSA 3QYBA 1H9SA 2DNCA 3HOZH 2EYPA 2L6OA 2F0KA 1XTCD 5I9OA 3KOJA 2F4VL 1DOLA 1QG7A 5K5PA 4CBVA 1QQWA 4JI0Q 1EYCA 1ET9A 4L5TA 2UXDM 3CCRA 5I9PA 1Q82C 3CGWA 5D65A 2B29A 2JA8G 1LTID 1IKLA 2PZWA 1PGYA 1WTPA 1M4VA 3CRKC 3D0FA 4FVMA 2R4EA 2C96A 4X3TA 5M3FG 1M90C 2BDOA 1D5MC 1IL8A 3MAQA 3HP3A 1WYDA 1X56A 2E2JB 4OL7A 3BVZA 1YHQA 3HJQA 2K47A 1TWAB 1A15A 4GRIA 3MFGA 4KN7C 3UDFA 4A3FH 3M0EA 4DR7M 4FWGA 5EXTA 3TQSA 1PDQA 3CCSA 4MGZE 3A0JA 3I4MH 3SHLA 4ZKBB 3J7AS 1BXTA 3BZCA 1X3FA 2K5NA 3RUZA 3F2UA 3SVMA 1HNWQ 2R93G 2UUBM 2IW3A 3M4PA 2AHMA 2EPBA 1PFMA 2L11A 3DM3A 1S5CD 4G57A 1MGSA 1IN5A 2HDLA 5GAHC 4A3JG 4L4UA 5ELOA 4B7GA 1FJGQ 1STGA 1TIID 3RZDB 1GJXA 2RBMA 3B7QA 2R18A 2LFNA 2O2LD 3F1ZA 4IBKA 2YTYA 3HHXA 4I4LA 3GLHE 3DXJC 4LFAQ 1CHPD 4Q5VA 4JI7Q 4A3GG 5HGQA 4DV4Q 1J9OA 4AG5A 3EFXD 3KS8A 4IUPA 1IKMA 1T6OA 5C0XI 3GTMH 4JI4M 2R6FA 4RKUF 1I4PA 1SNDA 1ASZA 5EXSA 1SR3A 3HOXG 3GPPA 2DJGC 2F3WA 5IWAM 2QILA 4X64M 1Q7YC 2A8VA 5KGUA 1NY6A 2Y0TA 2VIIA 3LQRA 1II3A 4A3VB 1I6VC 2UUAM 5LMNM 2V1CC 4QMGA 4EX5A 3GTQH 3V76A 1IN7A 4L63B 3MXGA 2FE8A 4JYAM 1VQEA 3W3AA 5JEAJ 5JPNC 1EQVA 5C3EH 2VQEL 1OAOC 1L1OA 1SYGA 3SYLA 3JAMi 2ZANA 5EP1A 1N36M 4BBAA 1YLAA 3H3VI 4DUYL 1XYIA 1YZ6A 1GUGA 1JORA 4DPGA 3SK5A 3CPWA 4JI0L 2Q8IB 1N78A 3NBIA 1QDRA 3OHXC 3TEHB 4CDDC 1O78A 1VQCA 1I94Q 1ENFA 3UI2A 3QWNA 4HIMA 4IO9A 2OQ4A 3HEJA 1OFIA 5CV6A 3BDLA 1SXJC 1UFZA 1K0SA 5LL6X 4OX9M 3NTKA 2NVQH 5KEEA 1EYDA 3P20A 3SASA 2G9DA 5FLXE 1SYDA 1ENAA 2KRKA 1A2UA 2XSZD 3E9HA 4IUUA 4J8QA 2DAGA 3VDPA 4PT5A 3HOZB 1Q8KA 1V1PA 1JR3D 4LF6M 4B3SM 4OONA 1IY2A 3E9SA 3CF5A 1HNWL 3UDXA 2B2YC 4DV1M 1SXTA 3MHVC 1VQ5A 4GKKQ 4GOPA 1CSQA 2OTJA 1D0KA 2Q2IA 1SLJA 2B63H 3S2HH 2B2VA 3IL8A 4ZQ3A 1QILA 2CV0A 1J7KA 1ICFB 4BWGB 4LFBL 5M5YB 4IJHA 1IY1A 4IBCA 5JVG3 1E2VA 4IJFA 4LFAL 4IBIA 3FRIA 4IFDH 1ICWA 5ELNA 3CF2A 4XYQA 1WTXA 2I7NA 3K5NA 4DV4L 1TWCH 4S3SA 5LMUQ 2ZM6M 2ZJPA 2BE5C 1PRTF 2LXJA 2Z6KA 3FRHA 3UJNA 3U5ZA 2K6AA 4R9WA 2CE7A 4A3FB 2K5WA 4N9TA 4REZA 3CC2A 2F5PA 2JXMB 2AHOB 1VDDA 1OIPA 3B74A 2EXDA 1X3GA 2ENBA 1B8AA 3A8IE 3K7AH 1AIPC 5I2YA 4F8MA 4DR6Q 4LUZA 3S1NH 4JV5M 2JJQA 2MGSA 3OIPA 4OHJA 2K4KA 5FLMH 2O01F 2R7DA 2WZJA 5D14A 5E4WC 3KOWE 3J7AV 1V33A 2ASBA 4C1NK 1PTOD 2QQ8A 2MJ5B 3NE5B 1XJVA 1R9TH 3HJ8A 5E4XA 1DV0A 4BY1H 4DGZA 2Z1CA 4LCBA 1KD1C 1WGLA 2A6EC 1O7IA 2EY5A 3GTMB 4O2DA 2GA4B 2JY8A 4NRWA 4OWXB 3MFYA 4DXFA 4JI5Q 1G291 5IYCG 1PRTC 2N3SA 1KSFX 1I94L 3B9PA 4KHPM 1HZAA 3C1EA 3FKIG 2EYFA 2QZ4A 2CW0D 4MZ9A 2OF1A 3MJ5A 5AJ3Q 3IECA 1VQOA 3J81c 1MSHA 4WURA 4V0BA 2D62A 1VEKA 2FINB 4YCUA 1WD1A 2DAIA 4GS3A 4HJ8A 1AW7A 5BR8M 1CA5A 2Q8RE 4KD4A 4JBWA 2KEBA 1TWHB 1I4QA 1VF5C 2WSFF 1STNA 2LY7A 4JI8M 1B53A 3VDUA 3KDFA 3I7FA 1PTOH 2KDLA 4P2CB 4P75A 3I4NH 4KT0F 1PH7A 1B70B 1PTOC 4GKKL 1S5DD 1JWMD 3OTOM 1BR9A 1SXJB 2QEJC 2CVRA 2NVYB 3HOWH 3TBIB 1JOOA 4GNXC 3S15H 2K5DA 2K75A 3S1MB 3U6CA 2NVQB 3BJUA 2D2CC 3S24A 1NVMA 2CW0C 5LMUL 1V43A 3AOGA 5FTJA 4B3MQ 3F2BA 2PI2A 1MJCA 1SEBD 3U6QA 2CFMA 3TREA 5I6WA 1R5LA 3DMUA 4ME5A 3E3XA 3MXUA 4X3SA 4IJEA 2D7HA 2NQ8C 2HCIA 2NB0A 2MNAA 1LT5D 3NENA 4CJ1B 3HOYG 2N55A 2PNHA 4K5WA 2L7IA 4M9XA 2DAMA 2R7ZH 4DR6L 5C4XB 2Y0SB 4XDXA 5IE8A 3HFZB 2B63B 1HXYD 3C3LA 3S2HB 2YFQA 1L1OC 1GO3E 3E0JA 3U6DA 1EQTA 3HKZG 3M3YH 2KZSA 4NKLA 3M4YA 3RGSA 2EXZA 1XC8A 1PMRA 1TS5A 3J80E 4GC9A 3BS1A 5FSWA 2SNMA 3STBD 1KDBA 1TWCB 5L37A 2VF7A 5FO8B 1EOVA 2Q2HA 4KY7A 1U4LA 1CFMA 2HWJA 5FLXL 1B44D 2DWZB 4JBJA 2OCEA 4X65M 2DWNA 4X6AH 2UXCM 2BWBA 3HJSA 4CGYB 2F5OA 3RGPA 5DNYA 1TR5A 2LMCB 4JVZA 3EBEA 4O1NA 2MUYA 5BN3A 2CUZA 3NELA 3QR8A 4NB3A 1JT8A 3GQ3A 3E6ZX 2LVPC 2GN5A 3L26A 4DAMA 1MX0A 2HL7A 1NV9A 2JP7A 2OPFA 3K7AB 4R4TA 1N33L 3KJOA 2QBYA 4KD3A 3S17H 1QVCA 4R4OA 3SAUA 2E5LL 1TY0A 4BXXG 1YNXA 1PH2A 2XVSA 3FVQA 1XNQQ 1PH1A 4LK1C 3K6OA 4PV1C 4DR4Q 1ESFA 1HNZQ 2VUMH 5FTMA 1QCBD 1R9TB 2ZAMA 4D80A 2IX3A 1Q81C 2F3VA 4NXMQ 1PRTB 2RGHA 1VDLA 1QNUA 2UU9Q 5JEAH 2CH4W 3NP8A 2B2VC 1QVRA 1PLFA 4RCNA 3K57A 2FXQA 4TKOB 2VZAA 3S2DH 3CAMA 1VEJA 2VNUD 2CQOA 1X32A 2HIXA 3D6CA 4FNFA 4HIDA 2K1BA 2KA6B 1D5ZC 4FF2A 2LVQD 3AKZA 1WVLA 1HFGA 1B9MA 2E2IH 2ERCA 3R8BA 2AUJD 4QHTA 2LKVA 3MK6A 1HR0W 3IFTA 1GABA 3H94A 4M9ZA 2OQ0A 1JQYD 2DJFC 3RD4A 3HU3A 3OWEB 3FHWA 3I73A 1EY8A 1YEZA 2F0MA 3PSIA 1WTWA 3K5LA 2FJ2A 4IZ8A 1NJFA 3M4OB 4TRDA 2DXIA 2EIFA 4ZCKA 3HOWB 4A3KG 3KSXA 1B1ZA 1CT1D 3RR5A 4W5WA 4LFCM 1D2NA 1BDOA 1XTDA 3WDNA 1FYCA 1TH4A 3JAME 1KLUD 1DCZA 4NP5A 3GTJH 4CHTB 4GN3B 1Y69U 5EKIA 3H91A 2X49A 3PNVA 5ISRA 3GTLH 3GP1A 2WIIB 1N9WA 2WACA 3HU1A 4PMWA 1KHIA 3IRBA 2F0HA 4L6V6 2F0TA 4P72A 3W1GA 2YQZA 3DFZA 4R7GA 4ZUIA 5ITTA 3I2ZA 2KNVA 2LNHC 3VLFB 2EA0A 3EN2A 3MHBA 1H9KA 4U673 3CC7A 1STYA 2QCPX 2O4XA 2L12A 4K8IA 5CMDA 2CEAA 4H44C 2NVXH 3ULJA 2X69A 4LNQA 1L1OB 3WHLA 3EIVA 2LVNC 5K36G 3U6EA 4DN4M 4DF7A 4QQBX 1BUVT 1U4RA 4NDXA 2ICEC 3MXNA 4DU9A 1XNQL 2A1AA 4MM3B 4DR1Q 3CPFA 1T5EA 2M60A 2OOBA 1STAA 1X6OA 1WTOA 4IFDI 4DR5Q 4KHZA 2FFKB 1G59A 1HR0Q 5I2XA 4WJWA 4NXML 2F0NA 2ZBKB 1HUMA 1UE6A 1XPRA 4WJ3M 2UU9L 4POGA 4LJ7A 2EYMA 2LWXA 3GLGA 2F0PA 3SBJA 2I07B 3CW2C 3IKJA 4LF5M 2QF7A 3HOZG 2C99A 3SMPA 4LF8L 2VS1A 1JR3E 1HUNA 1EL0A 3H3VC 2JA9A 4AQYM 3SAWA 1H6UA 2R46A 2K5VA 4DBGB 3FTCA 2R62A 1YNJD 4YCVA 3S16B 2RRUA 1B50A 1E1TA 2Q2TA 1Z7TA 3ZCBB 2A5HA 3FUWA 2AMCB 1V1PB 1AE2A 1F9QA 2XN9C 5IZ7D 2ZTCA 3CD6A 2CRUA 3W2DA 3J80L 2UUCQ 1QAOA 3QOJA 3OMCA 3LVVA 4DR2M 2UXBQ 1KNEA 1XMOM 2DWMA 3IAYA 4A3FG 2EYHA 1EFWA 2K14A 3ERQA 1TR8A 2H5XA 3CQZH 2I0QA 4DV7M 3A98B 1SMXA 5CBEE 2OQKA 5KNCA 3TS2A 4LRSA 1RTOA 1A3TA 1VQGA 3CP0A 5M3MH 1VQ9A 2ALYB 2ZTDA 1STEA 4B08A 3GRYA 1ENCA 1HNXM 4NPSA 4N9PA 3U5ZB 1NY5A 3W5OA 4DV2M 1QOHA 3FUUA 2M5ZA 2CH4A 3KP1E 2HIVA 4C3IH 2K32A 1JCKB 2E2IB 1G2SA 1OKSA 1J5EM 3LVWA 3DHQA 1F2MA 5G3LD 4FYDA 3VFDA 3ZQJA 2L0CA 1DJRD 2EKFA 1F9RA 1EE8A 1FD7D 4K5VA 1WCMB 3GO8A 4MN3A 1UUPA 4K5XA 3TDQA 3PIP3 3BU2A 1VQBA 1JE4A 1ZAEA 1HQYE 5M5XH 5ELBA 1YIJA 3R2TA 2K01A 2KXEA 1LT6D 2H4OA 4HJ7A 4C3HH 2R92B 2EY2A 1IHZA 1K8OA 2DWLA 1BBWA 1MIUA 1QAMA 4QIWE 3G7LA 4DR1L 1D5XC 4A3DH 3I90A 4YWLA 5FJ8G 4PZ7A 2FMMA 1CUKA 2NN6H 3RMHA 1HTLD 3GTJB 1XX8A 4YHHQ 3IG8A 1F4IA 4C2MB 2IPKD 3KJPA 2JQOA 3PO2H 1G2TA 4EVOA 3Q8DA 4RHSA 2BNKA 4C3JH 4KJOA 4JCVE 1FL0A 1QANA 3GLHB 2HQLA 1IW7D 5IGBA 1X37A 2Z0SA 5CR3A 4ALPA 5ELFA 2RKSA 3B7NA 1EY5A 2MQHA 1E7ZA 3GTKH 3U58A 3OOCA 3S14H 1K3XA 4A93H 4EQPA 3GP7A 2E8GA 3A8KE 1QZGA 5FLXc 2L09A 1QWYA 1W5SA 2Y0QA 4QJFA 1XWIA 4DR3M 3KDFB 2JA6B 2K52A 3SK4A 3JAML 2MO1A 1X3QA 3UE0A 4DV3Q 3H15A 3F92A 1J09A 2UXBL 3DLLA 3KOYE 5IT9E 3OW7A 3L2PA 1SNQA 4QY7A 4AIMA 2XLJA 2KEDA 1L2BA 5IOCA 3HOVB 2A6HD 3CHBD 1K8AC 1OQYA 4OGQC 4CISA 1YHAA 1ONLA 4QF4A 4AI6A 3S1QH 2F4VM 3HX3A 3G6EA 2K04A 2JXNA 4XBOA 4KK7A 4QNRA 1T3TA 1KAWA 4A3BG 1ZV1A 2F0OA 2QHOB 1BOSA 1CK1A 2XH9A 1LT4D 5C4XG 3A5ZB 1D0MA 2C9OA 5IGCA 3P1HA 5L8RF 4JI1M 2B63G 3J7ZC 2UXDQ 1W3SA 1IW7C 4WW0A 1A63A 4I5SA 1CKOA 2KHJA 3I8ZA 3KBGA 3KFUA 2K0BX 4K6DA 2XSZA 1VQIA 4JI6M 4DV5Q 3BDOA 3TS0A 2H1EA 1JR3A 5HURA 1H9RA 2O5RA 3M6AA 1DOMA 1A2TA 2JA5B 1GL7A 3BYTB 3DWAA 2N35A 1QYRA 2MHVA 2KOLA 1WD0A 1MHWC 2IX1A 4DUYQ 3NK9A 1EIGA 2L15A 3J81j 4IUQA 2JNHA 3LMMA 3FUTA 1YVCA 2A6HC 4WRDA 1DZ1A 4MB7A 4G4RA 1EWIA 2F0VA 3CCVA 1LTBD 2LXKA 4YHHL 2RHQB 3C3EA 3U61A 4C3IB 2BJVA 1GUTA 1WTVA 4HN7A 1QVFA 3T38A 3LW5F 1YNND 1UEBA 3VA5A 1XMQQ 1Q12A 2KA7A 3U6MA 2YU9H 3TWKA 3I4VA 4TQUS 1LT3D 2F52A 1Z5CA 5M5XB 3J81S 4QOSA 2QBYB 3T15A 2R45A 3DWQA 1TWGB 4DK3C 2ZXRA 5DFLA 1F9PA 2ATWA 1AH9A 2K9DA 2F0FA 4GLAC 1QVGA 2XFSA 3KDSE 4UP7A 1CI3M 3Q6SA 4X64Q 4A3DB 4BA2I 2M00A 3FRPB 4RH6A 3U6SA 1WTHA 1JB0F 4DUZM 4BY7H 1VQHA 1E3PA 4DV3L 1KLGD 4MTNA 4B3RL 1VQJA 3ZH9B 1I50H 2BH2A 1L0XB 2VQEM 1K83B 4DK0A 2WB1E 3U9OA 2NVTH 4LFBQ 1CKNA 2AUKA 4LF9L 1IXSA 4GNXA 4KO8A 4A75A 2B8GA 3R3OA 2DNAA 4ZAIA 3CCMA 2Q8TA 3AOEA 4C3JB 3UZUA 1K3BC 1G3IA 3PFIA 1OXUA 1IN4A 1VMPA 3A7LA 3LWEA 2KZUA 3ZYYX 1Z9FA 3TWLA 5EQTA 4JI0M 2A73B 1TT2A 1V8QA 1PH5A 3AFQA 3K0XA 3NWSA 4JI3Q 4A93B 1MBYA 1UNSA 5IYDH 1EIYB 5BN5A 2UXDL 5E7NA 3H0GH 2KEEA 5JPMC 5GQOA 5IYBH 3GDEA 4HMIA 1WR1B 1TWFB 4DV5L 1X9NA 4P17A 2L4NA 3GQ5A 3SGIA 1R2YA 1B3QA 2MGWA 3FE3A 1NR2A 2RDGA 1EZ6A 4GHAA 3HHWA 1XXHE 1VQAA 5DAUA 3A54A 4FP5D 1P8LA 4HSPA 3PXGA 2YR0A 1X55A 1HNWM 2B39A 3QIAA 4KKUA 1FNNA 1BNZA 3FD9A 1G8ZD 1MI2A 4A3IH 3Q8GA 4WP2A 1B3AA 4B3SQ 4LF6Q 3BOSA 4LGYA 2BOSA 4R8NA 1EY0A 1HT1E 3EIHA 3J80c 1FJGM 1L2FA 2FFJA 4KODA 1O7ZA 4G6ZA 3GTPB 1CSPA 2PO4A 2C5CA 3BG3A 4C56C 2QPAA 4DV0Q 1VQ4A 2EDGA 1VQLA 4LFAM 2D9UA 4JI2M 4JC0A 4DAYB 4A3MH 4G4NA 1XMQL 4K0KQ 4JI7M 4FCTA 4G3OA 2HHHM 3AEVA 4OO1H 3SAVA 2VDBB 4IUTA 3W1BA 1U5KA 5IT9L 2J7OA 1TKWB 1JOKA 4LF7Q 4A3CG 3J81i 4FXKC 1TGUA 1XNRM 3FUVA 1V9PA 2VB2X 3KUPA 3MXNB 1MKHA 2C35B 3MEHA 1Q8IA 3A74A 3G48A 3HKZE 4K2LA 5DYIA 1KRSA 1GOZA 4MTKA 4DXGA 4NXNQ 5J1ZA 3OMGA 2HUGA 1GLNA 1WGNA 3TP7A 2BWEA 4X64L 2D0OA 2E74C 1ZEQX 2PNRC 4LWCA 2JN4A 4PCZA 1L2CA 4XT1B 5LMNL 2EY1A 4WORA 2C98A 3GLGB 2FNAA 3I4YA 4FF3A 2JY5A 1MD2D 3HZXA 3GPYA 3V2TA 5EXPA 2FMCA 4L8RC 2EJSA 2NYZD 1PYBA 4MGHA 1XB2B 1QUTA 1RF2D 4JPBW 4G7HC 1UEAB 1N36L 4A3LH 1YE9A 2QDLA 4FXDA 4RMFA 5FO7B 1Y8PB 5DYGA 1GL6A 4KV6A 3T1HQ 4R3DA 4RAUC 4JI3L 1I94M 3NTHA 5JEAG 3I4MB 1S5ED 4IPDA 4QB4A 5C44H 1JJ2A 1P16A 3PCOB 3UE1A 4ID6A 4DA2A 2EYJA 3CRLC 1C4QA 3SC3A 3VA7A 5IIFA 2RSOA 4BY7B 4OX9L 2NN6I 2DN8A 3Q8XA 1SNPA 2NTTA 2PZUA 1OTRA 4HCEA 1V1QA 3TL4X 4EQNA 2NVTB 3TPZA 4IBDA 2R61A 4L78A 1P3QQ 2HDMA 2JK8A 3DEOA 4BBRG 3OIQA 1WCMG 2G9HD 1N34Q 1PTOF 3SHFA 3K80C 4NW2A 2DNEA 4LF6L 4B3SL 4GKKM 4QUFA 4A4IA 2EKKA 4DV1L 5EGTA 2R92G 3DWPA 5EKKA 3PUZA 3SK8A 1RDPD 3H0GB 3KK7A 4ME3A 4DV0L 2JA8H 1PM5A 3K2LA 4UP9A 3U60A 2HCBA 4PD2A 2JA7H 4K0KL 4IUNA 1EOTA 1DO2A 2CKZB 2MP1A 3F8TA 4TVAB 3GLHA 5M3FH 1JMCA 1N33Q 4K2KA 3GTQB 5LMUM 2CHBD 3CF6E 4IALA 1UE7A 2CP8A 1KABA 4YY3M 1ILQA 3BBZA 1NMGA 2E5LQ 3J7A5 1G71A 5C3EB 4LF7L 2XZUA 1PH8A 1TS4A 2Q2UA 2HT1A 1QZHA 1PH3A 3GTGH 3D8LA 2EJGC 1SNCA 2F03A 1TY2A 2M9VA 3PMFA 4DKAC 4NXNL 1VQNA 1E9SA 2Z8LA 2R93H 2L4EA 2XSCA 1OXSC 3LWUA 1YITA 1E2WA 5C0XG 4DR6M 4GKJQ 1IN8A 1OFHA 4G4KA 5EBDA 1PH4A 4GITA 4N8FA 4A3JH 1V1OA 4GMQA 4JV5L 4FO2A 1BCPD 1AE3A 2E2HH 1A5TA 1XXHA 3LQQA 1SFOH 2JA6G 2CWPA 4A3MB 1D1IA 1MJGM 3AOEC 1GD7A 4J15A 2VB3X 3SDZA 1TDZA 3CCJA 2I7PA 2W82A 3DUZA 4IOCA 4A3GH 3E9IA 2PYKA 4GN5A 3H4JA 2VQFM 2ES2A 4B7FA 4F7XA 3T1HL 1Q90A 1ZQ9A 4JI5M 3TP5A 5IGEA 4G7ZC 1HFNA 4M1UB 1FNUA 1LO5D 4PG3A 4AKHA 2JY7A 3HOVG 5KPRA 4X65Q 1IM2A 3GRVA 4CJ6A 3HOXH 3PUXA 1CHQD 1NHWC 1G6PA 1FGUA 3NSWA 7CATA 2EJMA 1LTSD 2KHIA 1MN3A 2LS01 4EQOA 5FOBB 4LMQD 1DGFA 1HA5A 3RLFA 2C5RA 1TS2A 1R2ZA 3W0FA 4I65A 1Y1VG 3M7NA 2Y20A 1DXMA 1WOCA 2HCCA 3KLSX 3SMSA 4I7AA 2EZVA 3D31A 1NSNS 4BLCA 1PXUA 2B3TA 4X62Q 1F2LA 5IREB 5BR8L 4P71A 3GLIE 3TN2A 3M7GA 1VQKA 1N34L 2DZNB 3MC0B 1BCPC 3MZ5A 3OWFA 2MROB 1YUBA 1MSGA 4F88A 1NJGA 1VDZA 2JA5G 3WOEA 2VY3A 3OTOL 5C5MA 5C44B 4AYBE 4O0AA 4LF4M 4XTCS 1LV7A 1NE3A 1W6JA 4GIPA 4P73A 3E21A 8CATA 4XIGS 1EY4A 1IYJB 1S4ZA 1TH3A 2DKLA 5KNDA 5KYLA 3S1NB 1AZPA 3N52A 4B3MM 4C3IG 2JZ1A 3FYCA 4J6HA 4I81A 4IIWA 4L16A 4XQJA 1QUQB 4FCWA 3NXWA 5HGTA 1PRBA 1IZ6A 5IY0A 2QNJA 2Z7JA 1NCVA 2OXPA 4OVZB 4RFBA 4BY1B 4LJZC 2IY5B 1J8IA 1KDCA 2L1BA 4GKJL 1U0LA 3U61B 3K92A 2NZOA 4UPAA 2KCCA 2KENA 1YHBA 3STBC 2DY7A 5EXXA 1UM8A 3HHYA 1EQRA 2D0PA 2KBNA 3AJIB 5I4DA 4XQNA 4LF8Q 3E4RA 2JA8B 5BN4A 3CU7A 4R4CA 1YJWA 2F0UA 2PMZE 1IN6A 4HAEA 4RA8A 4A3DG 2FOIC 2I5LX 2JA7B 3KSJA 3CKIB 1N32M 3D8BA 3GRUA 4JBMA 3VR4A 1F9SA 3KS4A 2XNAC 2MJ8A 3VR2A 1S3OA 4KN4C 1PV4A 3DM1A 5LHY1 4LZZA 4X65L 4DV6M 4C3JG 4M0WA 5FLXS 1PYWD 5CYUA 2UXCL 2PPBC 2R93B 1PTOB 1X3PA 1Q1EA 5C5LA 4HJ5A 2Z4IA 2N49A 3KF8A 3I4NB 2A69D 4AZFA 1IYUA 2GVAA 4Z9CB 4B3TQ 2E75C 1CKNB 4NL4H 2IHFA 5CV7A 1IXSB 2R6GA 1JWSD 2F0EA 2K5QA 2QEXA 1BO0A 2EY6A 4GNXB 1IBMQ 5EQ0A 3L7ZC 2BJWA 1XNQM 5IT9c 4L5QA 2G8LA 3C3DA 2RSNA 1B7YB 1ESRA 3EA6A 5ELCA 4X62L 3S15B 4DR4M 1HQCA 4LRTA 1JB3A 1HNZM 2PCFB 3R2IA 4CDFC 1PH6A 4DFAA 3W0LB 2HKJA 5C18A 4OO1I 3THGA 4NXMM 1VS0A 2WAQB 2XTIA 2ICIA 5CGKA 1A0IA 3U6OA 2UU9M 1W6KA 2IHEA 3A5UA 3EIEA 4ABNA 3LCUA 3IHPA 1BBUA 1STHA 5IYCH 2AWNA 3L28A 1QAQA 2NBFA 3FKIH 2EOTA 3A7AB 2IT1A 4DAYA 4YWMA 3PV0A 4IPGA 4UP8A 2DAEA 4HIOA 2E2HB 4HL4A 2HD3A 2GQFA 3P7JA 5C4HA 5CV5A 4BBSH 2R7ZB 1LYLA 4DNRB 2G5GX 3CXCA 3T1YQ 2DY8A 1KFVA 2F3IA 2SEBD 3TMEA 1GXDC 1HH2P 1U4PA 2F4IA 1IBLQ 3L0OA 4KLNA 3M3YB 2QSFX 1NSFA 3VK8A 5A2QS 2N8NA 1IBKQ 1QNKA 4U68A 3PNYA 1DD2A 1UE1A 1SRUA 3G4SA 1C9OA 1LV9A 1GHJA 2APLA 1GUSA 3GD7A 3T51B 2Y21A 3T6PA 3I3CA 3PF4A 5LL6S 4Y52H 4D81A 3QO2A 5HY6A 2LBCA 4ITQA 3K5OA 4BA1I 1U9RA 2YTXA 4ILWA 4X3UA 1QE6A 2F5NA 3L29A 2VF8A 2R7FA 3GLIA 1L2DA 3P75A 4MH0E 3RLOA 5JVH3 3PUWA 5T1GA 1Q3BA 3S17B 4X3KA 3RZOH 4AH6A 3CMEA 4MIUA 5C4ZA 4WFN3 1E24A 2JWSA 3I91A 4H02A 2VUMB 4N8X1 5E1FA 1W2BA 3D6WA 1TTEA 2KQ3A 1XPOA 1LM0A 4LJ6A 4B3TL 2DUDA 3NTIA 3CCQA 4Y28F 1PYSB 4GH9A 1LTRD 4C1NI 3I4MG 5FK9C 1IBML 3ZJYC 2F0GA 3ULLA 2J0TD 5IGGA 3S2DB 1EFID 3E0EA 2GNOA 4DR1M 2LH0A 4OW0A 2E2DC 3NQIA 4DR5M 2E76C 2L2DA 1U4MA 2PZTA 3T16A 1HR0M 5KO3A 4BY7G 1BBXC 1AZQA 2F1MA 2NUCA 1CKMA 4MGYE 2QDBA 3PVSA 1JC7A 1Z6TA 4M0DA 3UMMA 3HWSA 2B2TA 2JUJA 4CKCA 2IWHA 1BKBA 4HSVA 2RDHA 2VL6A 1YNJC 5EPLA 4EQ5A 3VR3A 2YV5A 4K6LA 5G3LF 3V05A 5IODA 2K33A 4LF5L 2MFIA 1ZYRD 1DYQA 4X66Q 3ZC7B 2I5MX 4IBBA 2L4FA 3NBXX 4L5SA 3SFZA 1O80A 5EPKA 3AQQA 3Q22A 2KUMA 2Q2EB 2RCFA 3ND8A 5AFWA 1ET6A 3T1YL 1EIFA 2ZTEA 5CBAE 5IYDG 3H0GG 4KLKA 2EVBA 3HY5A 3A46A 1WI5A 1IBLL 2UUCM 1X54A 3BZDB 3C2PA 3KLSA 3SEBA 4UY8C 1IBKL 2UXBM 1TF0B 2JY6B 2WFWA 1D7QA 1PZKD 2RF4A 1F2ZA 5C4JH 3GTLB 3EJIA 5C3XA 5C3EG 3J80S 1GM5A 1R6BX 1EUJA 1SYCA 3U60B 3J2PB 2WB1B 3MVVA 2K50A 4LJ4A 4PMBA 2NTSA 1WTQA 1LUZA 1NR4A 3NWLA 4ZK9B 1A3UA 1B9NA 2SOBA 3TWMA 3HKSA 1IXRC 5TSSA 3L27A 4BBSB 1PJQA 2NVXB 1O7LA 1D1KA 3K8AA 3QWLA 2EYLA 2R0IA 3GQBA 3N6RA 2LVAA 3FTEA 1S40A 2I46A 4Q0FA 4JI1Q 3M85A 4AKGA 1H9MA 2BH8A 2JSOA 3RZDH 1HHVA 4IURA 1J5EL 4NSOB 5DM63 2DENA 1LTAD 1VQ6A 3K0YA 2WKCA 2J7NA 4KY5A 4APVA 4B3RQ 2LTUA 1YJNA 1T5XD 2AQ1B 4CJ0B 4GC5A 1ZMVA 2K5HA 4HEDA 1UE5A 1L1ZA 2EJFC 4RGMA 4LF9Q 1E32A 1GUNA 2BA0A 2O5JC 1XXHB 1TDHA 2KNAA 1K3RA 2K6BA 3NBHA 4GN4B 4IQZA 1IXZA 4A3KH 3NWTA 1SE2A 1K28A 3D4WA 3UGJA 3E46A 1DGSA 4HMJA 5M5WH 3B89A 3GLFE 1I6HH 2Y0SG 4YHHM 2XF3A 4R4IA 2MH8A 3AYHB 2GVBA 1EYGA 4RHRA 2F5QA 5EP3A 1VQ7A 2ZXOA 5E26A 1EY9A 5LMNW 5IP9H 1STBA 2J4XA 1VEGA 1G91A 4IFDG 3FKEA 4DAVA 4UDUC 4QGUA 1Q46A 4X66L 1EIHA 3IFDA 1C7YA 1FVIA 2KHHA 2AKWB 5ELEA 3VDYA 3I04M 3TP8A 3GV6A 3KFUG 3CQZB 1KNAA 2LVOC 5A35A 4DR7Q 2G3QA 4HCSA 4J1MA 5K36H 2R4JA 1G8PA 1QUQA 2Z8YM 2F0LA 3D4RA 5CORA 5M3MB 1CQFA 4R1JA 3HKZB 3D4DA 4LW1A 2LHCA 4DR3L 4RGNA 4OVZA 2UUBQ 2AQ3B 1QB5D 4M8AA 4K14A 4UAIA 1KC8C 2PW5A 4DUZQ 1E22A 4O42A 3VKHA 2DAKA 3K5MA 1Z47A 1PFNA 3JAMS 5FLMG 2CQAA 2CFOA 4S12A 5KPTA 4MGKE 2MPMA 5IGDA 1MU5A 3J80i 3E5SA 3AV0A 3C9PA 1QZMA 4CDEC 2OO9A 2IJ0A 2R3ZA 1LABA 3MEFA 1FGBD 1WFQA 1PFSA 1ZMWA 4FW9A 4BY1G 3CCUA 3AU7A 1I5FA 3U4ZA 2D7GA 4CKBA 1KIXA 4LJ9A 5CV8A 1WXQA 4XK8F 4C3HB 3PIO3 3HU2A 3VYRA 4JI4Q 2Z4SA 3C58A 2F0SA 1AP0A 1HRJA 1RKNA 4JI1L 4QHSA 5EAYA 1EIJA 3NQTA 4TUWA 4LUVA 4R4QA 5IWAQ 4NC6A 1TS3A 5M5YH 4DV5M 2JA7G 4ZPXA 4A76A 4XGIA 5FTKA 5F3WA 2B8FA 1NMFA 5J3BA 4JI6L 1LTMA 5LMNQ 2UUAQ 2WKDA 1Q1BA 3EVQA 3I4LA 3PIPA 3U6PA 5C4JB 1A8VA 1VQPA 4JYAQ 2ZJRA 3RLNA 5FO9B 5IP7H 3PO2B 1G41A 4DUYM 3DA1A 1SN8A 4ZUJA 3PO3H 4LG2A 1N36Q 4YCWA 4NRVA 2A5YB 4G4QA 1SMYD 1N8RC 3MTSA 1KAAA 4AW4A 1YNNC 4ANRA 5C1BA 2SNSA 1RU3A 1HZBA 5KPZA 4IPHA 4YWKA 2R44A 3QAUA 2BCOA 3I4NG 3GTKB 3S14B 1PHJA 4IJLA 3MA2B 1CZGA 1NAPA 3A55A 3HOWG 1H95A 4PQXA 1YJ9A 4L5RC 3QJYA 2B2TC 1LLRD 1XMQM 4ZYSA 2CWAA 5J39A 3K59A 2X6GA 4JI2Q 3KF8B 4OX9Q 1F77A 4IBFA 4R71A 1JICA 2HHHQ 2WAQG 1XXGA 4RKLA 2CHGA 4JOIA 3R93A 2DI0A 1SJHD 1DOKA 5J22A 2V4DA 5EJWA 3HRZC 1YI2A 1SXJD 2RDFA 2L55A 2JZ0A 3KXEC 4DR7L 1OIZA 1HCZA 3T53B 1XNRQ 1ORYB 2JP1A 3V96A 4A3KB 3S1QB 4GZYC 4F87A 3I56A 5EP4A 1R4GA 3OPOA 4UHVA 2UUBL 5FJ8H 5M5WB 5JJIA 3FYDA 2R7ZG 1I6HB 4DV1Q 1X65A 4DUZL 4L8JA 2OT2A 1SMYC 4LFBM 4B9WA 3Q23A 2L7HA 1AEXA 2N88A 1NTGA 2VXWA 2B3GA 5CV4A 2CCZA 5C6AA 2KHSA 1CA6A 4D82A 3KW6A 3FPUB 4DV4M 1TWHH 2JE6I 1C1KA 5ITXE 4JK1C 5COYA 4JN6A 2K7VA 3GTOH 2Z3XA 5EKLA 3PUYA 4RF0A 4JI3M 4Y7NH 2ZM6Q 3UDGA 2LHGA 3W67A 2PI2E 3AFPA 2JEAI 2RVLA 4JI4L 3GLFA 3I72A 2LSSA 3VR6A 3J7AF 3A8JE 4AKIA 3K81C 2IX0A 2NVYH 5IWAL 3HOUH 2BE5D 2C9CA 2D7EA 5FKAC 1BQQT 1Y1WH 3BYYB 5JI3E 1NJIC 3S1MH 3FMCA 4LUOA 5EP2A 5I6YA 4DNIA 4IBJA 2UUAL 1SYBA 2H1RA 2V1UA 4JYAL 3NUCA 1OJLA 3D8GA 4JV5Q 1D8LA 5CV9A 1GUWA 1T9HA 5JJLA 1L8QA 2YU9B 2VUMG 3K9OA 3GLIB 3QG1A 3FTDA 3D3RA 4A3BH 1HPCA 5NUCA 1HJPA 5C4XH 4A3EH 4LJ8A 1EFUB 3LGJA 3I4OA 4DV0M 4MGIE 3FDTA 1EU4A 3UDIA 1FJGL 2B2UC 4KHPQ 1KDAA 4K0KM 2K28A 1SJED 2XIWA 3DEPA 3X3MA 2CHQA 2A6ED 1GHKA 1BVSA 1F2YA 3RNUA 1E1OA 4AYBB 4E6IA 4JI2L 2WSCF 5JOBA 5KIXA 4JI7L 1Z5BA 1PRTD 2QA4A 1E9RA 2HHHL 5C0XJ 1I50B 5DM73 4LF7M 1EWCA 4RCOA 1CTMA 1XWEA 4YY3Q 2XFTA 1RD9D 5BR8Q 4NXNM 1EQQA 3PO3B 2XGNA 3TZUA 5IT9S 1XNRL 1JWUD 3R9XB 1SNOA 3PIOA 4PZ8A 1SNMA 2VW9A 3ILKA 3PUVA 3QYEA 2XRSD 4JI8Q 1LTLA 4B7HA 4LZJA 2RCNA 2SDFA 3TE6A 1FR3A 5C3WA 3JAMc 3SYKA 1R7RA 4XT3B 4KKSA 1SAPA 1J6QA 5A2QE 1PJIA 3ITPA 2X4AA 5ITRA 4QL5A 4KMUC 3OTOQ 3GV3A 2AWOA 3S9WA 1GO5A 3U9SA 5EPJA 3ND9A 1NNJA 4B9XA 5KNBA 2CV1A 3KOXE 1Q02A 2PMZB 3KOZE 3NEMA 4IOAA 3T1HM 2ZM6L 1UWVA 3GO5A 2J7ZA 2VQFQ 3F2DA 3JR4A 4QUCA 2HQEA 2A74C 3MMPA 5KQDA 1PJJA 2G5DA 2WB1G 2Z4HA 4PZ6A 1GKHA 3M4QA 1IL2A 2J5YA 4QNMA 4R8IA 3L3OC 2F0WA 4RNAA 2QCUA 2RHSB 4A3IB 1ASYA 1QZEA 4OWWB 2EUCA 3ONAB 4XXEA 3KF6B 1Y14B 4ODGA 1EY6A 4BBSG 4G7OC 1NNUC 2Z6BA 4OEMB 3KP0E 3TZDA 2KCNA 2PQEA 1RJTA 2K03A 3O13A 3BVMA 5JJKA 2F0IA 3FP9A 1XHBA 2BA1A 1BCPF 1N34M 3OW2A 1I4WA 4ZRZA 1N75A 1HA6A 4LJ5A 2NZ1D 1QUSA 1G51A 1TQOA 3GTOB 4Y7NB 3SHGB 1K82A 1EZ8A 5IGFA 4PNYA 1DGHA 2F5SA 3M4OH 2PQAB 4II7A 1LTGD 4XQQA 3RN5A 4KHPL 2UXCQ 4OU7A 3FTFA 2F0JA 1CZWA 3K8ZA 1N33M 3HOUB 1VQDA 1Y1WB 1DGGA 2EE1A 4BB9A 3SE0A 4KHVA 4LF4Q 3GQ4A 3GRRA 2RKOA 1VF7A 5ITXA 2E5LM 1EY7A 4JOIC 3T56B 4IBEA 4XYOA 4YY3L 2K05A 3NBHB 2Z9HA 2I5HA 1E94E 4JW0A 2ZXPA 1PH9A 3RFWA 1PVOA 2KRUA 4JXJA 1OXXK 1HT2E 3EQLC 1VG5A 1B4OA 4TSSA 4GKJM 1HQRD 4JI8L 1VCIA 1KXLA 4DNTB 3C1FA 2DZLA 3I51A 4A3BB 3MWYW 3B7ZA 4A3EB 3GLGE 1A6XA 1YSYA 1OTCA 1LACA 1GUOA 1C48A 1PJSA 4Z8XA 2JYOA 1T43A 3BZKA 2QW7A 1M8AA 1NBWA 1EWHA 5M3MG 1GVPA 1Q86C 1RL2A 3BDCA 3JC66 5ITYA 3CMAA 3PF5A 1Q39A 4DAPA 2B2WA 5DLQE 1KL9A 2DZOB 1SE4A 1N32Q 5KYIA 2YTVA 1M1KC 4DK1A 2VQFL 2ID0A 4HTHA 1XPUA 2X6LA 1UAPA 5D3IB 4A3CH 4Q7JA 1OAIA 2DGYA 4LAAA 1I4GA 4JI5L 4KI0A 1R4QB 1IQPA 3NPPA 4I8OA 1JB7A 4DV6Q 2OOAA 3AFHA 2P5ZX 2F0QA 1E0BA 4GEWA 2EQSA 5AJ3L 1CQVA 4PDGA 4H13C 2N78A 5E3FA 1L0YB 1Q3CA 2WV6D 3J7BA 4C3HG 1DONA 5EBCA 3S16H 5ITUA 4RF1A 4X62M 1H9SB 2V6ZM 1IXRA 5M3FB 4LFCQ 4ULLA 3X3NA 1OXTA 1Y8OB 2KCTA 3K58A 1ZMUA 1H9JA 2NN6G 4IPCA 1AN8A 2DHYA 4HLQA 3TSSA 4LGMA 4RWSC 1I4XA 5GAEC 4OXPA 3SR1A 3GTGB 1PZID 3PO2G 1QDTA 3G6JB 1TVXA 4GOPC 1NO1A 3H4MA 3BVGA 4ZKCB 3S1RH 1RODA 5DEHA 1YBYA 5GROA 2P5TA 4CDCC 1TH2A 4KJNA 2KW0A 1R4PB 1W5TA 1QJOA 4JG2A 1K8GA 4LF4L 3I55A 4A93G 4FWDA 5GKNA 3L25A 4OIKA 1S72A 5A2QL 4A3JB 1RTNA 2DHRA 2BDNA 2PW7A 2Z6KC 4NSRA 4QOZC 1A3VA 4B3ML 1SFOB
chains in the Genus database with same CATH topology
2XWBB 3LNNA 4LY6A 1S5FD 4QIWB 4RGOS 4A3GB 1RCVD 5T1IA 3HHZA 1AFPA 1GVNA 3A56A 1B2TA 1SXJE 1ZXTA 1PFBA 5KQ8A 2YNMD 4LF8M 1S5BD 5FTNA 3HOXB 3DZDA 3AMUA 1Z59A 2FHTA 3FUXA 1VMCA 5JJZA 1KTKA 2IL8A 3VYSA 4MHEA 5H37D 4P16A 3T13A 4K8JA 3QOLA 1D2BA 2X8AA 3CF0A 2RGOA 2A69C 3J81E 1BCPB 4IBGA 4AG6A 4PDIA 2F0DA 4FF4A 2EYOA 1GKIA 4B3TM 3CTWB 3TP6A 5C0XH 5EJCA 2A68D 5ELDA 5E6JA 1ILPA 1NHGC 2YYZA 1IBMM 2JEBI 2QKIC 4L6TB 1KYIA 1LTTD 3FPPA 1EEFD 1JQJC 4ZLTF 2AQ2B 2KJXA 1O7YA 1C8CA 2Z4RA 3GLFB 3Q24A 4IN3A 3C46A 1FNVA 1K3WA 1SBBB 2CHVA 5KRUA 1WTRA 5BPVA 3VYTA 3QB3A 4FXGC 1EEID 3VK7A 4IUVA 3H6MA 4FF1A 4GHLA 2TMPA 3T1YM 4KY6A 2NWGA 3SK6A 1IBLM 1OO9B 4CKEA 2A68C 3L2AA 1Y8NB 2WINB 1IBKM 1SE3A 3Q0AA 4YIJA 1PZJD 2RQXA 3SATA 4L15A 2L5TA 2XWJB 4PMCA 2QENA 3HGBA 1SYEA 3HS0C 3VYUA 1Z6HA 3S1RB 1I4HA 2QP9X 4EIWA 1K8MA 4NOOB 1IYVA 1DM0B 3GPXA 1G4AE 2JA2A 4LJAA 3I70A 1FNWA 2B2WC 3L9AX 3KVWA 5F2DA 1EU3A 1CM9A 3R8FA 3VKGA 3JR5A 4HR7B 4BBRB 4RGTA 2V1CA 3J7YW 1HQMC 3KBXA 2R65A 3LX0A 1DGBA 3HGIA 5JI2E 3A42A 2L9HA 1IY0A 3FKIB 1SDFA 1BF4A 1Q3LA 4M9SA 3SARA 1OXVA 4IFDJ 3URYA 1E2ZA 1SYFA 3J27B 1JOQA 3U6LA 1ZYRC 4OIJA 4H7BA 5JAVA 4V190 3FEWX 4I7ZC 2WP8J 1SXJA 4QCLA 2KECA 1JR0D 3KLRA 4OO1G 4X66M 3RE8A 4BS9A 4Z6YA 4RKBA 3H09A 5DNFA 3EROA 3WHKA 1I3QB 3IG5A 1TU2B 2OEOA 2M2LA 1ML0D 1Z5AA 3K1JA 1G6ZA 4CJ2C 5FTLA 2B2YA 3WOFA 3HG9A 2D5DA 1DGHB 3RZOB 4FCVA 2XEPA 2RA4A 4G4OA 2B2UA 1L1TA 2CV2A 4KTAA 4NMZA 5D3DA 3J81L 2O5IC 3MXPA 5ITQA 1S3SA 2LXEA 3SXHA 1D6EC 1EYAA 4FWHA 1NUCA 1I4RA 3UK6A 2ZT9C 4EGVA 3A45A 2XRQD 3HOYB 1RHPA 4H0LC 3OSOA 5CC4A 3NHHA 1Y1VB 2EO2A 5M9OA 3T4AC 4FD2A 2KVMA 3AL0C 3HKPA 1HTPA 3VR5A 4DV3M 4KKTA 1N77A 4B3RM 2DVWB 2ZAOA 1ZKOA 2XZFA 4LF9M 1DO0A 3DOAA 3GPUA 3AB9A 1SSOA 2TSSA 1H9SA 2DNCA 2EYPA 2L6OA 2F0KA 1XTCD 5I9OA 1DOLA 1QG7A 5K5PA 4CBVA 1QQWA 1EYCA 1ET9A 2UXDM 5I9PA 5D65A 1LTID 1IKLA 2PZWA 1WTPA 1M4VA 3CRKC 4FVMA 2R4EA 2C96A 4X3TA 2BDOA 1D5MC 1IL8A 3MAQA 3HP3A 2E2JB 4OL7A 3BVZA 3HJQA 2K47A 1TWAB 1A15A 4GRIA 3MFGA 4KN7C 3M0EA 4DR7M 4FWGA 5EXTA 3TQSA 1PDQA 4MGZE 3SHLA 4ZKBB 3J7AS 1BXTA 3RUZA 3SVMA 3F2UA 2UUBM 2IW3A 2AHMA 2EPBA 1PFMA 2L11A 4G57A 1S5CD 1MGSA 1IN5A 2HDLA 4L4UA 4B7GA 1STGA 1TIID 3RZDB 1GJXA 2RBMA 2R18A 2LFNA 2O2LD 4IBKA 3HHXA 4I4LA 3DXJC 1CHPD 4Q5VA 1J9OA 4AG5A 3EFXD 3KS8A 4IUPA 1IKMA 5C0XI 4JI4M 1I4PA 1SNDA 5EXSA 3GPPA 2F3WA 5IWAM 2QILA 4X64M 5KGUA 1NY6A 2Y0TA 2VIIA 3LQRA 1II3A 4A3VB 1I6VC 2UUAM 5LMNM 4QMGA 1IN7A 4L63B 3MXGA 2FE8A 4JYAM 3W3AA 5JEAJ 5JPNC 1EQVA 1SYGA 3SYLA 2ZANA 5EP1A 1N36M 4BBAA 1XYIA 1GUGA 1JORA 3SK5A 2Q8IB 1N78A 3NBIA 3OHXC 1O78A 1ENFA 3UI2A 3QWNA 2OQ4A 3HEJA 1OFIA 5CV6A 3BDLA 1SXJC 5LL6X 4OX9M 3NTKA 5KEEA 1EYDA 3P20A 3SASA 2G9DA 5FLXE 1SYDA 1ENAA 2KRKA 1A2UA 2XSZD 4IUUA 4J8QA 3VDPA 4PT5A 3HOZB 1V1PA 1JR3D 4LF6M 4B3SM 1IY2A 3E9SA 2B2YC 4DV1M 1SXTA 3MHVC 2B2VA 3IL8A 4ZQ3A 1QILA 2CV0A 1J7KA 4BWGB 5M5YB 1IY1A 4IBCA 5JVG3 1E2VA 4IJFA 4IBIA 4IFDH 1ICWA 3CF2A 4XYQA 1WTXA 2I7NA 3K5NA 4S3SA 2ZM6M 2BE5C 1PRTF 3UJNA 3U5ZA 2K6AA 4R9WA 2CE7A 4A3FB 2K5WA 4N9TA 4REZA 2F5PA 2JXMB 1VDDA 2ENBA 3A8IE 5I2YA 4F8MA 4JV5M 2MGSA 3OIPA 4OHJA 5D14A 5E4WC 3KOWE 3J7AV 4C1NK 1PTOD 3NE5B 3HJ8A 5E4XA 4DGZA 2Z1CA 4LCBA 2A6EC 2EY5A 3GTMB 2GA4B 4NRWA 4DXFA 3MFYA 1G291 1PRTC 1KSFX 3B9PA 4KHPM 3C1EA 2EYFA 2QZ4A 2CW0D 2OF1A 3MJ5A 1MSHA 4WURA 4V0BA 2D62A 2FINB 1WD1A 1AW7A 5BR8M 1CA5A 2Q8RE 4KD4A 4JBWA 2KEBA 1TWHB 1I4QA 1VF5C 2LY7A 1STNA 4JI8M 1B53A 3VDUA 1PTOH 4P2CB 1PTOC 1S5DD 1JWMD 3OTOM 1BR9A 1SXJB 2QEJC 2CVRA 2NVYB 3TBIB 1JOOA 2K5DA 3S1MB 3U6CA 2NVQB 2D2CC 1NVMA 2CW0C 1V43A 3AOGA 5FTJA 1SEBD 3U6QA 5I6WA 4ME5A 3DMUA 3MXUA 4X3SA 4IJEA 2D7HA 2NQ8C 2HCIA 2NB0A 1LT5D 4CJ1B 2N55A 4K5WA 2L7IA 4M9XA 5C4XB 2Y0SB 4XDXA 2B63B 1HXYD 3C3LA 3S2HB 2YFQA 3E0JA 3U6DA 1EQTA 2KZSA 4NKLA 3M4YA 3RGSA 2EXZA 1XC8A 1PMRA 1TS5A 3J80E 4GC9A 3BS1A 5FSWA 2SNMA 1KDBA 1TWCB 5FO8B 4KY7A 1U4LA 1CFMA 5FLXL 1B44D 2DWZB 4X65M 2DWNA 2UXCM 4CGYB 3HJSA 2F5OA 3RGPA 5DNYA 1TR5A 2LMCB 4O1NA 2MUYA 5BN3A 2CUZA 3GQ3A 3E6ZX 3L26A 1MX0A 2HL7A 2OPFA 3K7AB 2QBYA 4KD3A 3SAUA 1TY0A 2XVSA 3FVQA 4LK1C 3K6OA 4PV1C 1ESFA 5FTMA 1QCBD 1R9TB 2ZAMA 4D80A 2IX3A 2F3VA 1PRTB 2RGHA 1QNUA 5JEAH 3NP8A 2B2VC 1QVRA 1PLFA 4RCNA 3K57A 4TKOB 2VNUD 1X32A 4FNFA 3D6CA 2K1BA 2KA6B 1D5ZC 4FF2A 3AKZA 1WVLA 1HFGA 1B9MA 2ERCA 3R8BA 2AUJD 4QHTA 2LKVA 3MK6A 3IFTA 3H94A 4M9ZA 1JQYD 3RD4A 3HU3A 3OWEB 3I73A 1EY8A 2F0MA 1WTWA 3K5LA 2FJ2A 4IZ8A 1NJFA 3M4OB 4TRDA 2DXIA 3HOWB 3KSXA 1B1ZA 1CT1D 4W5WA 4LFCM 1D2NA 1BDOA 3WDNA 1FYCA 1TH4A 3JAME 1KLUD 1DCZA 4NP5A 4CHTB 1Y69U 5EKIA 3H91A 2X49A 3PNVA 5ISRA 3GP1A 2WIIB 2WACA 3HU1A 4PMWA 2F0HA 2F0TA 2YQZA 3DFZA 4R7GA 4ZUIA 5ITTA 2LNHC 3MHBA 3VLFB 2EA0A 4U673 1H9KA 1STYA 2QCPX 2O4XA 2L12A 4K8IA 5CMDA 2CEAA 4H44C 2X69A 3WHLA 5K36G 3U6EA 4DN4M 4DF7A 1BUVT 1U4RA 4NDXA 2ICEC 3MXNA 4DU9A 4MM3B 1T5EA 2M60A 1STAA 1WTOA 4IFDI 4KHZA 2FFKB 1G59A 5I2XA 4WJWA 2F0NA 2ZBKB 1HUMA 4LJ7A 2EYMA 2LWXA 3GLGA 2F0PA 3SBJA 2I07B 3IKJA 4LF5M 2QF7A 2C99A 3SMPA 1HUNA 1EL0A 3H3VC 4AQYM 3SAWA 1H6UA 2R46A 3FTCA 2R62A 1YNJD 3S16B 1B50A 1Z7TA 3ZCBB 2A5HA 3FUWA 1V1PB 1F9QA 2XN9C 5IZ7D 3W2DA 3J80L 1QAOA 3QOJA 3OMCA 3LVVA 4DR2M 1KNEA 1XMOM 2DWMA 3IAYA 2EYHA 3ERQA 4DV7M 3A98B 5CBEE 5KNCA 4LRSA 1RTOA 1A3TA 1STEA 4B08A 3GRYA 1ENCA 1HNXM 4N9PA 3U5ZB 1NY5A 4DV2M 1QOHA 3FUUA 2M5ZA 3KP1E 2K32A 1JCKB 2E2IB 1J5EM 1G2SA 3DHQA 3LVWA 4FYDA 1F2MA 5G3LD 3VFDA 2L0CA 1DJRD 1F9RA 1EE8A 1FD7D 4K5VA 1WCMB 3GO8A 4MN3A 1UUPA 4K5XA 3TDQA 3PIP3 1JE4A 1ZAEA 1HQYE 5ELBA 3R2TA 2K01A 2KXEA 1LT6D 2H4OA 2R92B 2EY2A 1IHZA 1K8OA 2DWLA 1QAMA 3G7LA 1D5XC 3I90A 2FMMA 2NN6H 3RMHA 3GTJB 1HTLD 1XX8A 3IG8A 4C2MB 2IPKD 1G2TA 4EVOA 4RHSA 2BNKA 4KJOA 1QANA 3GLHB 1IW7D 5IGBA 1X37A 5CR3A 5ELFA 2RKSA 1EY5A 3OOCA 1K3XA 4EQPA 3GP7A 3A8KE 2L09A 1QWYA 1W5SA 2Y0QA 1XWIA 4DR3M 2JA6B 3SK4A 3JAML 1X3QA 1J09A 3KOYE 5IT9E 3OW7A 1SNQA 2XLJA 2KEDA 1L2BA 5IOCA 3HOVB 2A6HD 3CHBD 4OGQC 4CISA 1ONLA 4QF4A 4AI6A 2F4VM 2K04A 4XBOA 4KK7A 4QNRA 1T3TA 2F0OA 1BOSA 1CK1A 1LT4D 2XH9A 2C9OA 5IGCA 3P1HA 4JI1M 1IW7C 4WW0A 4I5SA 3I8ZA 3KBGA 4K6DA 2XSZA 4JI6M 3BDOA 2H1EA 1JR3A 5HURA 1H9RA 2O5RA 3M6AA 1DOMA 1A2TA 2JA5B 1GL7A 3BYTB 3DWAA 1QYRA 2MHVA 2KOLA 1WD0A 2IX1A 3NK9A 1EIGA 4IUQA 3LMMA 3FUTA 2A6HC 4WRDA 1DZ1A 4MB7A 4G4RA 2F0VA 1LTBD 3U61A 4C3IB 2BJVA 1GUTA 1WTVA 4HN7A 3T38A 1YNND 3VA5A 1Q12A 2KA7A 3U6MA 3TWKA 3I4VA 4TQUS 1LT3D 1Z5CA 5M5XB 3J81S 4QOSA 2QBYB 3T15A 2R45A 3DWQA 1TWGB 2ZXRA 1F9PA 2F0FA 2XFSA 3KDSE 1CI3M 3Q6SA 4A3DB 4BA2I 2M00A 3FRPB 4RH6A 3U6SA 4DUZM 1KLGD 3ZH9B 1L0XB 2VQEM 1K83B 4DK0A 3U9OA 2AUKA 4KO8A 2B8GA 3R3OA 4ZAIA 2Q8TA 3AOEA 4C3JB 3UZUA 1G3IA 3PFIA 1OXUA 1IN4A 1VMPA 3A7LA 3LWEA 2KZUA 3ZYYX 3TWLA 5EQTA 4JI0M 2A73B 1TT2A 1V8QA 3NWSA 4A93B 1MBYA 1UNSA 5BN5A 2KEEA 5JPMC 4HMIA 1TWFB 2L4NA 3GQ5A 1R2YA 2RDGA 1NR2A 1EZ6A 4GHAA 3HHWA 5DAUA 3A54A 4FP5D 4HSPA 3PXGA 2YR0A 3QIAA 1HNWM 2B39A 4KKUA 1FNNA 1BNZA 3FD9A 1G8ZD 1MI2A 1B3AA 3BOSA 4LGYA 2BOSA 4R8NA 1EY0A 1HT1E 3EIHA 1FJGM 2FFJA 4KODA 1O7ZA 4G6ZA 3GTPB 2PO4A 2C5CA 3BG3A 4C56C 2QPAA 2EDGA 4LFAM 2D9UA 4JI2M 4G4NA 4JI7M 4FCTA 2HHHM 4OO1H 3SAVA 4IUTA 5IT9L 2J7OA 1TKWB 1JOKA 4FXKC 1TGUA 1XNRM 3FUVA 2VB2X 3KUPA 4QUCA 3MEHA 4K2LA 1Q8IA 5DYIA 1GOZA 4DXGA 5J1ZA 3OMGA 2HUGA 1GLNA 3TP7A 2E74C 1ZEQX 2PNRC 4PCZA 1L2CA 4XT1B 2EY1A 4WORA 2C98A 3GLGB 2FNAA 3I4YA 4FF3A 1MD2D 3HZXA 3GPYA 3V2TA 5EXPA 2FMCA 4L8RC 2NYZD 4MGHA 1RF2D 4G7HC 1UEAB 1YE9A 4FXDA 5FO7B 1Y8PB 5DYGA 1GL6A 4KV6A 4R3DA 4RAUC 1I94M 3NTHA 5JEAG 3I4MB 1S5ED 4QB4A 4ID6A 4DA2A 2EYJA 3CRLC 1C4QA 3SC3A 3VA7A 5IIFA 2RSOA 4BY7B 2NN6I 2DN8A 3Q8XA 1SNPA 2NTTA 2PZUA 4HCEA 3TL4X 4EQNA 2NVTB 3TPZA 4IBDA 2R61A 4L78A 2HDMA 3DEOA 3OIQA 2G9HD 1PTOF 3SHFA 4NW2A 2DNEA 4GKKM 4QUFA 5EGTA 3DWPA 5EKKA 3PUZA 3SK8A 1RDPD 3H0GB 3KK7A 1PM5A 3K2LA 3U60A 2HCBA 4PD2A 4IUNA 1EOTA 1DO2A 2MP1A 3GLHA 4K2KA 3GTQB 5LMUM 2CHBD 3CF6E 4IALA 1KABA 4YY3M 1ILQA 5C3EB 2XZUA 1TS4A 3D8LA 2EJGC 1SNCA 2F03A 1TY2A 2M9VA 3PMFA 1E9SA 2Z8LA 2XSCA 1OXSC 3LWUA 1E2WA 5C0XG 4DR6M 1IN8A 1OFHA 4G4KA 5EBDA 4GITA 1V1OA 4GMQA 4FO2A 1BCPD 1XXHA 3LQQA 4A3MB 1D1IA 3AOEC 2VB3X 3SDZA 1TDZA 2I7PA 2W82A 3DUZA 2PYKA 2VQFM 4B7FA 4F7XA 1Q90A 1ZQ9A 4JI5M 3TP5A 5IGEA 4G7ZC 1HFNA 4M1UB 1FNUA 1LO5D 4AKHA 5KPRA 1IM2A 3GRVA 3PUXA 1CHQD 1NHWC 3NSWA 7CATA 2EJMA 1LTSD 2LS01 4EQOA 5FOBB 4LMQD 1DGFA 1HA5A 3RLFA 2C5RA 1TS2A 1R2ZA 3W0FA 4I65A 3M7NA 2Y20A 1DXMA 2HCCA 3KLSX 3SMSA 2EZVA 3D31A 1NSNS 4BLCA 1PXUA 1F2LA 5IREB 3TN2A 3M7GA 2DZNB 3MC0B 1BCPC 3MZ5A 3OWFA 1YUBA 1MSGA 4F88A 1NJGA 1VDZA 3WOEA 5C5MA 5C44B 4LF4M 4XTCS 1LV7A 1W6JA 4GIPA 8CATA 4XIGS 1EY4A 1S4ZA 5KNDA 1TH3A 5KYLA 3S1NB 1AZPA 3N52A 4B3MM 4C3IG 3FYCA 4J6HA 4I81A 4IIWA 4L16A 4XQJA 4FCWA 3NXWA 5HGTA 2Z7JA 1NCVA 2OXPA 4OVZB 4RFBA 4BY1B 4LJZC 1J8IA 1KDCA 2L1BA 3U61B 3K92A 2KCCA 2DY7A 5EXXA 1UM8A 3HHYA 5I4DA 3AJIB 4XQNA 3E4RA 2JA8B 5BN4A 3CU7A 2F0UA 2JA7B 1IN6A 4HAEA 4RA8A 2FOIC 3KSJA 3CKIB 1N32M 3D8BA 3GRUA 3VR4A 1F9SA 3KS4A 2XNAC 2MJ8A 3VR2A 4KN4C 3DM1A 5LHY1 4LZZA 4DV6M 4C3JG 4M0WA 5FLXS 1PYWD 5CYUA 2PPBC 2R93B 1PTOB 1X3PA 1Q1EA 5C5LA 2Z4IA 3KF8A 3I4NB 2A69D 4AZFA 1IYUA 4Z9CB 2E75C 4NL4H 5CV7A 1IXSB 2R6GA 1JWSD 2F0EA 2K5QA 1BO0A 2EY6A 5EQ0A 3L7ZC 2BJWA 1XNQM 2G8LA 2RSNA 5ELCA 3S15B 1ESRA 3EA6A 4DR4M 1HQCA 4LRTA 1JB3A 1HNZM 2PCFB 3R2IA 4DFAA 3W0LB 2HKJA 5C18A 4OO1I 3THGA 4NXMM 2WAQB 2ICIA 5CGKA 3U6OA 2UU9M 1W6KA 3EIEA 4ABNA 1STHA 2AWNA 3L28A 1QAQA 2NBFA 2EOTA 3A7AB 2IT1A 4DAYA 3PV0A 4HL4A 3P7JA 5C4HA 5CV5A 2R7ZB 4DNRB 2G5GX 2DY8A 1KFVA 2SEBD 3TMEA 1GXDC 2F4IA 1U4PA 4KLNA 3M3YB 1NSFA 3VK8A 5A2QS 1QNKA 4U68A 3PNYA 1DD2A 1LV9A 1GHJA 1GUSA 3GD7A 3T51B 2Y21A 3I3CA 5LL6S 4D81A 3QO2A 4ITQA 3K5OA 4BA1I 1U9RA 4ILWA 4X3UA 1QE6A 2F5NA 3L29A 3GLIA 1L2DA 3P75A 4MH0E 5JVH3 3PUWA 5T1GA 1Q3BA 3S17B 4X3KA 4MIUA 5C4ZA 4WFN3 3I91A 2VUMB 5E1FA 3D6WA 2KQ3A 4LJ6A 3NTIA 4GH9A 1LTRD 4C1NI 5FK9C 5IGGA 2F0GA 2J0TD 3S2DB 1EFID 4DR1M 2LH0A 4OW0A 2E2DC 3NQIA 4DR5M 2E76C 2PZTA 1U4MA 3T16A 1HR0M 5KO3A 1BBXC 1AZQA 2F1MA 2NUCA 2QDBA 4MGYE 3PVSA 1JC7A 1Z6TA 4M0DA 3UMMA 3HWSA 2B2TA 4CKCA 2IWHA 4HSVA 2RDHA 1YNJC 5EPLA 3VR3A 5G3LF 4K6LA 3V05A 5IODA 2K33A 1ZYRD 1DYQA 3ZC7B 4IBBA 3SFZA 1O80A 5EPKA 3Q22A 2KUMA 2Q2EB 3ND8A 5AFWA 1ET6A 5CBAE 2EVBA 3A46A 2UUCM 3BZDB 3C2PA 3KLSA 3SEBA 2UXBM 1PZKD 1F2ZA 3GTLB 3EJIA 5C3XA 3J80S 1R6BX 3MVVA 1SYCA 3U60B 3J2PB 2WB1B 4PMBA 4LJ4A 2NTSA 1WTQA 1NR4A 4ZK9B 3NWLA 1A3UA 1B9NA 2SOBA 3TWMA 1IXRC 5TSSA 3L27A 4BBSB 2NVXB 1O7LA 1D1KA 2EYLA 3QWLA 3N6RA 3GQBA 3FTEA 2I46A 4Q0FA 3M85A 4AKGA 1H9MA 2JSOA 1HHVA 4IURA 4NSOB 5DM63 1LTAD 3K0YA 2WKCA 2J7NA 4KY5A 1T5XD 2AQ1B 4CJ0B 4GC5A 4HEDA 4RGMA 1L1ZA 2EJFC 1E32A 1GUNA 2BA0A 2O5JC 1XXHB 1TDHA 4IQZA 3NBHA 1IXZA 3NWTA 1SE2A 3D4WA 3UGJA 4HMJA 4YHHM 2XF3A 4RHRA 2F5QA 5EP3A 2ZXOA 5E26A 1EY9A 1STBA 2J4XA 1G91A 4IFDG 3FKEA 4DAVA 4UDUC 1EIHA 3IFDA 5ELEA 3TP8A 3GV6A 3KFUG 3CQZB 1KNAA 5A35A 4HCSA 4J1MA 5K36H 2R4JA 1G8PA 2F0LA 5CORA 3D4RA 5M3MB 1CQFA 3HKZB 3D4DA 4RGNA 4OVZA 2AQ3B 1QB5D 4M8AA 4K14A 4UAIA 2PW5A 4O42A 3VKHA 3K5MA 1Z47A 1PFNA 3JAMS 2CQAA 2CFOA 4S12A 5KPTA 4MGKE 2MPMA 5IGDA 1MU5A 3E5SA 3AV0A 1QZMA 2IJ0A 2R3ZA 1LABA 1FGBD 4FW9A 3AU7A 2D7GA 4CKBA 4LJ9A 5CV8A 1WXQA 4C3HB 3PIO3 3HU2A 3VYRA 1HRJA 2Z4SA 2F0SA 3C58A 1AP0A 1RKNA 4QHSA 3NQTA 4TUWA 1TS3A 4DV5M 4ZPXA 4XGIA 5FTKA 5F3WA 2B8FA 2WKDA 1Q1BA 3EVQA 3I4LA 3U6PA 5C4JB 5FO9B 3PO2B 1G41A 4DUYM 3DA1A 4ZUJA 4LG2A 4NRVA 2A5YB 4G4QA 1SMYD 3MTSA 1KAAA 4AW4A 1YNNC 5C1BA 2SNSA 5KPZA 2BCOA 3QAUA 3GTKB 3S14B 3MA2B 1CZGA 1NAPA 3A55A 4PQXA 3QJYA 2B2TC 1LLRD 1XMQM 4ZYSA 5J39A 3K59A 2X6GA 1F77A 4IBFA 1JICA 1XXGA 4RKLA 2CHGA 3R93A 1SJHD 1DOKA 5J22A 2V4DA 5EJWA 3HRZC 1SXJD 2RDFA 2L55A 3KXEC 1HCZA 3T53B 1ORYB 2JP1A 3V96A 4A3KB 3S1QB 4GZYC 4F87A 5EP4A 3OPOA 5M5WB 3FYDA 1I6HB 4L8JA 2OT2A 1SMYC 4LFBM 4B9WA 3Q23A 2L7HA 1AEXA 2N88A 2VXWA 5CV4A 5C6AA 2KHSA 1CA6A 4D82A 3KW6A 3FPUB 4DV4M 2JE6I 1C1KA 5ITXE 4JK1C 5COYA 4JN6A 2K7VA 2Z3XA 5EKLA 3PUYA 4RF0A 4JI3M 2JEAI 2RVLA 3GLFA 3I72A 3VR6A 3J7AF 3A8JE 4AKIA 2IX0A 2BE5D 2C9CA 2D7EA 5FKAC 1BQQT 3BYYB 5JI3E 3FMCA 5EP2A 5I6YA 4IBJA 1SYBA 2H1RA 2V1UA 3NUCA 1OJLA 3D8GA 5CV9A 1GUWA 1L8QA 2YU9B 3GLIB 3QG1A 3FTDA 3D3RA 1HPCA 5NUCA 4LJ8A 4DV0M 4MGIE 3FDTA 1EU4A 2B2UC 1KDAA 4K0KM 2K28A 1SJED 2XIWA 3DEPA 3X3MA 2CHQA 2A6ED 1GHKA 1F2YA 4AYBB 4E6IA 5JOBA 5KIXA 1Z5BA 1PRTD 1E9RA 5C0XJ 1I50B 5DM73 4LF7M 1EWCA 4RCOA 1CTMA 1XWEA 2XFTA 1RD9D 4NXNM 3PO3B 2XGNA 3TZUA 5IT9S 1JWUD 3R9XB 1SNOA 1SNMA 3ILKA 3PUVA 2XRSD 4B7HA 4LZJA 2SDFA 3TE6A 1FR3A 5C3WA 3SYKA 1R7RA 4XT3B 4KKSA 1SAPA 5A2QE 1PJIA 3ITPA 2X4AA 5ITRA 4KMUC 3GV3A 2AWOA 3S9WA 3U9SA 5EPJA 3ND9A 1NNJA 4B9XA 5KNBA 2CV1A 3KOXE 2PMZB 3KOZE 3T1HM 3GO5A 2J7ZA 3JR4A 2HQEA 2A74C 5KQDA 1PJJA 2Z4HA 4QNMA 4R8IA 3L3OC 2F0WA 4RNAA 2QCUA 4A3IB 2EUCA 3ONAB 4XXEA 4ODGA 1EY6A 4G7OC 1NNUC 3KP0E 3TZDA 2KCNA 2PQEA 1RJTA 2K03A 3O13A 3BVMA 2F0IA 1XHBA 2BA1A 1BCPF 1N34M 1I4WA 4ZRZA 1N75A 1HA6A 4LJ5A 2NZ1D 1TQOA 3GTOB 4Y7NB 3SHGB 1K82A 1EZ8A 5IGFA 4PNYA 1DGHA 2F5SA 4II7A 1LTGD 4XQQA 4OU7A 3FTFA 2F0JA 1CZWA 3K8ZA 1N33M 3HOUB 1Y1WB 1DGGA 2EE1A 4BB9A 3SE0A 4KHVA 3GQ4A 3GRRA 2RKOA 1VF7A 5ITXA 2E5LM 1EY7A 3T56B 4IBEA 4XYOA 2K05A 1E94E 2ZXPA 3RFWA 2KRUA 4JXJA 1OXXK 1HT2E 3EQLC 1B4OA 4TSSA 4GKJM 1HQRD 1VCIA 4DNTB 3C1FA 4A3BB 3I51A 3MWYW 4A3EB 1A6XA 1YSYA 1LACA 1GUOA 1C48A 4Z8XA 2JYOA 1M8AA 1EWHA 3BDCA 5ITYA 1Q39A 4DAPA 2B2WA 2DZOB 1SE4A 5KYIA 4DK1A 2ID0A 4HTHA 2X6LA 1UAPA 5D3IB 4LAAA 1I4GA 4KI0A 1R4QB 1IQPA 3NPPA 4I8OA 3AFHA 2F0QA 1E0BA 1CQVA 4PDGA 4H13C 5E3FA 1L0YB 1Q3CA 2WV6D 3J7BA 4C3HG 1DONA 5EBCA 5ITUA 4RF1A 4X62M 1H9SB 2V6ZM 5M3FB 4ULLA 3X3NA 1OXTA 1Y8OB 3K58A 1H9JA 2NN6G 1AN8A 4HLQA 3TSSA 4LGMA 4RWSC 1I4XA 3SR1A 3GTGB 1PZID 3G6JB 1TVXA 3H4MA 3BVGA 4ZKCB 1RODA 5DEHA 2P5TA 1TH2A 4KJNA 2KW0A 1R4PB 1W5TA 1QJOA 4FWDA 5GKNA 3L25A 4OIKA 5A2QL 4A3JB 1RTNA 2DHRA 2BDNA 2PW7A 4NSRA 4QOZC 1A3VA 2E2HB 1SFOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHT B;  3NBI A;  4CGY B; 
#chains in the Genus database with same CATH topology
 2XWB B;  3LNN A;  4POF A;  4LY6 A;  1S5F D;  4BBR H;  4QIW B;  4RGO S;  1HZ9 A;  4A3G B;  1WCM H;  1RCV D;  5T1I A;  3HHZ A;  1AFP A;  1GVN A;  3A56 A;  1NY4 A;  1SE8 A;  1B2T A;  1SXJ E;  1ZXT A;  1PFB A;  5KQ8 A;  2YNM D;  3B6Y A;  3ULP A;  4LF8 M;  2R92 H;  1S5B D;  5FTN A;  3HOX B;  3DZD A;  3CC4 A;  3AMU A;  1Z59 A;  1K73 C;  4LF5 Q;  2FHT A;  1MJE A;  3FUX A;  1VMC A;  5JJZ A;  1KTK A;  2IL8 A;  3VYS A;  1Y8G A;  4MHE A;  2OTL A;  4AQY Q;  5H37 D;  4P16 A;  3T13 A;  4K8J A;  1N32 L;  3M9B A;  3QOL A;  1WJJ A;  3KYH C;  3K7U C;  1D2B A;  2X8A A;  4C2M H;  3CF0 A;  2RGO A;  2A69 C;  4OWT B;  5IP9 G;  3J81 E;  1V34 A;  3U4V A;  1BCP B;  4IBG A;  4MNO A;  4AG6 A;  4PDI A;  2F0D A;  4FF4 A;  4DV6 L;  1VQ1 A;  2EYO A;  1GKI A;  1K9M C;  2Y0S E;  4B3T M;  3CTW B;  3TP6 A;  4DR2 Q;  5C0X H;  3U50 C;  5EJC A;  2A68 D;  5ELD A;  1IFY A;  1KQS A;  1SG9 A;  5E6J A;  1XMO Q;  1NHG C;  2CWB A;  1ILP A;  2YYZ A;  1I3Q H;  1IBM M;  1PA6 A;  1NV8 A;  2JEB I;  3PGZ A;  2QKI C;  4L6T B;  2KCM A;  1KYI A;  1L0W A;  4DV7 Q;  1LTT D;  3FPP A;  1EEF D;  4UN2 B;  1JQJ C;  4ZLT F;  2JA6 H;  1GJT A;  2AQ2 B;  2KJX A;  4LFC L;  4DR4 L;  1O7Y A;  1HNZ L;  1C8C A;  3ERS X;  1HNX Q;  2Z4R A;  4P74 A;  3GLF B;  2MO0 A;  3OYY A;  4IN3 A;  3Q24 A;  3C46 A;  1FNV A;  1K3W A;  4DV2 Q;  1SBB B;  2CHV A;  5KRU A;  1WTR A;  3HOV H;  2O25 A;  3KLW A;  1J5E Q;  5BPV A;  3VYT A;  3QB3 A;  3H3V H;  4FXG C;  1EEI D;  3VK7 A;  3RN2 A;  1X3E A;  4IUV A;  5H1S E;  1NNX A;  3H6M A;  3LCV B;  4DK6 C;  4FF1 A;  4GHL A;  2TMP A;  3HOY H;  3T1Y M;  4KY6 A;  1WHC A;  2NWG A;  4GLV B;  1Y1V H;  3SK6 A;  1JJG A;  1IBL M;  1OO9 B;  1A62 A;  4HJA A;  4CKE A;  2A68 C;  3L2A A;  1Y8N B;  4HIK A;  2WIN B;  1IBK M;  1SE3 A;  4AYB G;  3Q0A A;  4YIJ A;  1PZJ D;  4F1I A;  1TXY A;  1GJS A;  2RQX A;  4GOP B;  3SAT A;  2HAK A;  1VQM A;  4L15 A;  2L5T A;  2XWJ B;  3ICE A;  4PMC A;  2QEN A;  3HGB A;  5IP7 G;  1SYE A;  3HS0 C;  1RIP A;  3VYU A;  2JA5 H;  1Z6H A;  3S1R B;  1I4H A;  3PO3 G;  2QP9 X;  4EIW A;  1K8M A;  2QGQ A;  4NOO B;  1IYV A;  1DM0 B;  3GPX A;  2XGT A;  1G4A E;  2JA2 A;  4LJA A;  2NZH A;  3CCE A;  3I70 A;  1FNW A;  2B2W C;  4AQY L;  4RG1 A;  1PJT A;  3KVW A;  3L9A X;  3PQI A;  5F2D A;  1EU3 A;  4BXX H;  5IYB G;  1CM9 A;  3R8F A;  3VKG A;  3JR5 A;  4HR7 B;  3TQY A;  1WIV A;  4BBR B;  4DR3 Q;  4RGT A;  2V1C A;  3J7Y W;  1HQM C;  3KBX A;  3KF6 A;  3K9P A;  2R65 A;  2E2J H;  3HZJ A;  4F2L A;  1K0R A;  3LX0 A;  4DR2 L;  1DGB A;  3W68 A;  3HGI A;  1TWA H;  2WSE F;  1TWG H;  4HJ9 A;  5JI2 E;  1XMO L;  3A42 A;  2L9H A;  1IY0 A;  4GLX A;  3FKI B;  1SDF A;  1JE5 A;  1BF4 A;  1Q3L A;  4DV7 L;  4M9S A;  3SAR A;  4JBK A;  4A3I G;  3TRZ A;  1OXV A;  4IFD J;  3URY A;  3F2C A;  1VQ8 A;  2F4V Q;  1E2Z A;  2WAQ E;  3I01 M;  4OEL B;  2FH0 A;  4DR5 L;  1SYF A;  3J27 B;  1HNX L;  1HR0 L;  1JOQ A;  3U6L A;  2A19 A;  1ZYR C;  4OIJ A;  1K83 H;  1JJC B;  1SRO A;  4H7B A;  5JAV A;  4DV2 L;  4V19 0;  2PQA A;  3FEW X;  4I7Z C;  2WP8 J;  1SXJ A;  4A3M G;  4QCL A;  2KEC A;  1C0A A;  1JR0 D;  3KLR A;  4OO1 G;  4JI6 Q;  4X66 M;  5GAD C;  3RE8 A;  4BS9 A;  3ER0 A;  4Z6Y A;  4RKB A;  3H09 A;  5DNF A;  3BXW A;  3ERO A;  3WHK A;  1KRT A;  1VQF A;  1I3Q B;  3IG5 A;  3CCL A;  4HEO A;  1TU2 B;  2OEO A;  2M2L A;  5GAG C;  1ML0 D;  3HOU G;  1Z5A A;  2FS1 A;  3K1J A;  1Y1W G;  1G6Z A;  4CJ2 C;  5FTL A;  1TWF H;  2B2Y A;  2UUC L;  3WOF A;  3HG9 A;  2D5D A;  1DGH B;  3RZO B;  4FCV A;  2XEP A;  2RA4 A;  4G4O A;  2B2U A;  1L1T A;  2CV2 A;  4KTA A;  4NMZ A;  5D3D A;  3J81 L;  4CIZ A;  2O5I C;  3MXP A;  5ITQ A;  1S3S A;  2LXE A;  3SXH A;  1D6E C;  4A3L G;  1EYA A;  1HZC A;  4FWH A;  1NUC A;  1I4R A;  4FDB A;  3UK6 A;  2ZT9 C;  4EGV A;  3A45 A;  2XRQ D;  1WJ7 A;  2KNZ A;  3HOY B;  1RHP A;  4H0L C;  3OSO A;  3WWV A;  4A3E G;  2ZJQ A;  4WJ4 A;  5CC4 A;  3NHH A;  1Y1V B;  2EO2 A;  1V92 A;  5M9O A;  2OWO A;  3T4A C;  3G71 A;  3GTP H;  1D0L A;  5C44 G;  4FD2 A;  2KVM A;  3AL0 C;  3HKP A;  1HTP A;  3VR5 A;  4DV3 M;  4KKT A;  1N77 A;  4B3R M;  2DVW B;  2ZAO A;  2MR9 A;  1ZKO A;  2XZF A;  4LF9 M;  1DO0 A;  3DOA A;  3GPU A;  2VQE Q;  3AB9 A;  1AUA A;  1SSO A;  2TSS A;  3QYB A;  1H9S A;  2DNC A;  3HOZ H;  2EYP A;  2L6O A;  2F0K A;  1XTC D;  5I9O A;  3KOJ A;  2F4V L;  1DOL A;  1QG7 A;  5K5P A;  4CBV A;  1QQW A;  4JI0 Q;  1EYC A;  1ET9 A;  4L5T A;  2UXD M;  3CCR A;  5I9P A;  1Q82 C;  3CGW A;  5D65 A;  2B29 A;  2JA8 G;  1LTI D;  1IKL A;  2PZW A;  1PGY A;  1WTP A;  1M4V A;  3CRK C;  3D0F A;  4FVM A;  2R4E A;  2C96 A;  4X3T A;  5M3F G;  1M90 C;  2BDO A;  1D5M C;  1IL8 A;  3MAQ A;  3HP3 A;  1WYD A;  1X56 A;  2E2J B;  4OL7 A;  3BVZ A;  1YHQ A;  3HJQ A;  2K47 A;  1TWA B;  1A15 A;  4GRI A;  3MFG A;  4KN7 C;  3UDF A;  4A3F H;  3M0E A;  4DR7 M;  4FWG A;  5EXT A;  3TQS A;  1PDQ A;  3CCS A;  4MGZ E;  3A0J A;  3I4M H;  3SHL A;  4ZKB B;  3J7A S;  1BXT A;  3BZC A;  1X3F A;  2K5N A;  3RUZ A;  3F2U A;  3SVM A;  1HNW Q;  2R93 G;  2UUB M;  2IW3 A;  3M4P A;  2AHM A;  2EPB A;  1PFM A;  2L11 A;  3DM3 A;  1S5C D;  4G57 A;  1MGS A;  1IN5 A;  2HDL A;  5GAH C;  4A3J G;  4L4U A;  5ELO A;  4B7G A;  1FJG Q;  1STG A;  1TII D;  3RZD B;  1GJX A;  2RBM A;  3B7Q A;  2R18 A;  2LFN A;  2O2L D;  3F1Z A;  4IBK A;  2YTY A;  3HHX A;  4I4L A;  3GLH E;  3DXJ C;  4LFA Q;  1CHP D;  4Q5V A;  4JI7 Q;  4A3G G;  5HGQ A;  4DV4 Q;  1J9O A;  4AG5 A;  3EFX D;  3KS8 A;  4IUP A;  1IKM A;  1T6O A;  5C0X I;  3GTM H;  4JI4 M;  2R6F A;  4RKU F;  1I4P A;  1SND A;  1ASZ A;  5EXS A;  1SR3 A;  3HOX G;  3GPP A;  2DJG C;  2F3W A;  5IWA M;  2QIL A;  4X64 M;  1Q7Y C;  2A8V A;  5KGU A;  1NY6 A;  2Y0T A;  2VII A;  3LQR A;  1II3 A;  4A3V B;  1I6V C;  2UUA M;  5LMN M;  2V1C C;  4QMG A;  4EX5 A;  3GTQ H;  3V76 A;  1IN7 A;  4L63 B;  3MXG A;  2FE8 A;  4JYA M;  1VQE A;  3W3A A;  5JEA J;  5JPN C;  1EQV A;  5C3E H;  2VQE L;  1OAO C;  1L1O A;  1SYG A;  3SYL A;  3JAM i;  2ZAN A;  5EP1 A;  1N36 M;  4BBA A;  1YLA A;  3H3V I;  4DUY L;  1XYI A;  1YZ6 A;  1GUG A;  1JOR A;  4DPG A;  3SK5 A;  3CPW A;  4JI0 L;  2Q8I B;  1N78 A;  3NBI A;  1QDR A;  3OHX C;  3TEH B;  4CDD C;  1O78 A;  1VQC A;  1I94 Q;  1ENF A;  3UI2 A;  3QWN A;  4HIM A;  4IO9 A;  2OQ4 A;  3HEJ A;  1OFI A;  5CV6 A;  3BDL A;  1SXJ C;  1UFZ A;  1K0S A;  5LL6 X;  4OX9 M;  3NTK A;  2NVQ H;  5KEE A;  1EYD A;  3P20 A;  3SAS A;  2G9D A;  5FLX E;  1SYD A;  1ENA A;  2KRK A;  1A2U A;  2XSZ D;  3E9H A;  4IUU A;  4J8Q A;  2DAG A;  3VDP A;  4PT5 A;  3HOZ B;  1Q8K A;  1V1P A;  1JR3 D;  4LF6 M;  4B3S M;  4OON A;  1IY2 A;  3E9S A;  3CF5 A;  1HNW L;  3UDX A;  2B2Y C;  4DV1 M;  1SXT A;  3MHV C;  1VQ5 A;  4GKK Q;  4GOP A;  1CSQ A;  2OTJ A;  1D0K A;  2Q2I A;  1SLJ A;  2B63 H;  3S2H H;  2B2V A;  3IL8 A;  4ZQ3 A;  1QIL A;  2CV0 A;  1J7K A;  1ICF B;  4BWG B;  4LFB L;  5M5Y B;  4IJH A;  1IY1 A;  4IBC A;  5JVG 3;  1E2V A;  4IJF A;  4LFA L;  4IBI A;  3FRI A;  4IFD H;  1ICW A;  5ELN A;  3CF2 A;  4XYQ A;  1WTX A;  2I7N A;  3K5N A;  4DV4 L;  1TWC H;  4S3S A;  5LMU Q;  2ZM6 M;  2ZJP A;  2BE5 C;  1PRT F;  2LXJ A;  2Z6K A;  3FRH A;  3UJN A;  3U5Z A;  2K6A A;  4R9W A;  2CE7 A;  4A3F B;  2K5W A;  4N9T A;  4REZ A;  3CC2 A;  2F5P A;  2JXM B;  2AHO B;  1VDD A;  1OIP A;  3B74 A;  2EXD A;  1X3G A;  2ENB A;  1B8A A;  3A8I E;  3K7A H;  1AIP C;  5I2Y A;  4F8M A;  4DR6 Q;  4LUZ A;  3S1N H;  4JV5 M;  2JJQ A;  2MGS A;  3OIP A;  4OHJ A;  2K4K A;  5FLM H;  2O01 F;  2R7D A;  2WZJ A;  5D14 A;  5E4W C;  3KOW E;  3J7A V;  1V33 A;  2ASB A;  4C1N K;  1PTO D;  2QQ8 A;  2MJ5 B;  3NE5 B;  1XJV A;  1R9T H;  3HJ8 A;  5E4X A;  1DV0 A;  4BY1 H;  4DGZ A;  2Z1C A;  4LCB A;  1KD1 C;  1WGL A;  2A6E C;  1O7I A;  2EY5 A;  3GTM B;  4O2D A;  2GA4 B;  2JY8 A;  4NRW A;  4OWX B;  3MFY A;  4DXF A;  4JI5 Q;  1G29 1;  5IYC G;  1PRT C;  2N3S A;  1KSF X;  1I94 L;  3B9P A;  4KHP M;  1HZA A;  3C1E A;  3FKI G;  2EYF A;  2QZ4 A;  2CW0 D;  4MZ9 A;  2OF1 A;  3MJ5 A;  5AJ3 Q;  3IEC A;  1VQO A;  3J81 c;  1MSH A;  4WUR A;  4V0B A;  2D62 A;  1VEK A;  2FIN B;  4YCU A;  1WD1 A;  2DAI A;  4GS3 A;  4HJ8 A;  1AW7 A;  5BR8 M;  1CA5 A;  2Q8R E;  4KD4 A;  4JBW A;  2KEB A;  1TWH B;  1I4Q A;  1VF5 C;  2WSF F;  1STN A;  2LY7 A;  4JI8 M;  1B53 A;  3VDU A;  3KDF A;  3I7F A;  1PTO H;  2KDL A;  4P2C B;  4P75 A;  3I4N H;  4KT0 F;  1PH7 A;  1B70 B;  1PTO C;  4GKK L;  1S5D D;  1JWM D;  3OTO M;  1BR9 A;  1SXJ B;  2QEJ C;  2CVR A;  2NVY B;  3HOW H;  3TBI B;  1JOO A;  4GNX C;  3S15 H;  2K5D A;  2K75 A;  3S1M B;  3U6C A;  2NVQ B;  3BJU A;  2D2C C;  3S24 A;  1NVM A;  2CW0 C;  5LMU L;  1V43 A;  3AOG A;  5FTJ A;  4B3M Q;  3F2B A;  2PI2 A;  1MJC A;  1SEB D;  3U6Q A;  2CFM A;  3TRE A;  5I6W A;  1R5L A;  3DMU A;  4ME5 A;  3E3X A;  3MXU A;  4X3S A;  4IJE A;  2D7H A;  2NQ8 C;  2HCI A;  2NB0 A;  2MNA A;  1LT5 D;  3NEN A;  4CJ1 B;  3HOY G;  2N55 A;  2PNH A;  4K5W A;  2L7I A;  4M9X A;  2DAM A;  2R7Z H;  4DR6 L;  5C4X B;  2Y0S B;  4XDX A;  5IE8 A;  3HFZ B;  2B63 B;  1HXY D;  3C3L A;  3S2H B;  2YFQ A;  1L1O C;  1GO3 E;  3E0J A;  3U6D A;  1EQT A;  3HKZ G;  3M3Y H;  2KZS A;  4NKL A;  3M4Y A;  3RGS A;  2EXZ A;  1XC8 A;  1PMR A;  1TS5 A;  3J80 E;  4GC9 A;  3BS1 A;  5FSW A;  2SNM A;  3STB D;  1KDB A;  1TWC B;  5L37 A;  2VF7 A;  5FO8 B;  1EOV A;  2Q2H A;  4KY7 A;  1U4L A;  1CFM A;  2HWJ A;  5FLX L;  1B44 D;  2DWZ B;  4JBJ A;  2OCE A;  4X65 M;  2DWN A;  4X6A H;  2UXC M;  2BWB A;  3HJS A;  4CGY B;  2F5O A;  3RGP A;  5DNY A;  1TR5 A;  2LMC B;  4JVZ A;  3EBE A;  4O1N A;  2MUY A;  5BN3 A;  2CUZ A;  3NEL A;  3QR8 A;  4NB3 A;  1JT8 A;  3GQ3 A;  3E6Z X;  2LVP C;  2GN5 A;  3L26 A;  4DAM A;  1MX0 A;  2HL7 A;  1NV9 A;  2JP7 A;  2OPF A;  3K7A B;  4R4T A;  1N33 L;  3KJO A;  2QBY A;  4KD3 A;  3S17 H;  1QVC A;  4R4O A;  3SAU A;  2E5L L;  1TY0 A;  4BXX G;  1YNX A;  1PH2 A;  2XVS A;  3FVQ A;  1XNQ Q;  1PH1 A;  4LK1 C;  3K6O A;  4PV1 C;  4DR4 Q;  1ESF A;  1HNZ Q;  2VUM H;  5FTM A;  1QCB D;  1R9T B;  2ZAM A;  4D80 A;  2IX3 A;  1Q81 C;  2F3V A;  4NXM Q;  1PRT B;  2RGH A;  1VDL A;  1QNU A;  2UU9 Q;  5JEA H;  2CH4 W;  3NP8 A;  2B2V C;  1QVR A;  1PLF A;  4RCN A;  3K57 A;  2FXQ A;  4TKO B;  2VZA A;  3S2D H;  3CAM A;  1VEJ A;  2VNU D;  2CQO A;  1X32 A;  2HIX A;  3D6C A;  4FNF A;  4HID A;  2K1B A;  2KA6 B;  1D5Z C;  4FF2 A;  2LVQ D;  3AKZ A;  1WVL A;  1HFG A;  1B9M A;  2E2I H;  2ERC A;  3R8B A;  2AUJ D;  4QHT A;  2LKV A;  3MK6 A;  1HR0 W;  3IFT A;  1GAB A;  3H94 A;  4M9Z A;  2OQ0 A;  1JQY D;  2DJF C;  3RD4 A;  3HU3 A;  3OWE B;  3FHW A;  3I73 A;  1EY8 A;  1YEZ A;  2F0M A;  3PSI A;  1WTW A;  3K5L A;  2FJ2 A;  4IZ8 A;  1NJF A;  3M4O B;  4TRD A;  2DXI A;  2EIF A;  4ZCK A;  3HOW B;  4A3K G;  3KSX A;  1B1Z A;  1CT1 D;  3RR5 A;  4W5W A;  4LFC M;  1D2N A;  1BDO A;  1XTD A;  3WDN A;  1FYC A;  1TH4 A;  3JAM E;  1KLU D;  1DCZ A;  4NP5 A;  3GTJ H;  4CHT B;  4GN3 B;  1Y69 U;  5EKI A;  3H91 A;  2X49 A;  3PNV A;  5ISR A;  3GTL H;  3GP1 A;  2WII B;  1N9W A;  2WAC A;  3HU1 A;  4PMW A;  1KHI A;  3IRB A;  2F0H A;  4L6V 6;  2F0T A;  4P72 A;  3W1G A;  2YQZ A;  3DFZ A;  4R7G A;  4ZUI A;  5ITT A;  3I2Z A;  2KNV A;  2LNH C;  3VLF B;  2EA0 A;  3EN2 A;  3MHB A;  1H9K A;  4U67 3;  3CC7 A;  1STY A;  2QCP X;  2O4X A;  2L12 A;  4K8I A;  5CMD A;  2CEA A;  4H44 C;  2NVX H;  3ULJ A;  2X69 A;  4LNQ A;  1L1O B;  3WHL A;  3EIV A;  2LVN C;  5K36 G;  3U6E A;  4DN4 M;  4DF7 A;  4QQB X;  1BUV T;  1U4R A;  4NDX A;  2ICE C;  3MXN A;  4DU9 A;  1XNQ L;  2A1A A;  4MM3 B;  4DR1 Q;  3CPF A;  1T5E A;  2M60 A;  2OOB A;  1STA A;  1X6O A;  1WTO A;  4IFD I;  4DR5 Q;  4KHZ A;  2FFK B;  1G59 A;  1HR0 Q;  5I2X A;  4WJW A;  4NXM L;  2F0N A;  2ZBK B;  1HUM A;  1UE6 A;  1XPR A;  4WJ3 M;  2UU9 L;  4POG A;  4LJ7 A;  2EYM A;  2LWX A;  3GLG A;  2F0P A;  3SBJ A;  2I07 B;  3CW2 C;  3IKJ A;  4LF5 M;  2QF7 A;  3HOZ G;  2C99 A;  3SMP A;  4LF8 L;  2VS1 A;  1JR3 E;  1HUN A;  1EL0 A;  3H3V C;  2JA9 A;  4AQY M;  3SAW A;  1H6U A;  2R46 A;  2K5V A;  4DBG B;  3FTC A;  2R62 A;  1YNJ D;  4YCV A;  3S16 B;  2RRU A;  1B50 A;  1E1T A;  2Q2T A;  1Z7T A;  3ZCB B;  2A5H A;  3FUW A;  2AMC B;  1V1P B;  1AE2 A;  1F9Q A;  2XN9 C;  5IZ7 D;  2ZTC A;  3CD6 A;  2CRU A;  3W2D A;  3J80 L;  2UUC Q;  1QAO A;  3QOJ A;  3OMC A;  3LVV A;  4DR2 M;  2UXB Q;  1KNE A;  1XMO M;  2DWM A;  3IAY A;  4A3F G;  2EYH A;  1EFW A;  2K14 A;  3ERQ A;  1TR8 A;  2H5X A;  3CQZ H;  2I0Q A;  4DV7 M;  3A98 B;  1SMX A;  5CBE E;  2OQK A;  5KNC A;  3TS2 A;  4LRS A;  1RTO A;  1A3T A;  1VQG A;  3CP0 A;  5M3M H;  1VQ9 A;  2ALY B;  2ZTD A;  1STE A;  4B08 A;  3GRY A;  1ENC A;  1HNX M;  4NPS A;  4N9P A;  3U5Z B;  1NY5 A;  3W5O A;  4DV2 M;  1QOH A;  3FUU A;  2M5Z A;  2CH4 A;  3KP1 E;  2HIV A;  4C3I H;  2K32 A;  1JCK B;  2E2I B;  1G2S A;  1OKS A;  1J5E M;  3LVW A;  3DHQ A;  1F2M A;  5G3L D;  4FYD A;  3VFD A;  3ZQJ A;  2L0C A;  1DJR D;  2EKF A;  1F9R A;  1EE8 A;  1FD7 D;  4K5V A;  1WCM B;  3GO8 A;  4MN3 A;  1UUP A;  4K5X A;  3TDQ A;  3PIP 3;  3BU2 A;  1VQB A;  1JE4 A;  1ZAE A;  1HQY E;  5M5X H;  5ELB A;  1YIJ A;  3R2T A;  2K01 A;  2KXE A;  1LT6 D;  2H4O A;  4HJ7 A;  4C3H H;  2R92 B;  2EY2 A;  1IHZ A;  1K8O A;  2DWL A;  1BBW A;  1MIU A;  1QAM A;  4QIW E;  3G7L A;  4DR1 L;  1D5X C;  4A3D H;  3I90 A;  4YWL A;  5FJ8 G;  4PZ7 A;  2FMM A;  1CUK A;  2NN6 H;  3RMH A;  1HTL D;  3GTJ B;  1XX8 A;  4YHH Q;  3IG8 A;  1F4I A;  4C2M B;  2IPK D;  3KJP A;  2JQO A;  3PO2 H;  1G2T A;  4EVO A;  3Q8D A;  4RHS A;  2BNK A;  4C3J H;  4KJO A;  4JCV E;  1FL0 A;  1QAN A;  3GLH B;  2HQL A;  1IW7 D;  5IGB A;  1X37 A;  2Z0S A;  5CR3 A;  4ALP A;  5ELF A;  2RKS A;  3B7N A;  1EY5 A;  2MQH A;  1E7Z A;  3GTK H;  3U58 A;  3OOC A;  3S14 H;  1K3X A;  4A93 H;  4EQP A;  3GP7 A;  2E8G A;  3A8K E;  1QZG A;  5FLX c;  2L09 A;  1QWY A;  1W5S A;  2Y0Q A;  4QJF A;  1XWI A;  4DR3 M;  3KDF B;  2JA6 B;  2K52 A;  3SK4 A;  3JAM L;  2MO1 A;  1X3Q A;  3UE0 A;  4DV3 Q;  3H15 A;  3F92 A;  1J09 A;  2UXB L;  3DLL A;  3KOY E;  5IT9 E;  3OW7 A;  3L2P A;  1SNQ A;  4QY7 A;  4AIM A;  2XLJ A;  2KED A;  1L2B A;  5IOC A;  3HOV B;  2A6H D;  3CHB D;  1K8A C;  1OQY A;  4OGQ C;  4CIS A;  1YHA A;  1ONL A;  4QF4 A;  4AI6 A;  3S1Q H;  2F4V M;  3HX3 A;  3G6E A;  2K04 A;  2JXN A;  4XBO A;  4KK7 A;  4QNR A;  1T3T A;  1KAW A;  4A3B G;  1ZV1 A;  2F0O A;  2QHO B;  1BOS A;  1CK1 A;  2XH9 A;  1LT4 D;  5C4X G;  3A5Z B;  1D0M A;  2C9O A;  5IGC A;  3P1H A;  5L8R F;  4JI1 M;  2B63 G;  3J7Z C;  2UXD Q;  1W3S A;  1IW7 C;  4WW0 A;  1A63 A;  4I5S A;  1CKO A;  2KHJ A;  3I8Z A;  3KBG A;  3KFU A;  2K0B X;  4K6D A;  2XSZ A;  1VQI A;  4JI6 M;  4DV5 Q;  3BDO A;  3TS0 A;  2H1E A;  1JR3 A;  5HUR A;  1H9R A;  2O5R A;  3M6A A;  1DOM A;  1A2T A;  2JA5 B;  1GL7 A;  3BYT B;  3DWA A;  2N35 A;  1QYR A;  2MHV A;  2KOL A;  1WD0 A;  1MHW C;  2IX1 A;  4DUY Q;  3NK9 A;  1EIG A;  2L15 A;  3J81 j;  4IUQ A;  2JNH A;  3LMM A;  3FUT A;  1YVC A;  2A6H C;  4WRD A;  1DZ1 A;  4MB7 A;  4G4R A;  1EWI A;  2F0V A;  3CCV A;  1LTB D;  2LXK A;  4YHH L;  2RHQ B;  3C3E A;  3U61 A;  4C3I B;  2BJV A;  1GUT A;  1WTV A;  4HN7 A;  1QVF A;  3T38 A;  3LW5 F;  1YNN D;  1UEB A;  3VA5 A;  1XMQ Q;  1Q12 A;  2KA7 A;  3U6M A;  2YU9 H;  3TWK A;  3I4V A;  4TQU S;  1LT3 D;  2F52 A;  1Z5C A;  5M5X B;  3J81 S;  4QOS A;  2QBY B;  3T15 A;  2R45 A;  3DWQ A;  1TWG B;  4DK3 C;  2ZXR A;  5DFL A;  1F9P A;  2ATW A;  1AH9 A;  2K9D A;  2F0F A;  4GLA C;  1QVG A;  2XFS A;  3KDS E;  4UP7 A;  1CI3 M;  3Q6S A;  4X64 Q;  4A3D B;  4BA2 I;  2M00 A;  3FRP B;  4RH6 A;  3U6S A;  1WTH A;  1JB0 F;  4DUZ M;  4BY7 H;  1VQH A;  1E3P A;  4DV3 L;  1KLG D;  4MTN A;  4B3R L;  1VQJ A;  3ZH9 B;  1I50 H;  2BH2 A;  1L0X B;  2VQE M;  1K83 B;  4DK0 A;  2WB1 E;  3U9O A;  2NVT H;  4LFB Q;  1CKN A;  2AUK A;  4LF9 L;  1IXS A;  4GNX A;  4KO8 A;  4A75 A;  2B8G A;  3R3O A;  2DNA A;  4ZAI A;  3CCM A;  2Q8T A;  3AOE A;  4C3J B;  3UZU A;  1K3B C;  1G3I A;  3PFI A;  1OXU A;  1IN4 A;  1VMP A;  3A7L A;  3LWE A;  2KZU A;  3ZYY X;  1Z9F A;  3TWL A;  5EQT A;  4JI0 M;  2A73 B;  1TT2 A;  1V8Q A;  1PH5 A;  3AFQ A;  3K0X A;  3NWS A;  4JI3 Q;  4A93 B;  1MBY A;  1UNS A;  5IYD H;  1EIY B;  5BN5 A;  2UXD L;  5E7N A;  3H0G H;  2KEE A;  5JPM C;  5GQO A;  5IYB H;  3GDE A;  4HMI A;  1WR1 B;  1TWF B;  4DV5 L;  1X9N A;  4P17 A;  2L4N A;  3GQ5 A;  3SGI A;  1R2Y A;  1B3Q A;  2MGW A;  3FE3 A;  1NR2 A;  2RDG A;  1EZ6 A;  4GHA A;  3HHW A;  1XXH E;  1VQA A;  5DAU A;  3A54 A;  4FP5 D;  1P8L A;  4HSP A;  3PXG A;  2YR0 A;  1X55 A;  1HNW M;  2B39 A;  3QIA A;  4KKU A;  1FNN A;  1BNZ A;  3FD9 A;  1G8Z D;  1MI2 A;  4A3I H;  3Q8G A;  4WP2 A;  1B3A A;  4B3S Q;  4LF6 Q;  3BOS A;  4LGY A;  2BOS A;  4R8N A;  1EY0 A;  1HT1 E;  3EIH A;  3J80 c;  1FJG M;  1L2F A;  2FFJ A;  4KOD A;  1O7Z A;  4G6Z A;  3GTP B;  1CSP A;  2PO4 A;  2C5C A;  3BG3 A;  4C56 C;  2QPA A;  4DV0 Q;  1VQ4 A;  2EDG A;  1VQL A;  4LFA M;  2D9U A;  4JI2 M;  4JC0 A;  4DAY B;  4A3M H;  4G4N A;  1XMQ L;  4K0K Q;  4JI7 M;  4FCT A;  4G3O A;  2HHH M;  3AEV A;  4OO1 H;  3SAV A;  2VDB B;  4IUT A;  3W1B A;  1U5K A;  5IT9 L;  2J7O A;  1TKW B;  1JOK A;  4LF7 Q;  4A3C G;  3J81 i;  4FXK C;  1TGU A;  1XNR M;  3FUV A;  1V9P A;  2VB2 X;  3KUP A;  3MXN B;  1MKH A;  2C35 B;  3MEH A;  1Q8I A;  3A74 A;  3G48 A;  3HKZ E;  4K2L A;  5DYI A;  1KRS A;  1GOZ A;  4MTK A;  4DXG A;  4NXN Q;  5J1Z A;  3OMG A;  2HUG A;  1GLN A;  1WGN A;  3TP7 A;  2BWE A;  4X64 L;  2D0O A;  2E74 C;  1ZEQ X;  2PNR C;  4LWC A;  2JN4 A;  4PCZ A;  1L2C A;  4XT1 B;  5LMN L;  2EY1 A;  4WOR A;  2C98 A;  3GLG B;  2FNA A;  3I4Y A;  4FF3 A;  2JY5 A;  1MD2 D;  3HZX A;  3GPY A;  3V2T A;  5EXP A;  2FMC A;  4L8R C;  2EJS A;  2NYZ D;  1PYB A;  4MGH A;  1XB2 B;  1QUT A;  1RF2 D;  4JPB W;  4G7H C;  1UEA B;  1N36 L;  4A3L H;  1YE9 A;  2QDL A;  4FXD A;  4RMF A;  5FO7 B;  1Y8P B;  5DYG A;  1GL6 A;  4KV6 A;  3T1H Q;  4R3D A;  4RAU C;  4JI3 L;  1I94 M;  3NTH A;  5JEA G;  3I4M B;  1S5E D;  4IPD A;  4QB4 A;  5C44 H;  1JJ2 A;  1P16 A;  3PCO B;  3UE1 A;  4ID6 A;  4DA2 A;  2EYJ A;  3CRL C;  1C4Q A;  3SC3 A;  3VA7 A;  5IIF A;  2RSO A;  4BY7 B;  4OX9 L;  2NN6 I;  2DN8 A;  3Q8X A;  1SNP A;  2NTT A;  2PZU A;  1OTR A;  4HCE A;  1V1Q A;  3TL4 X;  4EQN A;  2NVT B;  3TPZ A;  4IBD A;  2R61 A;  4L78 A;  1P3Q Q;  2HDM A;  2JK8 A;  3DEO A;  4BBR G;  3OIQ A;  1WCM G;  2G9H D;  1N34 Q;  1PTO F;  3SHF A;  3K80 C;  4NW2 A;  2DNE A;  4LF6 L;  4B3S L;  4GKK M;  4QUF A;  4A4I A;  2EKK A;  4DV1 L;  5EGT A;  2R92 G;  3DWP A;  5EKK A;  3PUZ A;  3SK8 A;  1RDP D;  3H0G B;  3KK7 A;  4ME3 A;  4DV0 L;  2JA8 H;  1PM5 A;  3K2L A;  4UP9 A;  3U60 A;  2HCB A;  4PD2 A;  2JA7 H;  4K0K L;  4IUN A;  1EOT A;  1DO2 A;  2CKZ B;  2MP1 A;  3F8T A;  4TVA B;  3GLH A;  5M3F H;  1JMC A;  1N33 Q;  4K2K A;  3GTQ B;  5LMU M;  2CHB D;  3CF6 E;  4IAL A;  1UE7 A;  2CP8 A;  1KAB A;  4YY3 M;  1ILQ A;  3BBZ A;  1NMG A;  2E5L Q;  3J7A 5;  1G71 A;  5C3E B;  4LF7 L;  2XZU A;  1PH8 A;  1TS4 A;  2Q2U A;  2HT1 A;  1QZH A;  1PH3 A;  3GTG H;  3D8L A;  2EJG C;  1SNC A;  2F03 A;  1TY2 A;  2M9V A;  3PMF A;  4DKA C;  4NXN L;  1VQN A;  1E9S A;  2Z8L A;  2R93 H;  2L4E A;  2XSC A;  1OXS C;  3LWU A;  1YIT A;  1E2W A;  5C0X G;  4DR6 M;  4GKJ Q;  1IN8 A;  1OFH A;  4G4K A;  5EBD A;  1PH4 A;  4GIT A;  4N8F A;  4A3J H;  1V1O A;  4GMQ A;  4JV5 L;  4FO2 A;  1BCP D;  1AE3 A;  2E2H H;  1A5T A;  1XXH A;  3LQQ A;  1SFO H;  2JA6 G;  2CWP A;  4A3M B;  1D1I A;  1MJG M;  3AOE C;  1GD7 A;  4J15 A;  2VB3 X;  3SDZ A;  1TDZ A;  3CCJ A;  2I7P A;  2W82 A;  3DUZ A;  4IOC A;  4A3G H;  3E9I A;  2PYK A;  4GN5 A;  3H4J A;  2VQF M;  2ES2 A;  4B7F A;  4F7X A;  3T1H L;  1Q90 A;  1ZQ9 A;  4JI5 M;  3TP5 A;  5IGE A;  4G7Z C;  1HFN A;  4M1U B;  1FNU A;  1LO5 D;  4PG3 A;  4AKH A;  2JY7 A;  3HOV G;  5KPR A;  4X65 Q;  1IM2 A;  3GRV A;  4CJ6 A;  3HOX H;  3PUX A;  1CHQ D;  1NHW C;  1G6P A;  1FGU A;  3NSW A;  7CAT A;  2EJM A;  1LTS D;  2KHI A;  1MN3 A;  2LS0 1;  4EQO A;  5FOB B;  4LMQ D;  1DGF A;  1HA5 A;  3RLF A;  2C5R A;  1TS2 A;  1R2Z A;  3W0F A;  4I65 A;  1Y1V G;  3M7N A;  2Y20 A;  1DXM A;  1WOC A;  2HCC A;  3KLS X;  3SMS A;  4I7A A;  2EZV A;  3D31 A;  1NSN S;  4BLC A;  1PXU A;  2B3T A;  4X62 Q;  1F2L A;  5IRE B;  5BR8 L;  4P71 A;  3GLI E;  3TN2 A;  3M7G A;  1VQK A;  1N34 L;  2DZN B;  3MC0 B;  1BCP C;  3MZ5 A;  3OWF A;  2MRO B;  1YUB A;  1MSG A;  4F88 A;  1NJG A;  1VDZ A;  2JA5 G;  3WOE A;  2VY3 A;  3OTO L;  5C5M A;  5C44 B;  4AYB E;  4O0A A;  4LF4 M;  4XTC S;  1LV7 A;  1NE3 A;  1W6J A;  4GIP A;  4P73 A;  3E21 A;  8CAT A;  4XIG S;  1EY4 A;  1IYJ B;  1S4Z A;  1TH3 A;  2DKL A;  5KND A;  5KYL A;  3S1N B;  1AZP A;  3N52 A;  4B3M M;  4C3I G;  2JZ1 A;  3FYC A;  4J6H A;  4I81 A;  4IIW A;  4L16 A;  4XQJ A;  1QUQ B;  4FCW A;  3NXW A;  5HGT A;  1PRB A;  1IZ6 A;  5IY0 A;  2QNJ A;  2Z7J A;  1NCV A;  2OXP A;  4OVZ B;  4RFB A;  4BY1 B;  4LJZ C;  2IY5 B;  1J8I A;  1KDC A;  2L1B A;  4GKJ L;  1U0L A;  3U61 B;  3K92 A;  2NZO A;  4UPA A;  2KCC A;  2KEN A;  1YHB A;  3STB C;  2DY7 A;  5EXX A;  1UM8 A;  3HHY A;  1EQR A;  2D0P A;  2KBN A;  3AJI B;  5I4D A;  4XQN A;  4LF8 Q;  3E4R A;  2JA8 B;  5BN4 A;  3CU7 A;  4R4C A;  1YJW A;  2F0U A;  2PMZ E;  1IN6 A;  4HAE A;  4RA8 A;  4A3D G;  2FOI C;  2I5L X;  2JA7 B;  3KSJ A;  3CKI B;  1N32 M;  3D8B A;  3GRU A;  4JBM A;  3VR4 A;  1F9S A;  3KS4 A;  2XNA C;  2MJ8 A;  3VR2 A;  1S3O A;  4KN4 C;  1PV4 A;  3DM1 A;  5LHY 1;  4LZZ A;  4X65 L;  4DV6 M;  4C3J G;  4M0W A;  5FLX S;  1PYW D;  5CYU A;  2UXC L;  2PPB C;  2R93 B;  1PTO B;  1X3P A;  1Q1E A;  5C5L A;  4HJ5 A;  2Z4I A;  2N49 A;  3KF8 A;  3I4N B;  2A69 D;  4AZF A;  1IYU A;  2GVA A;  4Z9C B;  4B3T Q;  2E75 C;  1CKN B;  4NL4 H;  2IHF A;  5CV7 A;  1IXS B;  2R6G A;  1JWS D;  2F0E A;  2K5Q A;  2QEX A;  1BO0 A;  2EY6 A;  4GNX B;  1IBM Q;  5EQ0 A;  3L7Z C;  2BJW A;  1XNQ M;  5IT9 c;  4L5Q A;  2G8L A;  3C3D A;  2RSN A;  1B7Y B;  1ESR A;  3EA6 A;  5ELC A;  4X62 L;  3S15 B;  4DR4 M;  1HQC A;  4LRT A;  1JB3 A;  1HNZ M;  2PCF B;  3R2I A;  4CDF C;  1PH6 A;  4DFA A;  3W0L B;  2HKJ A;  5C18 A;  4OO1 I;  3THG A;  4NXM M;  1VS0 A;  2WAQ B;  2XTI A;  2ICI A;  5CGK A;  1A0I A;  3U6O A;  2UU9 M;  1W6K A;  2IHE A;  3A5U A;  3EIE A;  4ABN A;  3LCU A;  3IHP A;  1BBU A;  1STH A;  5IYC H;  2AWN A;  3L28 A;  1QAQ A;  2NBF A;  3FKI H;  2EOT A;  3A7A B;  2IT1 A;  4DAY A;  4YWM A;  3PV0 A;  4IPG A;  4UP8 A;  2DAE A;  4HIO A;  2E2H B;  4HL4 A;  2HD3 A;  2GQF A;  3P7J A;  5C4H A;  5CV5 A;  4BBS H;  2R7Z B;  1LYL A;  4DNR B;  2G5G X;  3CXC A;  3T1Y Q;  2DY8 A;  1KFV A;  2F3I A;  2SEB D;  3TME A;  1GXD C;  1HH2 P;  1U4P A;  2F4I A;  1IBL Q;  3L0O A;  4KLN A;  3M3Y B;  2QSF X;  1NSF A;  3VK8 A;  5A2Q S;  2N8N A;  1IBK Q;  1QNK A;  4U68 A;  3PNY A;  1DD2 A;  1UE1 A;  1SRU A;  3G4S A;  1C9O A;  1LV9 A;  1GHJ A;  2APL A;  1GUS A;  3GD7 A;  3T51 B;  2Y21 A;  3T6P A;  3I3C A;  3PF4 A;  5LL6 S;  4Y52 H;  4D81 A;  3QO2 A;  5HY6 A;  2LBC A;  4ITQ A;  3K5O A;  4BA1 I;  1U9R A;  2YTX A;  4ILW A;  4X3U A;  1QE6 A;  2F5N A;  3L29 A;  2VF8 A;  2R7F A;  3GLI A;  1L2D A;  3P75 A;  4MH0 E;  3RLO A;  5JVH 3;  3PUW A;  5T1G A;  1Q3B A;  3S17 B;  4X3K A;  3RZO H;  4AH6 A;  3CME A;  4MIU A;  5C4Z A;  4WFN 3;  1E24 A;  2JWS A;  3I91 A;  4H02 A;  2VUM B;  4N8X 1;  5E1F A;  1W2B A;  3D6W A;  1TTE A;  2KQ3 A;  1XPO A;  1LM0 A;  4LJ6 A;  4B3T L;  2DUD A;  3NTI A;  3CCQ A;  4Y28 F;  1PYS B;  4GH9 A;  1LTR D;  4C1N I;  3I4M G;  5FK9 C;  1IBM L;  3ZJY C;  2F0G A;  3ULL A;  2J0T D;  5IGG A;  3S2D B;  1EFI D;  3E0E A;  2GNO A;  4DR1 M;  2LH0 A;  4OW0 A;  2E2D C;  3NQI A;  4DR5 M;  2E76 C;  2L2D A;  1U4M A;  2PZT A;  3T16 A;  1HR0 M;  5KO3 A;  4BY7 G;  1BBX C;  1AZQ A;  2F1M A;  2NUC A;  1CKM A;  4MGY E;  2QDB A;  3PVS A;  1JC7 A;  1Z6T A;  4M0D A;  3UMM A;  3HWS A;  2B2T A;  2JUJ A;  4CKC A;  2IWH A;  1BKB A;  4HSV A;  2RDH A;  2VL6 A;  1YNJ C;  5EPL A;  4EQ5 A;  3VR3 A;  2YV5 A;  4K6L A;  5G3L F;  3V05 A;  5IOD A;  2K33 A;  4LF5 L;  2MFI A;  1ZYR D;  1DYQ A;  4X66 Q;  3ZC7 B;  2I5M X;  4IBB A;  2L4F A;  3NBX X;  4L5S A;  3SFZ A;  1O80 A;  5EPK A;  3AQQ A;  3Q22 A;  2KUM A;  2Q2E B;  2RCF A;  3ND8 A;  5AFW A;  1ET6 A;  3T1Y L;  1EIF A;  2ZTE A;  5CBA E;  5IYD G;  3H0G G;  4KLK A;  2EVB A;  3HY5 A;  3A46 A;  1WI5 A;  1IBL L;  2UUC M;  1X54 A;  3BZD B;  3C2P A;  3KLS A;  3SEB A;  4UY8 C;  1IBK L;  2UXB M;  1TF0 B;  2JY6 B;  2WFW A;  1D7Q A;  1PZK D;  2RF4 A;  1F2Z A;  5C4J H;  3GTL B;  3EJI A;  5C3X A;  5C3E G;  3J80 S;  1GM5 A;  1R6B X;  1EUJ A;  1SYC A;  3U60 B;  3J2P B;  2WB1 B;  3MVV A;  2K50 A;  4LJ4 A;  4PMB A;  2NTS A;  1WTQ A;  1LUZ A;  1NR4 A;  3NWL A;  4ZK9 B;  1A3U A;  1B9N A;  2SOB A;  3TWM A;  3HKS A;  1IXR C;  5TSS A;  3L27 A;  4BBS B;  1PJQ A;  2NVX B;  1O7L A;  1D1K A;  3K8A A;  3QWL A;  2EYL A;  2R0I A;  3GQB A;  3N6R A;  2LVA A;  3FTE A;  1S40 A;  2I46 A;  4Q0F A;  4JI1 Q;  3M85 A;  4AKG A;  1H9M A;  2BH8 A;  2JSO A;  3RZD H;  1HHV A;  4IUR A;  1J5E L;  4NSO B;  5DM6 3;  2DEN A;  1LTA D;  1VQ6 A;  3K0Y A;  2WKC A;  2J7N A;  4KY5 A;  4APV A;  4B3R Q;  2LTU A;  1YJN A;  1T5X D;  2AQ1 B;  4CJ0 B;  4GC5 A;  1ZMV A;  2K5H A;  4HED A;  1UE5 A;  1L1Z A;  2EJF C;  4RGM A;  4LF9 Q;  1E32 A;  1GUN A;  2BA0 A;  2O5J C;  1XXH B;  1TDH A;  2KNA A;  1K3R A;  2K6B A;  3NBH A;  4GN4 B;  4IQZ A;  1IXZ A;  4A3K H;  3NWT A;  1SE2 A;  1K28 A;  3D4W A;  3UGJ A;  3E46 A;  1DGS A;  4HMJ A;  5M5W H;  3B89 A;  3GLF E;  1I6H H;  2Y0S G;  4YHH M;  2XF3 A;  4R4I A;  2MH8 A;  3AYH B;  2GVB A;  1EYG A;  4RHR A;  2F5Q A;  5EP3 A;  1VQ7 A;  2ZXO A;  5E26 A;  1EY9 A;  5LMN W;  5IP9 H;  1STB A;  2J4X A;  1VEG A;  1G91 A;  4IFD G;  3FKE A;  4DAV A;  4UDU C;  4QGU A;  1Q46 A;  4X66 L;  1EIH A;  3IFD A;  1C7Y A;  1FVI A;  2KHH A;  2AKW B;  5ELE A;  3VDY A;  3I04 M;  3TP8 A;  3GV6 A;  3KFU G;  3CQZ B;  1KNA A;  2LVO C;  5A35 A;  4DR7 Q;  2G3Q A;  4HCS A;  4J1M A;  5K36 H;  2R4J A;  1G8P A;  1QUQ A;  2Z8Y M;  2F0L A;  3D4R A;  5COR A;  5M3M B;  1CQF A;  4R1J A;  3HKZ B;  3D4D A;  4LW1 A;  2LHC A;  4DR3 L;  4RGN A;  4OVZ A;  2UUB Q;  2AQ3 B;  1QB5 D;  4M8A A;  4K14 A;  4UAI A;  1KC8 C;  2PW5 A;  4DUZ Q;  1E22 A;  4O42 A;  3VKH A;  2DAK A;  3K5M A;  1Z47 A;  1PFN A;  3JAM S;  5FLM G;  2CQA A;  2CFO A;  4S12 A;  5KPT A;  4MGK E;  2MPM A;  5IGD A;  1MU5 A;  3J80 i;  3E5S A;  3AV0 A;  3C9P A;  1QZM A;  4CDE C;  2OO9 A;  2IJ0 A;  2R3Z A;  1LAB A;  3MEF A;  1FGB D;  1WFQ A;  1PFS A;  1ZMW A;  4FW9 A;  4BY1 G;  3CCU A;  3AU7 A;  1I5F A;  3U4Z A;  2D7G A;  4CKB A;  1KIX A;  4LJ9 A;  5CV8 A;  1WXQ A;  4XK8 F;  4C3H B;  3PIO 3;  3HU2 A;  3VYR A;  4JI4 Q;  2Z4S A;  3C58 A;  2F0S A;  1AP0 A;  1HRJ A;  1RKN A;  4JI1 L;  4QHS A;  5EAY A;  1EIJ A;  3NQT A;  4TUW A;  4LUV A;  4R4Q A;  5IWA Q;  4NC6 A;  1TS3 A;  5M5Y H;  4DV5 M;  2JA7 G;  4ZPX A;  4A76 A;  4XGI A;  5FTK A;  5F3W A;  2B8F A;  1NMF A;  5J3B A;  4JI6 L;  1LTM A;  5LMN Q;  2UUA Q;  2WKD A;  1Q1B A;  3EVQ A;  3I4L A;  3PIP A;  3U6P A;  5C4J B;  1A8V A;  1VQP A;  4JYA Q;  2ZJR A;  3RLN A;  5FO9 B;  5IP7 H;  3PO2 B;  1G41 A;  4DUY M;  3DA1 A;  1SN8 A;  4ZUJ A;  3PO3 H;  4LG2 A;  1N36 Q;  4YCW A;  4NRV A;  2A5Y B;  4G4Q A;  1SMY D;  1N8R C;  3MTS A;  1KAA A;  4AW4 A;  1YNN C;  4ANR A;  5C1B A;  2SNS A;  1RU3 A;  1HZB A;  5KPZ A;  4IPH A;  4YWK A;  2R44 A;  3QAU A;  2BCO A;  3I4N G;  3GTK B;  3S14 B;  1PHJ A;  4IJL A;  3MA2 B;  1CZG A;  1NAP A;  3A55 A;  3HOW G;  1H95 A;  4PQX A;  1YJ9 A;  4L5R C;  3QJY A;  2B2T C;  1LLR D;  1XMQ M;  4ZYS A;  2CWA A;  5J39 A;  3K59 A;  2X6G A;  4JI2 Q;  3KF8 B;  4OX9 Q;  1F77 A;  4IBF A;  4R71 A;  1JIC A;  2HHH Q;  2WAQ G;  1XXG A;  4RKL A;  2CHG A;  4JOI A;  3R93 A;  2DI0 A;  1SJH D;  1DOK A;  5J22 A;  2V4D A;  5EJW A;  3HRZ C;  1YI2 A;  1SXJ D;  2RDF A;  2L55 A;  2JZ0 A;  3KXE C;  4DR7 L;  1OIZ A;  1HCZ A;  3T53 B;  1XNR Q;  1ORY B;  2JP1 A;  3V96 A;  4A3K B;  3S1Q B;  4GZY C;  4F87 A;  3I56 A;  5EP4 A;  1R4G A;  3OPO A;  4UHV A;  2UUB L;  5FJ8 H;  5M5W B;  5JJI A;  3FYD A;  2R7Z G;  1I6H B;  4DV1 Q;  1X65 A;  4DUZ L;  4L8J A;  2OT2 A;  1SMY C;  4LFB M;  4B9W A;  3Q23 A;  2L7H A;  1AEX A;  2N88 A;  1NTG A;  2VXW A;  2B3G A;  5CV4 A;  2CCZ A;  5C6A A;  2KHS A;  1CA6 A;  4D82 A;  3KW6 A;  3FPU B;  4DV4 M;  1TWH H;  2JE6 I;  1C1K A;  5ITX E;  4JK1 C;  5COY A;  4JN6 A;  2K7V A;  3GTO H;  2Z3X A;  5EKL A;  3PUY A;  4RF0 A;  4JI3 M;  4Y7N H;  2ZM6 Q;  3UDG A;  2LHG A;  3W67 A;  2PI2 E;  3AFP A;  2JEA I;  2RVL A;  4JI4 L;  3GLF A;  3I72 A;  2LSS A;  3VR6 A;  3J7A F;  3A8J E;  4AKI A;  3K81 C;  2IX0 A;  2NVY H;  5IWA L;  3HOU H;  2BE5 D;  2C9C A;  2D7E A;  5FKA C;  1BQQ T;  1Y1W H;  3BYY B;  5JI3 E;  1NJI C;  3S1M H;  3FMC A;  4LUO A;  5EP2 A;  5I6Y A;  4DNI A;  4IBJ A;  2UUA L;  1SYB A;  2H1R A;  2V1U A;  4JYA L;  3NUC A;  1OJL A;  3D8G A;  4JV5 Q;  1D8L A;  5CV9 A;  1GUW A;  1T9H A;  5JJL A;  1L8Q A;  2YU9 B;  2VUM G;  3K9O A;  3GLI B;  3QG1 A;  3FTD A;  3D3R A;  4A3B H;  1HPC A;  5NUC A;  1HJP A;  5C4X H;  4A3E H;  4LJ8 A;  1EFU B;  3LGJ A;  3I4O A;  4DV0 M;  4MGI E;  3FDT A;  1EU4 A;  3UDI A;  1FJG L;  2B2U C;  4KHP Q;  1KDA A;  4K0K M;  2K28 A;  1SJE D;  2XIW A;  3DEP A;  3X3M A;  2CHQ A;  2A6E D;  1GHK A;  1BVS A;  1F2Y A;  3RNU A;  1E1O A;  4AYB B;  4E6I A;  4JI2 L;  2WSC F;  5JOB A;  5KIX A;  4JI7 L;  1Z5B A;  1PRT D;  2QA4 A;  1E9R A;  2HHH L;  5C0X J;  1I50 B;  5DM7 3;  4LF7 M;  1EWC A;  4RCO A;  1CTM A;  1XWE A;  4YY3 Q;  2XFT A;  1RD9 D;  5BR8 Q;  4NXN M;  1EQQ A;  3PO3 B;  2XGN A;  3TZU A;  5IT9 S;  1XNR L;  1JWU D;  3R9X B;  1SNO A;  3PIO A;  4PZ8 A;  1SNM A;  2VW9 A;  3ILK A;  3PUV A;  3QYE A;  2XRS D;  4JI8 Q;  1LTL A;  4B7H A;  4LZJ A;  2RCN A;  2SDF A;  3TE6 A;  1FR3 A;  5C3W A;  3JAM c;  3SYK A;  1R7R A;  4XT3 B;  4KKS A;  1SAP A;  1J6Q A;  5A2Q E;  1PJI A;  3ITP A;  2X4A A;  5ITR A;  4QL5 A;  4KMU C;  3OTO Q;  3GV3 A;  2AWO A;  3S9W A;  1GO5 A;  3U9S A;  5EPJ A;  3ND9 A;  1NNJ A;  4B9X A;  5KNB A;  2CV1 A;  3KOX E;  1Q02 A;  2PMZ B;  3KOZ E;  3NEM A;  4IOA A;  3T1H M;  2ZM6 L;  1UWV A;  3GO5 A;  2J7Z A;  2VQF Q;  3F2D A;  3JR4 A;  4QUC A;  2HQE A;  2A74 C;  3MMP A;  5KQD A;  1PJJ A;  2G5D A;  2WB1 G;  2Z4H A;  4PZ6 A;  1GKH A;  3M4Q A;  1IL2 A;  2J5Y A;  4QNM A;  4R8I A;  3L3O C;  2F0W A;  4RNA A;  2QCU A;  2RHS B;  4A3I B;  1ASY A;  1QZE A;  4OWW B;  2EUC A;  3ONA B;  4XXE A;  3KF6 B;  1Y14 B;  4ODG A;  1EY6 A;  4BBS G;  4G7O C;  1NNU C;  2Z6B A;  4OEM B;  3KP0 E;  3TZD A;  2KCN A;  2PQE A;  1RJT A;  2K03 A;  3O13 A;  3BVM A;  5JJK A;  2F0I A;  3FP9 A;  1XHB A;  2BA1 A;  1BCP F;  1N34 M;  3OW2 A;  1I4W A;  4ZRZ A;  1N75 A;  1HA6 A;  4LJ5 A;  2NZ1 D;  1QUS A;  1G51 A;  1TQO A;  3GTO B;  4Y7N B;  3SHG B;  1K82 A;  1EZ8 A;  5IGF A;  4PNY A;  1DGH A;  2F5S A;  3M4O H;  2PQA B;  4II7 A;  1LTG D;  4XQQ A;  3RN5 A;  4KHP L;  2UXC Q;  4OU7 A;  3FTF A;  2F0J A;  1CZW A;  3K8Z A;  1N33 M;  3HOU B;  1VQD A;  1Y1W B;  1DGG A;  2EE1 A;  4BB9 A;  3SE0 A;  4KHV A;  4LF4 Q;  3GQ4 A;  3GRR A;  2RKO A;  1VF7 A;  5ITX A;  2E5L M;  1EY7 A;  4JOI C;  3T56 B;  4IBE A;  4XYO A;  4YY3 L;  2K05 A;  3NBH B;  2Z9H A;  2I5H A;  1E94 E;  4JW0 A;  2ZXP A;  1PH9 A;  3RFW A;  1PVO A;  2KRU A;  4JXJ A;  1OXX K;  1HT2 E;  3EQL C;  1VG5 A;  1B4O A;  4TSS A;  4GKJ M;  1HQR D;  4JI8 L;  1VCI A;  1KXL A;  4DNT B;  3C1F A;  2DZL A;  3I51 A;  4A3B B;  3MWY W;  3B7Z A;  4A3E B;  3GLG E;  1A6X A;  1YSY A;  1OTC A;  1LAC A;  1GUO A;  1C48 A;  1PJS A;  4Z8X A;  2JYO A;  1T43 A;  3BZK A;  2QW7 A;  1M8A A;  1NBW A;  1EWH A;  5M3M G;  1GVP A;  1Q86 C;  1RL2 A;  3BDC A;  3JC6 6;  5ITY A;  3CMA A;  3PF5 A;  1Q39 A;  4DAP A;  2B2W A;  5DLQ E;  1KL9 A;  2DZO B;  1SE4 A;  1N32 Q;  5KYI A;  2YTV A;  1M1K C;  4DK1 A;  2VQF L;  2ID0 A;  4HTH A;  1XPU A;  2X6L A;  1UAP A;  5D3I B;  4A3C H;  4Q7J A;  1OAI A;  2DGY A;  4LAA A;  1I4G A;  4JI5 L;  4KI0 A;  1R4Q B;  1IQP A;  3NPP A;  4I8O A;  1JB7 A;  4DV6 Q;  2OOA A;  3AFH A;  2P5Z X;  2F0Q A;  1E0B A;  4GEW A;  2EQS A;  5AJ3 L;  1CQV A;  4PDG A;  4H13 C;  2N78 A;  5E3F A;  1L0Y B;  1Q3C A;  2WV6 D;  3J7B A;  4C3H G;  1DON A;  5EBC A;  3S16 H;  5ITU A;  4RF1 A;  4X62 M;  1H9S B;  2V6Z M;  1IXR A;  5M3F B;  4LFC Q;  4ULL A;  3X3N A;  1OXT A;  1Y8O B;  2KCT A;  3K58 A;  1ZMU A;  1H9J A;  2NN6 G;  4IPC A;  1AN8 A;  2DHY A;  4HLQ A;  3TSS A;  4LGM A;  4RWS C;  1I4X A;  5GAE C;  4OXP A;  3SR1 A;  3GTG B;  1PZI D;  3PO2 G;  1QDT A;  3G6J B;  1TVX A;  4GOP C;  1NO1 A;  3H4M A;  3BVG A;  4ZKC B;  3S1R H;  1ROD A;  5DEH A;  1YBY A;  5GRO A;  2P5T A;  4CDC C;  1TH2 A;  4KJN A;  2KW0 A;  1R4P B;  1W5T A;  1QJO A;  4JG2 A;  1K8G A;  4LF4 L;  3I55 A;  4A93 G;  4FWD A;  5GKN A;  3L25 A;  4OIK A;  1S72 A;  5A2Q L;  4A3J B;  1RTN A;  2DHR A;  2BDN A;  2PW7 A;  2Z6K C;  4NSR A;  4QOZ C;  1A3V A;  4B3M L;  1SFO B; 
#chains in the Genus database with same CATH homology
 2XWB B;  3LNN A;  4LY6 A;  1S5F D;  4QIW B;  4RGO S;  4A3G B;  1RCV D;  5T1I A;  3HHZ A;  1AFP A;  1GVN A;  3A56 A;  1B2T A;  1SXJ E;  1ZXT A;  1PFB A;  5KQ8 A;  2YNM D;  4LF8 M;  1S5B D;  5FTN A;  3HOX B;  3DZD A;  3AMU A;  1Z59 A;  2FHT A;  3FUX A;  1VMC A;  5JJZ A;  1KTK A;  2IL8 A;  3VYS A;  4MHE A;  5H37 D;  4P16 A;  3T13 A;  4K8J A;  3QOL A;  1D2B A;  2X8A A;  3CF0 A;  2RGO A;  2A69 C;  3J81 E;  1BCP B;  4IBG A;  4AG6 A;  4PDI A;  2F0D A;  4FF4 A;  2EYO A;  1GKI A;  4B3T M;  3CTW B;  3TP6 A;  5C0X H;  5EJC A;  2A68 D;  5ELD A;  5E6J A;  1ILP A;  1NHG C;  2YYZ A;  1IBM M;  2JEB I;  2QKI C;  4L6T B;  1KYI A;  1LTT D;  3FPP A;  1EEF D;  1JQJ C;  4ZLT F;  2AQ2 B;  2KJX A;  1O7Y A;  1C8C A;  2Z4R A;  3GLF B;  3Q24 A;  4IN3 A;  3C46 A;  1FNV A;  1K3W A;  1SBB B;  2CHV A;  5KRU A;  1WTR A;  5BPV A;  3VYT A;  3QB3 A;  4FXG C;  1EEI D;  3VK7 A;  4IUV A;  3H6M A;  4FF1 A;  4GHL A;  2TMP A;  3T1Y M;  4KY6 A;  2NWG A;  3SK6 A;  1IBL M;  1OO9 B;  4CKE A;  2A68 C;  3L2A A;  1Y8N B;  2WIN B;  1IBK M;  1SE3 A;  3Q0A A;  4YIJ A;  1PZJ D;  2RQX A;  3SAT A;  4L15 A;  2L5T A;  2XWJ B;  4PMC A;  2QEN A;  3HGB A;  1SYE A;  3HS0 C;  3VYU A;  1Z6H A;  3S1R B;  1I4H A;  2QP9 X;  4EIW A;  1K8M A;  4NOO B;  1IYV A;  1DM0 B;  3GPX A;  1G4A E;  2JA2 A;  4LJA A;  3I70 A;  1FNW A;  2B2W C;  3L9A X;  3KVW A;  5F2D A;  1EU3 A;  1CM9 A;  3R8F A;  3VKG A;  3JR5 A;  4HR7 B;  4BBR B;  4RGT A;  2V1C A;  3J7Y W;  1HQM C;  3KBX A;  2R65 A;  3LX0 A;  1DGB A;  3HGI A;  5JI2 E;  3A42 A;  2L9H A;  1IY0 A;  3FKI B;  1SDF A;  1BF4 A;  1Q3L A;  4M9S A;  3SAR A;  1OXV A;  4IFD J;  3URY A;  1E2Z A;  1SYF A;  3J27 B;  1JOQ A;  3U6L A;  1ZYR C;  4OIJ A;  4H7B A;  5JAV A;  4V19 0;  3FEW X;  4I7Z C;  2WP8 J;  1SXJ A;  4QCL A;  2KEC A;  1JR0 D;  3KLR A;  4OO1 G;  4X66 M;  3RE8 A;  4BS9 A;  4Z6Y A;  4RKB A;  3H09 A;  5DNF A;  3ERO A;  3WHK A;  1I3Q B;  3IG5 A;  1TU2 B;  2OEO A;  2M2L A;  1ML0 D;  1Z5A A;  3K1J A;  1G6Z A;  4CJ2 C;  5FTL A;  2B2Y A;  3WOF A;  3HG9 A;  2D5D A;  1DGH B;  3RZO B;  4FCV A;  2XEP A;  2RA4 A;  4G4O A;  2B2U A;  1L1T A;  2CV2 A;  4KTA A;  4NMZ A;  5D3D A;  3J81 L;  2O5I C;  3MXP A;  5ITQ A;  1S3S A;  2LXE A;  3SXH A;  1D6E C;  1EYA A;  4FWH A;  1NUC A;  1I4R A;  3UK6 A;  2ZT9 C;  4EGV A;  3A45 A;  2XRQ D;  3HOY B;  1RHP A;  4H0L C;  3OSO A;  5CC4 A;  3NHH A;  1Y1V B;  2EO2 A;  5M9O A;  3T4A C;  4FD2 A;  2KVM A;  3AL0 C;  3HKP A;  1HTP A;  3VR5 A;  4DV3 M;  4KKT A;  1N77 A;  4B3R M;  2DVW B;  2ZAO A;  1ZKO A;  2XZF A;  4LF9 M;  1DO0 A;  3DOA A;  3GPU A;  3AB9 A;  1SSO A;  2TSS A;  1H9S A;  2DNC A;  2EYP A;  2L6O A;  2F0K A;  1XTC D;  5I9O A;  1DOL A;  1QG7 A;  5K5P A;  4CBV A;  1QQW A;  1EYC A;  1ET9 A;  2UXD M;  5I9P A;  5D65 A;  1LTI D;  1IKL A;  2PZW A;  1WTP A;  1M4V A;  3CRK C;  4FVM A;  2R4E A;  2C96 A;  4X3T A;  2BDO A;  1D5M C;  1IL8 A;  3MAQ A;  3HP3 A;  2E2J B;  4OL7 A;  3BVZ A;  3HJQ A;  2K47 A;  1TWA B;  1A15 A;  4GRI A;  3MFG A;  4KN7 C;  3M0E A;  4DR7 M;  4FWG A;  5EXT A;  3TQS A;  1PDQ A;  4MGZ E;  3SHL A;  4ZKB B;  3J7A S;  1BXT A;  3RUZ A;  3SVM A;  3F2U A;  2UUB M;  2IW3 A;  2AHM A;  2EPB A;  1PFM A;  2L11 A;  4G57 A;  1S5C D;  1MGS A;  1IN5 A;  2HDL A;  4L4U A;  4B7G A;  1STG A;  1TII D;  3RZD B;  1GJX A;  2RBM A;  2R18 A;  2LFN A;  2O2L D;  4IBK A;  3HHX A;  4I4L A;  3DXJ C;  1CHP D;  4Q5V A;  1J9O A;  4AG5 A;  3EFX D;  3KS8 A;  4IUP A;  1IKM A;  5C0X I;  4JI4 M;  1I4P A;  1SND A;  5EXS A;  3GPP A;  2F3W A;  5IWA M;  2QIL A;  4X64 M;  5KGU A;  1NY6 A;  2Y0T A;  2VII A;  3LQR A;  1II3 A;  4A3V B;  1I6V C;  2UUA M;  5LMN M;  4QMG A;  1IN7 A;  4L63 B;  3MXG A;  2FE8 A;  4JYA M;  3W3A A;  5JEA J;  5JPN C;  1EQV A;  1SYG A;  3SYL A;  2ZAN A;  5EP1 A;  1N36 M;  4BBA A;  1XYI A;  1GUG A;  1JOR A;  3SK5 A;  2Q8I B;  1N78 A;  3NBI A;  3OHX C;  1O78 A;  1ENF A;  3UI2 A;  3QWN A;  2OQ4 A;  3HEJ A;  1OFI A;  5CV6 A;  3BDL A;  1SXJ C;  5LL6 X;  4OX9 M;  3NTK A;  5KEE A;  1EYD A;  3P20 A;  3SAS A;  2G9D A;  5FLX E;  1SYD A;  1ENA A;  2KRK A;  1A2U A;  2XSZ D;  4IUU A;  4J8Q A;  3VDP A;  4PT5 A;  3HOZ B;  1V1P A;  1JR3 D;  4LF6 M;  4B3S M;  1IY2 A;  3E9S A;  2B2Y C;  4DV1 M;  1SXT A;  3MHV C;  2B2V A;  3IL8 A;  4ZQ3 A;  1QIL A;  2CV0 A;  1J7K A;  4BWG B;  5M5Y B;  1IY1 A;  4IBC A;  5JVG 3;  1E2V A;  4IJF A;  4IBI A;  4IFD H;  1ICW A;  3CF2 A;  4XYQ A;  1WTX A;  2I7N A;  3K5N A;  4S3S A;  2ZM6 M;  2BE5 C;  1PRT F;  3UJN A;  3U5Z A;  2K6A A;  4R9W A;  2CE7 A;  4A3F B;  2K5W A;  4N9T A;  4REZ A;  2F5P A;  2JXM B;  1VDD A;  2ENB A;  3A8I E;  5I2Y A;  4F8M A;  4JV5 M;  2MGS A;  3OIP A;  4OHJ A;  5D14 A;  5E4W C;  3KOW E;  3J7A V;  4C1N K;  1PTO D;  3NE5 B;  3HJ8 A;  5E4X A;  4DGZ A;  2Z1C A;  4LCB A;  2A6E C;  2EY5 A;  3GTM B;  2GA4 B;  4NRW A;  4DXF A;  3MFY A;  1G29 1;  1PRT C;  1KSF X;  3B9P A;  4KHP M;  3C1E A;  2EYF A;  2QZ4 A;  2CW0 D;  2OF1 A;  3MJ5 A;  1MSH A;  4WUR A;  4V0B A;  2D62 A;  2FIN B;  1WD1 A;  1AW7 A;  5BR8 M;  1CA5 A;  2Q8R E;  4KD4 A;  4JBW A;  2KEB A;  1TWH B;  1I4Q A;  1VF5 C;  2LY7 A;  1STN A;  4JI8 M;  1B53 A;  3VDU A;  1PTO H;  4P2C B;  1PTO C;  1S5D D;  1JWM D;  3OTO M;  1BR9 A;  1SXJ B;  2QEJ C;  2CVR A;  2NVY B;  3TBI B;  1JOO A;  2K5D A;  3S1M B;  3U6C A;  2NVQ B;  2D2C C;  1NVM A;  2CW0 C;  1V43 A;  3AOG A;  5FTJ A;  1SEB D;  3U6Q A;  5I6W A;  4ME5 A;  3DMU A;  3MXU A;  4X3S A;  4IJE A;  2D7H A;  2NQ8 C;  2HCI A;  2NB0 A;  1LT5 D;  4CJ1 B;  2N55 A;  4K5W A;  2L7I A;  4M9X A;  5C4X B;  2Y0S B;  4XDX A;  2B63 B;  1HXY D;  3C3L A;  3S2H B;  2YFQ A;  3E0J A;  3U6D A;  1EQT A;  2KZS A;  4NKL A;  3M4Y A;  3RGS A;  2EXZ A;  1XC8 A;  1PMR A;  1TS5 A;  3J80 E;  4GC9 A;  3BS1 A;  5FSW A;  2SNM A;  1KDB A;  1TWC B;  5FO8 B;  4KY7 A;  1U4L A;  1CFM A;  5FLX L;  1B44 D;  2DWZ B;  4X65 M;  2DWN A;  2UXC M;  4CGY B;  3HJS A;  2F5O A;  3RGP A;  5DNY A;  1TR5 A;  2LMC B;  4O1N A;  2MUY A;  5BN3 A;  2CUZ A;  3GQ3 A;  3E6Z X;  3L26 A;  1MX0 A;  2HL7 A;  2OPF A;  3K7A B;  2QBY A;  4KD3 A;  3SAU A;  1TY0 A;  2XVS A;  3FVQ A;  4LK1 C;  3K6O A;  4PV1 C;  1ESF A;  5FTM A;  1QCB D;  1R9T B;  2ZAM A;  4D80 A;  2IX3 A;  2F3V A;  1PRT B;  2RGH A;  1QNU A;  5JEA H;  3NP8 A;  2B2V C;  1QVR A;  1PLF A;  4RCN A;  3K57 A;  4TKO B;  2VNU D;  1X32 A;  4FNF A;  3D6C A;  2K1B A;  2KA6 B;  1D5Z C;  4FF2 A;  3AKZ A;  1WVL A;  1HFG A;  1B9M A;  2ERC A;  3R8B A;  2AUJ D;  4QHT A;  2LKV A;  3MK6 A;  3IFT A;  3H94 A;  4M9Z A;  1JQY D;  3RD4 A;  3HU3 A;  3OWE B;  3I73 A;  1EY8 A;  2F0M A;  1WTW A;  3K5L A;  2FJ2 A;  4IZ8 A;  1NJF A;  3M4O B;  4TRD A;  2DXI A;  3HOW B;  3KSX A;  1B1Z A;  1CT1 D;  4W5W A;  4LFC M;  1D2N A;  1BDO A;  3WDN A;  1FYC A;  1TH4 A;  3JAM E;  1KLU D;  1DCZ A;  4NP5 A;  4CHT B;  1Y69 U;  5EKI A;  3H91 A;  2X49 A;  3PNV A;  5ISR A;  3GP1 A;  2WII B;  2WAC A;  3HU1 A;  4PMW A;  2F0H A;  2F0T A;  2YQZ A;  3DFZ A;  4R7G A;  4ZUI A;  5ITT A;  2LNH C;  3MHB A;  3VLF B;  2EA0 A;  4U67 3;  1H9K A;  1STY A;  2QCP X;  2O4X A;  2L12 A;  4K8I A;  5CMD A;  2CEA A;  4H44 C;  2X69 A;  3WHL A;  5K36 G;  3U6E A;  4DN4 M;  4DF7 A;  1BUV T;  1U4R A;  4NDX A;  2ICE C;  3MXN A;  4DU9 A;  4MM3 B;  1T5E A;  2M60 A;  1STA A;  1WTO A;  4IFD I;  4KHZ A;  2FFK B;  1G59 A;  5I2X A;  4WJW A;  2F0N A;  2ZBK B;  1HUM A;  4LJ7 A;  2EYM A;  2LWX A;  3GLG A;  2F0P A;  3SBJ A;  2I07 B;  3IKJ A;  4LF5 M;  2QF7 A;  2C99 A;  3SMP A;  1HUN A;  1EL0 A;  3H3V C;  4AQY M;  3SAW A;  1H6U A;  2R46 A;  3FTC A;  2R62 A;  1YNJ D;  3S16 B;  1B50 A;  1Z7T A;  3ZCB B;  2A5H A;  3FUW A;  1V1P B;  1F9Q A;  2XN9 C;  5IZ7 D;  3W2D A;  3J80 L;  1QAO A;  3QOJ A;  3OMC A;  3LVV A;  4DR2 M;  1KNE A;  1XMO M;  2DWM A;  3IAY A;  2EYH A;  3ERQ A;  4DV7 M;  3A98 B;  5CBE E;  5KNC A;  4LRS A;  1RTO A;  1A3T A;  1STE A;  4B08 A;  3GRY A;  1ENC A;  1HNX M;  4N9P A;  3U5Z B;  1NY5 A;  4DV2 M;  1QOH A;  3FUU A;  2M5Z A;  3KP1 E;  2K32 A;  1JCK B;  2E2I B;  1J5E M;  1G2S A;  3DHQ A;  3LVW A;  4FYD A;  1F2M A;  5G3L D;  3VFD A;  2L0C A;  1DJR D;  1F9R A;  1EE8 A;  1FD7 D;  4K5V A;  1WCM B;  3GO8 A;  4MN3 A;  1UUP A;  4K5X A;  3TDQ A;  3PIP 3;  1JE4 A;  1ZAE A;  1HQY E;  5ELB A;  3R2T A;  2K01 A;  2KXE A;  1LT6 D;  2H4O A;  2R92 B;  2EY2 A;  1IHZ A;  1K8O A;  2DWL A;  1QAM A;  3G7L A;  1D5X C;  3I90 A;  2FMM A;  2NN6 H;  3RMH A;  3GTJ B;  1HTL D;  1XX8 A;  3IG8 A;  4C2M B;  2IPK D;  1G2T A;  4EVO A;  4RHS A;  2BNK A;  4KJO A;  1QAN A;  3GLH B;  1IW7 D;  5IGB A;  1X37 A;  5CR3 A;  5ELF A;  2RKS A;  1EY5 A;  3OOC A;  1K3X A;  4EQP A;  3GP7 A;  3A8K E;  2L09 A;  1QWY A;  1W5S A;  2Y0Q A;  1XWI A;  4DR3 M;  2JA6 B;  3SK4 A;  3JAM L;  1X3Q A;  1J09 A;  3KOY E;  5IT9 E;  3OW7 A;  1SNQ A;  2XLJ A;  2KED A;  1L2B A;  5IOC A;  3HOV B;  2A6H D;  3CHB D;  4OGQ C;  4CIS A;  1ONL A;  4QF4 A;  4AI6 A;  2F4V M;  2K04 A;  4XBO A;  4KK7 A;  4QNR A;  1T3T A;  2F0O A;  1BOS A;  1CK1 A;  1LT4 D;  2XH9 A;  2C9O A;  5IGC A;  3P1H A;  4JI1 M;  1IW7 C;  4WW0 A;  4I5S A;  3I8Z A;  3KBG A;  4K6D A;  2XSZ A;  4JI6 M;  3BDO A;  2H1E A;  1JR3 A;  5HUR A;  1H9R A;  2O5R A;  3M6A A;  1DOM A;  1A2T A;  2JA5 B;  1GL7 A;  3BYT B;  3DWA A;  1QYR A;  2MHV A;  2KOL A;  1WD0 A;  2IX1 A;  3NK9 A;  1EIG A;  4IUQ A;  3LMM A;  3FUT A;  2A6H C;  4WRD A;  1DZ1 A;  4MB7 A;  4G4R A;  2F0V A;  1LTB D;  3U61 A;  4C3I B;  2BJV A;  1GUT A;  1WTV A;  4HN7 A;  3T38 A;  1YNN D;  3VA5 A;  1Q12 A;  2KA7 A;  3U6M A;  3TWK A;  3I4V A;  4TQU S;  1LT3 D;  1Z5C A;  5M5X B;  3J81 S;  4QOS A;  2QBY B;  3T15 A;  2R45 A;  3DWQ A;  1TWG B;  2ZXR A;  1F9P A;  2F0F A;  2XFS A;  3KDS E;  1CI3 M;  3Q6S A;  4A3D B;  4BA2 I;  2M00 A;  3FRP B;  4RH6 A;  3U6S A;  4DUZ M;  1KLG D;  3ZH9 B;  1L0X B;  2VQE M;  1K83 B;  4DK0 A;  3U9O A;  2AUK A;  4KO8 A;  2B8G A;  3R3O A;  4ZAI A;  2Q8T A;  3AOE A;  4C3J B;  3UZU A;  1G3I A;  3PFI A;  1OXU A;  1IN4 A;  1VMP A;  3A7L A;  3LWE A;  2KZU A;  3ZYY X;  3TWL A;  5EQT A;  4JI0 M;  2A73 B;  1TT2 A;  1V8Q A;  3NWS A;  4A93 B;  1MBY A;  1UNS A;  5BN5 A;  2KEE A;  5JPM C;  4HMI A;  1TWF B;  2L4N A;  3GQ5 A;  1R2Y A;  2RDG A;  1NR2 A;  1EZ6 A;  4GHA A;  3HHW A;  5DAU A;  3A54 A;  4FP5 D;  4HSP A;  3PXG A;  2YR0 A;  3QIA A;  1HNW M;  2B39 A;  4KKU A;  1FNN A;  1BNZ A;  3FD9 A;  1G8Z D;  1MI2 A;  1B3A A;  3BOS A;  4LGY A;  2BOS A;  4R8N A;  1EY0 A;  1HT1 E;  3EIH A;  1FJG M;  2FFJ A;  4KOD A;  1O7Z A;  4G6Z A;  3GTP B;  2PO4 A;  2C5C A;  3BG3 A;  4C56 C;  2QPA A;  2EDG A;  4LFA M;  2D9U A;  4JI2 M;  4G4N A;  4JI7 M;  4FCT A;  2HHH M;  4OO1 H;  3SAV A;  4IUT A;  5IT9 L;  2J7O A;  1TKW B;  1JOK A;  4FXK C;  1TGU A;  1XNR M;  3FUV A;  2VB2 X;  3KUP A;  4QUC A;  3MEH A;  4K2L A;  1Q8I A;  5DYI A;  1GOZ A;  4DXG A;  5J1Z A;  3OMG A;  2HUG A;  1GLN A;  3TP7 A;  2E74 C;  1ZEQ X;  2PNR C;  4PCZ A;  1L2C A;  4XT1 B;  2EY1 A;  4WOR A;  2C98 A;  3GLG B;  2FNA A;  3I4Y A;  4FF3 A;  1MD2 D;  3HZX A;  3GPY A;  3V2T A;  5EXP A;  2FMC A;  4L8R C;  2NYZ D;  4MGH A;  1RF2 D;  4G7H C;  1UEA B;  1YE9 A;  4FXD A;  5FO7 B;  1Y8P B;  5DYG A;  1GL6 A;  4KV6 A;  4R3D A;  4RAU C;  1I94 M;  3NTH A;  5JEA G;  3I4M B;  1S5E D;  4QB4 A;  4ID6 A;  4DA2 A;  2EYJ A;  3CRL C;  1C4Q A;  3SC3 A;  3VA7 A;  5IIF A;  2RSO A;  4BY7 B;  2NN6 I;  2DN8 A;  3Q8X A;  1SNP A;  2NTT A;  2PZU A;  4HCE A;  3TL4 X;  4EQN A;  2NVT B;  3TPZ A;  4IBD A;  2R61 A;  4L78 A;  2HDM A;  3DEO A;  3OIQ A;  2G9H D;  1PTO F;  3SHF A;  4NW2 A;  2DNE A;  4GKK M;  4QUF A;  5EGT A;  3DWP A;  5EKK A;  3PUZ A;  3SK8 A;  1RDP D;  3H0G B;  3KK7 A;  1PM5 A;  3K2L A;  3U60 A;  2HCB A;  4PD2 A;  4IUN A;  1EOT A;  1DO2 A;  2MP1 A;  3GLH A;  4K2K A;  3GTQ B;  5LMU M;  2CHB D;  3CF6 E;  4IAL A;  1KAB A;  4YY3 M;  1ILQ A;  5C3E B;  2XZU A;  1TS4 A;  3D8L A;  2EJG C;  1SNC A;  2F03 A;  1TY2 A;  2M9V A;  3PMF A;  1E9S A;  2Z8L A;  2XSC A;  1OXS C;  3LWU A;  1E2W A;  5C0X G;  4DR6 M;  1IN8 A;  1OFH A;  4G4K A;  5EBD A;  4GIT A;  1V1O A;  4GMQ A;  4FO2 A;  1BCP D;  1XXH A;  3LQQ A;  4A3M B;  1D1I A;  3AOE C;  2VB3 X;  3SDZ A;  1TDZ A;  2I7P A;  2W82 A;  3DUZ A;  2PYK A;  2VQF M;  4B7F A;  4F7X A;  1Q90 A;  1ZQ9 A;  4JI5 M;  3TP5 A;  5IGE A;  4G7Z C;  1HFN A;  4M1U B;  1FNU A;  1LO5 D;  4AKH A;  5KPR A;  1IM2 A;  3GRV A;  3PUX A;  1CHQ D;  1NHW C;  3NSW A;  7CAT A;  2EJM A;  1LTS D;  2LS0 1;  4EQO A;  5FOB B;  4LMQ D;  1DGF A;  1HA5 A;  3RLF A;  2C5R A;  1TS2 A;  1R2Z A;  3W0F A;  4I65 A;  3M7N A;  2Y20 A;  1DXM A;  2HCC A;  3KLS X;  3SMS A;  2EZV A;  3D31 A;  1NSN S;  4BLC A;  1PXU A;  1F2L A;  5IRE B;  3TN2 A;  3M7G A;  2DZN B;  3MC0 B;  1BCP C;  3MZ5 A;  3OWF A;  1YUB A;  1MSG A;  4F88 A;  1NJG A;  1VDZ A;  3WOE A;  5C5M A;  5C44 B;  4LF4 M;  4XTC S;  1LV7 A;  1W6J A;  4GIP A;  8CAT A;  4XIG S;  1EY4 A;  1S4Z A;  5KND A;  1TH3 A;  5KYL A;  3S1N B;  1AZP A;  3N52 A;  4B3M M;  4C3I G;  3FYC A;  4J6H A;  4I81 A;  4IIW A;  4L16 A;  4XQJ A;  4FCW A;  3NXW A;  5HGT A;  2Z7J A;  1NCV A;  2OXP A;  4OVZ B;  4RFB A;  4BY1 B;  4LJZ C;  1J8I A;  1KDC A;  2L1B A;  3U61 B;  3K92 A;  2KCC A;  2DY7 A;  5EXX A;  1UM8 A;  3HHY A;  5I4D A;  3AJI B;  4XQN A;  3E4R A;  2JA8 B;  5BN4 A;  3CU7 A;  2F0U A;  2JA7 B;  1IN6 A;  4HAE A;  4RA8 A;  2FOI C;  3KSJ A;  3CKI B;  1N32 M;  3D8B A;  3GRU A;  3VR4 A;  1F9S A;  3KS4 A;  2XNA C;  2MJ8 A;  3VR2 A;  4KN4 C;  3DM1 A;  5LHY 1;  4LZZ A;  4DV6 M;  4C3J G;  4M0W A;  5FLX S;  1PYW D;  5CYU A;  2PPB C;  2R93 B;  1PTO B;  1X3P A;  1Q1E A;  5C5L A;  2Z4I A;  3KF8 A;  3I4N B;  2A69 D;  4AZF A;  1IYU A;  4Z9C B;  2E75 C;  4NL4 H;  5CV7 A;  1IXS B;  2R6G A;  1JWS D;  2F0E A;  2K5Q A;  1BO0 A;  2EY6 A;  5EQ0 A;  3L7Z C;  2BJW A;  1XNQ M;  2G8L A;  2RSN A;  5ELC A;  3S15 B;  1ESR A;  3EA6 A;  4DR4 M;  1HQC A;  4LRT A;  1JB3 A;  1HNZ M;  2PCF B;  3R2I A;  4DFA A;  3W0L B;  2HKJ A;  5C18 A;  4OO1 I;  3THG A;  4NXM M;  2WAQ B;  2ICI A;  5CGK A;  3U6O A;  2UU9 M;  1W6K A;  3EIE A;  4ABN A;  1STH A;  2AWN A;  3L28 A;  1QAQ A;  2NBF A;  2EOT A;  3A7A B;  2IT1 A;  4DAY A;  3PV0 A;  4HL4 A;  3P7J A;  5C4H A;  5CV5 A;  2R7Z B;  4DNR B;  2G5G X;  2DY8 A;  1KFV A;  2SEB D;  3TME A;  1GXD C;  2F4I A;  1U4P A;  4KLN A;  3M3Y B;  1NSF A;  3VK8 A;  5A2Q S;  1QNK A;  4U68 A;  3PNY A;  1DD2 A;  1LV9 A;  1GHJ A;  1GUS A;  3GD7 A;  3T51 B;  2Y21 A;  3I3C A;  5LL6 S;  4D81 A;  3QO2 A;  4ITQ A;  3K5O A;  4BA1 I;  1U9R A;  4ILW A;  4X3U A;  1QE6 A;  2F5N A;  3L29 A;  3GLI A;  1L2D A;  3P75 A;  4MH0 E;  5JVH 3;  3PUW A;  5T1G A;  1Q3B A;  3S17 B;  4X3K A;  4MIU A;  5C4Z A;  4WFN 3;  3I91 A;  2VUM B;  5E1F A;  3D6W A;  2KQ3 A;  4LJ6 A;  3NTI A;  4GH9 A;  1LTR D;  4C1N I;  5FK9 C;  5IGG A;  2F0G A;  2J0T D;  3S2D B;  1EFI D;  4DR1 M;  2LH0 A;  4OW0 A;  2E2D C;  3NQI A;  4DR5 M;  2E76 C;  2PZT A;  1U4M A;  3T16 A;  1HR0 M;  5KO3 A;  1BBX C;  1AZQ A;  2F1M A;  2NUC A;  2QDB A;  4MGY E;  3PVS A;  1JC7 A;  1Z6T A;  4M0D A;  3UMM A;  3HWS A;  2B2T A;  4CKC A;  2IWH A;  4HSV A;  2RDH A;  1YNJ C;  5EPL A;  3VR3 A;  5G3L F;  4K6L A;  3V05 A;  5IOD A;  2K33 A;  1ZYR D;  1DYQ A;  3ZC7 B;  4IBB A;  3SFZ A;  1O80 A;  5EPK A;  3Q22 A;  2KUM A;  2Q2E B;  3ND8 A;  5AFW A;  1ET6 A;  5CBA E;  2EVB A;  3A46 A;  2UUC M;  3BZD B;  3C2P A;  3KLS A;  3SEB A;  2UXB M;  1PZK D;  1F2Z A;  3GTL B;  3EJI A;  5C3X A;  3J80 S;  1R6B X;  3MVV A;  1SYC A;  3U60 B;  3J2P B;  2WB1 B;  4PMB A;  4LJ4 A;  2NTS A;  1WTQ A;  1NR4 A;  4ZK9 B;  3NWL A;  1A3U A;  1B9N A;  2SOB A;  3TWM A;  1IXR C;  5TSS A;  3L27 A;  4BBS B;  2NVX B;  1O7L A;  1D1K A;  2EYL A;  3QWL A;  3N6R A;  3GQB A;  3FTE A;  2I46 A;  4Q0F A;  3M85 A;  4AKG A;  1H9M A;  2JSO A;  1HHV A;  4IUR A;  4NSO B;  5DM6 3;  1LTA D;  3K0Y A;  2WKC A;  2J7N A;  4KY5 A;  1T5X D;  2AQ1 B;  4CJ0 B;  4GC5 A;  4HED A;  4RGM A;  1L1Z A;  2EJF C;  1E32 A;  1GUN A;  2BA0 A;  2O5J C;  1XXH B;  1TDH A;  4IQZ A;  3NBH A;  1IXZ A;  3NWT A;  1SE2 A;  3D4W A;  3UGJ A;  4HMJ A;  4YHH M;  2XF3 A;  4RHR A;  2F5Q A;  5EP3 A;  2ZXO A;  5E26 A;  1EY9 A;  1STB A;  2J4X A;  1G91 A;  4IFD G;  3FKE A;  4DAV A;  4UDU C;  1EIH A;  3IFD A;  5ELE A;  3TP8 A;  3GV6 A;  3KFU G;  3CQZ B;  1KNA A;  5A35 A;  4HCS A;  4J1M A;  5K36 H;  2R4J A;  1G8P A;  2F0L A;  5COR A;  3D4R A;  5M3M B;  1CQF A;  3HKZ B;  3D4D A;  4RGN A;  4OVZ A;  2AQ3 B;  1QB5 D;  4M8A A;  4K14 A;  4UAI A;  2PW5 A;  4O42 A;  3VKH A;  3K5M A;  1Z47 A;  1PFN A;  3JAM S;  2CQA A;  2CFO A;  4S12 A;  5KPT A;  4MGK E;  2MPM A;  5IGD A;  1MU5 A;  3E5S A;  3AV0 A;  1QZM A;  2IJ0 A;  2R3Z A;  1LAB A;  1FGB D;  4FW9 A;  3AU7 A;  2D7G A;  4CKB A;  4LJ9 A;  5CV8 A;  1WXQ A;  4C3H B;  3PIO 3;  3HU2 A;  3VYR A;  1HRJ A;  2Z4S A;  2F0S A;  3C58 A;  1AP0 A;  1RKN A;  4QHS A;  3NQT A;  4TUW A;  1TS3 A;  4DV5 M;  4ZPX A;  4XGI A;  5FTK A;  5F3W A;  2B8F A;  2WKD A;  1Q1B A;  3EVQ A;  3I4L A;  3U6P A;  5C4J B;  5FO9 B;  3PO2 B;  1G41 A;  4DUY M;  3DA1 A;  4ZUJ A;  4LG2 A;  4NRV A;  2A5Y B;  4G4Q A;  1SMY D;  3MTS A;  1KAA A;  4AW4 A;  1YNN C;  5C1B A;  2SNS A;  5KPZ A;  2BCO A;  3QAU A;  3GTK B;  3S14 B;  3MA2 B;  1CZG A;  1NAP A;  3A55 A;  4PQX A;  3QJY A;  2B2T C;  1LLR D;  1XMQ M;  4ZYS A;  5J39 A;  3K59 A;  2X6G A;  1F77 A;  4IBF A;  1JIC A;  1XXG A;  4RKL A;  2CHG A;  3R93 A;  1SJH D;  1DOK A;  5J22 A;  2V4D A;  5EJW A;  3HRZ C;  1SXJ D;  2RDF A;  2L55 A;  3KXE C;  1HCZ A;  3T53 B;  1ORY B;  2JP1 A;  3V96 A;  4A3K B;  3S1Q B;  4GZY C;  4F87 A;  5EP4 A;  3OPO A;  5M5W B;  3FYD A;  1I6H B;  4L8J A;  2OT2 A;  1SMY C;  4LFB M;  4B9W A;  3Q23 A;  2L7H A;  1AEX A;  2N88 A;  2VXW A;  5CV4 A;  5C6A A;  2KHS A;  1CA6 A;  4D82 A;  3KW6 A;  3FPU B;  4DV4 M;  2JE6 I;  1C1K A;  5ITX E;  4JK1 C;  5COY A;  4JN6 A;  2K7V A;  2Z3X A;  5EKL A;  3PUY A;  4RF0 A;  4JI3 M;  2JEA I;  2RVL A;  3GLF A;  3I72 A;  3VR6 A;  3J7A F;  3A8J E;  4AKI A;  2IX0 A;  2BE5 D;  2C9C A;  2D7E A;  5FKA C;  1BQQ T;  3BYY B;  5JI3 E;  3FMC A;  5EP2 A;  5I6Y A;  4IBJ A;  1SYB A;  2H1R A;  2V1U A;  3NUC A;  1OJL A;  3D8G A;  5CV9 A;  1GUW A;  1L8Q A;  2YU9 B;  3GLI B;  3QG1 A;  3FTD A;  3D3R A;  1HPC A;  5NUC A;  4LJ8 A;  4DV0 M;  4MGI E;  3FDT A;  1EU4 A;  2B2U C;  1KDA A;  4K0K M;  2K28 A;  1SJE D;  2XIW A;  3DEP A;  3X3M A;  2CHQ A;  2A6E D;  1GHK A;  1F2Y A;  4AYB B;  4E6I A;  5JOB A;  5KIX A;  1Z5B A;  1PRT D;  1E9R A;  5C0X J;  1I50 B;  5DM7 3;  4LF7 M;  1EWC A;  4RCO A;  1CTM A;  1XWE A;  2XFT A;  1RD9 D;  4NXN M;  3PO3 B;  2XGN A;  3TZU A;  5IT9 S;  1JWU D;  3R9X B;  1SNO A;  1SNM A;  3ILK A;  3PUV A;  2XRS D;  4B7H A;  4LZJ A;  2SDF A;  3TE6 A;  1FR3 A;  5C3W A;  3SYK A;  1R7R A;  4XT3 B;  4KKS A;  1SAP A;  5A2Q E;  1PJI A;  3ITP A;  2X4A A;  5ITR A;  4KMU C;  3GV3 A;  2AWO A;  3S9W A;  3U9S A;  5EPJ A;  3ND9 A;  1NNJ A;  4B9X A;  5KNB A;  2CV1 A;  3KOX E;  2PMZ B;  3KOZ E;  3T1H M;  3GO5 A;  2J7Z A;  3JR4 A;  2HQE A;  2A74 C;  5KQD A;  1PJJ A;  2Z4H A;  4QNM A;  4R8I A;  3L3O C;  2F0W A;  4RNA A;  2QCU A;  4A3I B;  2EUC A;  3ONA B;  4XXE A;  4ODG A;  1EY6 A;  4G7O C;  1NNU C;  3KP0 E;  3TZD A;  2KCN A;  2PQE A;  1RJT A;  2K03 A;  3O13 A;  3BVM A;  2F0I A;  1XHB A;  2BA1 A;  1BCP F;  1N34 M;  1I4W A;  4ZRZ A;  1N75 A;  1HA6 A;  4LJ5 A;  2NZ1 D;  1TQO A;  3GTO B;  4Y7N B;  3SHG B;  1K82 A;  1EZ8 A;  5IGF A;  4PNY A;  1DGH A;  2F5S A;  4II7 A;  1LTG D;  4XQQ A;  4OU7 A;  3FTF A;  2F0J A;  1CZW A;  3K8Z A;  1N33 M;  3HOU B;  1Y1W B;  1DGG A;  2EE1 A;  4BB9 A;  3SE0 A;  4KHV A;  3GQ4 A;  3GRR A;  2RKO A;  1VF7 A;  5ITX A;  2E5L M;  1EY7 A;  3T56 B;  4IBE A;  4XYO A;  2K05 A;  1E94 E;  2ZXP A;  3RFW A;  2KRU A;  4JXJ A;  1OXX K;  1HT2 E;  3EQL C;  1B4O A;  4TSS A;  4GKJ M;  1HQR D;  1VCI A;  4DNT B;  3C1F A;  4A3B B;  3I51 A;  3MWY W;  4A3E B;  1A6X A;  1YSY A;  1LAC A;  1GUO A;  1C48 A;  4Z8X A;  2JYO A;  1M8A A;  1EWH A;  3BDC A;  5ITY A;  1Q39 A;  4DAP A;  2B2W A;  2DZO B;  1SE4 A;  5KYI A;  4DK1 A;  2ID0 A;  4HTH A;  2X6L A;  1UAP A;  5D3I B;  4LAA A;  1I4G A;  4KI0 A;  1R4Q B;  1IQP A;  3NPP A;  4I8O A;  3AFH A;  2F0Q A;  1E0B A;  1CQV A;  4PDG A;  4H13 C;  5E3F A;  1L0Y B;  1Q3C A;  2WV6 D;  3J7B A;  4C3H G;  1DON A;  5EBC A;  5ITU A;  4RF1 A;  4X62 M;  1H9S B;  2V6Z M;  5M3F B;  4ULL A;  3X3N A;  1OXT A;  1Y8O B;  3K58 A;  1H9J A;  2NN6 G;  1AN8 A;  4HLQ A;  3TSS A;  4LGM A;  4RWS C;  1I4X A;  3SR1 A;  3GTG B;  1PZI D;  3G6J B;  1TVX A;  3H4M A;  3BVG A;  4ZKC B;  1ROD A;  5DEH A;  2P5T A;  1TH2 A;  4KJN A;  2KW0 A;  1R4P B;  1W5T A;  1QJO A;  4FWD A;  5GKN A;  3L25 A;  4OIK A;  5A2Q L;  4A3J B;  1RTN A;  2DHR A;  2BDN A;  2PW7 A;  4NSR A;  4QOZ C;  1A3V A;  2E2H B;  1SFO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...