3NBIA

Crystal structure of human rmi1 n-terminus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
203
structure length
193
Chain Sequence
NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of RMI1 and RMI2, Two OB-Fold Regulatory Subunits of the BLM Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords RecQ-mediated genome instability protein 1
total genus 44
structure length 193
sequence length 203
ec nomenclature
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3nbiA01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nbiA02
3NBIA 4CGYB 4CHTB
chains in the Genus database with same CATH superfamily
2LMCB 2Q8RE 5C5MA 1MU5A 2EYFA 1PTOB 5LHY1 1GO3E 1TWGH 2RGHA 4PNYA 3U58A 4DXGA 3J80c 1TH2A 1VQIA 3HU1A 4GN5A 4I5SA 1LV7A 4B08A 1AE3A 5ELFA 4LFAL 1HR0Q 1WTRA 3KYHC 3VFDA 2UUCQ 1K0SA 1MBYA 3DMUA 1NHWC 1SAPA 1K9MC 1ZQ9A 3J7AS 1EUJA 3I8ZA 3IFTA 4RMFA 4KY5A 4K5VA 1QVCA 1ESFA 4R4QA 2JA9A 1IBKQ 2BOSA 4V190 2DHRA 2XTIA 2F4VQ 2WAQB 3GTPH 4BY1B 3M0EA 1EY7A 3VKGA 5EGTA 2D7GA 2KVMA 4XQNA 1XMOQ 1FJGQ 2Z8YM 4ILWA 4KODA 4A3VB 4JI3Q 4NXNM 5A35A 5IP9H 4F2LA 3PNYA 4IJEA 2IT1A 1U5KA 1KHIA 3FKIH 4FO2A 3K7AB 2L0CA 3X3MA 4IBDA 3SATA 3PO3B 1K82A 1IL2A 4A3FG 2R6FA 4OWTB 3J81S 2HCBA 4DR7M 4XGIA 3KOWE 1G71A 3B9PA 1LTMA 1D1KA 1TIID 1UE7A 4CKBA 4ZKCB 3GTJB 1KD1C 3TP5A 1K8AC 1XTDA 1QDRA 1GUTA 3S16H 1X3PA 3CPWA 4JI6L 2PQEA 3FUXA 2VS1A 4JI1Q 4BS9A 2X69A 1QZGA 3CRLC 4MIUA 5EXTA 1PM5A 1KLUD 1WYDA 3C3EA 2H1EA 5CR3A 1U4LA 2EVBA 2PO4A 3TZDA 4FF4A 2KUMA 2PI2A 4CDEC 1LTLA 3FYDA 2Y0SG 2JE6I 2UXBQ 4OX9Q 3TE6A 3E9IA 1ZYRC 1NR2A 4LF5L 2Z6KC 4DV0Q 4YY3L 4FDBA 3SMSA 5EP3A 2RHQB 1IBLL 3S1NH 5ELNA 1VEKA 4DR6Q 3ER0A 5D65A 4QL5A 1LTSD 2AMCB 3RMHA 2XSZD 2QBYB 2UUAM 1VMCA 5IT9L 4HJ7A 5G3LF 2EYPA 3C3LA 4Z6YA 2CQAA 3A56A 2VXWA 3PFIA 4DUYM 1PZJD 4IJLA 2Q8TA 1QANA 3G71A 3RGPA 2ZM6L 3ILKA 4ALPA 4QY7A 4DR2Q 4B3MM 1VQDA 4GS3A 4M8AA 3L2PA 3KFUG 4LFBM 4QB4A 1E2WA 1Z6HA 4ZRZA 3KOJA 3SHGB 1DGGA 2FMCA 5ITQA 5H37D 2VQFQ 2NUCA 1JMCA 4ZLTF 1NTGA 4P73A 5LMNL 3Q6SA 4HIDA 4DR4L 3MJ5A 4PZ8A 1R5LA 3IECA 3K7UC 3K59A 3OTOM 3PUXA 4GZYC 1XXHE 2X4AA 3I7FA 3ND9A 1B3QA 1OXXK 1IM2A 1TF0B 2DUDA 2LSSA 2JXNA 1HUMA 3SAUA 3H4MA 4AI6A 4O2DA 2F4IA 3T1HQ 2KEEA 1OKSA 4LK1C 1Q46A 2VDBB 1H9SB 5IGEA 3IFDA 4JI4M 1NJIC 4D81A 2HT1A 1EYCA 1N33L 4N8FA 3CXCA 2FE8A 2BA0A 2BWEA 1XWIA 1Z5BA 4LNQA 3L9AX 2NZ1D 4RG1A 5EKIA 4DFAA 4I7AA 2RBMA 3NENA 2JZ1A 1I50B 4BXXG 2A69D 1IYUA 2KDLA 3IG8A 1H9RA 4HMIA 3SVMA 4XK8F 5C4XG 1MI2A 5M3FH 3I4NH 1V9PA 4AYBB 1I94M 1W3SA 3GTKH 4NPSA 3TS2A 1C9OA 2PI2E 1XNRM 4IURA 2CVRA 3V2TA 1I94Q 1Y8PB 4DNRB 3TWMA 3GLGE 1N34M 1D5ZC 2DY8A 2JA2A 2K05A 2LY7A 4HMJA 4CKEA 2J4XA 1VQ5A 2M5ZA 3C3DA 1XXGA 1SNQA 4AQYQ 1BBWA 3S24A 1VQ8A 2K0BX 2C35B 4K2KA 4JI0L 4UN2B 2KOLA 2MO0A 2J7OA 5IT9c 1BCPD 4A3CG 2WIIB 3CP0A 1SNPA 1TS3A 1BF4A 1KTKA 4P16A 3K5LA 2J5YA 3AB9A 2CH4W 4GNXA 3C46A 3I4NB 1JOQA 4X64M 2JZ0A 4GMQA 3KJPA 1GJSA 2R7ZH 1QCBD 4IFDG 4D82A 4HEOA 3M7NA 3U50C 3OYYA 3PIPA 1EY9A 1AH9A 2EO2A 2JWSA 1HA5A 3TP7A 3RLOA 1K3WA 4BA1I 1PH6A 3FD9A 4DV2Q 5EXXA 4LF7M 1FVIA 2DWNA 2OCEA 2F0KA 3KF6B 1QG7A 1BBXC 2CEAA 2DVWB 4XQQA 1TVXA 1UEBA 2WKCA 3H15A 3I4LA 4L6V6 4R4TA 3FRPB 1N33Q 4A3IH 5LMNQ 4KHPL 5BN5A 4A3KG 4EQ5A 3FTDA 4FP5D 2A6EC 4LF4M 4DR6M 3R9XB 2JA5G 3GTGB 4DK0A 2K52A 2MQHA 2PNHA 1CI3M 3NBXX 1PJJA 1E7ZA 1HXYD 2A69C 5C3EG 1DJRD 1NVMA 2VF8A 4L63B 4IFDJ 1DXMA 3CCLA 4B3SL 2LBCA 2ZXPA 3HKZE 4KJNA 5CMDA 4MGYE 1N34L 2FFKB 2F52A 2A8VA 1E2ZA 1B4OA 3I4OA 2Y0SE 1YNNC 4AYBG 4DV6L 1F2MA 1HNXM 4JI1L 1WTVA 3K5OA 4DV3L 3C9PA 3K8AA 3TEHB 2LS01 4JOIA 3H94A 2EJFC 4QNMA 1J5EM 5I6WA 4DGZA 4Q0FA 2DAKA 3MFGA 1BCPC 3NEMA 2IX0A 4BBRH 3MXNA 1JR3A 2UUBL 1QILA 4LUOA 3T15A 5ITXE 4X62M 3K0XA 3QWNA 3BDOA 1ICWA 4A3BH 1TH4A 2O25A 2RVLA 3D6WA 3SASA 1YLAA 5GADC 2L09A 2EY2A 4DR1L 1D0MA 4NSRA 3SGIA 4HJAA 1JJCB 3CQZH 1VQKA 4RCOA 3OWEB 2E75C 1GXDC 1C7YA 3AFHA 2WV6D 4ZKBB 4EQOA 4DR3Q 4WW0A 1XMOL 4LFCQ 1PFNA 2VIIA 1SBBB 4OIKA 2JA7B 2LVPC 2HWJA 3B7QA 1PH1A 4B3RL 1G2TA 1WTHA 3VDYA 3OW2A 4DKAC 4F8MA 4LGMA 1PDQA 4OL7A 2A5HA 1D0KA 1UM8A 2BH8A 3H3VH 1RHPA 4HR7B 2WP8J 1AE2A 2NVQB 5JJIA 3EJIA 5K36H 1K0RA 1WD0A 3DOAA 3L28A 3DM1A 3UDXA 2Z6KA 3I90A 1PH8A 4QQBX 1ZMVA 3MTSA 3T56B 4FF1A 4OWXB 1NY5A 4Q7JA 5ELCA 4FF3A 1HNWQ 4Y52H 1G2SA 5KPTA 4ZPXA 3WHKA 3DLLA 3HZXA 5M3FG 3KOYE 1I4RA 1JR0D 3S1QH 5IP7H 4IFDI 1HZBA 1YEZA 2AHMA 1LTRD 5FTMA 2R92B 4LF9M 3JC66 3AL0C 2XWJB 4JXJA 3E0EA 1BOSA 2L9HA 2YTXA 4LFBL 2PW5A 1SR3A 5IYCG 2F0QA 2JA6G 3U6PA 3B74A 4M0WA 1CKNA 1JWUD 1DONA 1PFMA 1SLJA 2HIXA 4DK6C 4B3SQ 1ILPA 1DGFA 2DZNB 1K8OA 2BE5D 4IN3A 4XYOA 4L78A 2LTUA 2ZTCA 1A3UA 5BR8L 4XQJA 1IYJB 1B53A 1CA6A 2DJGC 4RKUF 1JJGA 1IXZA 2X8AA 1EZ6A 3E9HA 1BXTA 4NXML 4YHHQ 2L11A 4IFDH 1STGA 5HY6A 4A3LH 4KN7C 1P8LA 2LVOC 1G51A 3I51A 2EKFA 1V8QA 4FWDA 3SFZA 1IXSA 2MJ5B 2Z4IA 3NXWA 3L3OC 4DA2A 1E1OA 4DPGA 3ITPA 4QMGA 1S3OA 3NHHA 5LMUQ 4BA2I 4OX9M 2FINB 5C4XH 3J81j 1VS0A 3PO2H 3VR5A 1NV8A 1ENAA 3U60A 2L5TA 4APVA 1CKNB 4OO1I 1II3A 1Y1WB 5T1GA 5KQ8A 1I3QH 3DXJC 1HNXQ 4DF7A 2R7DA 3MHVC 2F1MA 5IGBA 4BWGB 3M4OH 5C44G 4K6LA 1J5EQ 3T1HL 2JA8B 3D3RA 4GN4B 1MHWC 4DR2M 3TL4X 4MH0E 3HKZB 2L12A 4LF8Q 4DN4M 1ENFA 2XNAC 1QOHA 4IO9A 4Y7NH 2ES2A 1F9PA 1X3EA 1YNJD 1HUNA 3ERSX 4IPGA 1EEFD 4DR4Q 3M7GA 2N78A 1H6UA 3H0GB 1LTAD 3M3YH 4M9SA 4IOCA 2R7ZG 2A74C 1I6HH 4IBCA 2BJVA 2KEBA 5IT9E 5DFLA 4C56C 1I3QB 2G8LA 2XGNA 3ULPA 4CGYB 4HCSA 2JJQA 3L7ZC 2XRSD 4KV6A 4DV0L 4DV7Q 3HJSA 2R45A 4LZJA 1I4HA 2BE5C 3A8KE 5HGTA 1PRTB 4BBRG 2K5NA 3U61B 5JAVA 3H3VC 3FEWX 5FLXE 1YJ9A 4IUQA 1P3QQ 5M5XH 4MTNA 2RDGA 4XT3B 4C3JH 1O7IA 3VDUA 1G59A 3SAVA 2RCFA 1B70B 1W5TA 1CQFA 3D31A 5K5PA 2K33A 3KBXA 4QIWB 1RODA 1UE1A 1PH7A 2QP9X 3H91A 3K6OA 2EYMA 1JOKA 1PTOC 3AFQA 2BA1A 2LVQD 3TPZA 3FKEA 3WWVA 4U68A 2E2JB 4JK1C 4DV1L 1X55A 1SFOH 2ZT9C 1GABA 1LT3D 1TY2A 3FE3A 3D4WA 5IGDA 5IYBH 4X62Q 2N35A 5LMUL 1VQ1A 1HNWM 3M85A 3SARA 2DWLA 3MXNB 4UY8C 3GTOB 4AH6A 2F5PA 4A3MG 2UXDL 1F2ZA 2XIWA 2ZAMA 2B39A 1I4PA 1KRTA 1QNUA 4DUZQ 3GLHA 2YFQA 3NWLA 3FUTA 1PTOH 3DFZA 4UP7A 5DM63 3HU2A 4LCBA 2HAKA 2VW9A 3MAQA 3U6SA 1F9QA 4X65M 5ELOA 3FTFA 1L2DA 3VYRA 5KIXA 3NK9A 1GJTA 2DNAA 2D62A 4A3KB 3K2LA 4NMZA 2M2LA 4XDXA 1SFOB 2L7HA 2KXEA 2F0LA 3EIVA 5GROA 1L0WA 2XFSA 4DR7Q 2R62A 2F0GA 2C99A 2UXCQ 1YITA 2Z6BA 1EYGA 5J22A 2DN8A 3QOLA 2NN6G 3DWPA 2B63G 2K5WA 2MH8A 1YJNA 2IHEA 3J7AF 3GLHB 3PIO3 4RGTA 1DGHB 4JI5M 3AQQA 4DV7L 3HOWG 4BY1G 3OTOL 2CFMA 3JAMc 5FTLA 4ZAIA 4LF6Q 3D8BA 2XRQD 4L5SA 3UDIA 1ZMUA 4PV1C 1HT1E 1G6ZA 2YNMD 2Q2UA 4I65A 2OTLA 2K4KA 2E74C 1ET9A 2F0TA 2ASBA 1L1OC 1IKLA 2EKKA 4IBIA 3HHZA 5J1ZA 5JJZA 2UUBM 4IUPA 2Z4SA 1K73C 1HNZQ 1ORYB 1QUTA 3BXWA 1DOMA 1N36Q 4RAUC 3GTJH 2UUBQ 2NVXB 3DM3A 3U6OA 3E21A 3LX0A 4L16A 2LNHC 2V4DA 1P16A 1X56A 4MTKA 5CYUA 1EEID 3HFZB 4A3BB 5COYA 3FMCA 5I6YA 4Z8XA 1YSYA 4Q5VA 5GAGC 3A74A 1STBA 2R18A 3U6LA 2UUAL 1KAWA 4IQZA 4FYDA 1G3IA 4AZFA 3BDCA 1L2BA 4NRVA 3VDPA 3KLRA 2EXZA 4TSSA 1XXHA 5JVH3 4JV5L 5KNBA 1DZ1A 1JT8A 2MJ8A 3KK7A 3AKZA 1N8RC 1IBMM 4DK3C 3PIOA 5C44H 5EP1A 4JI3L 1CHQD 4I4LA 2MO1A 5FJ8H 3KOXE 4LMQD 1YJWA 2UUCL 5A2QE 2EJGC 3EFXD 4JI7Q 2KNAA 3SXHA 2BJWA 1BCPF 4PDIA 2ZJPA 4DAPA 4BBSH 2WAQG 4WRDA 4LGYA 1SYDA 3BBZA 4PQXA 5JEAH 3TREA 3SHFA 1T5XD 4HIMA 4IBFA 5EP2A 2A68C 2AQ3B 4XXEA 5FOBB 1KIXA 4ZCKA 1EZ8A 3CCEA 2OOAA 4PCZA 3E5SA 3CU7A 1PA6A 1FNWA 3SAWA 4CISA 1BO0A 1HQMC 5CGKA 1NUCA 3F2BA 1W6KA 2N3SA 2ZJRA 4KHZA 1E0BA 5C44B 1R9TH 2N49A 1PRTC 3AOEC 1H9SA 2HQLA 2JXMB 1AEXA 3NELA 3ZYYX 1DOLA 2K7VA 3T38A 3E0JA 4CDDC 2CHVA 4KKUA 4HCEA 3PVSA 4IOAA 3UE0A 2JY5A 1IN8A 1B7YB 1EWHA 1MKHA 2VUMG 2Z4RA 3GRUA 2F5QA 4UPAA 3PO2G 2DAEA 1H9MA 2JA5B 4A75A 1GL7A 2I07B 3KVWA 3BJUA 3HGIA 1EU4A 2I0QA 2M9VA 3TP6A 1EY0A 5DLQE 4A3DH 1N34Q 3S9WA 3LMMA 1PVOA 3HOUB 4PT5A 3ZCBB 1PH5A 1ZXTA 4X65Q 2NZHA 3GPPA 3T4AC 2MUYA 4IUTA 1VQOA 2HD3A 4K5WA 4PZ7A 1KFVA 4B3TQ 3I70A 2Z1CA 1TWAB 2EY6A 1IQPA 1D2NA 2KECA 3T13A 1D1IA 3KUPA 1SNMA 2JA5H 2QCPX 4LF9Q 3H0GG 2R93H 1AP0A 2UUCM 2E2HH 2A6HC 3D8GA 1QZHA 1E9SA 1B9NA 1QB5D 1A2UA 2K03A 1NNJA 3HHYA 1EQVA 3HOUH 3HOZH 4H13C 5CV8A 1WIVA 2F0SA 2F0FA 1CA5A 3VKHA 3GLHE 5KRUA 2AWOA 1N33M 4LF7Q 4GLVB 1XNRQ 3HU3A 4R3DA 4IPCA 2YR0A 3GPYA 3LWEA 4LY6A 4RKBA 4R8NA 2JA8G 3RNUA 4HAEA 4R9WA 3E6ZX 2IX3A 2E5LL 1KDAA 4IBEA 1HFGA 2Z0SA 4LAAA 3M4YA 2NWGA 4MN3A 4JI7L 1STAA 3R2TA 4UAIA 2CRUA 1G6PA 1EQTA 4FXGC 1EYDA 1SYFA 2KJXA 2HHHL 4HIKA 2B2TC 3C58A 1L1ZA 2L55A 3S14B 1MIUA 2KBNA 3TBIB 3HOVH 4A3GH 1T5EA 1A2TA 2QENA 4FWHA 4HLQA 1ZAEA 4JI2M 1IZ6A 4FCTA 2IY5B 1FNVA 2PZTA 4L6TB 4L5TA 2D2CC 5JPNC 3FVQA 1HZCA 4J1MA 5M5XB 1NJGA 4JI6Q 2PNRC 4C3JB 2B8GA 2EPBA 4N9PA 4NXMQ 2I5LX 3K80C 4CJ2C 2HDMA 2KHJA 2CV2A 4E6IA 2HKJA 4DV4M 4X3TA 1I4QA 1NV9A 1NNUC 1Q86C 2XWBB 2OT2A 4OW0A 4IBJA 3K92A 4YY3Q 1QZEA 5DYGA 1TDHA 1R9TB 1K28A 5L8RF 4GITA 3J7A5 1UNSA 3QJYA 2O2LD 3VYTA 4NDXA 2QNJA 1LABA 3GQBA 5NUCA 1EY6A 4AKIA 4AW4A 2F0VA 1J8IA 1SNCA 4ABNA 1TS4A 2UUAQ 2R4EA 7CATA 3OMCA 2MHVA 2MR9A 3GTPB 1ZEQX 5ITUA 1HQYE 1HNXL 5M3FB 2BCOA 4DK1A 3UZUA 1Y1VB 5C3WA 3U5ZB 1Y1WG 1XTCD 3KXEC 3SYLA 4B3MQ 5GKNA 2HDLA 1SRUA 1FNUA 4G7OC 2F3VA 2C98A 2XFTA 1G8PA 3S1NB 2WFWA 1A63A 2F0PA 3FKIB 5M3MB 5BPVA 1PHJA 1OXUA 2XSCA 4G4QA 5JEAJ 4WORA 2SNSA 3F2DA 2HHHM 2I7NA 2KZUA 2ZBKB 3PUZA 3T1YL 1E94E 1ILQA 1H9JA 3P20A 2F4VL 1RTNA 2FJ2A 4G3OA 5IT9S 1Y8NB 2C5RA 4KY6A 1WR1B 4PZ6A 2CHBD 2KW0A 3K9PA 3A8JE 2PPBC 1EQRA 2ERCA 3T6PA 2CP8A 3GTQH 4YWLA 2JY8A 4FCWA 4RNAA 1NCVA 3KP1E 1BVSA 3CGWA 2TMPA 3H4JA 2ICIA 4UP9A 4YCUA 3OOCA 3BZCA 3GLGB 1NJFA 1WTQA 4MGIE 2CFOA 3NTHA 4DV1M 5EJCA 4X6AH 4CBVA 2K04A 2RGOA 3TZUA 2APLA 1W6JA 2QEJC 4BBSG 1RJTA 4M1UB 3ICEA 4HIOA 3IRBA 4YHHM 5JEAG 1GVNA 4GOPB 2R46A 1Q39A 3AFPA 4C2MB 3I3CA 1W2BA 4G4RA 1SG9A 1D2BA 2AKWB 2UU9Q 1LTGD 1CZGA 3MEFA 4ANRA 4DV3Q 3AU7A 3CCMA 4OVZB 3AMUA 2L4FA 3D4RA 1DO0A 1KC8C 1CKOA 4A3MH 3KDSE 1JWMD 1EFUB 3DEOA 4YCWA 4OVZA 3GTMB 1KABA 1Q7YC 1Y69U 2WINB 1HT2E 3K1JA 2OQ0A 4X3KA 4LFAM 3KF8A 1CTMA 3ZC7B 1E9RA 4KLNA 2ZTEA 1KXLA 3GRRA 4KHPM 1IBLQ 4KD4A 1GUSA 3KBGA 1QDTA 1IXRA 2NVTB 1NE3A 1KNEA 4X66Q 4N9TA 3CF2A 3I91A 2JA7G 4K5XA 4II7A 3RUZA 1M1KC 1EWCA 1VQ9A 4JPBW 1I4WA 4LJ5A 2XN9C 2L4EA 1D6EC 4JI4L 2F5OA 1UUPA 3K5NA 3HOYG 2X6GA 4NXMM 1HZAA 2GNOA 3N6RA 4GRIA 3BVZA 1V43A 3M4PA 5E26A 4DAMA 1Z59A 3PF5A 2SEBD 3S15B 1EQQA 1IW7C 4BY7B 1EY8A 3HKSA 1YE9A 5ITXA 2WB1E 4KKTA 4F87A 3WOFA 1SSOA 2FMMA 2R7ZB 4LF4L 2OPFA 3C2PA 2BH2A 4JBJA 1IY2A 2EXDA 5C6AA 2QHOB 2CE7A 1OXVA 5C5LA 5IYDG 1WHCA 2JP1A 1BBUA 1EIYB 2XVSA 4GLXA 4DR5M 3HHWA 3UE1A 1DM0B 1N36L 1TDZA 1U0LA 3LNNA 1GO5A 4G4OA 3NE5B 4LWCA 4U673 4OO1G 2JA8H 3U6QA 1WOCA 5IY0A 4REZA 3GV6A 3QO2A 3UDGA 2B3TA 1C1KA 4KT0F 3LVVA 2YV5A 3CCSA 4DV6M 3CCUA 3S1MB 1IY0A 2EYLA 3U5ZA 3I4YA 3BVGA 4MGZE 4F7XA 1EY5A 1OIPA 1CHPD 3I4NG 2F5SA 5EQTA 1OJLA 4A3GB 3I4MB 3CF5A 2IX1A 3A55A 1LT5D 4MZ9A 3FUVA 3TDQA 5IWAQ 5C0XI 1STEA 2N88A 1JB3A 1VQAA 4OONA 5FSWA 5M5YH 1KQSA 3HOZB 5F2DA 4V0BA 1CSQA 2TSSA 4QHSA 4PMBA 1IBKL 5C4ZA 1ZMWA 4C3IG 1XNQL 4K0KQ 1QJOA 3MHBA 3PF4A 2OWOA 2VF7A 1XNRL 1M90C 1Z7TA 1XXHB 3I01M 4R4CA 5IOCA 1DGSA 4QUFA 3V05A 1SXJA 4OIJA 2Y0QA 1CSPA 2XLJA 1V34A 5DNYA 1VQNA 2YTYA 3WOEA 2WB1G 2E2JH 1QAOA 3KS8A 2P5TA 1EYAA 2JYOA 4N8X1 2RCNA 4CJ1B 3IL8A 4JI5Q 1Q90A 1KAAA 2K6AA 3TWLA 4DR5L 3CC2A 3D8LA 3Q0AA 1LTID 3GTLH 2F0MA 2LXJA 2PCFB 3B7ZA 4JI1M 3FTEA 3HKZG 1EIJA 2O5RA 3KLSX 1VQMA 5I2XA 4YWKA 4AYBE 1TWFH 4ZUJA 1CKMA 2O01F 2G9DA 4NC6A 4LF4Q 5FLXc 1DGHA 1B9MA 3P75A 4A3EH 4JI8M 2KENA 2X6LA 4P71A 2JK8A 2G9HD 1LLRD 5IGFA 5ISRA 3PCOB 4GHAA 3J81c 4OX9L 2KHSA 2XEPA 2XGTA 2VZAA 1EY4A 1GVPA 5J39A 3OPOA 1GJXA 2LXEA 1VDZA 4A76A 3UGJA 3H0GH 3SC3A 2NTTA 2V1UA 3K9OA 2IW3A 3D6CA 1T9HA 4YHHL 4GLAC 4P17A 3J2PB 4NB3A 1PH9A 1C8CA 4DV5Q 4S3SA 4J15A 1GD7A 1PH4A 1EFWA 1UE6A 4ME3A 3JAMi 4LF7L 1Y1VH 2R92G 3DZDA 1SXJE 2ZM6Q 2Y21A 4DR2L 2FNAA 2RRUA 4GC9A 4HTHA 4GKKL 3ULLA 1BNZA 4HL4A 2E5LQ 1HH2P 3PQIA 3W67A 2L1BA 3PO3G 2DZLA 4B3RQ 3QOJA 2VQEQ 3HJ8A 4JBWA 2OOBA 3URYA 1AN8A 3KDFB 1A0IA 2JNHA 2EDGA 2R61A 3T51B 1QVGA 1C48A 2AUJD 1WVLA 1PV4A 3QIAA 3CC7A 2QDLA 4GN3B 4QHTA 3NPPA 3FRHA 1SE8A 4A93G 2BDOA 3B6YA 4J6HA 2KRUA 5GQOA 4ZQ3A 2F0HA 3MMPA 1ML0D 4PMCA 3W1BA 4FW9A 2B29A 1YHAA 4FWGA 1HCZA 2V1CC 3U61A 4OO1H 1GLNA 1ZV1A 1B8AA 4BY7G 2XSZA 2E2DC 4RGMA 4X64L 2A5YB 2K5DA 3LWUA 3MZ5A 3K5MA 3M9BA 1WI5A 3PUVA 4FVMA 1Q1BA 1Q3LA 3MC0B 4J8QA 2Q8IB 3B89A 2VB3X 1V33A 2J7NA 3A0JA 3T1YM 2OO9A 3RE8A 4GH9A 1STNA 4RA8A 5E3FA 1MJEA 2EYOA 1F9SA 4RHSA 4C2MH 5LL6X 1VCIA 1HQRD 1MJCA 1HA6A 2Z9HA 2RF4A 1QUQA 1XYIA 4OHJA 1PYSB 4Y7NB 4FD2A 5H1SE 3S2DH 4RGNA 2KRKA 1TKWB 3VYSA 4DR1Q 3PV0A 3TRZA 3M4QA 3K8ZA 1SJHD 2VB2X 3VA7A 4DUYL 5EP4A 4AQYL 2JUJA 2A68D 4JI0Q 1L2CA 1PJIA 1AIPC 1B2TA 3GQ3A 4MB7A 3S1RH 1WJ7A 3VR4A 1PRTD 2V6ZM 4OU7A 4IBBA 2NVYB 4R1JA 4LFCM 1TWFB 2KHHA 1OIZA 3UI2A 2YTVA 2KEDA 4EVOA 4C3HG 4H02A 1XX8A 5C4XB 3DWQA 3HOVG 3QR8A 2LHCA 4A3GG 3PIP3 4KI0A 4C1NI 5CC4A 4A3LG 4KK7A 1Q3BA 1OO9B 4M0DA 4TRDA 2OF1A 2GVAA 2ICEC 3GP7A 3KLSA 4AKGA 3BYTB 5CBAE 1WJJA 3OW7A 4DUZM 4DV3M 1HTPA 2MP1A 4KMUC 2QA4A 4WURA 1F2LA 3GP1A 1GUNA 1SXTA 1S5CD 1HTLD 1ONLA 3GDEA 2WACA 4CKCA 3A45A 2R93B 4AG6A 2G5DA 3AYHB 4JBMA 5ELDA 3W68A 2EIFA 1SYBA 1IBLM 1J09A 3E3XA 4KHPQ 3R93A 1XC8A 1FJGM 3AJIB 5LMUM 3EROA 3KJOA 2L4NA 4JN6A 2R3ZA 2DAGA 2QGQA 1VQJA 1GUWA 4IJHA 1D8LA 1V1OA 4H7BA 1CUKA 4L5RC 2DY7A 1SROA 2ID0A 1B44D 2LFNA 4JVZA 4AIMA 3HOZG 2W82A 1O7LA 4NP5A 4EQPA 3J7BA 2JA6B 1AZQA 1A62A 4GC5A 4K14A 1PMRA 2FH0A 5IGCA 3KFUA 4A3KH 1O80A 2HCIA 5BN4A 4X65L 1W5SA 1QUQB 2E76C 4QNRA 1RL2A 1A5TA 1MSHA 3I4MG 4P75A 1QQWA 3CQZB 4FXKC 1DV0A 3SR1A 1C0AA 5FLXS 2F03A 1R4PB 1VEJA 4I81A 4QJFA 1QAMA 1BDOA 2CV0A 1B1ZA 3CCRA 3GLIB 3RFWA 4IPHA 4AG5A 3PUYA 4A3FB 3BG3A 1HR0W 3HJQA 4Z9CB 2QW7A 4DR6L 2ENBA 2A1AA 3FHWA 1XPRA 3S16B 4ME5A 4A3JB 4OXPA 2Y20A 2EY5A 2NN6H 1TU2B 4C3HB 1U4PA 4R4IA 3E9SA 1QAQA 2I46A 4JI4Q 3HOWH 1VQ6A 1AUAA 1CFMA 2MFIA 2QDBA 4K6DA 5HGQA 4FNFA 3TSSA 4OGQC 3T1HM 2Q2HA 1Y14B 2DAIA 5FO8B 2EYJA 2G5GX 4X3SA 2G3QA 2JQOA 3S1QB 2NVXH 3THGA 3NBIA 4DAVA 4LF8L 1SMYC 1V1QA 1VQEA 3L26A 1LM0A 3KDFA 1PJQA 3HOYB 2AUKA 2K50A 4DBGB 1IN7A 4LJ8A 2F4VM 3HRZC 5EXPA 1WTPA 4JYAL 4TKOB 2AHOB 4QUCA 3CCVA 1JR3E 3HG9A 1PYBA 4JI0M 1D0LA 5FO7B 1TWCB 3J81E 3VK8A 4G57A 5IIFA 3OTOQ 1PGYA 3KOZE 1RF2D 1G8ZD 3FRIA 2EZVA 2NZOA 2L15A 2K01A 5K36G 2O5IC 1S5BD 4LRSA 3CPFA 3SK6A 1J6QA 3FDTA 4LJ4A 5CORA 1N32L 3NUCA 1WD1A 4LJ9A 1STYA 2SOBA 3SHLA 2P5ZX 1HNZL 5KPZA 2KQ3A 3HOXB 1FNNA 1L1OA 3NQTA 5BR8Q 5LMNW 4GHLA 3OIQA 4G4KA 1A3VA 2F0IA 3IG5A 1SMXA 5AJ3Q 3C1FA 1EWIA 4K8JA 1IXSB 2KNZA 3SYKA 5D14A 3AOGA 3KS4A 1YBYA 4LJ7A 2HQEA 1I5FA 2EYHA 1T43A 4C3IH 4HSVA 1VQFA 1R4GA 1GKIA 4KO8A 4B9XA 4DR3L 4FF2A 5FLMG 1FJGL 3JAMS 4JW0A 3RGSA 5KNDA 2KHIA 2DNCA 1HR0L 4WJ3M 3PXGA 1K8MA 4DV1Q 4NXNQ 4AQYM 3NP8A 4LF5M 2DJFC 2PYKA 3DEPA 2IHFA 1MX0A 1JC7A 5DM73 1OFHA 3CD6A 3CCJA 4XIGS 5TSSA 4LZZA 4C1NK 5C1BA 1JORA 1FL0A 1V1PA 2K5HA 5IREB 1SXJB 4JYAQ 4A3DG 5E1FA 4A93B 1JQYD 1LO5D 4GKJL 4HEDA 1DO2A 4DV2L 3J80E 4A3FH 3P7JA 1TWAH 2KCMA 5FKAC 1TWHH 4LJAA 5FJ8G 4NL4H 5FLXL 4IUNA 1J5EL 3IKJA 1I6VC 4NKLA 4A3JH 1B50A 1IXRC 4CIZA 4RWSC 4QCLA 5EPJA 2VY3A 3S2HB 1PRBA 2LXKA 2RHSB 4DV4Q 3I04M 3HP3A 1IN6A 4QOZC 1TWGB 1ENCA 2QEXA 1Q12A 4RKLA 1O7YA 4CHTB 2B2UC 1KNAA 4X66M 3GV3A 2UXDM 3NWTA 1MJGM 1QYRA 1XMQL 1KL9A 4A3DB 2DKLA 3GLFA 2ZANA 1N36M 2K32A 4JBKA 1L2FA 3RLNA 1WCMH 3HOYH 3SK5A 3ULJA 4DV6Q 3EBEA 3U9OA 3F1ZA 3STBC 2JY7A 4A3IB 3OHXC 3U4ZA 1XJVA 2SDFA 4KY7A 2PZWA 4K8IA 5IP9G 3GTGH 2F3WA 4RH6A 4DUYQ 4POGA 1PJTA 4LFBQ 5FTKA 4MM3B 1OTRA 1SYEA 1RDPD 3J81L 3GTQB 5IGGA 3VR6A 2M60A 1DGBA 2UXBL 2IPKD 4K2LA 4ITQA 1Y8OB 4WJWA 1LV9A 3DWAA 1R2ZA 3S17H 1WTWA 2XH9A 4PMWA 1I94L 3M6AA 5ITRA 3PO3H 2F0JA 3RZDH 5KQDA 1FD7D 1ASZA 4DXFA 1EIHA 3W3AA 2RKOA 3G48A 2X49A 5T1IA 4DV5L 1RD9D 5M5WH 3JR5A 1I4GA 3G6EA 4B3TL 1SJED 1SEBD 1EL0A 4I8OA 1TR5A 1K3RA 3OIPA 1UWVA 2FS1A 3CTWB 4LUVA 4ULLA 2MNAA 3HGBA 4RGOS 1T3TA 5E4WC 2E2IB 2D7EA 3CW2C 3HX3A 5EBCA 4P74A 2R0IA 1PZID 1LTTD 5EJWA 1IHZA 3H09A 4R4OA 5C3EB 2CWPA 3R3OA 3R8FA 2K28A 2F5NA 5M5YB 5FTJA 4HJ8A 2Y0TA 5ITTA 2JN4A 1S3SA 3KF8B 3S14H 4M9ZA 5D3DA 1F4IA 5DYIA 1GL6A 1J9OA 1TS2A 4GIPA 5M5WB 1ICFB 4BXXH 1U4RA 3KW6A 1E22A 2FFJA 2JA6H 3AV0A 1Z6TA 4JG2A 3RN2A 3GD7A 3L29A 3BYYB 3GLFE 1YZ6A 4R7GA 3X3NA 1YIJA 2PMZE 1O78A 2JSOA 3STBD 4MNOA 3U6EA 1UAPA 3A7AB 1TTEA 1TT2A 1KRSA 3PNVA 2LWXA 2O4XA 4IUUA 1WXQA 1TR8A 2C96A 3DUZA 2LH0A 2B63H 3L2AA 3G6JB 5FK9C 1R2YA 1D5XC 4CDCC 3HKPA 5GAHC 2Q2IA 3BOSA 4BY1H 4NOOB 3NTIA 4P2CB 2J0TD 4XT1B 3OSOA 1IL8A 3H3VI 3RZOB 3LCUA 5D3IB 1B3AA 2ATWA 5L37A 3CKIB 1VQHA 4EGVA 2E8GA 2C9OA 4CJ6A 4GNXB 4L4UA 1KDBA 1HRJA 2FOIC 2LKVA 3VR3A 4C3HH 3A5UA 4H0LC 4DV5M 2L6OA 1PZKD 5JOBA 2EQSA 1MD2D 2KA6B 2RSNA 1EOTA 3CMEA 1L0YB 3AOEA 4WP2A 3TWKA 2YU9B 4A3EB 1YVCA 1OAOC 2JY6B 4RCNA 4B3ML 3I4VA 2H5XA 2Z3XA 1UEAB 1WGLA 4O0AA 2CW0C 3K57A 1VF5C 5C4HA 4LF9L 1OTCA 1UFZA 2UXBM 1VQLA 5CV6A 4F88A 3AEVA 2ZXOA 3KSXA 1CM9A 4LG2A 1NNXA 1PRTF 5LMNM 5KO3A 4RFBA 1AW7A 3BZKA 4ZYSA 5ELBA 3B7NA 4DR5Q 3V76A 2I5MX 4MHEA 1EE8A 5FTNA 2MGWA 3VK7A 2F0EA 5EXSA 2WKDA 3GTKB 4QOSA 3W1GA 4IIWA 2QCUA 1QUSA 3A7LA 3OWFA 4GKJM 4KKSA 3RZDB 2NVTH 4L5QA 4M9XA 4JV5M 3U60B 4B7GA 4JI7M 1DOKA 3ERQA 1YNXA 1R7RA 2D5DA 2HHHQ 1VF7A 4C3JG 1N32M 1OXSC 4L8RC 5JJLA 2PW7A 1VQPA 2Q2TA 1N32Q 3QYEA 1S40A 3NQIA 2E2IH 2DZOB 4DR1M 3HOXH 2Z8LA 3Q8DA 1X6OA 1TS5A 5LL6S 1V92A 3CAMA 5DEHA 2E2HB 3A5ZB 3HS0C 2WZJA 3CC4A 2M00A 1XMOM 3E4RA 2UU9L 5IYBG 1MGSA 3QWLA 3K81C 2DENA 1XMQM 1U9RA 3KP0E 3A42A 4A3JG 2VUMH 3M3YB 1YHQA 4B9WA 3LVWA 3GTMH 1OXTA 5KNCA 4HJ5A 2B2TA 1PFSA 2YQZA 4LFCL 3CMAA 4DR3M 2SNMA 1IN4A 2FXQA 2QBYA 4FCVA 1K83B 2F0OA 3HY5A 3J7ZC 5IWAM 3TN2A 4DAYB 1SYGA 3Q22A 2Y0SB 2C9CA 2QSFX 2KCTA 3OMGA 2LVAA 3LGJA 5IODA 5C0XG 5IYDH 1IKMA 3LQRA 5JJKA 1JR3D 2AWNA 2D7HA 1A15A 3CHBD 2DWMA 2B63B 3I55A 5GAEC 3S1MH 4QIWE 3D4DA 2NQ8C 1K3BC 3UJNA 1S4ZA 5ELEA 3GRVA 4R8IA 1PTOF 1TWHB 2PZUA 3T16A 3J7AV 2B2WA 5DAUA 2OQKA 1H95A 3I4MH 1QE6A 2QPAA 3PUWA 3S1RB 1M8AA 2OEOA 2JA7H 2NVYH 3QB3A 4PDGA 2K1BA 1G41A 4JI3M 5JI3E 1K83H 3JAML 2H4OA 4JOIC 1E2VA 4RF1A 2J7ZA 1ASYA 1ZYRD 3MFYA 3O13A 2R6GA 2YU9H 1IW7D 3BU2A 1EIFA 2NVQH 4L15A 1KDCA 2D0OA 1D7QA 3EA6A 4OWWB 3GO8A 1R6BX 4EQNA 1NR4A 1NO1A 1F77A 2Q2EB 2NTSA 1JICA 5C0XJ 2CH4A 2CHQA 3FP9A 2ZTDA 2GQFA 1RIPA 4BBRB 3SDZA 1LACA 1X65A 2DWZB 2V1CA 3LW5F 4PD2A 4S12A 3GQ5A 3QYBA 1S5DD 1Q82C 3ZJYC 1AZPA 1NMFA 3W2DA 5CBEE 4TQUS 4CDFC 2UU9M 1NSFA 1HHVA 4P72A 1VDDA 3SK8A 4UDUC 1E32A 3R2IA 3H6MA 2WB1B 1JQJC 1XB2B 4GKKM 4JI8L 3CRKC 4DNTB 3F2CA 1CK1A 5IE8A 1TQOA 5I4DA 2N55A 1JB7A 2RSOA 1X3GA 2VQEM 3S17B 4LFAQ 1RTOA 4XBOA 3TQSA 3P1HA 3VA5A 5J3BA 2XZUA 2F0NA 2R7FA 4ZK9B 2VQFL 1WGNA 2EJMA 2MPMA 2XF3A 4GOPC 2L2DA 2RA4A 2DI0A 1X32A 3NBHB 1K8GA 2UXDQ 1F2YA 1M4VA 5I9PA 2GA4B 4EIWA 3PGZA 1XWEA 1FGUA 3D0FA 4GEWA 4OEMB 1SXJD 5CV7A 3KLWA 1G91A 2R44A 2WSCF 3PMFA 5M3MG 1D5MC 1U4MA 1Q8KA 4JCVE 2EA0A 3J80L 5EKLA 1IY1A 5IWAL 1HZ9A 2GVBA 3RLFA 1LYLA 4LF8M 1TH3A 2A73B 1QWYA 1T6OA 1LTBD 2MGSA 3Q23A 1I50H 1DD2A 3SBJA 5EPKA 3VYUA 2CQOA 3EVQA 4G7ZC 2EY1A 3CF0A 1L1TA 3MXGA 1Y1WH 3T1YQ 2FHTA 3JR4A 4F1IA 2XZFA 3KF6A 4UP8A 3HOWB 2I7PA 3RR5A 1VEGA 4IZ8A 3HEJA 1YNJC 4L8JA 3DA1A 4ZUIA 3J81i 4JI2L 3ZH9B 1FR3A 3GO5A 4LW1A 4XYQA 1NAPA 3WDNA 4NSOB 1FYCA 4I7ZC 3F92A 2EOTA 4WFN3 2O5JC 3J7YW 4IPDA 1I4XA 1X54A 2RKSA 5C4JH 3VLFB 3CCQA 3DHQA 3MXPA 4EX5A 3L0OA 1SE4A 2NN6I 1ZKOA 2ALYB 3FPPA 2B2UA 1RKNA 4DV4L 4BBSB 1LT6D 2JEBI 3G7LA 4WJ4A 1Q3CA 1BKBA 2IWHA 1H9KA 2HL7A 1HR0M 2HCCA 3UK6A 3NSWA 2I5HA 3VR2A 1VQGA 2B2VC 1GHJA 1SE3A 5BR8M 5G3LD 3T53B 3JAME 3TS0A 2DHYA 1RU3A 2DXIA 1SMYD 5EKKA 1JOOA 2KCNA 5EAYA 1L8QA 3WHLA 1TWCH 3K58A 4QF4A 3U4VA 3SK4A 2IL8A 5AFWA 1A8VA 4PG3A 2WSFF 5C4JB 2K75A 2EJSA 2K47A 1NY6A 2JP7A 4RF0A 2PQAB 1L1OB 4KD3A 4HJ9A 4NRWA 4TVAB 1E3PA 3BVMA 1SXJC 1PXUA 2EE1A 1ESRA 1WTOA 3NWSA 3J80i 1NHGC 2Z7JA 4R71A 4JYAM 2C5CA 2R4JA 5DNFA 1TGUA 2NBFA 4LF5Q 4BY7H 2KA7A 1BR9A 1AFPA 1OQYA 1GM5A 2NB0A 2VQEL 1YNND 4UHVA 5I9OA 1YUBA 2HUGA 4DR7L 1GUOA 3E46A 1Y1VG 2A19A 2R92H 3SMPA 1CZWA 2QF7A 2OTJA 1VG5A 1PYWD 3BDLA 1DYQA 1QVFA 1J7KA 5I2YA 1VMPA 5KYIA 3N52A 3HWSA 1N75A 5EBDA 4X3UA 4C3IB 5JI2E 4LJZC 1JE4A 4ODGA 5KEEA 5A2QS 1PLFA 4GNXC 1O7ZA 4LF6L 3Q8GA 4NW2A 2CWBA 3GRYA 1Y8GA 1DCZA 5FLMH 1PH2A 1GOZA 2CW0D 1PFBA 3F8TA 1EU3A 2KCCA 3MVVA 4YWMA 5C0XH 4TUWA 1JE5A 4O42A 1OFIA 1NMGA 1X37A 4YY3M 2RQXA 3K0YA 5EPLA 3W0FA 2ZXRA 2WSEF 2H1RA 3ONAB 4H44C 1SYCA 4MGKE 1HNWL 3HHXA 3UMMA 4GKJQ 5JVG3 3EQLC 3BS1A 2DAMA 1XHBA 1XPOA 4A4IA 3S2DB 2B3GA 2N8NA 4IBGA 2KZSA 4LUZA 1Q81C 1SNOA 2K5VA 4HSPA 2VUMB 5JPMC 3RN5A 1IFYA 4OELB 1JWSD 3PO2B 3TMEA 2VNUD 3GLFB 1SN8A 1IBMQ 4JV5Q 3FTCA 5BN3A 5HURA 1S72A 4CJ0B 2D0PA 2KNVA 3MWYW 3EIEA 3IAYA 2QZ4A 3HOVB 3FKIG 4XTCS 2K14A 3GLIA 3A54A 1CQVA 1NY4A 1MSGA 3UDFA 5CV5A 5FO9B 5E6JA 1Z5CA 2AQ2B 3M4OB 1KYIA 2B2VA 2CWAA 3V96A 5C3XA 1EOVA 2BNKA 5EQ0A 1TY0A 2AQ1B 4MGHA 3GPXA 1SNDA 3L25A 4X62L 1LT4D 4B7FA 5ITYA 3MK6A 2OXPA 5AJ3L 1E1TA 3W5OA 3NTKA 4IJFA 1JCKB 4W5WA 4B3TM 2CHGA 2F0UA 3I2ZA 1IN5A 3GTLB 1Q02A 4AKHA 3J80S 2MROB 1WCMG 2BWBA 5IZ7D 4KJOA 1N78A 2B2WC 1OAIA 2R65A 1PH3A 2OQ4A 1A3TA 2QILA 1VQ4A 2F0WA 3L27A 3NBHA 3QAUA 1V1PB 1RCVD 1QNKA 5IYCH 1E24A 5A2QL 5CV4A 4X66L 2F3IA 4IBKA 4YIJA 3LQQA 4B3SM 1IYVA 2B2YA 2WAQE 2UXCM 4G7HC 5E7NA 2JEAI 5M9OA 3MXUA 2L7IA 1SE2A 1KSFX 4K0KM 1YHBA 2LHGA 4A3BG 3QG1A 5KGUA 3HZJA 1JB0F 2VL6A 1SDFA 1G291 4IUVA 3GQ4A 1IBKM 4A3IG 3I56A 2K5QA 1Q8IA 1HQCA 4LJ6A 3ZQJA 4LF6M 1HFNA 5M3MH 2QQ8A 4DU9A 2QKIC 3FPUB 4X64Q 3FYCA 5C18A 5C3EH 1GHKA 3GLIE 1IBML 4BB9A 4FXDA 2CCZA 1Z5AA 4D80A 2EUCA 1HNZM 2B8FA 4KHVA 1MN3A 1EFID 1JJ2A 1Z47A 4KN4C 1C4QA 1VQBA 2VQFM 4G6ZA 3S2HH 1LUZA 1UE5A 1X3QA 2PMZB 2K9DA 2ZAOA 1NBWA 1G4AE 3IHPA 3FUUA 4B7HA 3A46A 2CKZB 4POFA 3GPUA 4BBAA 3SE0A 1Q1EA 4A3EG 2K6BA 1HJPA 3A8IE 4DV2M 3K7AH 3FUWA 3I73A 3HOUG 4B3RM 1STHA 2GN5A 1S5ED 2CUZA 1GUGA 2PQAA 1VDLA 1F9RA 1R4QB 1Z9FA 3Q24A 2A6HD 4JI8Q 1YI2A 1L0XB 4G4NA 1BCPB 1QZMA 4RHRA 4LRTA 3Q8XA 1N9WA 4QGUA 4GKKQ 1PJSA 1WCMB 3BZDB 4NXNL 4O1NA 1EIGA 3U6DA 5CV9A 3RZOH 3U9SA 2B2YC 4GOPA 1KLGD 2NYZD 3MEHA 8CATA 4DAYA 3HOXG 1A6XA 4DV7M 4JI5L 2ZJQA 1VQCA 3TP8A 2RDFA 1FGBD 1I6HB 3R8BA 2UXCL 1XNQQ 4K0KL 3RD4A 3KSJA 2Z4HA 4KLKA 4DUZL 4DV0M 4BLCA 2D9UA 3U6CA 4A3MB 1XNQM 1X9NA 1N77A 3EIHA 3C1EA 3GLGA 2F0DA 3CF6E 4JI2Q 5E4XA 5KYLA 1XPUA 2BDNA 3I72A 1GKHA 2HIVA 1PTOD 2DNEA 3EN2A 2RDHA 4Y28F 2ZM6M 5F3WA 4JI6M 4A3CH 2A6ED 3A98B 2DGYA 4IALA 1WTXA 4YCVA 3LCVB 3W0LB 2E5LM 2R93G 1VQ7A 5KPRA 4A93H 3J27B 3G4SA 2LVNC 3MA2B 1BQQT 4HN7A 4KTAA 3U6MA 1XMQQ 3TQYA 3SEBA 1BUVT 1WFQA 1S5FD 5IP7G 4DR4M 1K3XA 3F2UA 2YYZA 3S15H 1NSNS 1X3FA 3PSIA 4ID6A 4DNIA 1QVRA 2CV1A 2IJ0A 3GTOH 1CT1D 3ND8A 4JC0A 1ET6A 1HPCA 1TXYA
chains in the Genus database with same CATH topology
2LMCB 2Q8RE 5C5MA 1MU5A 2EYFA 1PTOB 5LHY1 2RGHA 4PNYA 4DXGA 1TH2A 3HU1A 4I5SA 1LV7A 4B08A 5ELFA 1WTRA 3VFDA 1MBYA 3DMUA 1NHWC 1SAPA 1ZQ9A 3J7AS 3I8ZA 3IFTA 4KY5A 4K5VA 1ESFA 2BOSA 4V190 2DHRA 2WAQB 4BY1B 3M0EA 1EY7A 3VKGA 5EGTA 2D7GA 2KVMA 4XQNA 4ILWA 4KODA 4A3VB 4NXNM 5A35A 3PNYA 4IJEA 2IT1A 4FO2A 3K7AB 2L0CA 3X3MA 4IBDA 3SATA 3PO3B 1K82A 3J81S 2HCBA 4DR7M 4XGIA 3KOWE 3B9PA 4CKBA 1D1KA 1TIID 4ZKCB 3GTJB 3TP5A 1GUTA 1X3PA 2PQEA 3FUXA 4BS9A 2X69A 3CRLC 4MIUA 5EXTA 1PM5A 1KLUD 2H1EA 5CR3A 1U4LA 2EVBA 2PO4A 3TZDA 4FF4A 2KUMA 3FYDA 2JE6I 3TE6A 1ZYRC 1NR2A 3SMSA 5EP3A 5D65A 1LTSD 3RMHA 2XSZD 2QBYB 2UUAM 1VMCA 5IT9L 5G3LF 2EYPA 3C3LA 4Z6YA 2CQAA 3A56A 2VXWA 3PFIA 4DUYM 1PZJD 2Q8TA 1QANA 3RGPA 3ILKA 4B3MM 4M8AA 3KFUG 4LFBM 4QB4A 1E2WA 1Z6HA 4ZRZA 3SHGB 1DGGA 2FMCA 5ITQA 5H37D 2NUCA 4ZLTF 3Q6SA 3MJ5A 3K59A 3OTOM 3PUXA 4GZYC 2X4AA 3ND9A 1OXXK 1IM2A 1HUMA 3SAUA 3H4MA 4AI6A 2F4IA 2KEEA 4LK1C 1H9SB 5IGEA 3IFDA 4JI4M 4D81A 1EYCA 2FE8A 2BA0A 1XWIA 1Z5BA 3L9AX 2NZ1D 4DFAA 5EKIA 2RBMA 1I50B 2A69D 1IYUA 3IG8A 1H9RA 4HMIA 3SVMA 1MI2A 4AYBB 1I94M 1XNRM 4IURA 2CVRA 3V2TA 1Y8PB 4DNRB 3TWMA 2K05A 1N34M 1D5ZC 2DY8A 2JA2A 2LY7A 4CKEA 4HMJA 2J4XA 2M5ZA 1XXGA 1SNQA 4K2KA 2KOLA 2J7OA 1BCPD 2WIIB 1SNPA 1TS3A 1BF4A 1KTKA 4P16A 3K5LA 3C46A 3AB9A 1JOQA 3I4NB 4X64M 4GMQA 1QCBD 4IFDG 4D82A 3M7NA 1EY9A 2EO2A 1HA5A 3TP7A 1K3WA 4BA1I 3FD9A 5EXXA 4LF7M 2DWNA 2F0KA 1QG7A 1BBXC 2CEAA 2DVWB 4XQQA 1TVXA 2WKCA 3I4LA 3FRPB 5BN5A 3FTDA 4FP5D 2A6EC 4LF4M 4DR6M 3R9XB 3GTGB 4DK0A 1CI3M 1PJJA 1HXYD 2A69C 1DJRD 1NVMA 4L63B 4IFDJ 1DXMA 2ZXPA 4KJNA 5CMDA 4MGYE 2FFKB 1E2ZA 1B4OA 1YNNC 1F2MA 1HNXM 1WTVA 3K5OA 2LS01 3H94A 2EJFC 4QNMA 1J5EM 5I6WA 4DGZA 4Q0FA 3MFGA 1BCPC 2IX0A 3MXNA 1JR3A 1QILA 3T15A 5ITXE 4X62M 3QWNA 3BDOA 1ICWA 1TH4A 2RVLA 3D6WA 3SASA 2L09A 2EY2A 4NSRA 4RCOA 3OWEB 2E75C 1GXDC 3AFHA 2WV6D 4ZKBB 4EQOA 4WW0A 1PFNA 2VIIA 1SBBB 4OIKA 2JA7B 1G2TA 4F8MA 4LGMA 1PDQA 4OL7A 2A5HA 1UM8A 1RHPA 4HR7B 2WP8J 2NVQB 3EJIA 5K36H 1WD0A 3DOAA 3L28A 3DM1A 3I90A 3MTSA 3T56B 4FF1A 1NY5A 5ELCA 4FF3A 5KPTA 1G2SA 4ZPXA 3WHKA 3HZXA 3KOYE 1I4RA 1JR0D 4IFDI 2AHMA 1LTRD 5FTMA 2R92B 4LF9M 3AL0C 2XWJB 4JXJA 1BOSA 2L9HA 2PW5A 2F0QA 3U6PA 4M0WA 1JWUD 1DONA 1PFMA 1ILPA 1K8OA 1DGFA 2DZNB 2BE5D 4IN3A 4XYOA 4L78A 1A3UA 4XQJA 1B53A 1CA6A 1IXZA 2X8AA 1EZ6A 1BXTA 2L11A 4IFDH 1STGA 4KN7C 3I51A 1V8QA 4FWDA 3SFZA 2Z4IA 3NXWA 3L3OC 4DA2A 3ITPA 4QMGA 3NHHA 4BA2I 4OX9M 2FINB 3VR5A 2L5TA 1ENAA 3U60A 4OO1I 1II3A 1Y1WB 5T1GA 5KQ8A 3DXJC 4DF7A 3MHVC 2F1MA 5IGBA 4BWGB 4K6LA 2JA8B 3D3RA 4DR2M 3TL4X 4MH0E 3HKZB 2L12A 4DN4M 1ENFA 2XNAC 1QOHA 1F9PA 1YNJD 1HUNA 1EEFD 3M7GA 1H6UA 3H0GB 1LTAD 4M9SA 2A74C 4IBCA 2BJVA 2KEBA 5IT9E 4C56C 1I3QB 2G8LA 2XGNA 4CGYB 4HCSA 3L7ZC 2XRSD 4KV6A 3HJSA 2R45A 4LZJA 1I4HA 2BE5C 3A8KE 5HGTA 1PRTB 3U61B 5JAVA 3H3VC 3FEWX 5FLXE 4IUQA 2RDGA 4XT3B 3VDUA 1G59A 3SAVA 1W5TA 1CQFA 3D31A 5K5PA 2K33A 3KBXA 4QIWB 1RODA 2QP9X 3H91A 3K6OA 2EYMA 1JOKA 1PTOC 2BA1A 3TPZA 3FKEA 4U68A 2E2JB 4JK1C 2ZT9C 3D4WA 1LT3D 1TY2A 5IGDA 1HNWM 3M85A 3SARA 2DWLA 3GTOB 2F5PA 1F2ZA 2XIWA 2ZAMA 2B39A 1I4PA 1QNUA 3GLHA 2YFQA 3NWLA 3FUTA 1PTOH 3DFZA 5DM63 3HU2A 4LCBA 3MAQA 3U6SA 1F9QA 4X65M 3FTFA 1L2DA 3VYRA 5KIXA 3NK9A 2D62A 4A3KB 3K2LA 4NMZA 2M2LA 4XDXA 1SFOB 2L7HA 2KXEA 2F0LA 2XFSA 2R62A 2F0GA 2C99A 5J22A 2DN8A 3QOLA 2NN6G 3DWPA 2K5WA 3J7AF 3GLHB 3PIO3 4RGTA 1DGHB 4JI5M 5FTLA 4ZAIA 3D8BA 2XRQD 4PV1C 1HT1E 1G6ZA 2YNMD 4I65A 2E74C 1ET9A 2F0TA 1IKLA 4IBIA 3HHZA 5J1ZA 5JJZA 2UUBM 4IUPA 2Z4SA 1ORYB 1DOMA 4RAUC 2NVXB 3U6OA 3LX0A 4L16A 2LNHC 2V4DA 5CYUA 1EEID 4A3BB 5COYA 3FMCA 5I6YA 4Z8XA 1YSYA 4Q5VA 1STBA 2R18A 3U6LA 4IQZA 4FYDA 1G3IA 4AZFA 3BDCA 1L2BA 4NRVA 3VDPA 3KLRA 2EXZA 4TSSA 1XXHA 5JVH3 1DZ1A 5KNBA 2MJ8A 3KK7A 3AKZA 1IBMM 5EP1A 1CHQD 4I4LA 3KOXE 4LMQD 5A2QE 2EJGC 3EFXD 3SXHA 2BJWA 1BCPF 4PDIA 4DAPA 4WRDA 4LGYA 1SYDA 4PQXA 5JEAH 3SHFA 1T5XD 4IBFA 5EP2A 2A68C 2AQ3B 4XXEA 5FOBB 1EZ8A 4PCZA 3E5SA 3CU7A 1FNWA 3SAWA 4CISA 1BO0A 1HQMC 5CGKA 1NUCA 1W6KA 4KHZA 1E0BA 5C44B 1PRTC 3AOEC 1H9SA 2JXMB 3ZYYX 1AEXA 1DOLA 2K7VA 3T38A 3E0JA 2CHVA 4KKUA 4HCEA 3PVSA 1IN8A 1EWHA 2Z4RA 3GRUA 2F5QA 1H9MA 2JA5B 1GL7A 2I07B 3KVWA 3HGIA 1EU4A 2M9VA 3TP6A 1EY0A 3S9WA 3LMMA 3HOUB 4PT5A 3ZCBB 1ZXTA 3GPPA 3T4AC 2MUYA 4IUTA 4K5WA 1KFVA 3I70A 2Z1CA 1TWAB 2EY6A 1IQPA 1D2NA 2KECA 3T13A 1D1IA 3KUPA 1SNMA 2QCPX 1AP0A 2UUCM 2A6HC 3D8GA 1E9SA 1B9NA 1QB5D 1A2UA 2K03A 1NNJA 3HHYA 1EQVA 4H13C 5CV8A 2F0SA 2F0FA 1CA5A 3VKHA 5KRUA 2AWOA 1N33M 3HU3A 4R3DA 4RKBA 2YR0A 3GPYA 3LWEA 4LY6A 4R8NA 4HAEA 4R9WA 3E6ZX 2IX3A 1KDAA 4IBEA 1HFGA 4LAAA 3M4YA 2NWGA 4MN3A 1STAA 3R2TA 4UAIA 1EQTA 4FXGC 1EYDA 1SYFA 2KJXA 2B2TC 3C58A 1L1ZA 2L55A 3S14B 3TBIB 1T5EA 1A2TA 2QENA 4FWHA 4HLQA 1ZAEA 4JI2M 4FCTA 1FNVA 2PZTA 4L6TB 2D2CC 5JPNC 3FVQA 4J1MA 5M5XB 1NJGA 2PNRC 4C3JB 2B8GA 2EPBA 4N9PA 4CJ2C 2HDMA 2CV2A 4E6IA 2HKJA 4DV4M 4X3TA 1I4QA 1NNUC 2XWBB 2OT2A 4OW0A 4IBJA 3K92A 5DYGA 1TDHA 1R9TB 4GITA 1UNSA 3QJYA 2O2LD 3VYTA 4NDXA 1LABA 3GQBA 5NUCA 1EY6A 4AKIA 4AW4A 2F0VA 1J8IA 1SNCA 4ABNA 1TS4A 2R4EA 7CATA 3OMCA 2MHVA 3GTPB 1ZEQX 5ITUA 1HQYE 5M3FB 2BCOA 4DK1A 3UZUA 1Y1VB 5C3WA 3U5ZB 1XTCD 3KXEC 3SYLA 5GKNA 2HDLA 1FNUA 4G7OC 2F3VA 2C98A 2XFTA 1G8PA 3S1NB 2F0PA 3FKIB 5M3MB 5BPVA 1OXUA 2XSCA 4G4QA 5JEAJ 4WORA 2SNSA 2HHHM 2I7NA 2KZUA 2ZBKB 3PUZA 1E94E 1ILQA 1H9JA 3P20A 1RTNA 2FJ2A 5IT9S 1Y8NB 2C5RA 4KY6A 2CHBD 2KW0A 3A8JE 2PPBC 2ERCA 4FCWA 4RNAA 1NCVA 3KP1E 2TMPA 2ICIA 3OOCA 3GLGB 1NJFA 1WTQA 4MGIE 2CFOA 3NTHA 4DV1M 5EJCA 2K04A 2RGOA 3TZUA 1W6JA 2QEJC 1RJTA 4M1UB 4YHHM 5JEAG 1GVNA 1Q39A 2R46A 4C2MB 3I3CA 4G4RA 1D2BA 1LTGD 1CZGA 3AU7A 4OVZB 3AMUA 3D4RA 1DO0A 3KDSE 1JWMD 3DEOA 4OVZA 3GTMB 1KABA 1Y69U 2WINB 1HT2E 3K1JA 4X3KA 4LFAM 3KF8A 1CTMA 3ZC7B 1E9RA 4KLNA 3GRRA 4KHPM 4KD4A 1GUSA 3KBGA 2NVTB 1KNEA 4N9TA 3CF2A 3I91A 4K5XA 4II7A 3RUZA 1EWCA 1I4WA 4LJ5A 2XN9C 1D6EC 2F5OA 1UUPA 3K5NA 2X6GA 4NXMM 3N6RA 4GRIA 3BVZA 1V43A 5E26A 1Z59A 2SEBD 3S15B 4BY7B 1IW7C 1EY8A 1YE9A 5ITXA 4KKTA 4F87A 3WOFA 1SSOA 2FMMA 2R7ZB 2OPFA 3C2PA 1IY2A 5C6AA 2CE7A 1OXVA 5C5LA 2JP1A 2XVSA 4DR5M 3HHWA 1DM0B 1TDZA 3LNNA 4G4OA 3NE5B 4U673 4OO1G 3U6QA 4REZA 3GV6A 3QO2A 1C1KA 3LVVA 4DV6M 3S1MB 1IY0A 2EYLA 3U5ZA 3I4YA 3BVGA 4MGZE 4F7XA 1EY5A 1CHPD 2F5SA 5EQTA 1OJLA 3I4MB 2IX1A 3A55A 1LT5D 3FUVA 3TDQA 5C0XI 1STEA 2N88A 1JB3A 5FSWA 3HOZB 5F2DA 4V0BA 2TSSA 4QHSA 4PMBA 5C4ZA 4C3IG 1QJOA 3MHBA 1Z7TA 1XXHB 5IOCA 4QUFA 3V05A 1SXJA 4OIJA 2Y0QA 2XLJA 5DNYA 3WOEA 1QAOA 3KS8A 2P5TA 1EYAA 2JYOA 4CJ1B 3IL8A 1Q90A 1KAAA 2K6AA 3TWLA 3D8LA 3Q0AA 1LTID 2F0MA 2PCFB 4JI1M 3FTEA 2O5RA 3KLSX 5I2XA 4ZUJA 2G9DA 1DGHA 1B9MA 3P75A 4JI8M 2X6LA 2G9HD 1LLRD 5IGFA 5ISRA 4GHAA 2KHSA 2XEPA 1EY4A 5J39A 3OPOA 1GJXA 2LXEA 1VDZA 3UGJA 3SC3A 2NTTA 2V1UA 2IW3A 3D6CA 3J2PB 1C8CA 4S3SA 3DZDA 1SXJE 2Y21A 2FNAA 4GC9A 4HTHA 1BNZA 4HL4A 2L1BA 3QOJA 3HJ8A 4JBWA 3URYA 1AN8A 2EDGA 2R61A 3T51B 1C48A 2AUJD 1WVLA 3QIAA 4QHTA 3NPPA 2BDOA 4J6HA 2KRUA 4ZQ3A 2F0HA 1ML0D 4PMCA 4FW9A 4FWGA 1HCZA 3U61A 4OO1H 1GLNA 2XSZA 2E2DC 4RGMA 2A5YB 2K5DA 3LWUA 3MZ5A 3K5MA 3PUVA 4FVMA 1Q1BA 1Q3LA 3MC0B 4J8QA 2Q8IB 2VB3X 2J7NA 3T1YM 3RE8A 4GH9A 1STNA 4RA8A 5E3FA 2EYOA 1F9SA 4RHSA 5LL6X 1VCIA 1HQRD 1HA6A 1XYIA 4OHJA 4Y7NB 4FD2A 4RGNA 2KRKA 1TKWB 3VYSA 3PV0A 3K8ZA 1SJHD 2VB2X 3VA7A 5EP4A 2A68D 1L2CA 1PJIA 1B2TA 3GQ3A 4MB7A 3VR4A 1PRTD 2V6ZM 4OU7A 4IBBA 2NVYB 4LFCM 1TWFB 3UI2A 2KEDA 4EVOA 4C3HG 1XX8A 5C4XB 3DWQA 3PIP3 4KI0A 4C1NI 5CC4A 4KK7A 1Q3BA 1OO9B 4M0DA 4TRDA 2OF1A 2ICEC 3GP7A 3KLSA 4AKGA 3BYTB 5CBAE 3OW7A 4DUZM 4DV3M 1HTPA 2MP1A 4KMUC 4WURA 1F2LA 3GP1A 1GUNA 1SXTA 1S5CD 1HTLD 1ONLA 2WACA 4CKCA 3A45A 2R93B 4AG6A 5ELDA 1SYBA 1IBLM 1J09A 3R93A 1XC8A 1FJGM 3AJIB 5LMUM 3EROA 2L4NA 4JN6A 2R3ZA 1GUWA 1V1OA 4H7BA 2DY7A 2ID0A 2LFNA 1B44D 2W82A 1O7LA 4NP5A 4EQPA 3J7BA 2JA6B 1AZQA 4GC5A 4K14A 1PMRA 5IGCA 1O80A 2HCIA 5BN4A 1W5SA 2E76C 4QNRA 1MSHA 1QQWA 3CQZB 4FXKC 3SR1A 5FLXS 2F03A 1R4PB 4I81A 1QAMA 1BDOA 2CV0A 1B1ZA 3GLIB 3RFWA 4AG5A 3PUYA 4A3FB 3BG3A 3HJQA 4Z9CB 2ENBA 3S16B 4ME5A 4A3JB 2Y20A 2EY5A 2NN6H 1TU2B 4C3HB 1U4PA 3E9SA 1QAQA 2I46A 2QDBA 1CFMA 4K6DA 4FNFA 3TSSA 4OGQC 3T1HM 5FO8B 2EYJA 2G5GX 4X3SA 3S1QB 3THGA 3NBIA 4DAVA 1SMYC 3L26A 3HOYB 2AUKA 1IN7A 4LJ8A 2F4VM 3HRZC 5EXPA 1WTPA 4TKOB 4QUCA 3HG9A 4JI0M 5FO7B 3J81E 1TWCB 3VK8A 4G57A 5IIFA 3KOZE 1RF2D 1G8ZD 2EZVA 2K01A 5K36G 2O5IC 1S5BD 4LRSA 3SK6A 3FDTA 4LJ4A 5CORA 3NUCA 1WD1A 4LJ9A 1STYA 2SOBA 3SHLA 5KPZA 2KQ3A 3HOXB 1FNNA 3NQTA 4GHLA 3OIQA 4G4KA 1A3VA 2F0IA 3IG5A 3C1FA 4K8JA 1IXSB 3SYKA 5D14A 3AOGA 3KS4A 4LJ7A 2HQEA 2EYHA 4HSVA 4B9XA 4FF2A 1GKIA 4KO8A 3JAMS 3RGSA 5KNDA 2DNCA 3PXGA 1K8MA 4AQYM 3NP8A 4LF5M 2PYKA 3DEPA 1MX0A 1JC7A 5DM73 1OFHA 4XIGS 5TSSA 4LZZA 4C1NK 5C1BA 1JORA 1V1PA 5IREB 1SXJB 5E1FA 4A93B 1JQYD 1LO5D 4HEDA 1DO2A 3J80E 3P7JA 5FKAC 4LJAA 4NL4H 5FLXL 4IUNA 3IKJA 1I6VC 4NKLA 1B50A 1IXRC 4RWSC 4QCLA 5EPJA 3S2HB 3HP3A 1IN6A 4QOZC 1TWGB 1ENCA 1Q12A 4RKLA 1O7YA 2B2UC 4CHTB 1KNAA 4X66M 3GV3A 2UXDM 3NWTA 1QYRA 4A3DB 3GLFA 2ZANA 1N36M 2K32A 3SK5A 3U9OA 4A3IB 3OHXC 2SDFA 4KY7A 2PZWA 4K8IA 2F3WA 4RH6A 5FTKA 4MM3B 1SYEA 1RDPD 3J81L 3GTQB 5IGGA 3VR6A 2M60A 1DGBA 2IPKD 4K2LA 4ITQA 1Y8OB 4WJWA 1LV9A 3DWAA 1R2ZA 1WTWA 2XH9A 4PMWA 3M6AA 5ITRA 2F0JA 5KQDA 1FD7D 1EIHA 4DXFA 3W3AA 2RKOA 5T1IA 2X49A 1RD9D 3JR5A 1I4GA 1SJED 1SEBD 1EL0A 4I8OA 1TR5A 3OIPA 3CTWB 4ULLA 3HGBA 4RGOS 1T3TA 5E4WC 2E2IB 2D7EA 5EBCA 1PZID 1LTTD 5EJWA 1IHZA 3H09A 5C3EB 3R3OA 3R8FA 2K28A 2F5NA 5M5YB 5FTJA 2Y0TA 5ITTA 1S3SA 4M9ZA 5D3DA 5DYIA 1GL6A 1J9OA 1TS2A 4GIPA 5M5WB 1U4RA 3KW6A 2FFJA 3AV0A 1Z6TA 3GD7A 3L29A 3BYYB 3X3NA 4R7GA 1O78A 2JSOA 3U6EA 1UAPA 3A7AB 2O4XA 1TT2A 3PNVA 2LWXA 4IUUA 1WXQA 2C96A 3DUZA 2LH0A 3L2AA 3G6JB 5FK9C 1R2YA 1D5XC 3HKPA 3BOSA 4NOOB 3NTIA 4P2CB 2J0TD 4XT1B 3OSOA 1IL8A 3RZOB 5D3IB 1B3AA 3CKIB 4EGVA 2C9OA 1HRJA 4L4UA 1KDBA 2FOIC 2LKVA 3VR3A 4H0LC 4DV5M 2L6OA 1PZKD 5JOBA 1MD2D 2KA6B 2RSNA 1EOTA 1L0YB 3AOEA 3TWKA 2YU9B 4A3EB 4RCNA 3I4VA 2Z3XA 1UEAB 2CW0C 3K57A 1VF5C 5C4HA 2UXBM 5CV6A 4F88A 2ZXOA 3KSXA 1CM9A 4LG2A 1PRTF 5LMNM 5KO3A 4RFBA 1AW7A 4ZYSA 5ELBA 4MHEA 1EE8A 5FTNA 3VK7A 2F0EA 5EXSA 2WKDA 3GTKB 4QOSA 4IIWA 2QCUA 3A7LA 3OWFA 4GKJM 4KKSA 3RZDB 4M9XA 4JV5M 3U60B 4B7GA 4JI7M 1DOKA 3ERQA 1R7RA 2D5DA 1VF7A 4C3JG 1N32M 1OXSC 4L8RC 2PW7A 3NQIA 2DZOB 4DR1M 2Z8LA 1TS5A 5LL6S 5DEHA 2E2HB 3HS0C 2M00A 1XMOM 3E4RA 1MGSA 3QWLA 1XMQM 1U9RA 3KP0E 3A42A 3M3YB 4B9WA 3LVWA 1OXTA 5KNCA 2B2TA 2YQZA 4DR3M 2SNMA 1IN4A 2QBYA 4FCVA 1K83B 2F0OA 5IWAM 3TN2A 1SYGA 3Q22A 2Y0SB 2C9CA 3OMGA 5IODA 5C0XG 1IKMA 3LQRA 1JR3D 2AWNA 2D7HA 1A15A 3CHBD 2DWMA 2B63B 3D4DA 2NQ8C 1S4ZA 3UJNA 5ELEA 3GRVA 4R8IA 1PTOF 1TWHB 2PZUA 3T16A 3J7AV 2B2WA 5DAUA 1QE6A 2QPAA 3PUWA 3S1RB 1M8AA 2OEOA 3QB3A 4PDGA 2K1BA 1G41A 4JI3M 5JI3E 3JAML 2H4OA 1E2VA 4RF1A 2J7ZA 1ZYRD 3MFYA 3O13A 2R6GA 1IW7D 4L15A 1KDCA 3EA6A 3GO8A 1R6BX 4EQNA 1NR4A 1F77A 2Q2EB 2NTSA 1JICA 5C0XJ 2CHQA 4BBRB 3SDZA 1LACA 2DWZB 2V1CA 4PD2A 3GQ5A 4S12A 1S5DD 1AZPA 3W2DA 5CBEE 4TQUS 2UU9M 1NSFA 1HHVA 1VDDA 3SK8A 4UDUC 1E32A 3R2IA 3H6MA 2WB1B 1JQJC 4GKKM 3CRKC 4DNTB 1CK1A 1TQOA 5I4DA 2N55A 2RSOA 2VQEM 3S17B 1RTOA 4XBOA 3TQSA 3P1HA 3VA5A 2XZUA 2F0NA 4ZK9B 2EJMA 2MPMA 2XF3A 2RA4A 1X32A 1F2YA 1M4VA 5I9PA 2GA4B 4EIWA 1XWEA 1SXJD 5CV7A 1G91A 3PMFA 1D5MC 1U4MA 2EA0A 3J80L 5EKLA 1IY1A 3RLFA 4LF8M 1TH3A 2A73B 1QWYA 1LTBD 2MGSA 3Q23A 1DD2A 3SBJA 5EPKA 3VYUA 3EVQA 4G7ZC 2EY1A 3CF0A 1L1TA 3MXGA 2FHTA 3JR4A 2XZFA 3HOWB 2I7PA 4IZ8A 3HEJA 1YNJC 4L8JA 3DA1A 4ZUIA 3ZH9B 1FR3A 3GO5A 3WDNA 4XYQA 1NAPA 4NSOB 1FYCA 4I7ZC 2EOTA 2O5JC 4WFN3 3J7YW 1I4XA 2RKSA 3VLFB 3DHQA 3MXPA 1SE4A 2NN6I 1ZKOA 3FPPA 4BBSB 2B2UA 1RKNA 1LT6D 2JEBI 3G7LA 1Q3CA 2IWHA 1H9KA 2HL7A 1HR0M 2HCCA 3UK6A 3NSWA 3VR2A 2B2VC 1GHJA 1SE3A 5BR8M 5G3LD 3T53B 3JAME 2DXIA 1SMYD 5EKKA 1JOOA 2KCNA 1L8QA 3WHLA 3K58A 4QF4A 3SK4A 2IL8A 5AFWA 5C4JB 2K47A 1NY6A 4RF0A 4KD3A 4NRWA 3BVMA 1SXJC 1PXUA 2EE1A 1ESRA 1WTOA 3NWSA 1NHGC 2Z7JA 4JYAM 2C5CA 2R4JA 5DNFA 1TGUA 2NBFA 2KA7A 1BR9A 1AFPA 2NB0A 1YNND 5I9OA 1YUBA 2HUGA 1GUOA 3SMPA 1CZWA 2QF7A 1PYWD 3BDLA 1DYQA 1J7KA 5I2YA 1VMPA 5KYIA 3N52A 3HWSA 1N75A 5EBDA 4X3UA 4C3IB 5JI2E 4LJZC 1JE4A 4ODGA 5KEEA 5A2QS 1PLFA 1O7ZA 4NW2A 3GRYA 1DCZA 1GOZA 2CW0D 1PFBA 1EU3A 2KCCA 3MVVA 5C0XH 4TUWA 4O42A 1OFIA 2RQXA 1X37A 4YY3M 3K0YA 5EPLA 3W0FA 2ZXRA 2H1RA 3ONAB 4H44C 1SYCA 4MGKE 3HHXA 3UMMA 5JVG3 3EQLC 3BS1A 1XHBA 3S2DB 4IBGA 2KZSA 1SNOA 4HSPA 2VUMB 5JPMC 1JWSD 3PO2B 3TMEA 2VNUD 3GLFB 3FTCA 5BN3A 5HURA 4CJ0B 3MWYW 3EIEA 3IAYA 2QZ4A 3HOVB 4A3GB 4XTCS 3GLIA 3A54A 1CQVA 5FO9B 1MSGA 5CV5A 5E6JA 1Z5CA 2AQ2B 3M4OB 1KYIA 2B2VA 3V96A 5C3XA 2BNKA 5EQ0A 1TY0A 2AQ1B 4MGHA 3GPXA 1SNDA 3L25A 1LT4D 4B7FA 2OXPA 3MK6A 5ITYA 3NTKA 4IJFA 1JCKB 4W5WA 4B3TM 2CHGA 2F0UA 3GTLB 1IN5A 4AKHA 3J80S 5IZ7D 4KJOA 1N78A 2B2WC 2R65A 2OQ4A 1A3TA 2QILA 2F0WA 3L27A 3NBHA 3QAUA 1V1PB 1RCVD 1QNKA 5A2QL 5CV4A 4IBKA 4YIJA 3LQQA 4B3SM 1IYVA 2B2YA 2UXCM 4G7HC 2JEAI 5M9OA 3MXUA 2L7IA 1SE2A 1KSFX 4K0KM 3QG1A 5KGUA 1SDFA 1G291 4IUVA 3GQ4A 1IBKM 1HFNA 2K5QA 1Q8IA 1HQCA 4LJ6A 4LF6M 4DU9A 2QKIC 3FPUB 3FYCA 5C18A 1GHKA 4BB9A 4FXDA 1Z5AA 4D80A 2EUCA 1HNZM 2B8FA 4KHVA 1EFID 1Z47A 4KN4C 1C4QA 2VQFM 4G6ZA 2PMZB 1X3QA 3A46A 2ZAOA 1G4AE 4B7HA 3FUUA 3GPUA 4BBAA 3SE0A 1Q1EA 3A8IE 4DV2M 3FUWA 3I73A 4B3RM 1STHA 1S5ED 2CUZA 1GUGA 3Q24A 1F9RA 1R4QB 2A6HD 1L0XB 4G4NA 1BCPB 1QZMA 4RHRA 4LRTA 3Q8XA 1WCMB 3BZDB 4O1NA 1EIGA 3U6DA 5CV9A 3U9SA 2B2YC 1KLGD 2NYZD 3MEHA 8CATA 4DAYA 1A6XA 4DV7M 3TP8A 2RDFA 1FGBD 1I6HB 3R8BA 3RD4A 3KSJA 2Z4HA 4DV0M 4BLCA 2D9UA 3U6CA 4A3MB 1XNQM 1N77A 3EIHA 3C1EA 3GLGA 2F0DA 3CF6E 5E4XA 5KYLA 2BDNA 3I72A 1PTOD 2DNEA 2RDHA 2ZM6M 5F3WA 4JI6M 2A6ED 3A98B 4IALA 1WTXA 2E5LM 3W0LB 5KPRA 3J27B 3MA2B 1BQQT 4HN7A 4KTAA 3U6MA 3SEBA 1BUVT 1S5FD 4DR4M 1K3XA 3F2UA 2YYZA 1NSNS 4ID6A 1QVRA 2CV1A 2IJ0A 1CT1D 3ND8A 4CBVA 1ET6A 1HPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBI A;  4CGY B;  4CHT B; 
#chains in the Genus database with same CATH topology
 2LMC B;  2Q8R E;  5C5M A;  1MU5 A;  2EYF A;  1PTO B;  5LHY 1;  1GO3 E;  1TWG H;  2RGH A;  4PNY A;  3U58 A;  4DXG A;  3J80 c;  1TH2 A;  1VQI A;  3HU1 A;  4GN5 A;  4I5S A;  1LV7 A;  4B08 A;  1AE3 A;  5ELF A;  4LFA L;  1HR0 Q;  1WTR A;  3KYH C;  3VFD A;  2UUC Q;  1K0S A;  1MBY A;  3DMU A;  1NHW C;  1SAP A;  1K9M C;  1ZQ9 A;  3J7A S;  1EUJ A;  3I8Z A;  3IFT A;  4RMF A;  4KY5 A;  4K5V A;  1QVC A;  1ESF A;  4R4Q A;  2JA9 A;  1IBK Q;  2BOS A;  4V19 0;  2DHR A;  2XTI A;  2F4V Q;  2WAQ B;  3GTP H;  4BY1 B;  3M0E A;  1EY7 A;  3VKG A;  5EGT A;  2D7G A;  2KVM A;  4XQN A;  1XMO Q;  1FJG Q;  2Z8Y M;  4ILW A;  4KOD A;  4A3V B;  4JI3 Q;  4NXN M;  5A35 A;  5IP9 H;  4F2L A;  3PNY A;  4IJE A;  2IT1 A;  1U5K A;  1KHI A;  3FKI H;  4FO2 A;  3K7A B;  2L0C A;  3X3M A;  4IBD A;  3SAT A;  3PO3 B;  1K82 A;  1IL2 A;  4A3F G;  2R6F A;  4OWT B;  3J81 S;  2HCB A;  4DR7 M;  4XGI A;  3KOW E;  1G71 A;  3B9P A;  1LTM A;  1D1K A;  1TII D;  1UE7 A;  4CKB A;  4ZKC B;  3GTJ B;  1KD1 C;  3TP5 A;  1K8A C;  1XTD A;  1QDR A;  1GUT A;  3S16 H;  1X3P A;  3CPW A;  4JI6 L;  2PQE A;  3FUX A;  2VS1 A;  4JI1 Q;  4BS9 A;  2X69 A;  1QZG A;  3CRL C;  4MIU A;  5EXT A;  1PM5 A;  1KLU D;  1WYD A;  3C3E A;  2H1E A;  5CR3 A;  1U4L A;  2EVB A;  2PO4 A;  3TZD A;  4FF4 A;  2KUM A;  2PI2 A;  4CDE C;  1LTL A;  3FYD A;  2Y0S G;  2JE6 I;  2UXB Q;  4OX9 Q;  3TE6 A;  3E9I A;  1ZYR C;  1NR2 A;  4LF5 L;  2Z6K C;  4DV0 Q;  4YY3 L;  4FDB A;  3SMS A;  5EP3 A;  2RHQ B;  1IBL L;  3S1N H;  5ELN A;  1VEK A;  4DR6 Q;  3ER0 A;  5D65 A;  4QL5 A;  1LTS D;  2AMC B;  3RMH A;  2XSZ D;  2QBY B;  2UUA M;  1VMC A;  5IT9 L;  4HJ7 A;  5G3L F;  2EYP A;  3C3L A;  4Z6Y A;  2CQA A;  3A56 A;  2VXW A;  3PFI A;  4DUY M;  1PZJ D;  4IJL A;  2Q8T A;  1QAN A;  3G71 A;  3RGP A;  2ZM6 L;  3ILK A;  4ALP A;  4QY7 A;  4DR2 Q;  4B3M M;  1VQD A;  4GS3 A;  4M8A A;  3L2P A;  3KFU G;  4LFB M;  4QB4 A;  1E2W A;  1Z6H A;  4ZRZ A;  3KOJ A;  3SHG B;  1DGG A;  2FMC A;  5ITQ A;  5H37 D;  2VQF Q;  2NUC A;  1JMC A;  4ZLT F;  1NTG A;  4P73 A;  5LMN L;  3Q6S A;  4HID A;  4DR4 L;  3MJ5 A;  4PZ8 A;  1R5L A;  3IEC A;  3K7U C;  3K59 A;  3OTO M;  3PUX A;  4GZY C;  1XXH E;  2X4A A;  3I7F A;  3ND9 A;  1B3Q A;  1OXX K;  1IM2 A;  1TF0 B;  2DUD A;  2LSS A;  2JXN A;  1HUM A;  3SAU A;  3H4M A;  4AI6 A;  4O2D A;  2F4I A;  3T1H Q;  2KEE A;  1OKS A;  4LK1 C;  1Q46 A;  2VDB B;  1H9S B;  5IGE A;  3IFD A;  4JI4 M;  1NJI C;  4D81 A;  2HT1 A;  1EYC A;  1N33 L;  4N8F A;  3CXC A;  2FE8 A;  2BA0 A;  2BWE A;  1XWI A;  1Z5B A;  4LNQ A;  3L9A X;  2NZ1 D;  4RG1 A;  5EKI A;  4DFA A;  4I7A A;  2RBM A;  3NEN A;  2JZ1 A;  1I50 B;  4BXX G;  2A69 D;  1IYU A;  2KDL A;  3IG8 A;  1H9R A;  4HMI A;  3SVM A;  4XK8 F;  5C4X G;  1MI2 A;  5M3F H;  3I4N H;  1V9P A;  4AYB B;  1I94 M;  1W3S A;  3GTK H;  4NPS A;  3TS2 A;  1C9O A;  2PI2 E;  1XNR M;  4IUR A;  2CVR A;  3V2T A;  1I94 Q;  1Y8P B;  4DNR B;  3TWM A;  3GLG E;  1N34 M;  1D5Z C;  2DY8 A;  2JA2 A;  2K05 A;  2LY7 A;  4HMJ A;  4CKE A;  2J4X A;  1VQ5 A;  2M5Z A;  3C3D A;  1XXG A;  1SNQ A;  4AQY Q;  1BBW A;  3S24 A;  1VQ8 A;  2K0B X;  2C35 B;  4K2K A;  4JI0 L;  4UN2 B;  2KOL A;  2MO0 A;  2J7O A;  5IT9 c;  1BCP D;  4A3C G;  2WII B;  3CP0 A;  1SNP A;  1TS3 A;  1BF4 A;  1KTK A;  4P16 A;  3K5L A;  2J5Y A;  3AB9 A;  2CH4 W;  4GNX A;  3C46 A;  3I4N B;  1JOQ A;  4X64 M;  2JZ0 A;  4GMQ A;  3KJP A;  1GJS A;  2R7Z H;  1QCB D;  4IFD G;  4D82 A;  4HEO A;  3M7N A;  3U50 C;  3OYY A;  3PIP A;  1EY9 A;  1AH9 A;  2EO2 A;  2JWS A;  1HA5 A;  3TP7 A;  3RLO A;  1K3W A;  4BA1 I;  1PH6 A;  3FD9 A;  4DV2 Q;  5EXX A;  4LF7 M;  1FVI A;  2DWN A;  2OCE A;  2F0K A;  3KF6 B;  1QG7 A;  1BBX C;  2CEA A;  2DVW B;  4XQQ A;  1TVX A;  1UEB A;  2WKC A;  3H15 A;  3I4L A;  4L6V 6;  4R4T A;  3FRP B;  1N33 Q;  4A3I H;  5LMN Q;  4KHP L;  5BN5 A;  4A3K G;  4EQ5 A;  3FTD A;  4FP5 D;  2A6E C;  4LF4 M;  4DR6 M;  3R9X B;  2JA5 G;  3GTG B;  4DK0 A;  2K52 A;  2MQH A;  2PNH A;  1CI3 M;  3NBX X;  1PJJ A;  1E7Z A;  1HXY D;  2A69 C;  5C3E G;  1DJR D;  1NVM A;  2VF8 A;  4L63 B;  4IFD J;  1DXM A;  3CCL A;  4B3S L;  2LBC A;  2ZXP A;  3HKZ E;  4KJN A;  5CMD A;  4MGY E;  1N34 L;  2FFK B;  2F52 A;  2A8V A;  1E2Z A;  1B4O A;  3I4O A;  2Y0S E;  1YNN C;  4AYB G;  4DV6 L;  1F2M A;  1HNX M;  4JI1 L;  1WTV A;  3K5O A;  4DV3 L;  3C9P A;  3K8A A;  3TEH B;  2LS0 1;  4JOI A;  3H94 A;  2EJF C;  4QNM A;  1J5E M;  5I6W A;  4DGZ A;  4Q0F A;  2DAK A;  3MFG A;  1BCP C;  3NEM A;  2IX0 A;  4BBR H;  3MXN A;  1JR3 A;  2UUB L;  1QIL A;  4LUO A;  3T15 A;  5ITX E;  4X62 M;  3K0X A;  3QWN A;  3BDO A;  1ICW A;  4A3B H;  1TH4 A;  2O25 A;  2RVL A;  3D6W A;  3SAS A;  1YLA A;  5GAD C;  2L09 A;  2EY2 A;  4DR1 L;  1D0M A;  4NSR A;  3SGI A;  4HJA A;  1JJC B;  3CQZ H;  1VQK A;  4RCO A;  3OWE B;  2E75 C;  1GXD C;  1C7Y A;  3AFH A;  2WV6 D;  4ZKB B;  4EQO A;  4DR3 Q;  4WW0 A;  1XMO L;  4LFC Q;  1PFN A;  2VII A;  1SBB B;  4OIK A;  2JA7 B;  2LVP C;  2HWJ A;  3B7Q A;  1PH1 A;  4B3R L;  1G2T A;  1WTH A;  3VDY A;  3OW2 A;  4DKA C;  4F8M A;  4LGM A;  1PDQ A;  4OL7 A;  2A5H A;  1D0K A;  1UM8 A;  2BH8 A;  3H3V H;  1RHP A;  4HR7 B;  2WP8 J;  1AE2 A;  2NVQ B;  5JJI A;  3EJI A;  5K36 H;  1K0R A;  1WD0 A;  3DOA A;  3L28 A;  3DM1 A;  3UDX A;  2Z6K A;  3I90 A;  1PH8 A;  4QQB X;  1ZMV A;  3MTS A;  3T56 B;  4FF1 A;  4OWX B;  1NY5 A;  4Q7J A;  5ELC A;  4FF3 A;  1HNW Q;  4Y52 H;  1G2S A;  5KPT A;  4ZPX A;  3WHK A;  3DLL A;  3HZX A;  5M3F G;  3KOY E;  1I4R A;  1JR0 D;  3S1Q H;  5IP7 H;  4IFD I;  1HZB A;  1YEZ A;  2AHM A;  1LTR D;  5FTM A;  2R92 B;  4LF9 M;  3JC6 6;  3AL0 C;  2XWJ B;  4JXJ A;  3E0E A;  1BOS A;  2L9H A;  2YTX A;  4LFB L;  2PW5 A;  1SR3 A;  5IYC G;  2F0Q A;  2JA6 G;  3U6P A;  3B74 A;  4M0W A;  1CKN A;  1JWU D;  1DON A;  1PFM A;  1SLJ A;  2HIX A;  4DK6 C;  4B3S Q;  1ILP A;  1DGF A;  2DZN B;  1K8O A;  2BE5 D;  4IN3 A;  4XYO A;  4L78 A;  2LTU A;  2ZTC A;  1A3U A;  5BR8 L;  4XQJ A;  1IYJ B;  1B53 A;  1CA6 A;  2DJG C;  4RKU F;  1JJG A;  1IXZ A;  2X8A A;  1EZ6 A;  3E9H A;  1BXT A;  4NXM L;  4YHH Q;  2L11 A;  4IFD H;  1STG A;  5HY6 A;  4A3L H;  4KN7 C;  1P8L A;  2LVO C;  1G51 A;  3I51 A;  2EKF A;  1V8Q A;  4FWD A;  3SFZ A;  1IXS A;  2MJ5 B;  2Z4I A;  3NXW A;  3L3O C;  4DA2 A;  1E1O A;  4DPG A;  3ITP A;  4QMG A;  1S3O A;  3NHH A;  5LMU Q;  4BA2 I;  4OX9 M;  2FIN B;  5C4X H;  3J81 j;  1VS0 A;  3PO2 H;  3VR5 A;  1NV8 A;  1ENA A;  3U60 A;  2L5T A;  4APV A;  1CKN B;  4OO1 I;  1II3 A;  1Y1W B;  5T1G A;  5KQ8 A;  1I3Q H;  3DXJ C;  1HNX Q;  4DF7 A;  2R7D A;  3MHV C;  2F1M A;  5IGB A;  4BWG B;  3M4O H;  5C44 G;  4K6L A;  1J5E Q;  3T1H L;  2JA8 B;  3D3R A;  4GN4 B;  1MHW C;  4DR2 M;  3TL4 X;  4MH0 E;  3HKZ B;  2L12 A;  4LF8 Q;  4DN4 M;  1ENF A;  2XNA C;  1QOH A;  4IO9 A;  4Y7N H;  2ES2 A;  1F9P A;  1X3E A;  1YNJ D;  1HUN A;  3ERS X;  4IPG A;  1EEF D;  4DR4 Q;  3M7G A;  2N78 A;  1H6U A;  3H0G B;  1LTA D;  3M3Y H;  4M9S A;  4IOC A;  2R7Z G;  2A74 C;  1I6H H;  4IBC A;  2BJV A;  2KEB A;  5IT9 E;  5DFL A;  4C56 C;  1I3Q B;  2G8L A;  2XGN A;  3ULP A;  4CGY B;  4HCS A;  2JJQ A;  3L7Z C;  2XRS D;  4KV6 A;  4DV0 L;  4DV7 Q;  3HJS A;  2R45 A;  4LZJ A;  1I4H A;  2BE5 C;  3A8K E;  5HGT A;  1PRT B;  4BBR G;  2K5N A;  3U61 B;  5JAV A;  3H3V C;  3FEW X;  5FLX E;  1YJ9 A;  4IUQ A;  1P3Q Q;  5M5X H;  4MTN A;  2RDG A;  4XT3 B;  4C3J H;  1O7I A;  3VDU A;  1G59 A;  3SAV A;  2RCF A;  1B70 B;  1W5T A;  1CQF A;  3D31 A;  5K5P A;  2K33 A;  3KBX A;  4QIW B;  1ROD A;  1UE1 A;  1PH7 A;  2QP9 X;  3H91 A;  3K6O A;  2EYM A;  1JOK A;  1PTO C;  3AFQ A;  2BA1 A;  2LVQ D;  3TPZ A;  3FKE A;  3WWV A;  4U68 A;  2E2J B;  4JK1 C;  4DV1 L;  1X55 A;  1SFO H;  2ZT9 C;  1GAB A;  1LT3 D;  1TY2 A;  3FE3 A;  3D4W A;  5IGD A;  5IYB H;  4X62 Q;  2N35 A;  5LMU L;  1VQ1 A;  1HNW M;  3M85 A;  3SAR A;  2DWL A;  3MXN B;  4UY8 C;  3GTO B;  4AH6 A;  2F5P A;  4A3M G;  2UXD L;  1F2Z A;  2XIW A;  2ZAM A;  2B39 A;  1I4P A;  1KRT A;  1QNU A;  4DUZ Q;  3GLH A;  2YFQ A;  3NWL A;  3FUT A;  1PTO H;  3DFZ A;  4UP7 A;  5DM6 3;  3HU2 A;  4LCB A;  2HAK A;  2VW9 A;  3MAQ A;  3U6S A;  1F9Q A;  4X65 M;  5ELO A;  3FTF A;  1L2D A;  3VYR A;  5KIX A;  3NK9 A;  1GJT A;  2DNA A;  2D62 A;  4A3K B;  3K2L A;  4NMZ A;  2M2L A;  4XDX A;  1SFO B;  2L7H A;  2KXE A;  2F0L A;  3EIV A;  5GRO A;  1L0W A;  2XFS A;  4DR7 Q;  2R62 A;  2F0G A;  2C99 A;  2UXC Q;  1YIT A;  2Z6B A;  1EYG A;  5J22 A;  2DN8 A;  3QOL A;  2NN6 G;  3DWP A;  2B63 G;  2K5W A;  2MH8 A;  1YJN A;  2IHE A;  3J7A F;  3GLH B;  3PIO 3;  4RGT A;  1DGH B;  4JI5 M;  3AQQ A;  4DV7 L;  3HOW G;  4BY1 G;  3OTO L;  2CFM A;  3JAM c;  5FTL A;  4ZAI A;  4LF6 Q;  3D8B A;  2XRQ D;  4L5S A;  3UDI A;  1ZMU A;  4PV1 C;  1HT1 E;  1G6Z A;  2YNM D;  2Q2U A;  4I65 A;  2OTL A;  2K4K A;  2E74 C;  1ET9 A;  2F0T A;  2ASB A;  1L1O C;  1IKL A;  2EKK A;  4IBI A;  3HHZ A;  5J1Z A;  5JJZ A;  2UUB M;  4IUP A;  2Z4S A;  1K73 C;  1HNZ Q;  1ORY B;  1QUT A;  3BXW A;  1DOM A;  1N36 Q;  4RAU C;  3GTJ H;  2UUB Q;  2NVX B;  3DM3 A;  3U6O A;  3E21 A;  3LX0 A;  4L16 A;  2LNH C;  2V4D A;  1P16 A;  1X56 A;  4MTK A;  5CYU A;  1EEI D;  3HFZ B;  4A3B B;  5COY A;  3FMC A;  5I6Y A;  4Z8X A;  1YSY A;  4Q5V A;  5GAG C;  3A74 A;  1STB A;  2R18 A;  3U6L A;  2UUA L;  1KAW A;  4IQZ A;  4FYD A;  1G3I A;  4AZF A;  3BDC A;  1L2B A;  4NRV A;  3VDP A;  3KLR A;  2EXZ A;  4TSS A;  1XXH A;  5JVH 3;  4JV5 L;  5KNB A;  1DZ1 A;  1JT8 A;  2MJ8 A;  3KK7 A;  3AKZ A;  1N8R C;  1IBM M;  4DK3 C;  3PIO A;  5C44 H;  5EP1 A;  4JI3 L;  1CHQ D;  4I4L A;  2MO1 A;  5FJ8 H;  3KOX E;  4LMQ D;  1YJW A;  2UUC L;  5A2Q E;  2EJG C;  3EFX D;  4JI7 Q;  2KNA A;  3SXH A;  2BJW A;  1BCP F;  4PDI A;  2ZJP A;  4DAP A;  4BBS H;  2WAQ G;  4WRD A;  4LGY A;  1SYD A;  3BBZ A;  4PQX A;  5JEA H;  3TRE A;  3SHF A;  1T5X D;  4HIM A;  4IBF A;  5EP2 A;  2A68 C;  2AQ3 B;  4XXE A;  5FOB B;  1KIX A;  4ZCK A;  1EZ8 A;  3CCE A;  2OOA A;  4PCZ A;  3E5S A;  3CU7 A;  1PA6 A;  1FNW A;  3SAW A;  4CIS A;  1BO0 A;  1HQM C;  5CGK A;  1NUC A;  3F2B A;  1W6K A;  2N3S A;  2ZJR A;  4KHZ A;  1E0B A;  5C44 B;  1R9T H;  2N49 A;  1PRT C;  3AOE C;  1H9S A;  2HQL A;  2JXM B;  1AEX A;  3NEL A;  3ZYY X;  1DOL A;  2K7V A;  3T38 A;  3E0J A;  4CDD C;  2CHV A;  4KKU A;  4HCE A;  3PVS A;  4IOA A;  3UE0 A;  2JY5 A;  1IN8 A;  1B7Y B;  1EWH A;  1MKH A;  2VUM G;  2Z4R A;  3GRU A;  2F5Q A;  4UPA A;  3PO2 G;  2DAE A;  1H9M A;  2JA5 B;  4A75 A;  1GL7 A;  2I07 B;  3KVW A;  3BJU A;  3HGI A;  1EU4 A;  2I0Q A;  2M9V A;  3TP6 A;  1EY0 A;  5DLQ E;  4A3D H;  1N34 Q;  3S9W A;  3LMM A;  1PVO A;  3HOU B;  4PT5 A;  3ZCB B;  1PH5 A;  1ZXT A;  4X65 Q;  2NZH A;  3GPP A;  3T4A C;  2MUY A;  4IUT A;  1VQO A;  2HD3 A;  4K5W A;  4PZ7 A;  1KFV A;  4B3T Q;  3I70 A;  2Z1C A;  1TWA B;  2EY6 A;  1IQP A;  1D2N A;  2KEC A;  3T13 A;  1D1I A;  3KUP A;  1SNM A;  2JA5 H;  2QCP X;  4LF9 Q;  3H0G G;  2R93 H;  1AP0 A;  2UUC M;  2E2H H;  2A6H C;  3D8G A;  1QZH A;  1E9S A;  1B9N A;  1QB5 D;  1A2U A;  2K03 A;  1NNJ A;  3HHY A;  1EQV A;  3HOU H;  3HOZ H;  4H13 C;  5CV8 A;  1WIV A;  2F0S A;  2F0F A;  1CA5 A;  3VKH A;  3GLH E;  5KRU A;  2AWO A;  1N33 M;  4LF7 Q;  4GLV B;  1XNR Q;  3HU3 A;  4R3D A;  4IPC A;  2YR0 A;  3GPY A;  3LWE A;  4LY6 A;  4RKB A;  4R8N A;  2JA8 G;  3RNU A;  4HAE A;  4R9W A;  3E6Z X;  2IX3 A;  2E5L L;  1KDA A;  4IBE A;  1HFG A;  2Z0S A;  4LAA A;  3M4Y A;  2NWG A;  4MN3 A;  4JI7 L;  1STA A;  3R2T A;  4UAI A;  2CRU A;  1G6P A;  1EQT A;  4FXG C;  1EYD A;  1SYF A;  2KJX A;  2HHH L;  4HIK A;  2B2T C;  3C58 A;  1L1Z A;  2L55 A;  3S14 B;  1MIU A;  2KBN A;  3TBI B;  3HOV H;  4A3G H;  1T5E A;  1A2T A;  2QEN A;  4FWH A;  4HLQ A;  1ZAE A;  4JI2 M;  1IZ6 A;  4FCT A;  2IY5 B;  1FNV A;  2PZT A;  4L6T B;  4L5T A;  2D2C C;  5JPN C;  3FVQ A;  1HZC A;  4J1M A;  5M5X B;  1NJG A;  4JI6 Q;  2PNR C;  4C3J B;  2B8G A;  2EPB A;  4N9P A;  4NXM Q;  2I5L X;  3K80 C;  4CJ2 C;  2HDM A;  2KHJ A;  2CV2 A;  4E6I A;  2HKJ A;  4DV4 M;  4X3T A;  1I4Q A;  1NV9 A;  1NNU C;  1Q86 C;  2XWB B;  2OT2 A;  4OW0 A;  4IBJ A;  3K92 A;  4YY3 Q;  1QZE A;  5DYG A;  1TDH A;  1R9T B;  1K28 A;  5L8R F;  4GIT A;  3J7A 5;  1UNS A;  3QJY A;  2O2L D;  3VYT A;  4NDX A;  2QNJ A;  1LAB A;  3GQB A;  5NUC A;  1EY6 A;  4AKI A;  4AW4 A;  2F0V A;  1J8I A;  1SNC A;  4ABN A;  1TS4 A;  2UUA Q;  2R4E A;  7CAT A;  3OMC A;  2MHV A;  2MR9 A;  3GTP B;  1ZEQ X;  5ITU A;  1HQY E;  1HNX L;  5M3F B;  2BCO A;  4DK1 A;  3UZU A;  1Y1V B;  5C3W A;  3U5Z B;  1Y1W G;  1XTC D;  3KXE C;  3SYL A;  4B3M Q;  5GKN A;  2HDL A;  1SRU A;  1FNU A;  4G7O C;  2F3V A;  2C98 A;  2XFT A;  1G8P A;  3S1N B;  2WFW A;  1A63 A;  2F0P A;  3FKI B;  5M3M B;  5BPV A;  1PHJ A;  1OXU A;  2XSC A;  4G4Q A;  5JEA J;  4WOR A;  2SNS A;  3F2D A;  2HHH M;  2I7N A;  2KZU A;  2ZBK B;  3PUZ A;  3T1Y L;  1E94 E;  1ILQ A;  1H9J A;  3P20 A;  2F4V L;  1RTN A;  2FJ2 A;  4G3O A;  5IT9 S;  1Y8N B;  2C5R A;  4KY6 A;  1WR1 B;  4PZ6 A;  2CHB D;  2KW0 A;  3K9P A;  3A8J E;  2PPB C;  1EQR A;  2ERC A;  3T6P A;  2CP8 A;  3GTQ H;  4YWL A;  2JY8 A;  4FCW A;  4RNA A;  1NCV A;  3KP1 E;  1BVS A;  3CGW A;  2TMP A;  3H4J A;  2ICI A;  4UP9 A;  4YCU A;  3OOC A;  3BZC A;  3GLG B;  1NJF A;  1WTQ A;  4MGI E;  2CFO A;  3NTH A;  4DV1 M;  5EJC A;  4X6A H;  4CBV A;  2K04 A;  2RGO A;  3TZU A;  2APL A;  1W6J A;  2QEJ C;  4BBS G;  1RJT A;  4M1U B;  3ICE A;  4HIO A;  3IRB A;  4YHH M;  5JEA G;  1GVN A;  4GOP B;  2R46 A;  1Q39 A;  3AFP A;  4C2M B;  3I3C A;  1W2B A;  4G4R A;  1SG9 A;  1D2B A;  2AKW B;  2UU9 Q;  1LTG D;  1CZG A;  3MEF A;  4ANR A;  4DV3 Q;  3AU7 A;  3CCM A;  4OVZ B;  3AMU A;  2L4F A;  3D4R A;  1DO0 A;  1KC8 C;  1CKO A;  4A3M H;  3KDS E;  1JWM D;  1EFU B;  3DEO A;  4YCW A;  4OVZ A;  3GTM B;  1KAB A;  1Q7Y C;  1Y69 U;  2WIN B;  1HT2 E;  3K1J A;  2OQ0 A;  4X3K A;  4LFA M;  3KF8 A;  1CTM A;  3ZC7 B;  1E9R A;  4KLN A;  2ZTE A;  1KXL A;  3GRR A;  4KHP M;  1IBL Q;  4KD4 A;  1GUS A;  3KBG A;  1QDT A;  1IXR A;  2NVT B;  1NE3 A;  1KNE A;  4X66 Q;  4N9T A;  3CF2 A;  3I91 A;  2JA7 G;  4K5X A;  4II7 A;  3RUZ A;  1M1K C;  1EWC A;  1VQ9 A;  4JPB W;  1I4W A;  4LJ5 A;  2XN9 C;  2L4E A;  1D6E C;  4JI4 L;  2F5O A;  1UUP A;  3K5N A;  3HOY G;  2X6G A;  4NXM M;  1HZA A;  2GNO A;  3N6R A;  4GRI A;  3BVZ A;  1V43 A;  3M4P A;  5E26 A;  4DAM A;  1Z59 A;  3PF5 A;  2SEB D;  3S15 B;  1EQQ A;  1IW7 C;  4BY7 B;  1EY8 A;  3HKS A;  1YE9 A;  5ITX A;  2WB1 E;  4KKT A;  4F87 A;  3WOF A;  1SSO A;  2FMM A;  2R7Z B;  4LF4 L;  2OPF A;  3C2P A;  2BH2 A;  4JBJ A;  1IY2 A;  2EXD A;  5C6A A;  2QHO B;  2CE7 A;  1OXV A;  5C5L A;  5IYD G;  1WHC A;  2JP1 A;  1BBU A;  1EIY B;  2XVS A;  4GLX A;  4DR5 M;  3HHW A;  3UE1 A;  1DM0 B;  1N36 L;  1TDZ A;  1U0L A;  3LNN A;  1GO5 A;  4G4O A;  3NE5 B;  4LWC A;  4U67 3;  4OO1 G;  2JA8 H;  3U6Q A;  1WOC A;  5IY0 A;  4REZ A;  3GV6 A;  3QO2 A;  3UDG A;  2B3T A;  1C1K A;  4KT0 F;  3LVV A;  2YV5 A;  3CCS A;  4DV6 M;  3CCU A;  3S1M B;  1IY0 A;  2EYL A;  3U5Z A;  3I4Y A;  3BVG A;  4MGZ E;  4F7X A;  1EY5 A;  1OIP A;  1CHP D;  3I4N G;  2F5S A;  5EQT A;  1OJL A;  4A3G B;  3I4M B;  3CF5 A;  2IX1 A;  3A55 A;  1LT5 D;  4MZ9 A;  3FUV A;  3TDQ A;  5IWA Q;  5C0X I;  1STE A;  2N88 A;  1JB3 A;  1VQA A;  4OON A;  5FSW A;  5M5Y H;  1KQS A;  3HOZ B;  5F2D A;  4V0B A;  1CSQ A;  2TSS A;  4QHS A;  4PMB A;  1IBK L;  5C4Z A;  1ZMW A;  4C3I G;  1XNQ L;  4K0K Q;  1QJO A;  3MHB A;  3PF4 A;  2OWO A;  2VF7 A;  1XNR L;  1M90 C;  1Z7T A;  1XXH B;  3I01 M;  4R4C A;  5IOC A;  1DGS A;  4QUF A;  3V05 A;  1SXJ A;  4OIJ A;  2Y0Q A;  1CSP A;  2XLJ A;  1V34 A;  5DNY A;  1VQN A;  2YTY A;  3WOE A;  2WB1 G;  2E2J H;  1QAO A;  3KS8 A;  2P5T A;  1EYA A;  2JYO A;  4N8X 1;  2RCN A;  4CJ1 B;  3IL8 A;  4JI5 Q;  1Q90 A;  1KAA A;  2K6A A;  3TWL A;  4DR5 L;  3CC2 A;  3D8L A;  3Q0A A;  1LTI D;  3GTL H;  2F0M A;  2LXJ A;  2PCF B;  3B7Z A;  4JI1 M;  3FTE A;  3HKZ G;  1EIJ A;  2O5R A;  3KLS X;  1VQM A;  5I2X A;  4YWK A;  4AYB E;  1TWF H;  4ZUJ A;  1CKM A;  2O01 F;  2G9D A;  4NC6 A;  4LF4 Q;  5FLX c;  1DGH A;  1B9M A;  3P75 A;  4A3E H;  4JI8 M;  2KEN A;  2X6L A;  4P71 A;  2JK8 A;  2G9H D;  1LLR D;  5IGF A;  5ISR A;  3PCO B;  4GHA A;  3J81 c;  4OX9 L;  2KHS A;  2XEP A;  2XGT A;  2VZA A;  1EY4 A;  1GVP A;  5J39 A;  3OPO A;  1GJX A;  2LXE A;  1VDZ A;  4A76 A;  3UGJ A;  3H0G H;  3SC3 A;  2NTT A;  2V1U A;  3K9O A;  2IW3 A;  3D6C A;  1T9H A;  4YHH L;  4GLA C;  4P17 A;  3J2P B;  4NB3 A;  1PH9 A;  1C8C A;  4DV5 Q;  4S3S A;  4J15 A;  1GD7 A;  1PH4 A;  1EFW A;  1UE6 A;  4ME3 A;  3JAM i;  4LF7 L;  1Y1V H;  2R92 G;  3DZD A;  1SXJ E;  2ZM6 Q;  2Y21 A;  4DR2 L;  2FNA A;  2RRU A;  4GC9 A;  4HTH A;  4GKK L;  3ULL A;  1BNZ A;  4HL4 A;  2E5L Q;  1HH2 P;  3PQI A;  3W67 A;  2L1B A;  3PO3 G;  2DZL A;  4B3R Q;  3QOJ A;  2VQE Q;  3HJ8 A;  4JBW A;  2OOB A;  3URY A;  1AN8 A;  3KDF B;  1A0I A;  2JNH A;  2EDG A;  2R61 A;  3T51 B;  1QVG A;  1C48 A;  2AUJ D;  1WVL A;  1PV4 A;  3QIA A;  3CC7 A;  2QDL A;  4GN3 B;  4QHT A;  3NPP A;  3FRH A;  1SE8 A;  4A93 G;  2BDO A;  3B6Y A;  4J6H A;  2KRU A;  5GQO A;  4ZQ3 A;  2F0H A;  3MMP A;  1ML0 D;  4PMC A;  3W1B A;  4FW9 A;  2B29 A;  1YHA A;  4FWG A;  1HCZ A;  2V1C C;  3U61 A;  4OO1 H;  1GLN A;  1ZV1 A;  1B8A A;  4BY7 G;  2XSZ A;  2E2D C;  4RGM A;  4X64 L;  2A5Y B;  2K5D A;  3LWU A;  3MZ5 A;  3K5M A;  3M9B A;  1WI5 A;  3PUV A;  4FVM A;  1Q1B A;  1Q3L A;  3MC0 B;  4J8Q A;  2Q8I B;  3B89 A;  2VB3 X;  1V33 A;  2J7N A;  3A0J A;  3T1Y M;  2OO9 A;  3RE8 A;  4GH9 A;  1STN A;  4RA8 A;  5E3F A;  1MJE A;  2EYO A;  1F9S A;  4RHS A;  4C2M H;  5LL6 X;  1VCI A;  1HQR D;  1MJC A;  1HA6 A;  2Z9H A;  2RF4 A;  1QUQ A;  1XYI A;  4OHJ A;  1PYS B;  4Y7N B;  4FD2 A;  5H1S E;  3S2D H;  4RGN A;  2KRK A;  1TKW B;  3VYS A;  4DR1 Q;  3PV0 A;  3TRZ A;  3M4Q A;  3K8Z A;  1SJH D;  2VB2 X;  3VA7 A;  4DUY L;  5EP4 A;  4AQY L;  2JUJ A;  2A68 D;  4JI0 Q;  1L2C A;  1PJI A;  1AIP C;  1B2T A;  3GQ3 A;  4MB7 A;  3S1R H;  1WJ7 A;  3VR4 A;  1PRT D;  2V6Z M;  4OU7 A;  4IBB A;  2NVY B;  4R1J A;  4LFC M;  1TWF B;  2KHH A;  1OIZ A;  3UI2 A;  2YTV A;  2KED A;  4EVO A;  4C3H G;  4H02 A;  1XX8 A;  5C4X B;  3DWQ A;  3HOV G;  3QR8 A;  2LHC A;  4A3G G;  3PIP 3;  4KI0 A;  4C1N I;  5CC4 A;  4A3L G;  4KK7 A;  1Q3B A;  1OO9 B;  4M0D A;  4TRD A;  2OF1 A;  2GVA A;  2ICE C;  3GP7 A;  3KLS A;  4AKG A;  3BYT B;  5CBA E;  1WJJ A;  3OW7 A;  4DUZ M;  4DV3 M;  1HTP A;  2MP1 A;  4KMU C;  2QA4 A;  4WUR A;  1F2L A;  3GP1 A;  1GUN A;  1SXT A;  1S5C D;  1HTL D;  1ONL A;  3GDE A;  2WAC A;  4CKC A;  3A45 A;  2R93 B;  4AG6 A;  2G5D A;  3AYH B;  4JBM A;  5ELD A;  3W68 A;  2EIF A;  1SYB A;  1IBL M;  1J09 A;  3E3X A;  4KHP Q;  3R93 A;  1XC8 A;  1FJG M;  3AJI B;  5LMU M;  3ERO A;  3KJO A;  2L4N A;  4JN6 A;  2R3Z A;  2DAG A;  2QGQ A;  1VQJ A;  1GUW A;  4IJH A;  1D8L A;  1V1O A;  4H7B A;  1CUK A;  4L5R C;  2DY7 A;  1SRO A;  2ID0 A;  1B44 D;  2LFN A;  4JVZ A;  4AIM A;  3HOZ G;  2W82 A;  1O7L A;  4NP5 A;  4EQP A;  3J7B A;  2JA6 B;  1AZQ A;  1A62 A;  4GC5 A;  4K14 A;  1PMR A;  2FH0 A;  5IGC A;  3KFU A;  4A3K H;  1O80 A;  2HCI A;  5BN4 A;  4X65 L;  1W5S A;  1QUQ B;  2E76 C;  4QNR A;  1RL2 A;  1A5T A;  1MSH A;  3I4M G;  4P75 A;  1QQW A;  3CQZ B;  4FXK C;  1DV0 A;  3SR1 A;  1C0A A;  5FLX S;  2F03 A;  1R4P B;  1VEJ A;  4I81 A;  4QJF A;  1QAM A;  1BDO A;  2CV0 A;  1B1Z A;  3CCR A;  3GLI B;  3RFW A;  4IPH A;  4AG5 A;  3PUY A;  4A3F B;  3BG3 A;  1HR0 W;  3HJQ A;  4Z9C B;  2QW7 A;  4DR6 L;  2ENB A;  2A1A A;  3FHW A;  1XPR A;  3S16 B;  4ME5 A;  4A3J B;  4OXP A;  2Y20 A;  2EY5 A;  2NN6 H;  1TU2 B;  4C3H B;  1U4P A;  4R4I A;  3E9S A;  1QAQ A;  2I46 A;  4JI4 Q;  3HOW H;  1VQ6 A;  1AUA A;  1CFM A;  2MFI A;  2QDB A;  4K6D A;  5HGQ A;  4FNF A;  3TSS A;  4OGQ C;  3T1H M;  2Q2H A;  1Y14 B;  2DAI A;  5FO8 B;  2EYJ A;  2G5G X;  4X3S A;  2G3Q A;  2JQO A;  3S1Q B;  2NVX H;  3THG A;  3NBI A;  4DAV A;  4LF8 L;  1SMY C;  1V1Q A;  1VQE A;  3L26 A;  1LM0 A;  3KDF A;  1PJQ A;  3HOY B;  2AUK A;  2K50 A;  4DBG B;  1IN7 A;  4LJ8 A;  2F4V M;  3HRZ C;  5EXP A;  1WTP A;  4JYA L;  4TKO B;  2AHO B;  4QUC A;  3CCV A;  1JR3 E;  3HG9 A;  1PYB A;  4JI0 M;  1D0L A;  5FO7 B;  1TWC B;  3J81 E;  3VK8 A;  4G57 A;  5IIF A;  3OTO Q;  1PGY A;  3KOZ E;  1RF2 D;  1G8Z D;  3FRI A;  2EZV A;  2NZO A;  2L15 A;  2K01 A;  5K36 G;  2O5I C;  1S5B D;  4LRS A;  3CPF A;  3SK6 A;  1J6Q A;  3FDT A;  4LJ4 A;  5COR A;  1N32 L;  3NUC A;  1WD1 A;  4LJ9 A;  1STY A;  2SOB A;  3SHL A;  2P5Z X;  1HNZ L;  5KPZ A;  2KQ3 A;  3HOX B;  1FNN A;  1L1O A;  3NQT A;  5BR8 Q;  5LMN W;  4GHL A;  3OIQ A;  4G4K A;  1A3V A;  2F0I A;  3IG5 A;  1SMX A;  5AJ3 Q;  3C1F A;  1EWI A;  4K8J A;  1IXS B;  2KNZ A;  3SYK A;  5D14 A;  3AOG A;  3KS4 A;  1YBY A;  4LJ7 A;  2HQE A;  1I5F A;  2EYH A;  1T43 A;  4C3I H;  4HSV A;  1VQF A;  1R4G A;  1GKI A;  4KO8 A;  4B9X A;  4DR3 L;  4FF2 A;  5FLM G;  1FJG L;  3JAM S;  4JW0 A;  3RGS A;  5KND A;  2KHI A;  2DNC A;  1HR0 L;  4WJ3 M;  3PXG A;  1K8M A;  4DV1 Q;  4NXN Q;  4AQY M;  3NP8 A;  4LF5 M;  2DJF C;  2PYK A;  3DEP A;  2IHF A;  1MX0 A;  1JC7 A;  5DM7 3;  1OFH A;  3CD6 A;  3CCJ A;  4XIG S;  5TSS A;  4LZZ A;  4C1N K;  5C1B A;  1JOR A;  1FL0 A;  1V1P A;  2K5H A;  5IRE B;  1SXJ B;  4JYA Q;  4A3D G;  5E1F A;  4A93 B;  1JQY D;  1LO5 D;  4GKJ L;  4HED A;  1DO2 A;  4DV2 L;  3J80 E;  4A3F H;  3P7J A;  1TWA H;  2KCM A;  5FKA C;  1TWH H;  4LJA A;  5FJ8 G;  4NL4 H;  5FLX L;  4IUN A;  1J5E L;  3IKJ A;  1I6V C;  4NKL A;  4A3J H;  1B50 A;  1IXR C;  4CIZ A;  4RWS C;  4QCL A;  5EPJ A;  2VY3 A;  3S2H B;  1PRB A;  2LXK A;  2RHS B;  4DV4 Q;  3I04 M;  3HP3 A;  1IN6 A;  4QOZ C;  1TWG B;  1ENC A;  2QEX A;  1Q12 A;  4RKL A;  1O7Y A;  4CHT B;  2B2U C;  1KNA A;  4X66 M;  3GV3 A;  2UXD M;  3NWT A;  1MJG M;  1QYR A;  1XMQ L;  1KL9 A;  4A3D B;  2DKL A;  3GLF A;  2ZAN A;  1N36 M;  2K32 A;  4JBK A;  1L2F A;  3RLN A;  1WCM H;  3HOY H;  3SK5 A;  3ULJ A;  4DV6 Q;  3EBE A;  3U9O A;  3F1Z A;  3STB C;  2JY7 A;  4A3I B;  3OHX C;  3U4Z A;  1XJV A;  2SDF A;  4KY7 A;  2PZW A;  4K8I A;  5IP9 G;  3GTG H;  2F3W A;  4RH6 A;  4DUY Q;  4POG A;  1PJT A;  4LFB Q;  5FTK A;  4MM3 B;  1OTR A;  1SYE A;  1RDP D;  3J81 L;  3GTQ B;  5IGG A;  3VR6 A;  2M60 A;  1DGB A;  2UXB L;  2IPK D;  4K2L A;  4ITQ A;  1Y8O B;  4WJW A;  1LV9 A;  3DWA A;  1R2Z A;  3S17 H;  1WTW A;  2XH9 A;  4PMW A;  1I94 L;  3M6A A;  5ITR A;  3PO3 H;  2F0J A;  3RZD H;  5KQD A;  1FD7 D;  1ASZ A;  4DXF A;  1EIH A;  3W3A A;  2RKO A;  3G48 A;  2X49 A;  5T1I A;  4DV5 L;  1RD9 D;  5M5W H;  3JR5 A;  1I4G A;  3G6E A;  4B3T L;  1SJE D;  1SEB D;  1EL0 A;  4I8O A;  1TR5 A;  1K3R A;  3OIP A;  1UWV A;  2FS1 A;  3CTW B;  4LUV A;  4ULL A;  2MNA A;  3HGB A;  4RGO S;  1T3T A;  5E4W C;  2E2I B;  2D7E A;  3CW2 C;  3HX3 A;  5EBC A;  4P74 A;  2R0I A;  1PZI D;  1LTT D;  5EJW A;  1IHZ A;  3H09 A;  4R4O A;  5C3E B;  2CWP A;  3R3O A;  3R8F A;  2K28 A;  2F5N A;  5M5Y B;  5FTJ A;  4HJ8 A;  2Y0T A;  5ITT A;  2JN4 A;  1S3S A;  3KF8 B;  3S14 H;  4M9Z A;  5D3D A;  1F4I A;  5DYI A;  1GL6 A;  1J9O A;  1TS2 A;  4GIP A;  5M5W B;  1ICF B;  4BXX H;  1U4R A;  3KW6 A;  1E22 A;  2FFJ A;  2JA6 H;  3AV0 A;  1Z6T A;  4JG2 A;  3RN2 A;  3GD7 A;  3L29 A;  3BYY B;  3GLF E;  1YZ6 A;  4R7G A;  3X3N A;  1YIJ A;  2PMZ E;  1O78 A;  2JSO A;  3STB D;  4MNO A;  3U6E A;  1UAP A;  3A7A B;  1TTE A;  1TT2 A;  1KRS A;  3PNV A;  2LWX A;  2O4X A;  4IUU A;  1WXQ A;  1TR8 A;  2C96 A;  3DUZ A;  2LH0 A;  2B63 H;  3L2A A;  3G6J B;  5FK9 C;  1R2Y A;  1D5X C;  4CDC C;  3HKP A;  5GAH C;  2Q2I A;  3BOS A;  4BY1 H;  4NOO B;  3NTI A;  4P2C B;  2J0T D;  4XT1 B;  3OSO A;  1IL8 A;  3H3V I;  3RZO B;  3LCU A;  5D3I B;  1B3A A;  2ATW A;  5L37 A;  3CKI B;  1VQH A;  4EGV A;  2E8G A;  2C9O A;  4CJ6 A;  4GNX B;  4L4U A;  1KDB A;  1HRJ A;  2FOI C;  2LKV A;  3VR3 A;  4C3H H;  3A5U A;  4H0L C;  4DV5 M;  2L6O A;  1PZK D;  5JOB A;  2EQS A;  1MD2 D;  2KA6 B;  2RSN A;  1EOT A;  3CME A;  1L0Y B;  3AOE A;  4WP2 A;  3TWK A;  2YU9 B;  4A3E B;  1YVC A;  1OAO C;  2JY6 B;  4RCN A;  4B3M L;  3I4V A;  2H5X A;  2Z3X A;  1UEA B;  1WGL A;  4O0A A;  2CW0 C;  3K57 A;  1VF5 C;  5C4H A;  4LF9 L;  1OTC A;  1UFZ A;  2UXB M;  1VQL A;  5CV6 A;  4F88 A;  3AEV A;  2ZXO A;  3KSX A;  1CM9 A;  4LG2 A;  1NNX A;  1PRT F;  5LMN M;  5KO3 A;  4RFB A;  1AW7 A;  3BZK A;  4ZYS A;  5ELB A;  3B7N A;  4DR5 Q;  3V76 A;  2I5M X;  4MHE A;  1EE8 A;  5FTN A;  2MGW A;  3VK7 A;  2F0E A;  5EXS A;  2WKD A;  3GTK B;  4QOS A;  3W1G A;  4IIW A;  2QCU A;  1QUS A;  3A7L A;  3OWF A;  4GKJ M;  4KKS A;  3RZD B;  2NVT H;  4L5Q A;  4M9X A;  4JV5 M;  3U60 B;  4B7G A;  4JI7 M;  1DOK A;  3ERQ A;  1YNX A;  1R7R A;  2D5D A;  2HHH Q;  1VF7 A;  4C3J G;  1N32 M;  1OXS C;  4L8R C;  5JJL A;  2PW7 A;  1VQP A;  2Q2T A;  1N32 Q;  3QYE A;  1S40 A;  3NQI A;  2E2I H;  2DZO B;  4DR1 M;  3HOX H;  2Z8L A;  3Q8D A;  1X6O A;  1TS5 A;  5LL6 S;  1V92 A;  3CAM A;  5DEH A;  2E2H B;  3A5Z B;  3HS0 C;  2WZJ A;  3CC4 A;  2M00 A;  1XMO M;  3E4R A;  2UU9 L;  5IYB G;  1MGS A;  3QWL A;  3K81 C;  2DEN A;  1XMQ M;  1U9R A;  3KP0 E;  3A42 A;  4A3J G;  2VUM H;  3M3Y B;  1YHQ A;  4B9W A;  3LVW A;  3GTM H;  1OXT A;  5KNC A;  4HJ5 A;  2B2T A;  1PFS A;  2YQZ A;  4LFC L;  3CMA A;  4DR3 M;  2SNM A;  1IN4 A;  2FXQ A;  2QBY A;  4FCV A;  1K83 B;  2F0O A;  3HY5 A;  3J7Z C;  5IWA M;  3TN2 A;  4DAY B;  1SYG A;  3Q22 A;  2Y0S B;  2C9C A;  2QSF X;  2KCT A;  3OMG A;  2LVA A;  3LGJ A;  5IOD A;  5C0X G;  5IYD H;  1IKM A;  3LQR A;  5JJK A;  1JR3 D;  2AWN A;  2D7H A;  1A15 A;  3CHB D;  2DWM A;  2B63 B;  3I55 A;  5GAE C;  3S1M H;  4QIW E;  3D4D A;  2NQ8 C;  1K3B C;  3UJN A;  1S4Z A;  5ELE A;  3GRV A;  4R8I A;  1PTO F;  1TWH B;  2PZU A;  3T16 A;  3J7A V;  2B2W A;  5DAU A;  2OQK A;  1H95 A;  3I4M H;  1QE6 A;  2QPA A;  3PUW A;  3S1R B;  1M8A A;  2OEO A;  2JA7 H;  2NVY H;  3QB3 A;  4PDG A;  2K1B A;  1G41 A;  4JI3 M;  5JI3 E;  1K83 H;  3JAM L;  2H4O A;  4JOI C;  1E2V A;  4RF1 A;  2J7Z A;  1ASY A;  1ZYR D;  3MFY A;  3O13 A;  2R6G A;  2YU9 H;  1IW7 D;  3BU2 A;  1EIF A;  2NVQ H;  4L15 A;  1KDC A;  2D0O A;  1D7Q A;  3EA6 A;  4OWW B;  3GO8 A;  1R6B X;  4EQN A;  1NR4 A;  1NO1 A;  1F77 A;  2Q2E B;  2NTS A;  1JIC A;  5C0X J;  2CH4 A;  2CHQ A;  3FP9 A;  2ZTD A;  2GQF A;  1RIP A;  4BBR B;  3SDZ A;  1LAC A;  1X65 A;  2DWZ B;  2V1C A;  3LW5 F;  4PD2 A;  4S12 A;  3GQ5 A;  3QYB A;  1S5D D;  1Q82 C;  3ZJY C;  1AZP A;  1NMF A;  3W2D A;  5CBE E;  4TQU S;  4CDF C;  2UU9 M;  1NSF A;  1HHV A;  4P72 A;  1VDD A;  3SK8 A;  4UDU C;  1E32 A;  3R2I A;  3H6M A;  2WB1 B;  1JQJ C;  1XB2 B;  4GKK M;  4JI8 L;  3CRK C;  4DNT B;  3F2C A;  1CK1 A;  5IE8 A;  1TQO A;  5I4D A;  2N55 A;  1JB7 A;  2RSO A;  1X3G A;  2VQE M;  3S17 B;  4LFA Q;  1RTO A;  4XBO A;  3TQS A;  3P1H A;  3VA5 A;  5J3B A;  2XZU A;  2F0N A;  2R7F A;  4ZK9 B;  2VQF L;  1WGN A;  2EJM A;  2MPM A;  2XF3 A;  4GOP C;  2L2D A;  2RA4 A;  2DI0 A;  1X32 A;  3NBH B;  1K8G A;  2UXD Q;  1F2Y A;  1M4V A;  5I9P A;  2GA4 B;  4EIW A;  3PGZ A;  1XWE A;  1FGU A;  3D0F A;  4GEW A;  4OEM B;  1SXJ D;  5CV7 A;  3KLW A;  1G91 A;  2R44 A;  2WSC F;  3PMF A;  5M3M G;  1D5M C;  1U4M A;  1Q8K A;  4JCV E;  2EA0 A;  3J80 L;  5EKL A;  1IY1 A;  5IWA L;  1HZ9 A;  2GVB A;  3RLF A;  1LYL A;  4LF8 M;  1TH3 A;  2A73 B;  1QWY A;  1T6O A;  1LTB D;  2MGS A;  3Q23 A;  1I50 H;  1DD2 A;  3SBJ A;  5EPK A;  3VYU A;  2CQO A;  3EVQ A;  4G7Z C;  2EY1 A;  3CF0 A;  1L1T A;  3MXG A;  1Y1W H;  3T1Y Q;  2FHT A;  3JR4 A;  4F1I A;  2XZF A;  3KF6 A;  4UP8 A;  3HOW B;  2I7P A;  3RR5 A;  1VEG A;  4IZ8 A;  3HEJ A;  1YNJ C;  4L8J A;  3DA1 A;  4ZUI A;  3J81 i;  4JI2 L;  3ZH9 B;  1FR3 A;  3GO5 A;  4LW1 A;  4XYQ A;  1NAP A;  3WDN A;  4NSO B;  1FYC A;  4I7Z C;  3F92 A;  2EOT A;  4WFN 3;  2O5J C;  3J7Y W;  4IPD A;  1I4X A;  1X54 A;  2RKS A;  5C4J H;  3VLF B;  3CCQ A;  3DHQ A;  3MXP A;  4EX5 A;  3L0O A;  1SE4 A;  2NN6 I;  1ZKO A;  2ALY B;  3FPP A;  2B2U A;  1RKN A;  4DV4 L;  4BBS B;  1LT6 D;  2JEB I;  3G7L A;  4WJ4 A;  1Q3C A;  1BKB A;  2IWH A;  1H9K A;  2HL7 A;  1HR0 M;  2HCC A;  3UK6 A;  3NSW A;  2I5H A;  3VR2 A;  1VQG A;  2B2V C;  1GHJ A;  1SE3 A;  5BR8 M;  5G3L D;  3T53 B;  3JAM E;  3TS0 A;  2DHY A;  1RU3 A;  2DXI A;  1SMY D;  5EKK A;  1JOO A;  2KCN A;  5EAY A;  1L8Q A;  3WHL A;  1TWC H;  3K58 A;  4QF4 A;  3U4V A;  3SK4 A;  2IL8 A;  5AFW A;  1A8V A;  4PG3 A;  2WSF F;  5C4J B;  2K75 A;  2EJS A;  2K47 A;  1NY6 A;  2JP7 A;  4RF0 A;  2PQA B;  1L1O B;  4KD3 A;  4HJ9 A;  4NRW A;  4TVA B;  1E3P A;  3BVM A;  1SXJ C;  1PXU A;  2EE1 A;  1ESR A;  1WTO A;  3NWS A;  3J80 i;  1NHG C;  2Z7J A;  4R71 A;  4JYA M;  2C5C A;  2R4J A;  5DNF A;  1TGU A;  2NBF A;  4LF5 Q;  4BY7 H;  2KA7 A;  1BR9 A;  1AFP A;  1OQY A;  1GM5 A;  2NB0 A;  2VQE L;  1YNN D;  4UHV A;  5I9O A;  1YUB A;  2HUG A;  4DR7 L;  1GUO A;  3E46 A;  1Y1V G;  2A19 A;  2R92 H;  3SMP A;  1CZW A;  2QF7 A;  2OTJ A;  1VG5 A;  1PYW D;  3BDL A;  1DYQ A;  1QVF A;  1J7K A;  5I2Y A;  1VMP A;  5KYI A;  3N52 A;  3HWS A;  1N75 A;  5EBD A;  4X3U A;  4C3I B;  5JI2 E;  4LJZ C;  1JE4 A;  4ODG A;  5KEE A;  5A2Q S;  1PLF A;  4GNX C;  1O7Z A;  4LF6 L;  3Q8G A;  4NW2 A;  2CWB A;  3GRY A;  1Y8G A;  1DCZ A;  5FLM H;  1PH2 A;  1GOZ A;  2CW0 D;  1PFB A;  3F8T A;  1EU3 A;  2KCC A;  3MVV A;  4YWM A;  5C0X H;  4TUW A;  1JE5 A;  4O42 A;  1OFI A;  1NMG A;  1X37 A;  4YY3 M;  2RQX A;  3K0Y A;  5EPL A;  3W0F A;  2ZXR A;  2WSE F;  2H1R A;  3ONA B;  4H44 C;  1SYC A;  4MGK E;  1HNW L;  3HHX A;  3UMM A;  4GKJ Q;  5JVG 3;  3EQL C;  3BS1 A;  2DAM A;  1XHB A;  1XPO A;  4A4I A;  3S2D B;  2B3G A;  2N8N A;  4IBG A;  2KZS A;  4LUZ A;  1Q81 C;  1SNO A;  2K5V A;  4HSP A;  2VUM B;  5JPM C;  3RN5 A;  1IFY A;  4OEL B;  1JWS D;  3PO2 B;  3TME A;  2VNU D;  3GLF B;  1SN8 A;  1IBM Q;  4JV5 Q;  3FTC A;  5BN3 A;  5HUR A;  1S72 A;  4CJ0 B;  2D0P A;  2KNV A;  3MWY W;  3EIE A;  3IAY A;  2QZ4 A;  3HOV B;  3FKI G;  4XTC S;  2K14 A;  3GLI A;  3A54 A;  1CQV A;  1NY4 A;  1MSG A;  3UDF A;  5CV5 A;  5FO9 B;  5E6J A;  1Z5C A;  2AQ2 B;  3M4O B;  1KYI A;  2B2V A;  2CWA A;  3V96 A;  5C3X A;  1EOV A;  2BNK A;  5EQ0 A;  1TY0 A;  2AQ1 B;  4MGH A;  3GPX A;  1SND A;  3L25 A;  4X62 L;  1LT4 D;  4B7F A;  5ITY A;  3MK6 A;  2OXP A;  5AJ3 L;  1E1T A;  3W5O A;  3NTK A;  4IJF A;  1JCK B;  4W5W A;  4B3T M;  2CHG A;  2F0U A;  3I2Z A;  1IN5 A;  3GTL B;  1Q02 A;  4AKH A;  3J80 S;  2MRO B;  1WCM G;  2BWB A;  5IZ7 D;  4KJO A;  1N78 A;  2B2W C;  1OAI A;  2R65 A;  1PH3 A;  2OQ4 A;  1A3T A;  2QIL A;  1VQ4 A;  2F0W A;  3L27 A;  3NBH A;  3QAU A;  1V1P B;  1RCV D;  1QNK A;  5IYC H;  1E24 A;  5A2Q L;  5CV4 A;  4X66 L;  2F3I A;  4IBK A;  4YIJ A;  3LQQ A;  4B3S M;  1IYV A;  2B2Y A;  2WAQ E;  2UXC M;  4G7H C;  5E7N A;  2JEA I;  5M9O A;  3MXU A;  2L7I A;  1SE2 A;  1KSF X;  4K0K M;  1YHB A;  2LHG A;  4A3B G;  3QG1 A;  5KGU A;  3HZJ A;  1JB0 F;  2VL6 A;  1SDF A;  1G29 1;  4IUV A;  3GQ4 A;  1IBK M;  4A3I G;  3I56 A;  2K5Q A;  1Q8I A;  1HQC A;  4LJ6 A;  3ZQJ A;  4LF6 M;  1HFN A;  5M3M H;  2QQ8 A;  4DU9 A;  2QKI C;  3FPU B;  4X64 Q;  3FYC A;  5C18 A;  5C3E H;  1GHK A;  3GLI E;  1IBM L;  4BB9 A;  4FXD A;  2CCZ A;  1Z5A A;  4D80 A;  2EUC A;  1HNZ M;  2B8F A;  4KHV A;  1MN3 A;  1EFI D;  1JJ2 A;  1Z47 A;  4KN4 C;  1C4Q A;  1VQB A;  2VQF M;  4G6Z A;  3S2H H;  1LUZ A;  1UE5 A;  1X3Q A;  2PMZ B;  2K9D A;  2ZAO A;  1NBW A;  1G4A E;  3IHP A;  3FUU A;  4B7H A;  3A46 A;  2CKZ B;  4POF A;  3GPU A;  4BBA A;  3SE0 A;  1Q1E A;  4A3E G;  2K6B A;  1HJP A;  3A8I E;  4DV2 M;  3K7A H;  3FUW A;  3I73 A;  3HOU G;  4B3R M;  1STH A;  2GN5 A;  1S5E D;  2CUZ A;  1GUG A;  2PQA A;  1VDL A;  1F9R A;  1R4Q B;  1Z9F A;  3Q24 A;  2A6H D;  4JI8 Q;  1YI2 A;  1L0X B;  4G4N A;  1BCP B;  1QZM A;  4RHR A;  4LRT A;  3Q8X A;  1N9W A;  4QGU A;  4GKK Q;  1PJS A;  1WCM B;  3BZD B;  4NXN L;  4O1N A;  1EIG A;  3U6D A;  5CV9 A;  3RZO H;  3U9S A;  2B2Y C;  4GOP A;  1KLG D;  2NYZ D;  3MEH A;  8CAT A;  4DAY A;  3HOX G;  1A6X A;  4DV7 M;  4JI5 L;  2ZJQ A;  1VQC A;  3TP8 A;  2RDF A;  1FGB D;  1I6H B;  3R8B A;  2UXC L;  1XNQ Q;  4K0K L;  3RD4 A;  3KSJ A;  2Z4H A;  4KLK A;  4DUZ L;  4DV0 M;  4BLC A;  2D9U A;  3U6C A;  4A3M B;  1XNQ M;  1X9N A;  1N77 A;  3EIH A;  3C1E A;  3GLG A;  2F0D A;  3CF6 E;  4JI2 Q;  5E4X A;  5KYL A;  1XPU A;  2BDN A;  3I72 A;  1GKH A;  2HIV A;  1PTO D;  2DNE A;  3EN2 A;  2RDH A;  4Y28 F;  2ZM6 M;  5F3W A;  4JI6 M;  4A3C H;  2A6E D;  3A98 B;  2DGY A;  4IAL A;  1WTX A;  4YCV A;  3LCV B;  3W0L B;  2E5L M;  2R93 G;  1VQ7 A;  5KPR A;  4A93 H;  3J27 B;  3G4S A;  2LVN C;  3MA2 B;  1BQQ T;  4HN7 A;  4KTA A;  3U6M A;  1XMQ Q;  3TQY A;  3SEB A;  1BUV T;  1WFQ A;  1S5F D;  5IP7 G;  4DR4 M;  1K3X A;  3F2U A;  2YYZ A;  3S15 H;  1NSN S;  1X3F A;  3PSI A;  4ID6 A;  4DNI A;  1QVR A;  2CV1 A;  2IJ0 A;  3GTO H;  1CT1 D;  3ND8 A;  4JC0 A;  1ET6 A;  1HPC A;  1TXY A; 
#chains in the Genus database with same CATH homology
 2LMC B;  2Q8R E;  5C5M A;  1MU5 A;  2EYF A;  1PTO B;  5LHY 1;  2RGH A;  4PNY A;  4DXG A;  1TH2 A;  3HU1 A;  4I5S A;  1LV7 A;  4B08 A;  5ELF A;  1WTR A;  3VFD A;  1MBY A;  3DMU A;  1NHW C;  1SAP A;  1ZQ9 A;  3J7A S;  3I8Z A;  3IFT A;  4KY5 A;  4K5V A;  1ESF A;  2BOS A;  4V19 0;  2DHR A;  2WAQ B;  4BY1 B;  3M0E A;  1EY7 A;  3VKG A;  5EGT A;  2D7G A;  2KVM A;  4XQN A;  4ILW A;  4KOD A;  4A3V B;  4NXN M;  5A35 A;  3PNY A;  4IJE A;  2IT1 A;  4FO2 A;  3K7A B;  2L0C A;  3X3M A;  4IBD A;  3SAT A;  3PO3 B;  1K82 A;  3J81 S;  2HCB A;  4DR7 M;  4XGI A;  3KOW E;  3B9P A;  4CKB A;  1D1K A;  1TII D;  4ZKC B;  3GTJ B;  3TP5 A;  1GUT A;  1X3P A;  2PQE A;  3FUX A;  4BS9 A;  2X69 A;  3CRL C;  4MIU A;  5EXT A;  1PM5 A;  1KLU D;  2H1E A;  5CR3 A;  1U4L A;  2EVB A;  2PO4 A;  3TZD A;  4FF4 A;  2KUM A;  3FYD A;  2JE6 I;  3TE6 A;  1ZYR C;  1NR2 A;  3SMS A;  5EP3 A;  5D65 A;  1LTS D;  3RMH A;  2XSZ D;  2QBY B;  2UUA M;  1VMC A;  5IT9 L;  5G3L F;  2EYP A;  3C3L A;  4Z6Y A;  2CQA A;  3A56 A;  2VXW A;  3PFI A;  4DUY M;  1PZJ D;  2Q8T A;  1QAN A;  3RGP A;  3ILK A;  4B3M M;  4M8A A;  3KFU G;  4LFB M;  4QB4 A;  1E2W A;  1Z6H A;  4ZRZ A;  3SHG B;  1DGG A;  2FMC A;  5ITQ A;  5H37 D;  2NUC A;  4ZLT F;  3Q6S A;  3MJ5 A;  3K59 A;  3OTO M;  3PUX A;  4GZY C;  2X4A A;  3ND9 A;  1OXX K;  1IM2 A;  1HUM A;  3SAU A;  3H4M A;  4AI6 A;  2F4I A;  2KEE A;  4LK1 C;  1H9S B;  5IGE A;  3IFD A;  4JI4 M;  4D81 A;  1EYC A;  2FE8 A;  2BA0 A;  1XWI A;  1Z5B A;  3L9A X;  2NZ1 D;  4DFA A;  5EKI A;  2RBM A;  1I50 B;  2A69 D;  1IYU A;  3IG8 A;  1H9R A;  4HMI A;  3SVM A;  1MI2 A;  4AYB B;  1I94 M;  1XNR M;  4IUR A;  2CVR A;  3V2T A;  1Y8P B;  4DNR B;  3TWM A;  2K05 A;  1N34 M;  1D5Z C;  2DY8 A;  2JA2 A;  2LY7 A;  4CKE A;  4HMJ A;  2J4X A;  2M5Z A;  1XXG A;  1SNQ A;  4K2K A;  2KOL A;  2J7O A;  1BCP D;  2WII B;  1SNP A;  1TS3 A;  1BF4 A;  1KTK A;  4P16 A;  3K5L A;  3C46 A;  3AB9 A;  1JOQ A;  3I4N B;  4X64 M;  4GMQ A;  1QCB D;  4IFD G;  4D82 A;  3M7N A;  1EY9 A;  2EO2 A;  1HA5 A;  3TP7 A;  1K3W A;  4BA1 I;  3FD9 A;  5EXX A;  4LF7 M;  2DWN A;  2F0K A;  1QG7 A;  1BBX C;  2CEA A;  2DVW B;  4XQQ A;  1TVX A;  2WKC A;  3I4L A;  3FRP B;  5BN5 A;  3FTD A;  4FP5 D;  2A6E C;  4LF4 M;  4DR6 M;  3R9X B;  3GTG B;  4DK0 A;  1CI3 M;  1PJJ A;  1HXY D;  2A69 C;  1DJR D;  1NVM A;  4L63 B;  4IFD J;  1DXM A;  2ZXP A;  4KJN A;  5CMD A;  4MGY E;  2FFK B;  1E2Z A;  1B4O A;  1YNN C;  1F2M A;  1HNX M;  1WTV A;  3K5O A;  2LS0 1;  3H94 A;  2EJF C;  4QNM A;  1J5E M;  5I6W A;  4DGZ A;  4Q0F A;  3MFG A;  1BCP C;  2IX0 A;  3MXN A;  1JR3 A;  1QIL A;  3T15 A;  5ITX E;  4X62 M;  3QWN A;  3BDO A;  1ICW A;  1TH4 A;  2RVL A;  3D6W A;  3SAS A;  2L09 A;  2EY2 A;  4NSR A;  4RCO A;  3OWE B;  2E75 C;  1GXD C;  3AFH A;  2WV6 D;  4ZKB B;  4EQO A;  4WW0 A;  1PFN A;  2VII A;  1SBB B;  4OIK A;  2JA7 B;  1G2T A;  4F8M A;  4LGM A;  1PDQ A;  4OL7 A;  2A5H A;  1UM8 A;  1RHP A;  4HR7 B;  2WP8 J;  2NVQ B;  3EJI A;  5K36 H;  1WD0 A;  3DOA A;  3L28 A;  3DM1 A;  3I90 A;  3MTS A;  3T56 B;  4FF1 A;  1NY5 A;  5ELC A;  4FF3 A;  5KPT A;  1G2S A;  4ZPX A;  3WHK A;  3HZX A;  3KOY E;  1I4R A;  1JR0 D;  4IFD I;  2AHM A;  1LTR D;  5FTM A;  2R92 B;  4LF9 M;  3AL0 C;  2XWJ B;  4JXJ A;  1BOS A;  2L9H A;  2PW5 A;  2F0Q A;  3U6P A;  4M0W A;  1JWU D;  1DON A;  1PFM A;  1ILP A;  1K8O A;  1DGF A;  2DZN B;  2BE5 D;  4IN3 A;  4XYO A;  4L78 A;  1A3U A;  4XQJ A;  1B53 A;  1CA6 A;  1IXZ A;  2X8A A;  1EZ6 A;  1BXT A;  2L11 A;  4IFD H;  1STG A;  4KN7 C;  3I51 A;  1V8Q A;  4FWD A;  3SFZ A;  2Z4I A;  3NXW A;  3L3O C;  4DA2 A;  3ITP A;  4QMG A;  3NHH A;  4BA2 I;  4OX9 M;  2FIN B;  3VR5 A;  2L5T A;  1ENA A;  3U60 A;  4OO1 I;  1II3 A;  1Y1W B;  5T1G A;  5KQ8 A;  3DXJ C;  4DF7 A;  3MHV C;  2F1M A;  5IGB A;  4BWG B;  4K6L A;  2JA8 B;  3D3R A;  4DR2 M;  3TL4 X;  4MH0 E;  3HKZ B;  2L12 A;  4DN4 M;  1ENF A;  2XNA C;  1QOH A;  1F9P A;  1YNJ D;  1HUN A;  1EEF D;  3M7G A;  1H6U A;  3H0G B;  1LTA D;  4M9S A;  2A74 C;  4IBC A;  2BJV A;  2KEB A;  5IT9 E;  4C56 C;  1I3Q B;  2G8L A;  2XGN A;  4CGY B;  4HCS A;  3L7Z C;  2XRS D;  4KV6 A;  3HJS A;  2R45 A;  4LZJ A;  1I4H A;  2BE5 C;  3A8K E;  5HGT A;  1PRT B;  3U61 B;  5JAV A;  3H3V C;  3FEW X;  5FLX E;  4IUQ A;  2RDG A;  4XT3 B;  3VDU A;  1G59 A;  3SAV A;  1W5T A;  1CQF A;  3D31 A;  5K5P A;  2K33 A;  3KBX A;  4QIW B;  1ROD A;  2QP9 X;  3H91 A;  3K6O A;  2EYM A;  1JOK A;  1PTO C;  2BA1 A;  3TPZ A;  3FKE A;  4U68 A;  2E2J B;  4JK1 C;  2ZT9 C;  3D4W A;  1LT3 D;  1TY2 A;  5IGD A;  1HNW M;  3M85 A;  3SAR A;  2DWL A;  3GTO B;  2F5P A;  1F2Z A;  2XIW A;  2ZAM A;  2B39 A;  1I4P A;  1QNU A;  3GLH A;  2YFQ A;  3NWL A;  3FUT A;  1PTO H;  3DFZ A;  5DM6 3;  3HU2 A;  4LCB A;  3MAQ A;  3U6S A;  1F9Q A;  4X65 M;  3FTF A;  1L2D A;  3VYR A;  5KIX A;  3NK9 A;  2D62 A;  4A3K B;  3K2L A;  4NMZ A;  2M2L A;  4XDX A;  1SFO B;  2L7H A;  2KXE A;  2F0L A;  2XFS A;  2R62 A;  2F0G A;  2C99 A;  5J22 A;  2DN8 A;  3QOL A;  2NN6 G;  3DWP A;  2K5W A;  3J7A F;  3GLH B;  3PIO 3;  4RGT A;  1DGH B;  4JI5 M;  5FTL A;  4ZAI A;  3D8B A;  2XRQ D;  4PV1 C;  1HT1 E;  1G6Z A;  2YNM D;  4I65 A;  2E74 C;  1ET9 A;  2F0T A;  1IKL A;  4IBI A;  3HHZ A;  5J1Z A;  5JJZ A;  2UUB M;  4IUP A;  2Z4S A;  1ORY B;  1DOM A;  4RAU C;  2NVX B;  3U6O A;  3LX0 A;  4L16 A;  2LNH C;  2V4D A;  5CYU A;  1EEI D;  4A3B B;  5COY A;  3FMC A;  5I6Y A;  4Z8X A;  1YSY A;  4Q5V A;  1STB A;  2R18 A;  3U6L A;  4IQZ A;  4FYD A;  1G3I A;  4AZF A;  3BDC A;  1L2B A;  4NRV A;  3VDP A;  3KLR A;  2EXZ A;  4TSS A;  1XXH A;  5JVH 3;  1DZ1 A;  5KNB A;  2MJ8 A;  3KK7 A;  3AKZ A;  1IBM M;  5EP1 A;  1CHQ D;  4I4L A;  3KOX E;  4LMQ D;  5A2Q E;  2EJG C;  3EFX D;  3SXH A;  2BJW A;  1BCP F;  4PDI A;  4DAP A;  4WRD A;  4LGY A;  1SYD A;  4PQX A;  5JEA H;  3SHF A;  1T5X D;  4IBF A;  5EP2 A;  2A68 C;  2AQ3 B;  4XXE A;  5FOB B;  1EZ8 A;  4PCZ A;  3E5S A;  3CU7 A;  1FNW A;  3SAW A;  4CIS A;  1BO0 A;  1HQM C;  5CGK A;  1NUC A;  1W6K A;  4KHZ A;  1E0B A;  5C44 B;  1PRT C;  3AOE C;  1H9S A;  2JXM B;  3ZYY X;  1AEX A;  1DOL A;  2K7V A;  3T38 A;  3E0J A;  2CHV A;  4KKU A;  4HCE A;  3PVS A;  1IN8 A;  1EWH A;  2Z4R A;  3GRU A;  2F5Q A;  1H9M A;  2JA5 B;  1GL7 A;  2I07 B;  3KVW A;  3HGI A;  1EU4 A;  2M9V A;  3TP6 A;  1EY0 A;  3S9W A;  3LMM A;  3HOU B;  4PT5 A;  3ZCB B;  1ZXT A;  3GPP A;  3T4A C;  2MUY A;  4IUT A;  4K5W A;  1KFV A;  3I70 A;  2Z1C A;  1TWA B;  2EY6 A;  1IQP A;  1D2N A;  2KEC A;  3T13 A;  1D1I A;  3KUP A;  1SNM A;  2QCP X;  1AP0 A;  2UUC M;  2A6H C;  3D8G A;  1E9S A;  1B9N A;  1QB5 D;  1A2U A;  2K03 A;  1NNJ A;  3HHY A;  1EQV A;  4H13 C;  5CV8 A;  2F0S A;  2F0F A;  1CA5 A;  3VKH A;  5KRU A;  2AWO A;  1N33 M;  3HU3 A;  4R3D A;  4RKB A;  2YR0 A;  3GPY A;  3LWE A;  4LY6 A;  4R8N A;  4HAE A;  4R9W A;  3E6Z X;  2IX3 A;  1KDA A;  4IBE A;  1HFG A;  4LAA A;  3M4Y A;  2NWG A;  4MN3 A;  1STA A;  3R2T A;  4UAI A;  1EQT A;  4FXG C;  1EYD A;  1SYF A;  2KJX A;  2B2T C;  3C58 A;  1L1Z A;  2L55 A;  3S14 B;  3TBI B;  1T5E A;  1A2T A;  2QEN A;  4FWH A;  4HLQ A;  1ZAE A;  4JI2 M;  4FCT A;  1FNV A;  2PZT A;  4L6T B;  2D2C C;  5JPN C;  3FVQ A;  4J1M A;  5M5X B;  1NJG A;  2PNR C;  4C3J B;  2B8G A;  2EPB A;  4N9P A;  4CJ2 C;  2HDM A;  2CV2 A;  4E6I A;  2HKJ A;  4DV4 M;  4X3T A;  1I4Q A;  1NNU C;  2XWB B;  2OT2 A;  4OW0 A;  4IBJ A;  3K92 A;  5DYG A;  1TDH A;  1R9T B;  4GIT A;  1UNS A;  3QJY A;  2O2L D;  3VYT A;  4NDX A;  1LAB A;  3GQB A;  5NUC A;  1EY6 A;  4AKI A;  4AW4 A;  2F0V A;  1J8I A;  1SNC A;  4ABN A;  1TS4 A;  2R4E A;  7CAT A;  3OMC A;  2MHV A;  3GTP B;  1ZEQ X;  5ITU A;  1HQY E;  5M3F B;  2BCO A;  4DK1 A;  3UZU A;  1Y1V B;  5C3W A;  3U5Z B;  1XTC D;  3KXE C;  3SYL A;  5GKN A;  2HDL A;  1FNU A;  4G7O C;  2F3V A;  2C98 A;  2XFT A;  1G8P A;  3S1N B;  2F0P A;  3FKI B;  5M3M B;  5BPV A;  1OXU A;  2XSC A;  4G4Q A;  5JEA J;  4WOR A;  2SNS A;  2HHH M;  2I7N A;  2KZU A;  2ZBK B;  3PUZ A;  1E94 E;  1ILQ A;  1H9J A;  3P20 A;  1RTN A;  2FJ2 A;  5IT9 S;  1Y8N B;  2C5R A;  4KY6 A;  2CHB D;  2KW0 A;  3A8J E;  2PPB C;  2ERC A;  4FCW A;  4RNA A;  1NCV A;  3KP1 E;  2TMP A;  2ICI A;  3OOC A;  3GLG B;  1NJF A;  1WTQ A;  4MGI E;  2CFO A;  3NTH A;  4DV1 M;  5EJC A;  2K04 A;  2RGO A;  3TZU A;  1W6J A;  2QEJ C;  1RJT A;  4M1U B;  4YHH M;  5JEA G;  1GVN A;  1Q39 A;  2R46 A;  4C2M B;  3I3C A;  4G4R A;  1D2B A;  1LTG D;  1CZG A;  3AU7 A;  4OVZ B;  3AMU A;  3D4R A;  1DO0 A;  3KDS E;  1JWM D;  3DEO A;  4OVZ A;  3GTM B;  1KAB A;  1Y69 U;  2WIN B;  1HT2 E;  3K1J A;  4X3K A;  4LFA M;  3KF8 A;  1CTM A;  3ZC7 B;  1E9R A;  4KLN A;  3GRR A;  4KHP M;  4KD4 A;  1GUS A;  3KBG A;  2NVT B;  1KNE A;  4N9T A;  3CF2 A;  3I91 A;  4K5X A;  4II7 A;  3RUZ A;  1EWC A;  1I4W A;  4LJ5 A;  2XN9 C;  1D6E C;  2F5O A;  1UUP A;  3K5N A;  2X6G A;  4NXM M;  3N6R A;  4GRI A;  3BVZ A;  1V43 A;  5E26 A;  1Z59 A;  2SEB D;  3S15 B;  4BY7 B;  1IW7 C;  1EY8 A;  1YE9 A;  5ITX A;  4KKT A;  4F87 A;  3WOF A;  1SSO A;  2FMM A;  2R7Z B;  2OPF A;  3C2P A;  1IY2 A;  5C6A A;  2CE7 A;  1OXV A;  5C5L A;  2JP1 A;  2XVS A;  4DR5 M;  3HHW A;  1DM0 B;  1TDZ A;  3LNN A;  4G4O A;  3NE5 B;  4U67 3;  4OO1 G;  3U6Q A;  4REZ A;  3GV6 A;  3QO2 A;  1C1K A;  3LVV A;  4DV6 M;  3S1M B;  1IY0 A;  2EYL A;  3U5Z A;  3I4Y A;  3BVG A;  4MGZ E;  4F7X A;  1EY5 A;  1CHP D;  2F5S A;  5EQT A;  1OJL A;  3I4M B;  2IX1 A;  3A55 A;  1LT5 D;  3FUV A;  3TDQ A;  5C0X I;  1STE A;  2N88 A;  1JB3 A;  5FSW A;  3HOZ B;  5F2D A;  4V0B A;  2TSS A;  4QHS A;  4PMB A;  5C4Z A;  4C3I G;  1QJO A;  3MHB A;  1Z7T A;  1XXH B;  5IOC A;  4QUF A;  3V05 A;  1SXJ A;  4OIJ A;  2Y0Q A;  2XLJ A;  5DNY A;  3WOE A;  1QAO A;  3KS8 A;  2P5T A;  1EYA A;  2JYO A;  4CJ1 B;  3IL8 A;  1Q90 A;  1KAA A;  2K6A A;  3TWL A;  3D8L A;  3Q0A A;  1LTI D;  2F0M A;  2PCF B;  4JI1 M;  3FTE A;  2O5R A;  3KLS X;  5I2X A;  4ZUJ A;  2G9D A;  1DGH A;  1B9M A;  3P75 A;  4JI8 M;  2X6L A;  2G9H D;  1LLR D;  5IGF A;  5ISR A;  4GHA A;  2KHS A;  2XEP A;  1EY4 A;  5J39 A;  3OPO A;  1GJX A;  2LXE A;  1VDZ A;  3UGJ A;  3SC3 A;  2NTT A;  2V1U A;  2IW3 A;  3D6C A;  3J2P B;  1C8C A;  4S3S A;  3DZD A;  1SXJ E;  2Y21 A;  2FNA A;  4GC9 A;  4HTH A;  1BNZ A;  4HL4 A;  2L1B A;  3QOJ A;  3HJ8 A;  4JBW A;  3URY A;  1AN8 A;  2EDG A;  2R61 A;  3T51 B;  1C48 A;  2AUJ D;  1WVL A;  3QIA A;  4QHT A;  3NPP A;  2BDO A;  4J6H A;  2KRU A;  4ZQ3 A;  2F0H A;  1ML0 D;  4PMC A;  4FW9 A;  4FWG A;  1HCZ A;  3U61 A;  4OO1 H;  1GLN A;  2XSZ A;  2E2D C;  4RGM A;  2A5Y B;  2K5D A;  3LWU A;  3MZ5 A;  3K5M A;  3PUV A;  4FVM A;  1Q1B A;  1Q3L A;  3MC0 B;  4J8Q A;  2Q8I B;  2VB3 X;  2J7N A;  3T1Y M;  3RE8 A;  4GH9 A;  1STN A;  4RA8 A;  5E3F A;  2EYO A;  1F9S A;  4RHS A;  5LL6 X;  1VCI A;  1HQR D;  1HA6 A;  1XYI A;  4OHJ A;  4Y7N B;  4FD2 A;  4RGN A;  2KRK A;  1TKW B;  3VYS A;  3PV0 A;  3K8Z A;  1SJH D;  2VB2 X;  3VA7 A;  5EP4 A;  2A68 D;  1L2C A;  1PJI A;  1B2T A;  3GQ3 A;  4MB7 A;  3VR4 A;  1PRT D;  2V6Z M;  4OU7 A;  4IBB A;  2NVY B;  4LFC M;  1TWF B;  3UI2 A;  2KED A;  4EVO A;  4C3H G;  1XX8 A;  5C4X B;  3DWQ A;  3PIP 3;  4KI0 A;  4C1N I;  5CC4 A;  4KK7 A;  1Q3B A;  1OO9 B;  4M0D A;  4TRD A;  2OF1 A;  2ICE C;  3GP7 A;  3KLS A;  4AKG A;  3BYT B;  5CBA E;  3OW7 A;  4DUZ M;  4DV3 M;  1HTP A;  2MP1 A;  4KMU C;  4WUR A;  1F2L A;  3GP1 A;  1GUN A;  1SXT A;  1S5C D;  1HTL D;  1ONL A;  2WAC A;  4CKC A;  3A45 A;  2R93 B;  4AG6 A;  5ELD A;  1SYB A;  1IBL M;  1J09 A;  3R93 A;  1XC8 A;  1FJG M;  3AJI B;  5LMU M;  3ERO A;  2L4N A;  4JN6 A;  2R3Z A;  1GUW A;  1V1O A;  4H7B A;  2DY7 A;  2ID0 A;  2LFN A;  1B44 D;  2W82 A;  1O7L A;  4NP5 A;  4EQP A;  3J7B A;  2JA6 B;  1AZQ A;  4GC5 A;  4K14 A;  1PMR A;  5IGC A;  1O80 A;  2HCI A;  5BN4 A;  1W5S A;  2E76 C;  4QNR A;  1MSH A;  1QQW A;  3CQZ B;  4FXK C;  3SR1 A;  5FLX S;  2F03 A;  1R4P B;  4I81 A;  1QAM A;  1BDO A;  2CV0 A;  1B1Z A;  3GLI B;  3RFW A;  4AG5 A;  3PUY A;  4A3F B;  3BG3 A;  3HJQ A;  4Z9C B;  2ENB A;  3S16 B;  4ME5 A;  4A3J B;  2Y20 A;  2EY5 A;  2NN6 H;  1TU2 B;  4C3H B;  1U4P A;  3E9S A;  1QAQ A;  2I46 A;  2QDB A;  1CFM A;  4K6D A;  4FNF A;  3TSS A;  4OGQ C;  3T1H M;  5FO8 B;  2EYJ A;  2G5G X;  4X3S A;  3S1Q B;  3THG A;  3NBI A;  4DAV A;  1SMY C;  3L26 A;  3HOY B;  2AUK A;  1IN7 A;  4LJ8 A;  2F4V M;  3HRZ C;  5EXP A;  1WTP A;  4TKO B;  4QUC A;  3HG9 A;  4JI0 M;  5FO7 B;  3J81 E;  1TWC B;  3VK8 A;  4G57 A;  5IIF A;  3KOZ E;  1RF2 D;  1G8Z D;  2EZV A;  2K01 A;  5K36 G;  2O5I C;  1S5B D;  4LRS A;  3SK6 A;  3FDT A;  4LJ4 A;  5COR A;  3NUC A;  1WD1 A;  4LJ9 A;  1STY A;  2SOB A;  3SHL A;  5KPZ A;  2KQ3 A;  3HOX B;  1FNN A;  3NQT A;  4GHL A;  3OIQ A;  4G4K A;  1A3V A;  2F0I A;  3IG5 A;  3C1F A;  4K8J A;  1IXS B;  3SYK A;  5D14 A;  3AOG A;  3KS4 A;  4LJ7 A;  2HQE A;  2EYH A;  4HSV A;  4B9X A;  4FF2 A;  1GKI A;  4KO8 A;  3JAM S;  3RGS A;  5KND A;  2DNC A;  3PXG A;  1K8M A;  4AQY M;  3NP8 A;  4LF5 M;  2PYK A;  3DEP A;  1MX0 A;  1JC7 A;  5DM7 3;  1OFH A;  4XIG S;  5TSS A;  4LZZ A;  4C1N K;  5C1B A;  1JOR A;  1V1P A;  5IRE B;  1SXJ B;  5E1F A;  4A93 B;  1JQY D;  1LO5 D;  4HED A;  1DO2 A;  3J80 E;  3P7J A;  5FKA C;  4LJA A;  4NL4 H;  5FLX L;  4IUN A;  3IKJ A;  1I6V C;  4NKL A;  1B50 A;  1IXR C;  4RWS C;  4QCL A;  5EPJ A;  3S2H B;  3HP3 A;  1IN6 A;  4QOZ C;  1TWG B;  1ENC A;  1Q12 A;  4RKL A;  1O7Y A;  2B2U C;  4CHT B;  1KNA A;  4X66 M;  3GV3 A;  2UXD M;  3NWT A;  1QYR A;  4A3D B;  3GLF A;  2ZAN A;  1N36 M;  2K32 A;  3SK5 A;  3U9O A;  4A3I B;  3OHX C;  2SDF A;  4KY7 A;  2PZW A;  4K8I A;  2F3W A;  4RH6 A;  5FTK A;  4MM3 B;  1SYE A;  1RDP D;  3J81 L;  3GTQ B;  5IGG A;  3VR6 A;  2M60 A;  1DGB A;  2IPK D;  4K2L A;  4ITQ A;  1Y8O B;  4WJW A;  1LV9 A;  3DWA A;  1R2Z A;  1WTW A;  2XH9 A;  4PMW A;  3M6A A;  5ITR A;  2F0J A;  5KQD A;  1FD7 D;  1EIH A;  4DXF A;  3W3A A;  2RKO A;  5T1I A;  2X49 A;  1RD9 D;  3JR5 A;  1I4G A;  1SJE D;  1SEB D;  1EL0 A;  4I8O A;  1TR5 A;  3OIP A;  3CTW B;  4ULL A;  3HGB A;  4RGO S;  1T3T A;  5E4W C;  2E2I B;  2D7E A;  5EBC A;  1PZI D;  1LTT D;  5EJW A;  1IHZ A;  3H09 A;  5C3E B;  3R3O A;  3R8F A;  2K28 A;  2F5N A;  5M5Y B;  5FTJ A;  2Y0T A;  5ITT A;  1S3S A;  4M9Z A;  5D3D A;  5DYI A;  1GL6 A;  1J9O A;  1TS2 A;  4GIP A;  5M5W B;  1U4R A;  3KW6 A;  2FFJ A;  3AV0 A;  1Z6T A;  3GD7 A;  3L29 A;  3BYY B;  3X3N A;  4R7G A;  1O78 A;  2JSO A;  3U6E A;  1UAP A;  3A7A B;  2O4X A;  1TT2 A;  3PNV A;  2LWX A;  4IUU A;  1WXQ A;  2C96 A;  3DUZ A;  2LH0 A;  3L2A A;  3G6J B;  5FK9 C;  1R2Y A;  1D5X C;  3HKP A;  3BOS A;  4NOO B;  3NTI A;  4P2C B;  2J0T D;  4XT1 B;  3OSO A;  1IL8 A;  3RZO B;  5D3I B;  1B3A A;  3CKI B;  4EGV A;  2C9O A;  1HRJ A;  4L4U A;  1KDB A;  2FOI C;  2LKV A;  3VR3 A;  4H0L C;  4DV5 M;  2L6O A;  1PZK D;  5JOB A;  1MD2 D;  2KA6 B;  2RSN A;  1EOT A;  1L0Y B;  3AOE A;  3TWK A;  2YU9 B;  4A3E B;  4RCN A;  3I4V A;  2Z3X A;  1UEA B;  2CW0 C;  3K57 A;  1VF5 C;  5C4H A;  2UXB M;  5CV6 A;  4F88 A;  2ZXO A;  3KSX A;  1CM9 A;  4LG2 A;  1PRT F;  5LMN M;  5KO3 A;  4RFB A;  1AW7 A;  4ZYS A;  5ELB A;  4MHE A;  1EE8 A;  5FTN A;  3VK7 A;  2F0E A;  5EXS A;  2WKD A;  3GTK B;  4QOS A;  4IIW A;  2QCU A;  3A7L A;  3OWF A;  4GKJ M;  4KKS A;  3RZD B;  4M9X A;  4JV5 M;  3U60 B;  4B7G A;  4JI7 M;  1DOK A;  3ERQ A;  1R7R A;  2D5D A;  1VF7 A;  4C3J G;  1N32 M;  1OXS C;  4L8R C;  2PW7 A;  3NQI A;  2DZO B;  4DR1 M;  2Z8L A;  1TS5 A;  5LL6 S;  5DEH A;  2E2H B;  3HS0 C;  2M00 A;  1XMO M;  3E4R A;  1MGS A;  3QWL A;  1XMQ M;  1U9R A;  3KP0 E;  3A42 A;  3M3Y B;  4B9W A;  3LVW A;  1OXT A;  5KNC A;  2B2T A;  2YQZ A;  4DR3 M;  2SNM A;  1IN4 A;  2QBY A;  4FCV A;  1K83 B;  2F0O A;  5IWA M;  3TN2 A;  1SYG A;  3Q22 A;  2Y0S B;  2C9C A;  3OMG A;  5IOD A;  5C0X G;  1IKM A;  3LQR A;  1JR3 D;  2AWN A;  2D7H A;  1A15 A;  3CHB D;  2DWM A;  2B63 B;  3D4D A;  2NQ8 C;  1S4Z A;  3UJN A;  5ELE A;  3GRV A;  4R8I A;  1PTO F;  1TWH B;  2PZU A;  3T16 A;  3J7A V;  2B2W A;  5DAU A;  1QE6 A;  2QPA A;  3PUW A;  3S1R B;  1M8A A;  2OEO A;  3QB3 A;  4PDG A;  2K1B A;  1G41 A;  4JI3 M;  5JI3 E;  3JAM L;  2H4O A;  1E2V A;  4RF1 A;  2J7Z A;  1ZYR D;  3MFY A;  3O13 A;  2R6G A;  1IW7 D;  4L15 A;  1KDC A;  3EA6 A;  3GO8 A;  1R6B X;  4EQN A;  1NR4 A;  1F77 A;  2Q2E B;  2NTS A;  1JIC A;  5C0X J;  2CHQ A;  4BBR B;  3SDZ A;  1LAC A;  2DWZ B;  2V1C A;  4PD2 A;  3GQ5 A;  4S12 A;  1S5D D;  1AZP A;  3W2D A;  5CBE E;  4TQU S;  2UU9 M;  1NSF A;  1HHV A;  1VDD A;  3SK8 A;  4UDU C;  1E32 A;  3R2I A;  3H6M A;  2WB1 B;  1JQJ C;  4GKK M;  3CRK C;  4DNT B;  1CK1 A;  1TQO A;  5I4D A;  2N55 A;  2RSO A;  2VQE M;  3S17 B;  1RTO A;  4XBO A;  3TQS A;  3P1H A;  3VA5 A;  2XZU A;  2F0N A;  4ZK9 B;  2EJM A;  2MPM A;  2XF3 A;  2RA4 A;  1X32 A;  1F2Y A;  1M4V A;  5I9P A;  2GA4 B;  4EIW A;  1XWE A;  1SXJ D;  5CV7 A;  1G91 A;  3PMF A;  1D5M C;  1U4M A;  2EA0 A;  3J80 L;  5EKL A;  1IY1 A;  3RLF A;  4LF8 M;  1TH3 A;  2A73 B;  1QWY A;  1LTB D;  2MGS A;  3Q23 A;  1DD2 A;  3SBJ A;  5EPK A;  3VYU A;  3EVQ A;  4G7Z C;  2EY1 A;  3CF0 A;  1L1T A;  3MXG A;  2FHT A;  3JR4 A;  2XZF A;  3HOW B;  2I7P A;  4IZ8 A;  3HEJ A;  1YNJ C;  4L8J A;  3DA1 A;  4ZUI A;  3ZH9 B;  1FR3 A;  3GO5 A;  3WDN A;  4XYQ A;  1NAP A;  4NSO B;  1FYC A;  4I7Z C;  2EOT A;  2O5J C;  4WFN 3;  3J7Y W;  1I4X A;  2RKS A;  3VLF B;  3DHQ A;  3MXP A;  1SE4 A;  2NN6 I;  1ZKO A;  3FPP A;  4BBS B;  2B2U A;  1RKN A;  1LT6 D;  2JEB I;  3G7L A;  1Q3C A;  2IWH A;  1H9K A;  2HL7 A;  1HR0 M;  2HCC A;  3UK6 A;  3NSW A;  3VR2 A;  2B2V C;  1GHJ A;  1SE3 A;  5BR8 M;  5G3L D;  3T53 B;  3JAM E;  2DXI A;  1SMY D;  5EKK A;  1JOO A;  2KCN A;  1L8Q A;  3WHL A;  3K58 A;  4QF4 A;  3SK4 A;  2IL8 A;  5AFW A;  5C4J B;  2K47 A;  1NY6 A;  4RF0 A;  4KD3 A;  4NRW A;  3BVM A;  1SXJ C;  1PXU A;  2EE1 A;  1ESR A;  1WTO A;  3NWS A;  1NHG C;  2Z7J A;  4JYA M;  2C5C A;  2R4J A;  5DNF A;  1TGU A;  2NBF A;  2KA7 A;  1BR9 A;  1AFP A;  2NB0 A;  1YNN D;  5I9O A;  1YUB A;  2HUG A;  1GUO A;  3SMP A;  1CZW A;  2QF7 A;  1PYW D;  3BDL A;  1DYQ A;  1J7K A;  5I2Y A;  1VMP A;  5KYI A;  3N52 A;  3HWS A;  1N75 A;  5EBD A;  4X3U A;  4C3I B;  5JI2 E;  4LJZ C;  1JE4 A;  4ODG A;  5KEE A;  5A2Q S;  1PLF A;  1O7Z A;  4NW2 A;  3GRY A;  1DCZ A;  1GOZ A;  2CW0 D;  1PFB A;  1EU3 A;  2KCC A;  3MVV A;  5C0X H;  4TUW A;  4O42 A;  1OFI A;  2RQX A;  1X37 A;  4YY3 M;  3K0Y A;  5EPL A;  3W0F A;  2ZXR A;  2H1R A;  3ONA B;  4H44 C;  1SYC A;  4MGK E;  3HHX A;  3UMM A;  5JVG 3;  3EQL C;  3BS1 A;  1XHB A;  3S2D B;  4IBG A;  2KZS A;  1SNO A;  4HSP A;  2VUM B;  5JPM C;  1JWS D;  3PO2 B;  3TME A;  2VNU D;  3GLF B;  3FTC A;  5BN3 A;  5HUR A;  4CJ0 B;  3MWY W;  3EIE A;  3IAY A;  2QZ4 A;  3HOV B;  4A3G B;  4XTC S;  3GLI A;  3A54 A;  1CQV A;  5FO9 B;  1MSG A;  5CV5 A;  5E6J A;  1Z5C A;  2AQ2 B;  3M4O B;  1KYI A;  2B2V A;  3V96 A;  5C3X A;  2BNK A;  5EQ0 A;  1TY0 A;  2AQ1 B;  4MGH A;  3GPX A;  1SND A;  3L25 A;  1LT4 D;  4B7F A;  2OXP A;  3MK6 A;  5ITY A;  3NTK A;  4IJF A;  1JCK B;  4W5W A;  4B3T M;  2CHG A;  2F0U A;  3GTL B;  1IN5 A;  4AKH A;  3J80 S;  5IZ7 D;  4KJO A;  1N78 A;  2B2W C;  2R65 A;  2OQ4 A;  1A3T A;  2QIL A;  2F0W A;  3L27 A;  3NBH A;  3QAU A;  1V1P B;  1RCV D;  1QNK A;  5A2Q L;  5CV4 A;  4IBK A;  4YIJ A;  3LQQ A;  4B3S M;  1IYV A;  2B2Y A;  2UXC M;  4G7H C;  2JEA I;  5M9O A;  3MXU A;  2L7I A;  1SE2 A;  1KSF X;  4K0K M;  3QG1 A;  5KGU A;  1SDF A;  1G29 1;  4IUV A;  3GQ4 A;  1IBK M;  1HFN A;  2K5Q A;  1Q8I A;  1HQC A;  4LJ6 A;  4LF6 M;  4DU9 A;  2QKI C;  3FPU B;  3FYC A;  5C18 A;  1GHK A;  4BB9 A;  4FXD A;  1Z5A A;  4D80 A;  2EUC A;  1HNZ M;  2B8F A;  4KHV A;  1EFI D;  1Z47 A;  4KN4 C;  1C4Q A;  2VQF M;  4G6Z A;  2PMZ B;  1X3Q A;  3A46 A;  2ZAO A;  1G4A E;  4B7H A;  3FUU A;  3GPU A;  4BBA A;  3SE0 A;  1Q1E A;  3A8I E;  4DV2 M;  3FUW A;  3I73 A;  4B3R M;  1STH A;  1S5E D;  2CUZ A;  1GUG A;  3Q24 A;  1F9R A;  1R4Q B;  2A6H D;  1L0X B;  4G4N A;  1BCP B;  1QZM A;  4RHR A;  4LRT A;  3Q8X A;  1WCM B;  3BZD B;  4O1N A;  1EIG A;  3U6D A;  5CV9 A;  3U9S A;  2B2Y C;  1KLG D;  2NYZ D;  3MEH A;  8CAT A;  4DAY A;  1A6X A;  4DV7 M;  3TP8 A;  2RDF A;  1FGB D;  1I6H B;  3R8B A;  3RD4 A;  3KSJ A;  2Z4H A;  4DV0 M;  4BLC A;  2D9U A;  3U6C A;  4A3M B;  1XNQ M;  1N77 A;  3EIH A;  3C1E A;  3GLG A;  2F0D A;  3CF6 E;  5E4X A;  5KYL A;  2BDN A;  3I72 A;  1PTO D;  2DNE A;  2RDH A;  2ZM6 M;  5F3W A;  4JI6 M;  2A6E D;  3A98 B;  4IAL A;  1WTX A;  2E5L M;  3W0L B;  5KPR A;  3J27 B;  3MA2 B;  1BQQ T;  4HN7 A;  4KTA A;  3U6M A;  3SEB A;  1BUV T;  1S5F D;  4DR4 M;  1K3X A;  3F2U A;  2YYZ A;  1NSN S;  4ID6 A;  1QVR A;  2CV1 A;  2IJ0 A;  1CT1 D;  3ND8 A;  4CBV A;  1ET6 A;  1HPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...