3NBIA

Crystal structure of human rmi1 n-terminus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
203
structure length
193
Chain Sequence
NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of RMI1 and RMI2, Two OB-Fold Regulatory Subunits of the BLM Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords RecQ-mediated genome instability protein 1
total genus 44
structure length 193
sequence length 203
ec nomenclature
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3nbiA01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nbiA02
4CGYB 3NBIA 4CHTB
chains in the Genus database with same CATH superfamily
1PFSA 1Z7TA 3I4NH 2LNHC 4LFCQ 2F0WA 2VB3X 4UAIA 1F2YA 2HHHM 1QVCA 3VR5A 3KFUA 2PZWA 5JJKA 2XGNA 4ZQ3A 2ERCA 3GLHA 3GTMB 2KJXA 1XMQM 4P71A 1XMOM 3HU3A 4MHEA 2KA6B 2IX0A 1VQ7A 4KD3A 1E0BA 2JA7G 1PGYA 3DLLA 2K01A 3GV6A 4EQ5A 4DR4L 4S12A 1G8ZD 1Y1WB 2E2JB 2CRUA 3SHGB 1X3FA 1YJ9A 3U6QA 4CISA 2BH8A 1YNNC 3M3YH 2G9DA 1MKHA 2M2LA 3KDFA 3Q0AA 1A3UA 3CQZB 2WZJA 4RA8A 4GNXA 3HOYG 4DR4Q 4IPDA 2DJGC 3WOEA 1D1IA 1L0YB 3FKIH 2R92B 3ZC7B 3NXWA 4NMZA 1LUZA 4RNAA 1FJGM 4IJLA 4H13C 4KK7A 1TF0B 4L6TB 4X66L 4JW0A 3T51B 4DR1L 1JORA 1G8PA 5DFLA 3GQ4A 4JI0Q 2N3SA 2DZNB 3DHQA 4LF5M 2DAIA 1CKOA 1ZQ9A 1X3EA 4G7ZC 1JWMD 1VQPA 1KYIA 1Q86C 3HOUH 4GIPA 4DR2M 1SMXA 4FO2A 2F5OA 4HEOA 3S2HH 2WV6D 3MAQA 3C1FA 4LJ8A 3HOXG 1IXSA 1IYJB 1Z47A 1HZBA 4OWTB 2B3GA 5IP9H 1QZMA 3FE3A 5EQTA 3M6AA 3KOZE 1U4LA 2D2CC 2ZM6L 1G291 1T9HA 3FMCA 5K5PA 4FCWA 3G7LA 2YU9H 5JEAJ 1STHA 4DV0L 2HD3A 2IHEA 2CHGA 2XZUA 3SARA 2JXMB 1A8VA 4LF5Q 1TDZA 2KQ3A 2XF3A 4JBJA 2QW7A 5KNCA 2LVOC 1EE8A 1P16A 2NVYB 1VQLA 2PW5A 1YITA 2EXDA 1PYWD 4E6IA 3PUZA 5ITUA 1JR3E 4HCEA 4A93G 1GUOA 1QCBD 2F5NA 3CPFA 4N9PA 4ITQA 4C3JG 4MNOA 2DHRA 5KO3A 1TQOA 2EUCA 2ZBKB 4EX5A 2KRKA 1J09A 4JI3Q 1PH1A 4DR1M 3S14B 3IAYA 3HOUG 4A3DB 1WTWA 4IJFA 3RFWA 1KHIA 3CCJA 2KBNA 3PO3H 4RH6A 4DV4M 2QZ4A 1QJOA 1VQDA 1XNQL 3F8TA 3CRLC 5IY0A 2BOSA 2KECA 1IN7A 2RRUA 4JOIC 3P7JA 2WAQG 3NTIA 3ND8A 4F1IA 5IYCG 5CV9A 4A3EB 1FGBD 4HSPA 3K1JA 3KBGA 3ILKA 1XMOQ 4LF9Q 4YWMA 1N75A 1MBYA 1V1QA 4DBGB 4DR4M 1OXVA 2CW0D 2AUKA 4GLAC 4O42A 3GLFB 2H4OA 3KLSX 4DV5M 1IYVA 4QMGA 1QWYA 4WFN3 3D8BA 2Q8RE 3KLWA 4LFCM 1QB5D 1A62A 5HY6A 4IOAA 4YHHL 1S5CD 1CSQA 1V1OA 1HA5A 1G59A 3HKZG 4DUZM 1L1ZA 1I3QB 4ZUJA 5M5XB 3GLFE 3SVMA 1SEBD 2F3VA 4DV3M 4YHHQ 1DJRD 1GVNA 3J7BA 3GRVA 3TRZA 5GKNA 1Y69U 5FLXE 1HCZA 1WTQA 3U50C 3V76A 4Y28F 3R93A 3CC2A 2O5RA 3Q8XA 1L0XB 5IYCH 1PTOF 5BN5A 4JI1Q 1NVMA 4FNFA 2B63H 1PFMA 4R4QA 2B8GA 2HQLA 4F88A 1W5SA 3BU2A 3TWLA 2QENA 4DR2Q 3H0GB 2DKLA 2EJMA 2F0KA 3MZ5A 3OWFA 1KTKA 5C3EB 3U6OA 5C6AA 4K8JA 5ELNA 4IFDH 5ITRA 1R4GA 1K8OA 1TS5A 1K3BC 5ELOA 5EBDA 2XVSA 4A3LH 3PSIA 4C1NI 3KP0E 4MZ9A 4QL5A 2LH0A 3RN2A 3PO3B 4YY3Q 4NRWA 2RKSA 3LMMA 1I50H 4AYBE 4XXEA 4GKJL 2VQFM 1X6OA 4O2DA 2XSCA 1V92A 3KF8B 1GUTA 4JK1C 4DV0Q 4IUQA 1P3QQ 4DV2L 5DNYA 4I65A 1WD0A 5JVG3 5LMNM 1X56A 2I7PA 3SAVA 4OVZA 2L15A 3CRKC 1WTOA 2XRSD 4DFAA 1YHQA 3FRHA 3TBIB 3I4NB 1EY4A 2JJQA 3D3RA 5CV6A 1UFZA 2D62A 1SRUA 4DNRB 1X55A 1Y1VH 4B3TM 2K47A 2R7ZB 4N8X1 2EJFC 2QBYB 2XTIA 4LF9M 4DR7L 2XH9A 3D4WA 1T5XD 1IW7D 1K0RA 5GROA 1HQYE 4IJEA 1S4ZA 3P75A 3MVVA 1M90C 3KUPA 2JNHA 4ME3A 4H44C 4A3LG 4HIKA 3TEHB 2F5SA 1I5FA 4AIMA 3NWTA 1LT6D 4DN4M 5D3DA 1M8AA 4UP7A 2K52A 4ABNA 1TKWB 1TH3A 2G9HD 4XDXA 5L37A 3IL8A 4OWXB 4K5XA 3FUTA 1KDBA 3PF5A 1DGSA 1CZWA 1EUJA 4CKEA 2N35A 4B7FA 2ZXPA 3PCOB 1PV4A 1MD2D 1ZEQX 1OAOC 1B70B 2ZJPA 1A2TA 3MXUA 3C3LA 2CFMA 5EQ0A 4QB4A 2ZJRA 1EIYB 1B3QA 4REZA 3GLIE 2EVBA 2O4XA 5C5MA 5ITYA 4DV6Q 4X3TA 4DV7Q 1WTPA 3S16H 2MGSA 3B7QA 2A69C 2IHFA 1NY6A 2KHHA 3HOWH 3RGSA 2VDBB 4CGYB 2K14A 1IN6A 1E2WA 3QG1A 4K6DA 1WVLA 4BXXG 1HNWM 1SNPA 3RUZA 1TU2B 1U4RA 3CCMA 3W0FA 5IYDG 1K9MC 3J80S 1D0KA 1HXYD 2Q2IA 2FJ2A 3VR4A 3DFZA 3HU2A 2DUDA 3SR1A 3GTLB 1Q3CA 3S2DH 4LJ9A 4PDIA 4JG2A 1Q8IA 2K03A 1B2TA 2RQXA 1IY2A 2FMCA 1Z5CA 2H1RA 4LF6L 4QOZC 1CZGA 4KHPQ 4LJ6A 2XGTA 5IZ7D 1BCPD 5ELFA 4OHJA 1Z5BA 1TWAH 5IGGA 2QBYA 5C4JB 1VEGA 2VQEQ 1IXSB 1FNNA 5JI2E 2CWPA 4A3IG 4GC5A 4GHLA 1W6KA 3B7ZA 1VQCA 1STNA 2VQEM 2JA6B 4HJ7A 3W2DA 2H5XA 4JI8Q 3PMFA 4GKJQ 4ZRZA 2W82A 3U6EA 1DGHA 3HX3A 3J80i 1VQ8A 2BJWA 3HEJA 2V1CA 3OPOA 4TKOB 3W1GA 3E9IA 4JI5Q 2YQZA 3K8ZA 3AFQA 4WJ3M 3EQLC 1TIID 1GLNA 1TWCB 5M3MB 3JAMc 3FKIB 1NJGA 1IBKM 4AQYL 1PTOH 4A3FG 1DOMA 1SNCA 2KNVA 3DEPA 3CCEA 1G71A 4AQYM 2CHQA 1JE5A 4LMQD 4ZUIA 4KJOA 2CE7A 1ZYRD 4DAPA 4A3JB 1HNXQ 4K0KQ 5C4XH 1SNQA 1MSHA 3D4DA 4S3SA 1QZGA 2Z0SA 3VFDA 1J6QA 1QOHA 3A8JE 4PV1C 1PJTA 1U4PA 2C96A 1B4OA 1WJ7A 1TR5A 2B2TC 4L8RC 1IBLL 4Y7NH 2QPAA 3KOWE 2R46A 2RDHA 3DM3A 4DV1L 1K73C 4XYOA 5BN4A 3VK7A 2F0NA 5CYUA 2LHGA 2F0HA 2DNAA 2DN8A 1D5ZC 3SAUA 5BPVA 2A5HA 4IALA 1II3A 5C3EH 1HHVA 4JI8L 5E7NA 1E9RA 3A74A 1DM0B 1DCZA 2HQEA 5J22A 5M3FH 3TWMA 3FKIG 5ELEA 4CDDC 4G4NA 1TVXA 1EZ8A 1SYDA 4A3BB 4P17A 5EJCA 4BBSH 1VQ1A 1VG5A 2QF7A 3NK9A 1L2DA 5C3XA 1QUTA 1KFVA 1EQQA 2N49A 2VB2X 3UDIA 4P75A 1NJFA 3CF0A 3KBXA 3K57A 5K36H 4BA1I 3HZXA 2JY7A 4R4IA 3A56A 3IFTA 3HS0C 1UE6A 4QF4A 2FE8A 4MGHA 2MP1A 2QILA 4B3TQ 2VUMB 5JJLA 3E3XA 1HT2E 3K9PA 1Z6HA 1S40A 3FUWA 2WB1E 2EKKA 4IOCA 1MN3A 2E2DC 1NJIC 3GTGB 3GRRA 2O5IC 2HCBA 5I6YA 3EVQA 3WDNA 2C9CA 4K6LA 2B63G 4IBKA 1HR0L 5ISRA 1DYQA 3LVWA 2Z7JA 4IBBA 1HR0M 3PO2G 1SJED 4HR7B 4JPBW 4BB9A 1ZYRC 3V96A 4DAYA 3PF4A 2I7NA 4R7GA 1IBMM 4OXPA 1HR0Q 1LT3D 2M00A 1ONLA 1D0MA 3J27B 2LKVA 3CQZH 5EXSA 1BVSA 1U9RA 2X6GA 4B9XA 5AJ3L 4R3DA 3U6PA 4WW0A 1KQSA 2EIFA 3WHKA 3AU7A 3HP3A 1NR4A 1TWFH 3K58A 1VQMA 3HOVG 2RHSB 1WJJA 1ZXTA 4XQQA 1GM5A 2E2HB 3SMPA 3OSOA 3VYTA 2EYOA 3V05A 1YIJA 3BDLA 5A35A 4LGMA 1DO2A 4A3GG 3CC7A 3GTMH 3J81S 2K1BA 2CHVA 1UEBA 2RVLA 5A2QE 3OTOQ 2DZOB 3JAME 1J5EQ 1R2ZA 4D82A 1KDAA 3MWYW 1Q1EA 1C4QA 3CD6A 1JB7A 2VY3A 1O7YA 2XFSA 3FRIA 1CI3M 3A55A 5DM63 5LMUM 3K59A 4RHSA 1F9PA 2DENA 2UUCM 3C2PA 5C0XI 3K5LA 2D7GA 4KN7C 1K28A 1X32A 1YBYA 4QHTA 2LVQD 1Z6TA 2ENBA 1JE4A 3GLHE 3G4SA 5ITXE 3UE1A 4GRIA 1I6HH 2AWNA 2OQ4A 4NKLA 4IO9A 4G7HC 4AKHA 2UU9L 1HTPA 5CBAE 1HT1E 5JOBA 3HHWA 2OQKA 4NW2A 3GTKH 2DWZB 2IJ0A 2NVXB 4WRDA 1AP0A 5DNFA 2NTSA 1A3VA 5A2QS 4IPHA 1I6VC 2R7ZG 4IBGA 2ZAOA 1F9SA 3BVZA 2VF8A 4NXMQ 2EE1A 1ZMWA 1XTCD 4P74A 1JR3A 2QCUA 2RGHA 3BZDB 1NE3A 2VQEL 3GLGE 2OCEA 2E5LM 2G5DA 1YHAA 1L1OB 2C35B 2RSNA 1YSYA 4OVZB 4RGNA 3KLRA 2PI2E 2NBFA 3HKPA 1VMPA 3D8GA 4LF4Q 1HZ9A 2JN4A 3I4VA 3U9SA 1EQVA 2K5VA 5LL6S 3RGPA 4R1JA 4FF4A 1JWSD 1SR3A 1XPOA 1PYBA 3D31A 3TP5A 4K2KA 3I56A 5LMUL 4HJ8A 3GTPB 3PIP3 4IFDG 5F3WA 2CQAA 1N36L 2V1UA 2A19A 1VQKA 3CCRA 3HKSA 4HSVA 3TPZA 4X3KA 4JI2Q 2R93B 1O78A 4MGIE 3NSWA 2KNZA 2D0OA 2EDGA 2F5PA 2MJ5B 2HUGA 3EN2A 1AIPC 4DUYM 3PFIA 4RGTA 2M9VA 1N36Q 1F2MA 4X6AH 1ESRA 1TWFB 1BR9A 3FDTA 4KV6A 5C4XG 5IT9L 1PZJD 2B29A 4LFBQ 4C56C 5FSWA 3JAMS 4B3RL 1XB2B 2AKWB 1JMCA 4RKLA 1KNEA 4ILWA 5I6WA 2ZJQA 2F4IA 2QEXA 3B9PA 1FNVA 3A7LA 4MH0E 3BYYB 1OIZA 2HKJA 1D6EC 1U4MA 3CU7A 3HOXH 5IGDA 2UUCQ 2B2VA 4AI6A 4D80A 4JV5L 5EP2A 1G4AE 4Q5VA 4FXGC 2LVAA 2DAKA 3I55A 3KOXE 3NTHA 2EKFA 4DR6Q 1HRJA 2JP1A 4L16A 1MJCA 1BKBA 1UE1A 4ZKCB 3GTGH 2I5LX 5IP9G 3I4MH 1TY0A 1SE3A 3X3MA 2JA5H 3NELA 2CP8A 1RIPA 3O13A 5C4JH 1TXYA 3EFXD 2QDBA 2JUJA 2JY8A 1FYCA 2QQ8A 5GQOA 3JAMi 4X65M 3MXGA 4QQBX 1CA6A 3I7FA 1QVFA 3TREA 1EFID 3ZQJA 2VL6A 5J3BA 1XXHA 5M5WB 4FF3A 4DAMA 1PMRA 4KMUC 2EYFA 5FLXL 5IT9E 5LMNW 3J80c 1GJTA 4G6ZA 2F0IA 3ULLA 1TDHA 4P2CB 3J81L 1XNRL 2X4AA 5FLMG 2ES2A 1IBKQ 4QOSA 4ALPA 2F4VQ 2CFOA 5L8RF 2LTUA 4A75A 1VQNA 3KF6B 1EYCA 3K7UC 3NENA 3AFPA 4X62L 3HOWB 3PIPA 2FS1A 1ASYA 3K7AB 4C3IH 3CP0A 1AN8A 3UGJA 1Y1VG 2HCCA 2HIVA 4JI4M 4NOOB 4R4TA 2LSSA 1T6OA 3T6PA 4KLNA 2A74C 4UDUC 3E5SA 1BOSA 3S16B 1XMOL 4A93B 3W0LB 4KKUA 3U4ZA 3K92A 4G3OA 2UUBM 2Z4HA 5IOCA 3S1RH 2R45A 3ZCBB 2ALYB 3BJUA 3N52A 5C0XH 4YCVA 4L5TA 5IWAM 1UAPA 4KHPM 5LHY1 2KRUA 4A3JH 3KVWA 4POGA 3QAUA 3LVVA 1SMYC 2R3ZA 1IY1A 1LTSD 4FCTA 3L25A 1FNUA 1OXSC 1R4PB 4U68A 2YTYA 5FLXS 1RU3A 1E24A 2WACA 3KOJA 1I4QA 2E2JH 3GTKB 1N32M 3C1EA 1MSGA 1E22A 4LFAM 5KPRA 4MGKE 2EY5A 2QSFX 4TUWA 5F2DA 2OO9A 2F0MA 1AZQA 5EKKA 3H3VC 4F7XA 1I6HB 1YZ6A 3OTOL 5ITXA 2GA4B 1JCKB 3SASA 2K33A 1PH8A 2OPFA 1C0AA 1J5EM 4J6HA 2Y0TA 2R93H 2QKIC 2DY8A 3BYTB 1EIHA 4OO1I 3HJQA 1J5EL 2E2IB 4LJ5A 4JVZA 2JQOA 1OKSA 2JEAI 2ICEC 3A46A 5DYGA 1XPRA 2PQAA 3T16A 2UU9M 3ERSX 1IKLA 4KKSA 4BBRH 1FJGQ 4A3VB 1NUCA 2R92G 1Z9FA 1B53A 3KK7A 2F0DA 3VYRA 2NVYH 1N33Q 3HOYB 3Q24A 4WJ4A 4FYDA 4A3CG 2KVMA 2K4KA 3VR3A 3S2DB 3D6WA 2LVNC 1EQRA 1GD7A 4FD2A 3F2DA 2RA4A 3S1MB 4KHPL 1D2NA 2R4EA 2VS1A 2KHSA 3TL4X 3RZOH 1CHPD 3A5ZB 3A54A 2HCIA 4L15A 4GNXC 1R7RA 5CV7A 4NDXA 3STBD 4FVMA 1WI5A 2XZFA 4ZLTF 2BA1A 4QIWB 2HHHL 5I4DA 1V1PA 1QUSA 3DZDA 4GKKQ 1DV0A 1OTRA 4QUFA 3T1HM 1JB0F 5J1ZA 4DK3C 4H02A 3HOVB 3TP7A 3LW5F 4HIMA 4F2LA 3HG9A 3ZJYC 4EQOA 4ZKBB 2L6OA 1KC8C 2UU9Q 5FLXc 1S72A 2UUBL 2OOAA 4P72A 3CW2C 2B2WA 4RAUC 1YJNA 1ILQA 1VMCA 2LY7A 3J7A5 2A6HC 5IGEA 4AH6A 3M3YB 1IFYA 4M9XA 2PMZB 1STYA 2M60A 4DV5L 2SNSA 4LUVA 4DR7Q 4IBFA 1ILPA 3LCVB 3I70A 3AOEA 1C7YA 3NBIA 2KCCA 2B2UA 3QB3A 3H15A 4IFDJ 2BWBA 3QYBA 2K7VA 1CQVA 2PCFB 3I90A 4GN5A 1R4QB 2HDLA 5BR8Q 2ZANA 3C3DA 2QEJC 3SEBA 4JYAM 3T56B 1MI2A 1YJWA 4DR7M 1WOCA 4PMCA 5J39A 1ICFB 2TMPA 3FEWX 3J7AF 1MX0A 1OXTA 5ELDA 3MEHA 1CKNB 4BBRB 2VUMG 4ANRA 5IWAQ 2ZXRA 4G4RA 2EJSA 2NYZD 1KAWA 2RHQB 5ITQA 1JWUD 4IUVA 3C58A 2EYJA 3GTOH 3TN2A 2JXNA 3ND9A 5LMUQ 4X65L 3U4VA 2XN9C 2MNAA 4GKKL 2GN5A 1LTMA 4UPAA 3HU1A 5E4XA 2JA5B 2JZ0A 2A1AA 4LG2A 1BBUA 1I4GA 2JA2A 5EPJA 4DAYB 3TZUA 1V8QA 4C3JH 2F03A 4OIKA 4DV3Q 1LT5D 4JI0M 2YTXA 1ZV1A 1RCVD 3AL0C 1NY4A 4R4CA 4JI3L 2A5YB 2KW0A 1QYRA 1WTRA 2WINB 1YVCA 4X64Q 3I4OA 3CCQA 4HL4A 1PFNA 3ONAB 2UXDQ 1NSFA 1Q39A 4JN6A 5IP7H 4X64M 2I46A 3RNUA 4A3MH 3RLOA 1WTVA 4JI7L 2NQ8C 1IW7C 2F0QA 3L0OA 2K0BX 3D8LA 2UXCL 4OX9M 1GUSA 1LO5D 2R6FA 2CQOA 3CKIB 1N34L 3HY5A 2Q2UA 1HFNA 1QE6A 2J5YA 1I4RA 1SLJA 3W67A 4H7BA 2EYLA 2KHJA 4XK8F 2R61A 3K7AH 1PJSA 4A3FH 3X3NA 3MTSA 7CATA 3NP8A 1AH9A 1HPCA 4FCVA 1B44D 2A69D 2EXZA 5KNBA 3FUXA 2JP7A 3BG3A 4DR6M 3VR2A 1QILA 1R9TB 4GS3A 3KXEC 1DD2A 4HMIA 3KP1E 2E2IH 4LF7M 2CV1A 5EXPA 1WFQA 2FFJA 1Y8OB 1JJGA 1VQ4A 4PNYA 3GRUA 2K5DA 4QNMA 1TGUA 3BOSA 3VA7A 3QWLA 1H9MA 3PUYA 2DAGA 3ITPA 1PA6A 1STGA 3I4LA 1X9NA 3DEOA 4R9WA 1E3PA 5C0XJ 5M5WH 4DR5M 5DEHA 1GUNA 2VW9A 4NRVA 2EOTA 1HTLD 1NHGC 1HJPA 1KLGD 4V190 1SN8A 3HOWG 4IUUA 1EZ6A 2X6LA 2B39A 3K8AA 1PRTC 3U9OA 2KCNA 1PTOD 1ENFA 3WHLA 2B2TA 2XWBB 3BVGA 3T1YQ 2EYHA 4JCVE 2Z8LA 2FNAA 3G48A 2FFKB 1QAQA 3G6EA 5M3FG 2DZLA 2I0QA 4A3DH 1K82A 4CDEC 4A3KB 2KA7A 1LABA 1QNUA 2D7HA 3F1ZA 3R2IA 3FVQA 3U6LA 3MXNB 5M5YH 1KD1C 4KD4A 1I4PA 1VDZA 4QCLA 4RKBA 1ASZA 1BNZA 1CK1A 4JI5L 1F2LA 1QUQA 5E26A 1Q3BA 1BDOA 3R8FA 4FWGA 3FTCA 1VQJA 1GUGA 3BS1A 2IY5B 4WP2A 5KQDA 1CM9A 1MHWC 3OWEB 5HURA 2C99A 3KF6A 3KJPA 4PCZA 1E1OA 2K04A 1STEA 1L2FA 1NY5A 4NXNL 3TDQA 1L0WA 4NB3A 3B74A 2D0PA 4A4IA 5A2QL 2LMCB 4NXNM 2PQAB 1HQCA 2E2HH 1N34M 2B8FA 3LQRA 4L6V6 1LV9A 3H94A 2X8AA 2PI2A 4NXNQ 4JI6L 5D14A 4CKBA 3J81c 4P73A 1EIGA 3HGIA 2PZUA 4XTCS 2MQHA 2BDNA 3GLIB 2OWOA 2QP9X 2R62A 2ICIA 4MGZE 3W1BA 4HMJA 4RWSC 1SXTA 3PQIA 4DR1Q 3EIHA 5C18A 1K3XA 1F4IA 4BWGB 1NHWC 4G7OC 3R3OA 1K8AC 4HIDA 1N32L 2F1MA 4L5RC 3CF6E 3GRYA 1NV8A 4X66M 5KPTA 4NP5A 4B9WA 1CA5A 3TS2A 2OTLA 4I7ZC 5EP3A 5C4XB 1QANA 1TY2A 1PJJA 1SROA 1HA6A 3PUVA 1H9JA 2JWSA 3UJNA 4C2MB 2UUAM 3CF5A 2RDFA 1V43A 5CMDA 3T53B 1RTNA 3I4NG 2LHCA 5E6JA 1LTRD 4WORA 4B08A 2E76C 2PMZE 2AWOA 2FINB 2VQFQ 1NAPA 2LS01 2D7EA 4CJ2C 2LXKA 1PM5A 1EWIA 2P5TA 4C3IG 2OOBA 3PGZA 3UZUA 1QAMA 3L3OC 3FTDA 1UWVA 1NSNS 4LF8Q 1DGFA 4JI4L 3VA5A 1GO3E 4JI1M 2AMCB 3GQ5A 4ME5A 4CBVA 1IN8A 3SYLA 5C4ZA 4OO1G 1AEXA 2K50A 1NR2A 1EYGA 3FYDA 4LFCL 2YYZA 4AKIA 2B2VC 3JC66 2A8VA 5KRUA 4DV6M 2DGYA 1G2TA 1JOOA 1LTTD 3VDPA 1DGHB 3GO5A 5FKAC 3GV3A 3DM1A 5GADC 2F3IA 2N8NA 2DWLA 3Q22A 4C1NK 3E6ZX 4DNTB 3H4JA 1QG7A 4EQPA 1Q90A 3RN5A 3MJ5A 3B89A 1OIPA 1BCPF 1C1KA 5BR8L 3QJYA 1IN4A 4ULLA 2O01F 1A5TA 3H0GG 1SYGA 5IYBG 4JI7M 1MU5A 1ZKOA 4KJNA 3TP6A 4X64L 5FLMH 1PH7A 1A63A 4BY1G 5AFWA 1X37A 1L1OA 2F4VM 3F2BA 4GMQA 1Q7YC 3PIOA 1TS3A 3QOLA 1Z5AA 1K83B 1EFUB 1I4HA 2Z9HA 1RDPD 2JEBI 1XXHE 4MGYE 2RDGA 4IZ8A 1FL0A 4LF8L 4G57A 5IYDH 4JBKA 1GXDC 3OW7A 4JC0A 1AZPA 3K81C 5KPZA 4X65Q 3HOZH 2KZUA 3H4MA 4DUZL 4O1NA 1EYDA 5DLQE 3ER0A 3B6YA 1DXMA 2Q2TA 1DO0A 1CFMA 3S14H 5LMNQ 4DV3L 3KFUG 1GJSA 1XHBA 1BO0A 2SNMA 5KEEA 4DK6C 2NVQH 1R6BX 4A3GH 3MFGA 1KIXA 1G41A 1PXUA 1NV9A 4F87A 1IN5A 5C44H 1SAPA 5GAHC 4A3KG 1CQFA 2XFTA 1PFBA 1XC8A 2F0EA 1EY9A 1TWHH 4I7AA 1QZEA 2JA7H 1HZCA 4ID6A 1VQ5A 2D9UA 1TWAB 4XYQA 4I4LA 3TSSA 3BBZA 3LNNA 5JJIA 3SE0A 2BH2A 1SSOA 1F77A 3JR4A 1CSPA 5JPMC 5EKLA 1WXQA 1BBWA 1IBLQ 4DR5Q 1GABA 1PRTD 2B63B 5GAEC 3HFZB 2QNJA 2F5QA 3GTLH 3NPPA 3BXWA 2CCZA 2R6GA 2UUAQ 5E1FA 4QJFA 3TE6A 4DUYQ 5EXTA 3STBC 1KAAA 1QVGA 1HNWL 1G91A 1PTOB 3GLHB 1EOVA 2D5DA 4XIGS 3ULPA 4DR3M 3AB9A 3GTQH 2KXEA 1B9MA 2GVBA 4JI4Q 4F8MA 4GKJM 3GO8A 3HGBA 1EY6A 1QVRA 1QNKA 1K8GA 3OHXC 1Z59A 1CKMA 3OW2A 3MHVC 4LNQA 3EIVA 4IURA 4A3BG 3FD9A 4II7A 1ET9A 2I5MX 4UP9A 3GQ3A 3KJOA 5CV5A 2JY6B 4BBAA 4CJ0B 2PQEA 4DUZQ 1OXXK 2CKZB 5M5YB 2L09A 3U60B 2PNHA 2NZ1D 4PZ7A 3R8BA 4Z8XA 1XTDA 3VDUA 4JI8M 4R71A 1S5DD 4IFDI 1JR3D 1BXTA 4JI6Q 1HZAA 1B9NA 1D0LA 4IQZA 2IWHA 2L2DA 1SE4A 1JOKA 2KOLA 3LGJA 4X62Q 1FR3A 4PQXA 2FXQA 4K8IA 4CKCA 4LF7L 2PZTA 3HZJA 2CHBD 4IBIA 3GTJH 4DV4L 1E1TA 4XBOA 2MROB 1XMQQ 5IREB 3U61B 2XIWA 2IX1A 2JA7B 3PVSA 3A8KE 4A3FB 1TWHB 3PUXA 2F0FA 3U6DA 2AQ1B 5EAYA 2NZHA 5JEAG 4LF8M 4G4KA 2QGQA 4JBMA 1AUAA 4M1UB 2LVPC 1PTOC 3TS0A 1ENCA 2L4FA 1XWEA 4B3RM 4GC9A 3F2UA 2KEDA 1YNJC 2B2UC 4DV2Q 3AOEC 1Q8KA 4BBRG 2ID0A 1RHPA 4A3IB 3NE5B 3NWSA 1VCIA 1XX8A 3MEFA 3I4YA 4JV5M 3PUWA 1HNXL 4K0KL 2Z3XA 3MXPA 3N6RA 3TQYA 1HNXM 4K0KM 1Y8GA 3RZOB 3KW6A 4LWCA 4ZK9B 2VNUD 1IL8A 5EPKA 2QA4A 1H9KA 1JICA 1I94L 4PG3A 3S9WA 1HQRD 2DY7A 1SYFA 2L0CA 4LZZA 1B1ZA 3NEMA 1RTOA 3ICEA 1YI2A 1NMFA 2WSCF 5EJWA 2KENA 1TR8A 1PJQA 4LJAA 5EBCA 3Q6SA 2SOBA 2E8GA 2NTTA 2ZAMA 3L7ZC 3FUUA 1SMYD 2Z1CA 3UDGA 2L11A 2MUYA 2Z6BA 4JI6M 4KY5A 4CJ1B 1HH2P 3J7ZC 2EYMA 3DWQA 5CBEE 1GL7A 3CTWB 2L4NA 1W3SA 3GQBA 3G71A 3U5ZA 2G5GX 1DOLA 1KXLA 3E9HA 2L5TA 3BDCA 1M1KC 2R7DA 3I4MG 2MO1A 2LXEA 4JI2L 3HHZA 3RE8A 1EFWA 2Z4SA 1SNOA 4LF4L 1RODA 1L1TA 5CV4A 1LYLA 4DV2M 1RJTA 4DV7M 1EY8A 1KSFX 1ESFA 5LMNL 1JJ2A 3T4AC 4DV7L 1SXJC 2WB1G 5IODA 5DYIA 3IG8A 2RCFA 4C3HB 1SE8A 5TSSA 2FOIC 5C44G 3GPXA 1EU3A 1IXZA 5M9OA 2KUMA 3J81E 3K0XA 3VKHA 3SXHA 4A3KH 3UK6A 2B2WC 2KEEA 1J8IA 1IKMA 2A68D 4MN3A 5JVH3 1W6JA 2HL7A 2WIIB 4GOPA 3KDSE 1LACA 3EJIA 1QAOA 1LLRD 3NHHA 2DAEA 4AG5A 3AQQA 3NQIA 4H0LC 4UN2B 1Y1WH 2DVWB 3T1YM 4B3MM 1O7ZA 2VUMH 1SXJE 2RGOA 3CF2A 2K5HA 3AYHB 1PZKD 2NVTB 2MR9A 3U6SA 2DXIA 2E74C 2HWJA 4TRDA 3FHWA 1L1OC 1CTMA 2MGWA 4I81A 3T13A 2BWEA 5IIFA 1J9OA 4BBSB 1A2UA 1WTXA 1XXHB 2V1CC 4OWWB 2SDFA 3AOGA 1IBMQ 3C9PA 2CVRA 4CDFC 3IHPA 2KNAA 1G6ZA 2Q2EB 3SK8A 2AUJD 1HUMA 2IPKD 4LRSA 1LV7A 2EO2A 4XGIA 2K28A 4A3MB 4FWDA 2NN6G 3EIEA 3U6MA 2DI0A 2FHTA 2F4VL 2QDLA 3J81j 3S2HB 1H95A 3U5ZB 4PMBA 2C98A 4I5SA 1PH2A 2PNRC 3H6MA 4DV5Q 1UE5A 2N78A 3SYKA 4DKAC 1OQYA 4OL7A 3JAML 2DNCA 1OFIA 4YCUA 1VQBA 1WGLA 5C3EG 4DR3Q 2GQFA 4GHAA 3M9BA 1EWHA 1Y1VB 2XRQD 1Q3LA 1D1KA 5M5XH 2WKCA 3OYYA 4DNIA 4B3ML 4LY6A 2C5CA 2YTVA 3MC0B 2BE5D 3D4RA 1WCMG 4LF4M 2O5JC 3RLFA 3OMCA 2JE6I 1GO5A 4KY6A 1STBA 5C5LA 3UDFA 4GN3B 4JI0L 1EL0A 3SK4A 2UXDL 4JI3M 1VQIA 1V34A 2IL8A 1ORYB 1E7ZA 3PXGA 2F0VA 1AW7A 2NUCA 3Q23A 3GD7A 1K83H 5K36G 4M0WA 2FH0A 5FO8B 4L4UA 2Q8TA 4JV5Q 1V1PB 1DOKA 4HLQA 3FUVA 1SDFA 3E46A 2JA8H 1SBBB 3L9AX 3MMPA 1W2BA 5C3WA 3AEVA 3I91A 1WD1A 4BY7B 3U60A 3GPUA 3AJIB 2K9DA 3OOCA 2F0GA 1Q82C 2EYPA 1PH9A 1VS0A 2L9HA 3I72A 2XNAC 2CV0A 2Z8YM 3E0EA 3AKZA 4L5QA 3SGIA 4M0DA 1GVPA 1R9TH 3GTQB 3VYUA 1GUWA 3KOYE 1WYDA 1JQJC 5IT9c 1RL2A 2VF7A 4A3EG 3LWEA 3GP1A 2PPBC 3L29A 1E32A 1M4VA 3J81i 3HWSA 2WAQB 4AYBB 3QO2A 3RMHA 3PV0A 4DPGA 4FDBA 2OQ0A 3DWPA 2EA0A 1WCMB 4RFBA 3L26A 5EP4A 4YHHM 4DV1Q 4TVAB 4ZAIA 3HOUB 1TWGB 4RG1A 1ET6A 4M9SA 2L55A 2KHIA 3NQTA 5KQ8A 1E2VA 2QCPX 4B7HA 1H6UA 1ZMUA 4C3JB 3GTJB 4DR6L 1G6PA 3T15A 3E9SA 5I2XA 3T1YL 3SBJA 3KS8A 4PZ6A 4J8QA 4LW1A 2J7OA 2Y0SE 2C5RA 3A5UA 2F0PA 3FP9A 3M7NA 4OEMB 3K5OA 5IGCA 2E5LL 4FXKC 3UMMA 4ZCKA 2F0JA 4W5WA 2L4EA 1L2CA 3I8ZA 4DU9A 4Y7NB 2R93G 1Y14B 1NO1A 2N55A 3QWNA 5IP7G 4A3MG 3LCUA 2CEAA 2AQ2B 2Z4IA 4AKGA 1PRTF 1XWIA 4LF9L 3K80C 2KEBA 1ZMVA 2KZSA 2DAMA 3I04M 1HNZQ 4GN4B 3HOXB 3K5MA 3BVMA 4HCSA 2MHVA 4C3HH 4EGVA 4AW4A 4BBSG 4PDGA 1VQ6A 2EPBA 2HHHQ 1KRTA 4TSSA 3PNVA 4B3SM 4ODGA 2YFQA 1HR0W 4HJAA 1CT1D 5C0XG 4LGYA 2R65A 1XYIA 4KO8A 2Q8IB 2R18A 4RGMA 1TTEA 4IUNA 3UDXA 4LF6Q 2IX3A 1XXGA 2A68C 5T1GA 4GZYC 1WGNA 1C9OA 3IRBA 3P1HA 1QQWA 4FXDA 2K32A 1B3AA 4CHTB 1IXRC 2BJVA 3EROA 4J15A 1XJVA 3GTOB 3DA1A 4RMFA 2KCTA 3BZKA 3S1NH 3CHBD 5C44B 4X66Q 3IFDA 4C3HG 4DXFA 4G4QA 3Q8DA 4LF7Q 2WB1B 1D2BA 2WAQE 2F0LA 3KLSA 1LTGD 4V0BA 1JB3A 1E2ZA 3K2LA 1SJHD 2LFNA 2O2LD 1Q12A 2K5QA 2BDOA 2VQFL 3CMEA 5FTKA 3P20A 2Z4RA 3ZH9B 1A0IA 3THGA 4IIWA 1PHJA 3SATA 1O7LA 4NL4H 1SFOB 4HTHA 2XLJA 2APLA 1VQFA 4PT5A 1GKIA 1VEJA 2GVAA 5KGUA 4A3GB 4LF6M 2NVQB 3CC4A 4QHSA 1NCVA 5KYLA 1LTID 3NWLA 3QIAA 3VDYA 1EOTA 1N77A 4DAVA 2UUBQ 3AMUA 4LFAQ 2Y0SG 4FF1A 4OW0A 2RBMA 3KF8A 4RF1A 1UNSA 2Z6KA 4QY7A 4GKKM 3H3VH 3FTFA 4Z6YA 1KL9A 1WTHA 2I5HA 5G3LF 4WJWA 3S1QB 4IPCA 5JJZA 2F52A 4IUPA 1MJEA 2RKOA 3M4OH 1CHQD 5IT9S 3LWUA 4KN4C 1BUVT 2JSOA 1DZ1A 1BQQT 3KS4A 2X49A 4LJ4A 1G3IA 1YEZA 1YNXA 1Q46A 4EVOA 2Y0QA 2XEPA 4GH9A 4KTAA 1W5TA 4LF5L 4R4OA 4AZFA 4DV0M 2VXWA 5H37D 2K6AA 2L1BA 4DV4Q 3PO2B 2A6EC 1I4XA 2X69A 2A6ED 3NBHA 2GNOA 3L27A 4KLKA 4LJZC 3IG5A 1Y8NB 1OO9B 3SK6A 2KCMA 1JC7A 2UXDM 1UE7A 1RKNA 2I07B 2BCOA 2ZXOA 5KNDA 1VQ9A 4GNXB 5H1SE 1I3QH 3A42A 2AHMA 4FW9A 2J7ZA 3HOZG 2K5NA 3SMSA 1I94M 1HNZL 2L7HA 1OTCA 1NNUC 2R7ZH 1Q02A 3BZCA 3GPYA 5FTLA 3OIQA 4B7GA 4OIJA 1TH4A 1ZAEA 4DV1M 1BCPC 2MH8A 5I9OA 3VYSA 1VQGA 5IGBA 3B7NA 2R44A 4IBDA 5BR8M 1NBWA 5KIXA 3GP7A 1L2BA 1K8MA 3AFHA 4M9ZA 1T5EA 2B3TA 3RZDB 2HT1A 1CUKA 1XNQM 4K14A 4QGUA 4BXXH 2BNKA 3F92A 5EXXA 2O25A 4N8FA 2JA6H 3NBHB 5FTJA 3M7GA 1I4WA 4PD2A 2C9OA 2UXBL 3J80L 3GDEA 3AV0A 2CUZA 2WFWA 5BN3A 3NUCA 2UXBM 1YNND 3IKJA 1XNQQ 3H91A 2EY2A 4ZPXA 2BE5C 4HAEA 4JI1L 3UE0A 1EEFD 4NC6A 3R2TA 3KSXA 3L2AA 1PH5A 5HGQA 3FYCA 1A15A 4IUTA 4A3BH 2K5WA 3I01M 1QUQB 1GOZA 3ZYYX 4A3JG 4JBWA 2DNEA 5IWAL 5T1IA 2J7NA 3NBXX 4U673 1P8LA 4DA2A 1N34Q 4DK1A 1UEAB 2SEBD 5M3MG 2Y20A 2K05A 4JYAL 3U6CA 1FGUA 1MIUA 1XPUA 5FO9B 1WHCA 2JZ1A 1DONA 2ZT9C 3PO2H 3URYA 4YY3M 2L7IA 4YCWA 1IBML 3MFYA 4LZJA 4YY3L 1PZID 2UXCM 2NVXH 2LWXA 2JA6G 3FRPB 3TP8A 1PYSB 2XSZA 3SDZA 3W3AA 1A3TA 5JAVA 1NMGA 3NTKA 4FF2A 2EY6A 1VQAA 3G6JB 3I2ZA 2UXBQ 1PDQA 2FMMA 3DWAA 4K5VA 3HOVH 2V6ZM 5FTNA 2CW0C 3ERQA 4DXGA 4R8IA 2R0IA 2JA8G 1IYUA 1CKNA 4HN7A 4DR3L 3TMEA 3S17B 5FJ8G 2NN6H 1YHBA 3D0FA 3M4QA 4BA2I 5IGFA 1B7YB 2LXJA 3FTEA 4NXMM 1HUNA 1KRSA 5CGKA 1HNWQ 2MO0A 1G51A 4IJHA 2ASBA 1EY5A 1QZHA 1K0SA 4P16A 1IY0A 2G8LA 2UUCL 1BCPB 1S3SA 4DK0A 2Z6KC 2Y0SB 2P5ZX 2OEOA 2OTJA 1Y8PB 4L63B 5EP1A 3FPUB 3W68A 4KHVA 4JYAQ 3GLGB 4DF7A 3W5OA 3WWVA 3DXJC 2BA0A 3A0JA 3CCLA 1YUBA 4R8NA 4MB7A 5E4WC 4IBCA 4JOIA 1KDCA 1PH4A 2JA9A 3I3CA 3FKEA 2YV5A 1VQOA 1B8AA 1E94E 3TQSA 3R9XB 3LQQA 4AG6A 2L12A 3V2TA 3VLFB 3K0YA 2YNMD 3QOJA 1O7IA 2E75C 3MA2B 3GPPA 1SNMA 4LFBM 1KLUD 1S5BD 1EY0A 4BY1B 3DMUA 1QDRA 3DUZA 4X3SA 5CR3A 4JI5M 2CWBA 4GLVB 4OX9Q 1DGBA 1JT8A 5I2YA 2RSOA 4JI7Q 2NWGA 2VIIA 3CGWA 3I73A 2ZTEA 4XQNA 1C8CA 1IL2A 2UXCQ 1PVOA 4YWKA 1FVIA 3M4PA 3FPPA 4HIOA 4DGZA 3U58A 2EY1A 2ZM6M 1HFGA 1N8RC 4OO1H 3PIO3 2HIXA 4KKTA 1SE2A 2J0TD 1NTGA 2DJFC 4A3CH 4ZYSA 3SHLA 4MTKA 3EBEA 2R92H 1GHJA 2HAKA 2JK8A 2OF1A 1PH3A 4FWHA 1EIJA 1IBLM 5NUCA 3HOYH 3QR8A 2E5LQ 3S24A 4MTNA 4YIJA 3HHXA 2R4JA 1EEID 2WP8J 1LTLA 3J7AV 1U5KA 3S15H 1N78A 1X3QA 4IBJA 2CH4A 4C3IB 1IHZA 2YR0A 3S1MH 1RD9D 1H9RA 3PO3G 1PH6A 3I51A 1JQYD 4YWLA 3LX0A 4G4OA 1EQTA 4BY1H 4M8AA 2HDMA 5ELCA 4UY8C 4BY7H 1OXUA 3UI2A 3A45A 1MJGM 3PNYA 4UP8A 4A76A 4IPGA 1T43A 3K5NA 1C48A 1ENAA 3CCSA 4CDCC 4KODA 4OELB 3GTPH 5EGTA 4JXJA 4GOPB 1EYAA 2R7FA 4LJ7A 3C46A 1LTBD 4DR5L 4XT3B 4NPSA 1I94Q 4Q0FA 1F2ZA 1VQEA 3HKZE 4J1MA 2MJ8A 4LCBA 1IBKL 4A3EH 3SK5A 1F9QA 3MHBA 2ATWA 1IXRA 8CATA 2K75A 1O80A 4LRTA 1N9WA 2N88A 2NB0A 2V4DA 3M4OB 4B3SL 3EA6A 3VR6A 4QNRA 3OMGA 3CPWA 4JI2M 4N9TA 3OIPA 4K2LA 4OONA 4GLXA 4NXML 1IM2A 3TZDA 4AYBG 1JR0D 1HQMC 1TS4A 5DAUA 1I50B 2B2YA 2AQ3B 3CXCA 1DGGA 4A93H 1TS2A 3IECA 2WSFF 5G3LD 1X65A 1X3PA 1SXJA 4PZ8A 1PLFA 1TT2A 1LM0A 2Q2HA 1A6XA 4CJ6A 1TWGH 3T1HQ 4RGOS 4A3IH 3HKZB 1TWCH 5M3MH 4NSRA 5C1BA 1NNJA 4BY7G 3VKGA 2OT2A 5JEAH 1Q81C 2JYOA 3U61A 4C2MH 4AQYQ 5D65A 3E0JA 2YU9B 3T38A 1GL6A 4LAAA 3MK6A 1F9RA 2A73B 3GLFA 2B2YC 3J80E 1H9SA 1V33A 1UM8A 3HJ8A 2TSSA 3M85A 1XNRQ 1D7QA 1J7KA 1WCMH 4L78A 3HHYA 4LK1C 4RF0A 5EPLA 3S1NB 1PRBA 4XT1B 5M3FB 4GITA 3C3EA 4KI0A 1X3GA 2M5ZA 3K6OA 4K5WA 2LBCA 3DOAA 3BDOA 3WOFA 3D6CA 1YNJD 3F2CA 2JA8B 1N33M 5E3FA 4A3DG 3TWKA 2EZVA 2ZTCA 2QHOB 3K9OA 3GLIA 5FJ8H 2DWNA 4XQJA 4IN3A 4OGQC 4KY7A 3Q8GA 3OTOM 1X54A 2CH4W 1R2YA 4FP5D 3RR5A 3RZDH 1GJXA 3E21A 5EKIA 3H3VI 4EQNA 1KABA 1SXJD 5JI3E 4NSOB 4APVA 4Q7JA 1SYBA 5IE8A 1BBXC 1OJLA 1UUPA 4Y52H 1AFPA 2NZOA 1FNWA 2MFIA 3JR5A 3SAWA 1BF4A 3QYEA 4POFA 5D3IB 1GHKA 4GEWA 4Z9CB 3T1HL 1D5MC 4WURA 3SFZA 4HJ9A 4B3TL 5FTMA 1H9SB 2F0UA 1MGSA 5CC4A 1VDDA 1SYCA 1EU4A 2F0SA 3M0EA 4I8OA 1K3RA 3S1RB 1SXJB 1GKHA 5C4HA 1IQPA 1ICWA 1VDLA 4DV6L 3J7AS 4BLCA 1KNAA 1T3TA 1PJIA 4RHRA 2DWMA 1FD7D 1V9PA 1WIVA 1U0LA 3S17H 1HNZM 4LFBL 2NN6I 2KDLA 4CIZA 4KT0F 1VEKA 1OAIA 1EWCA 2ZTDA 1LTAD 1STAA 2PW7A 3HJSA 1AE2A 4QIWE 3CMAA 5I9PA 1D8LA 1K3WA 1SYEA 1IZ6A 4B3SQ 3RD4A 2RCNA 1XMQL 4HJ5A 3SC3A 5KYIA 1SG9A 5HGTA 2UUAL 1WR1B 2EJGC 3RLNA 5LL6X 3S1QH 1OFHA 2F0OA 1R5LA 1Y1WG 1PRTB 2K6BA 1S3OA 2H1EA 2NVTH 3KSJA 4EIWA 4HEDA 3H09A 5GAGC 3S15B 3CAMA 1QDTA 1EIFA 3CCVA 2JA5G 4UHVA 3SHFA 2JY5A 2AHOB 4O0AA 4L8JA 4RCNA 2G3QA 4KHZA 2IT1A 1NNXA 3HRZC 2F3WA 4BS9A 3A7AB 4LUOA 5CV8A 2WKDA 4LUZA 4LFAL 2XWJB 1RF2D 3I4MB 4RKUF 5COYA 1EY7A 2DHYA 2EQSA 1ML0D 4RCOA 3J2PB 3MXNA 1L8QA 1YE9A 3J7YW 3HOZB 4MM3B 4L5SA 3H0GH 2OXPA 4TQUS 2J4XA 3KYHC 3CCUA 4DR2L 5FO7B 2RF4A 5DM73 1SNDA 4PMWA 3VK8A 1D5XC 2WSEF 2IW3A 5IYBH 5JPNC 1VF5C 1B50A 3A98B 1AE3A 2A6HD 3ULJA 1VF7A 5FOBB 2F0TA 3A8IE 4OX9L 1N32Q 1JJCB 4QUCA 2PO4A 1SFOH 3KDFB 2PYKA 1G2SA 5ELBA 4GOPC 4B3MQ 1N33L 2XSZD 1JOQA 1S5FD 4MIUA 3E4RA 3GLGA 4DUYL 3L28A 4OU7A 1FJGL 4IBEA 1YLAA 2VZAA 4B3RQ 2CV2A 1VQHA 5ITTA 3L2PA 2Y21A 2CWAA 1E9SA 1XNRM 1S5ED 4D81A 1TH2A 1N36M 5CORA 1LT4D 1Q1BA 5FK9C 5AJ3Q 2MPMA 2ZM6Q 4X3UA 4X62M 3M4YA
chains in the Genus database with same CATH topology
1Z7TA 2LNHC 2F0WA 2VB3X 4UAIA 1F2YA 2HHHM 3VR5A 2PZWA 2XGNA 4ZQ3A 2ERCA 3GLHA 3GTMB 2KJXA 1XMQM 1XMOM 3HU3A 4MHEA 2KA6B 2IX0A 4KD3A 1E0BA 2K01A 3GV6A 4S12A 1G8ZD 1Y1WB 2E2JB 3SHGB 3U6QA 4CISA 1YNNC 2G9DA 2M2LA 3Q0AA 1A3UA 3CQZB 4RA8A 3WOEA 1D1IA 1L0YB 2R92B 3ZC7B 3NXWA 4NMZA 4RNAA 1FJGM 4H13C 4KK7A 4L6TB 1JORA 3T51B 1G8PA 3GQ4A 2DZNB 3DHQA 4LF5M 1ZQ9A 4G7ZC 1JWMD 1KYIA 4GIPA 4DR2M 4FO2A 2F5OA 2WV6D 3MAQA 3C1FA 4LJ8A 1Z47A 1QZMA 2D2CC 5EQTA 3M6AA 3KOZE 1U4LA 1G291 3FMCA 5K5PA 4FCWA 3G7LA 5JEAJ 1STHA 2CHGA 2XZUA 3SARA 2JXMB 1TDZA 2KQ3A 2XF3A 5KNCA 1EE8A 2NVYB 2PW5A 1PYWD 4E6IA 3PUZA 5ITUA 4HCEA 1GUOA 1QCBD 2F5NA 4N9PA 4ITQA 4C3JG 2DHRA 5KO3A 1TQOA 2EUCA 2ZBKB 2KRKA 1J09A 4DR1M 3S14B 3IAYA 4A3DB 1WTWA 4IJFA 3RFWA 4RH6A 4DV4M 2QZ4A 1QJOA 3CRLC 2BOSA 2KECA 1IN7A 3P7JA 3NTIA 3ND8A 5CV9A 4A3EB 1FGBD 4HSPA 3K1JA 3KBGA 3ILKA 1N75A 1MBYA 4DR4M 1OXVA 2CW0D 2AUKA 4O42A 3GLFB 2H4OA 3KLSX 4DV5M 1IYVA 4QMGA 1QWYA 4WFN3 3D8BA 2Q8RE 4LFCM 1QB5D 1S5CD 1V1OA 1HA5A 1G59A 4DUZM 1L1ZA 1I3QB 4ZUJA 5M5XB 3SVMA 1SEBD 2F3VA 4DV3M 1DJRD 1GVNA 3J7BA 3GRVA 5GKNA 1Y69U 5FLXE 1HCZA 1WTQA 3R93A 2O5RA 3Q8XA 1L0XB 1PTOF 5BN5A 1NVMA 4FNFA 1PFMA 4F88A 2B8GA 1W5SA 3TWLA 2QENA 3H0GB 2EJMA 2F0KA 3MZ5A 3OWFA 1KTKA 5C3EB 3U6OA 5C6AA 4K8JA 4IFDH 5ITRA 1K8OA 1TS5A 5EBDA 2XVSA 4C1NI 3KP0E 2LH0A 3PO3B 4NRWA 2RKSA 3LMMA 4XXEA 2VQFM 2XSCA 1GUTA 4JK1C 4IUQA 5DNYA 4I65A 1WD0A 5JVG3 5LMNM 2I7PA 3SAVA 4OVZA 3CRKC 1WTOA 2XRSD 4DFAA 3TBIB 3I4NB 1EY4A 3D3RA 5CV6A 2D62A 4DNRB 4B3TM 2K47A 2R7ZB 2EJFC 2QBYB 4LF9M 2XH9A 3D4WA 1T5XD 1IW7D 1HQYE 4IJEA 1S4ZA 3P75A 3MVVA 3KUPA 4H44C 2F5SA 3NWTA 1LT6D 4DN4M 5D3DA 1M8AA 4ABNA 1TKWB 1TH3A 2G9HD 4XDXA 3IL8A 4K5XA 3FUTA 1KDBA 1CZWA 4CKEA 4B7FA 2ZXPA 1MD2D 1ZEQX 1A2TA 3MXUA 3C3LA 5EQ0A 4QB4A 4REZA 2EVBA 2O4XA 5C5MA 1WTPA 5ITYA 4X3TA 2MGSA 2A69C 1NY6A 3RGSA 4CGYB 1IN6A 1E2WA 3QG1A 4K6DA 1WVLA 1HNWM 1SNPA 3RUZA 1TU2B 1U4RA 3W0FA 3J80S 1HXYD 2FJ2A 3VR4A 3DFZA 3HU2A 3SR1A 3GTLB 1Q3CA 4LJ9A 4PDIA 1Q8IA 2K03A 1B2TA 2RQXA 1IY2A 2FMCA 1Z5CA 2H1RA 4QOZC 1CZGA 4LJ6A 5IZ7D 1BCPD 5ELFA 4OHJA 1Z5BA 5IGGA 2QBYA 5C4JB 1IXSB 1FNNA 5JI2E 4GC5A 4GHLA 1W6KA 1STNA 2VQEM 2JA6B 3W2DA 3PMFA 4ZRZA 2W82A 3U6EA 1DGHA 2BJWA 3HEJA 2V1CA 3OPOA 4TKOB 2YQZA 3K8ZA 3EQLC 1TIID 1GLNA 1TWCB 5M3MB 3FKIB 1NJGA 1IBKM 1PTOH 1DOMA 1SNCA 3DEPA 4AQYM 2CHQA 4LMQD 4ZUIA 4KJOA 2CE7A 1ZYRD 4DAPA 4A3JB 1SNQA 1MSHA 3D4DA 4S3SA 3VFDA 1QOHA 3A8JE 4PV1C 1U4PA 2C96A 1B4OA 1TR5A 2B2TC 4L8RC 2QPAA 3KOWE 2R46A 2RDHA 4XYOA 5BN4A 3VK7A 2F0NA 5CYUA 2F0HA 2DN8A 1D5ZC 3SAUA 5BPVA 2A5HA 4IALA 1II3A 1HHVA 1E9RA 1DM0B 1DCZA 2HQEA 5J22A 3TWMA 5ELEA 4G4NA 1TVXA 1EZ8A 1SYDA 4A3BB 5EJCA 2QF7A 3NK9A 1L2DA 5C3XA 1KFVA 2VB2X 1NJFA 3CF0A 3KBXA 3K57A 5K36H 4BA1I 3HZXA 3A56A 3IFTA 3HS0C 4QF4A 2VUMB 2FE8A 4MGHA 2QILA 2MP1A 1HT2E 1Z6HA 3FUWA 2E2DC 3GTGB 3GRRA 2O5IC 2HCBA 5I6YA 3EVQA 3WDNA 2C9CA 4K6LA 4IBKA 5ISRA 1DYQA 3LVWA 2Z7JA 4IBBA 1HR0M 1SJED 4HR7B 4BB9A 1ZYRC 3V96A 4DAYA 2I7NA 4R7GA 1IBMM 1LT3D 2M00A 1ONLA 3J27B 2LKVA 5EXSA 1U9RA 2X6GA 4B9XA 4R3DA 3U6PA 4WW0A 3WHKA 3AU7A 3HP3A 1NR4A 3K58A 1ZXTA 4XQQA 2E2HB 3SMPA 3OSOA 3VYTA 2EYOA 3V05A 3BDLA 5A35A 4LGMA 1DO2A 3J81S 2K1BA 2CHVA 5A2QE 2RVLA 2DZOB 3JAME 1R2ZA 4D82A 1KDAA 3MWYW 1Q1EA 1C4QA 1O7YA 2XFSA 3A55A 1CI3M 5DM63 3K59A 5LMUM 4RHSA 1F9PA 2UUCM 3C2PA 5C0XI 3K5LA 2D7GA 4KN7C 1X32A 2ENBA 4QHTA 1Z6TA 1JE4A 5ITXE 4GRIA 2AWNA 2OQ4A 4NKLA 4G7HC 4AKHA 1HTPA 5CBAE 1HT1E 5JOBA 3HHWA 4NW2A 2DWZB 2IJ0A 2NVXB 4WRDA 1AP0A 5DNFA 2NTSA 1A3VA 5A2QS 1I6VC 4IBGA 2ZAOA 1F9SA 3BVZA 2EE1A 1XTCD 1JR3A 2QCUA 2RGHA 3BZDB 2E5LM 2RSNA 1YSYA 4OVZB 4RGNA 3KLRA 2NBFA 3HKPA 1VMPA 3D8GA 3I4VA 3U9SA 1EQVA 5LL6S 3RGPA 4FF4A 1JWSD 3D31A 3TP5A 4K2KA 3GTPB 4IFDG 3PIP3 5F3WA 2CQAA 2V1UA 4HSVA 3TPZA 4X3KA 2R93B 1O78A 4MGIE 3NSWA 2EDGA 2F5PA 2HUGA 4RGTA 4DUYM 3PFIA 2M9VA 1F2MA 1ESRA 1TWFB 1BR9A 3FDTA 4KV6A 5IT9L 1PZJD 4C56C 5FSWA 3JAMS 4RKLA 1KNEA 4ILWA 5I6WA 2F4IA 3B9PA 1FNVA 3A7LA 4MH0E 3BYYB 2HKJA 1D6EC 1U4MA 3CU7A 5IGDA 2B2VA 4AI6A 4D80A 5EP2A 1G4AE 4Q5VA 4FXGC 3KOXE 3NTHA 1HRJA 2JP1A 4L16A 4ZKCB 1TY0A 1SE3A 3X3MA 3O13A 3EFXD 2QDBA 1FYCA 4X65M 3MXGA 1CA6A 1EFID 1XXHA 5M5WB 4FF3A 1PMRA 4KMUC 2EYFA 5FLXL 5IT9E 4G6ZA 2F0IA 1TDHA 4P2CB 3J81L 2X4AA 4QOSA 2CFOA 1EYCA 3HOWB 3K7AB 1AN8A 3UGJA 2HCCA 4JI4M 4NOOB 4KLNA 2A74C 4UDUC 3E5SA 1BOSA 3S16B 4A93B 3W0LB 4KKUA 3K92A 2UUBM 2Z4HA 5IOCA 2R45A 3ZCBB 3N52A 5C0XH 5IWAM 1UAPA 4KHPM 5LHY1 2KRUA 3KVWA 3QAUA 3LVVA 1SMYC 2R3ZA 1IY1A 1LTSD 4FCTA 3L25A 1FNUA 1OXSC 1R4PB 4U68A 5FLXS 2WACA 1I4QA 3GTKB 1N32M 3C1EA 1MSGA 4LFAM 5KPRA 4MGKE 2EY5A 4TUWA 5F2DA 1AZQA 2F0MA 5EKKA 3H3VC 4F7XA 1I6HB 5ITXA 2GA4B 1JCKB 3SASA 2K33A 2OPFA 1J5EM 4J6HA 2Y0TA 2QKIC 2DY8A 3BYTB 1EIHA 4OO1I 3HJQA 2E2IB 4LJ5A 2JEAI 2ICEC 3A46A 5DYGA 3T16A 2UU9M 4KKSA 1IKLA 4A3VB 1NUCA 1B53A 3KK7A 2F0DA 3VYRA 3HOYB 3Q24A 4FYDA 2KVMA 3VR3A 3S2DB 3D6WA 4FD2A 2RA4A 3S1MB 1D2NA 2R4EA 2KHSA 3TL4X 1CHPD 3A54A 2HCIA 4L15A 1R7RA 5CV7A 4NDXA 4FVMA 2XZFA 4ZLTF 2BA1A 4QIWB 5I4DA 1V1PA 3DZDA 4QUFA 3T1HM 5J1ZA 3HOVB 3TP7A 3HG9A 4EQOA 4ZKBB 2L6OA 2B2WA 4RAUC 1ILQA 1VMCA 2LY7A 2A6HC 5IGEA 3M3YB 4M9XA 2PMZB 1STYA 2M60A 1ILPA 2SNSA 4IBFA 3I70A 3AOEA 3QB3A 3NBIA 2KCCA 2B2UA 4IFDJ 2K7VA 2PCFB 1CQVA 3I90A 1R4QB 2HDLA 2ZANA 2QEJC 3SEBA 4JYAM 3T56B 1MI2A 4DR7M 4PMCA 5J39A 2TMPA 3FEWX 3J7AF 1MX0A 1OXTA 5ELDA 3MEHA 4BBRB 2ZXRA 4G4RA 2NYZD 5ITQA 1JWUD 4IUVA 3C58A 2EYJA 3TN2A 3ND9A 2XN9C 3HU1A 5E4XA 2JA5B 4LG2A 1I4GA 2JA2A 5EPJA 3TZUA 1V8QA 2F03A 4OIKA 1LT5D 4JI0M 1RCVD 3AL0C 2A5YB 2KW0A 1QYRA 1WTRA 2WINB 4HL4A 1PFNA 3ONAB 1NSFA 1Q39A 4JN6A 4X64M 2I46A 1WTVA 2NQ8C 1IW7C 2F0QA 3D8LA 4OX9M 1GUSA 1LO5D 3CKIB 1HFNA 1QE6A 1I4RA 4H7BA 2EYLA 2R61A 3X3NA 3MTSA 7CATA 3NP8A 1HPCA 4FCVA 1B44D 2A69D 2EXZA 5KNBA 3FUXA 3BG3A 4DR6M 3VR2A 1QILA 1R9TB 3KXEC 1DD2A 4HMIA 3KP1E 4LF7M 2CV1A 5EXPA 2FFJA 1Y8OB 4PNYA 3GRUA 2K5DA 4QNMA 1TGUA 3BOSA 3VA7A 3QWLA 1H9MA 3PUYA 3ITPA 1STGA 3I4LA 3DEOA 4R9WA 5C0XJ 4DR5M 5DEHA 1GUNA 4NRVA 2EOTA 1HTLD 1NHGC 1KLGD 4V190 4IUUA 1EZ6A 2X6LA 2B39A 1PRTC 3U9OA 2KCNA 1PTOD 1ENFA 3WHLA 2B2TA 2XWBB 3BVGA 2EYHA 2Z8LA 2FNAA 2FFKB 1QAQA 1K82A 4A3KB 2KA7A 1LABA 1QNUA 2D7HA 3R2IA 3FVQA 3U6LA 4KD4A 1I4PA 1VDZA 4QCLA 4RKBA 1BNZA 1CK1A 1F2LA 5E26A 1Q3BA 1BDOA 3R8FA 4FWGA 3FTCA 1GUGA 3BS1A 5KQDA 1CM9A 3OWEB 5HURA 2C99A 4PCZA 2K04A 1STEA 1NY5A 3TDQA 5A2QL 2LMCB 4NXNM 1HQCA 1N34M 2B8FA 3LQRA 1LV9A 3H94A 2X8AA 5D14A 4CKBA 1EIGA 3HGIA 2PZUA 4XTCS 2BDNA 3GLIB 2QP9X 2R62A 2ICIA 4MGZE 4HMJA 4RWSC 1SXTA 3EIHA 5C18A 1K3XA 4BWGB 1NHWC 4G7OC 3R3OA 2F1MA 3CF6E 3GRYA 4X66M 5KPTA 4NP5A 4B9WA 1CA5A 4I7ZC 5EP3A 5C4XB 1QANA 1TY2A 1PJJA 1HA6A 3PUVA 1H9JA 3UJNA 4C2MB 2UUAM 2RDFA 1V43A 5CMDA 3T53B 1RTNA 5E6JA 4WORA 1LTRD 4B08A 2E76C 2AWOA 2FINB 1NAPA 2LS01 2D7EA 4CJ2C 1PM5A 2P5TA 4C3IG 3UZUA 1QAMA 3L3OC 3FTDA 1NSNS 1DGFA 3VA5A 4JI1M 3GQ5A 4ME5A 4CBVA 1IN8A 3SYLA 5C4ZA 4OO1G 1AEXA 1NR2A 3FYDA 2YYZA 4AKIA 2B2VC 5KRUA 4DV6M 1G2TA 1JOOA 1LTTD 3VDPA 1DGHB 3GO5A 5FKAC 3GV3A 3DM1A 2DWLA 3Q22A 4C1NK 3E6ZX 4DNTB 4EQPA 1QG7A 1Q90A 3MJ5A 1BCPF 1C1KA 3QJYA 1IN4A 4ULLA 1SYGA 4JI7M 1MU5A 1ZKOA 4KJNA 3TP6A 5AFWA 1X37A 2F4VM 4GMQA 1TS3A 3QOLA 1Z5AA 1K83B 1I4HA 1RDPD 2JEBI 4MGYE 2RDGA 4IZ8A 4G57A 1GXDC 3OW7A 1AZPA 5KPZA 2KZUA 3H4MA 4O1NA 1EYDA 1DXMA 1DO0A 1CFMA 3KFUG 1XHBA 1BO0A 2SNMA 5KEEA 1R6BX 3MFGA 1G41A 1PXUA 4F87A 1IN5A 1SAPA 1CQFA 2XFTA 1PFBA 1XC8A 2F0EA 1EY9A 4ID6A 2D9UA 1TWAB 4XYQA 4I4LA 3TSSA 3LNNA 3SE0A 1SSOA 1F77A 3JR4A 5JPMC 5EKLA 1WXQA 1PRTD 2B63B 2F5QA 3NPPA 2R6GA 5E1FA 3TE6A 5EXTA 1KAAA 1G91A 1PTOB 3GLHB 2D5DA 4XIGS 4DR3M 3AB9A 2KXEA 1B9MA 4F8MA 4GKJM 3GO8A 3HGBA 1EY6A 1QVRA 1QNKA 3OHXC 1Z59A 3MHVC 4IURA 3FD9A 4II7A 1ET9A 3GQ3A 5CV5A 4BBAA 4CJ0B 2PQEA 1OXXK 5M5YB 2L09A 3U60B 2NZ1D 3R8BA 4Z8XA 3VDUA 4JI8M 1S5DD 4IFDI 1JR3D 1BXTA 1B9NA 4IQZA 2IWHA 1SE4A 1JOKA 2KOLA 1FR3A 4PQXA 4K8IA 4CKCA 2PZTA 2CHBD 4IBIA 4XBOA 5IREB 3U61B 2XIWA 2IX1A 2JA7B 3PVSA 3A8KE 4A3FB 1TWHB 3PUXA 2F0FA 3U6DA 2AQ1B 5JEAG 4LF8M 4G4KA 4M1UB 1PTOC 1ENCA 1XWEA 4B3RM 4GC9A 3F2UA 2KEDA 1YNJC 2B2UC 3AOEC 2ID0A 1RHPA 4A3IB 3NE5B 3NWSA 1VCIA 1XX8A 3I4YA 4JV5M 3PUWA 2Z3XA 3MXPA 3N6RA 1HNXM 4K0KM 3RZOB 3KW6A 4ZK9B 2VNUD 1IL8A 5EPKA 1H9KA 1JICA 3S9WA 1HQRD 2DY7A 1SYFA 2L0CA 4LZZA 1B1ZA 1RTOA 5EJWA 4LJAA 5EBCA 3Q6SA 2SOBA 2NTTA 2ZAMA 3L7ZC 3FUUA 1SMYD 2Z1CA 2L11A 2MUYA 4JI6M 4KY5A 4CJ1B 2EYMA 3DWQA 5CBEE 1GL7A 3CTWB 2L4NA 3GQBA 3U5ZA 2G5GX 1DOLA 2L5TA 3BDCA 2LXEA 3HHZA 3RE8A 2Z4SA 1SNOA 1RODA 1L1TA 5CV4A 4DV2M 1RJTA 4DV7M 1EY8A 1KSFX 1ESFA 3T4AC 1SXJC 5IODA 5DYIA 3IG8A 4C3HB 5TSSA 2FOIC 3GPXA 1EU3A 1IXZA 5M9OA 2KUMA 3J81E 3VKHA 3SXHA 1J8IA 3UK6A 2B2WC 2KEEA 1IKMA 2A68D 4MN3A 5JVH3 1W6JA 2HL7A 2WIIB 3KDSE 1LACA 3EJIA 1QAOA 1LLRD 3NHHA 4AG5A 3NQIA 4H0LC 2DVWB 3T1YM 4B3MM 1O7ZA 1SXJE 2RGOA 3CF2A 2NVTB 1PZKD 3U6SA 2DXIA 2E74C 4TRDA 1CTMA 4I81A 3T13A 5IIFA 1J9OA 4BBSB 1A2UA 1WTXA 1XXHB 2SDFA 3AOGA 2CVRA 1G6ZA 2Q2EB 3SK8A 2AUJD 2IPKD 1HUMA 4LRSA 1LV7A 2EO2A 4XGIA 2K28A 4A3MB 4FWDA 2NN6G 3EIEA 3U6MA 2FHTA 3S2HB 3U5ZB 4PMBA 2C98A 4I5SA 2PNRC 3H6MA 3SYKA 4OL7A 3JAML 2DNCA 1OFIA 4GHAA 1Y1VB 1EWHA 2XRQD 1Q3LA 1D1KA 2WKCA 4LY6A 2C5CA 3MC0B 2BE5D 3D4RA 4LF4M 2O5JC 3RLFA 3OMCA 2JE6I 4KY6A 1STBA 5C5LA 1EL0A 3SK4A 4JI3M 2IL8A 1ORYB 3PXGA 2F0VA 1AW7A 2NUCA 3Q23A 3GD7A 5K36G 4M0WA 5FO8B 4L4UA 2Q8TA 1V1PB 1DOKA 4HLQA 3FUVA 1SDFA 1SBBB 3L9AX 5C3WA 3I91A 1WD1A 4BY7B 3U60A 3GPUA 3AJIB 3OOCA 2F0GA 2EYPA 2L9HA 3I72A 2XNAC 2CV0A 3AKZA 4M0DA 3GTQB 3VYUA 1GUWA 3KOYE 1JQJC 3LWEA 3GP1A 2PPBC 3L29A 1E32A 1M4VA 3HWSA 2WAQB 4AYBB 3QO2A 3RMHA 3PV0A 3DWPA 2EA0A 1WCMB 4RFBA 3L26A 5EP4A 4YHHM 4ZAIA 3HOUB 1TWGB 1ET6A 4M9SA 2L55A 3NQTA 5KQ8A 1E2VA 2QCPX 4B7HA 1H6UA 4C3JB 3GTJB 3T15A 3E9SA 5I2XA 3SBJA 3KS8A 4J8QA 2J7OA 2C5RA 3M7NA 2F0PA 3K5OA 5IGCA 4FXKC 3UMMA 4DU9A 2F0JA 4W5WA 1L2CA 3I8ZA 4Y7NB 2N55A 3QWNA 2CEAA 2AQ2B 2Z4IA 4AKGA 1PRTF 1XWIA 2KEBA 2KZSA 3HOXB 3K5MA 3BVMA 4HCSA 2MHVA 4EGVA 4AW4A 4PDGA 2EPBA 4TSSA 3PNVA 4B3SM 4ODGA 2YFQA 1CT1D 5C0XG 4LGYA 2R65A 1XYIA 4KO8A 2Q8IB 2R18A 4RGMA 4IUNA 2IX3A 1XXGA 2A68C 5T1GA 4GZYC 3P1HA 1QQWA 4FXDA 2K32A 1B3AA 4CHTB 1IXRC 2BJVA 3EROA 3GTOB 3DA1A 3CHBD 5C44B 3IFDA 4C3HG 4DXFA 4G4QA 2WB1B 1D2BA 3KLSA 2F0LA 1LTGD 4V0BA 1JB3A 1E2ZA 3K2LA 1SJHD 2LFNA 2O2LD 1Q12A 2K5QA 2BDOA 5FTKA 3P20A 2Z4RA 3ZH9B 3THGA 4IIWA 3SATA 1O7LA 4NL4H 1SFOB 4HTHA 2XLJA 4PT5A 1GKIA 4A3GB 2NVQB 5KGUA 4LF6M 4QHSA 1NCVA 5KYLA 1LTID 3NWLA 3QIAA 1EOTA 1N77A 4DAVA 3AMUA 4FF1A 4OW0A 2RBMA 3KF8A 4RF1A 1UNSA 4GKKM 3FTFA 4Z6YA 5G3LF 3S1QB 4WJWA 5JJZA 4IUPA 2RKOA 1CHQD 5IT9S 3LWUA 4KN4C 1BUVT 2JSOA 1DZ1A 1BQQT 3KS4A 2X49A 4LJ4A 1G3IA 4EVOA 2Y0QA 2XEPA 4GH9A 4KTAA 1W5TA 4AZFA 4DV0M 2VXWA 5H37D 2K6AA 2L1BA 3PO2B 2A6EC 1I4XA 2X69A 2A6ED 3NBHA 3L27A 4LJZC 3IG5A 1Y8NB 1OO9B 3SK6A 1JC7A 2UXDM 1RKNA 2I07B 2BCOA 2ZXOA 5KNDA 3A42A 2AHMA 4FW9A 2J7ZA 3SMSA 1I94M 2L7HA 1NNUC 3GPYA 5FTLA 3OIQA 4B7GA 4OIJA 1TH4A 1ZAEA 4DV1M 1BCPC 5I9OA 3VYSA 5IGBA 5KIXA 4IBDA 5BR8M 3GP7A 1L2BA 1K8MA 3AFHA 4M9ZA 1T5EA 3RZDB 1XNQM 4K14A 2BNKA 5EXXA 5FTJA 3M7GA 1I4WA 4PD2A 2C9OA 3J80L 3AV0A 2CUZA 5BN3A 3NUCA 2UXBM 1YNND 3IKJA 3H91A 2EY2A 4ZPXA 2BE5C 4HAEA 1EEFD 3R2TA 3KSXA 3L2AA 3FYCA 1A15A 4IUTA 2K5WA 1GOZA 3ZYYX 4JBWA 2DNEA 5T1IA 2J7NA 4U673 4DA2A 4DK1A 1UEAB 2SEBD 2Y20A 2K05A 3U6CA 5FO9B 1DONA 2ZT9C 3URYA 4YY3M 2L7IA 3MFYA 4LZJA 1PZID 2UXCM 2LWXA 3FRPB 3TP8A 2XSZA 3SDZA 3W3AA 1A3TA 5JAVA 3NTKA 4FF2A 2EY6A 3G6JB 1PDQA 2FMMA 3DWAA 4K5VA 2V6ZM 5FTNA 2CW0C 3ERQA 4DXGA 4R8IA 1IYUA 4HN7A 3TMEA 3S17B 2NN6H 4BA2I 5IGFA 3FTEA 4NXMM 1HUNA 5CGKA 1EY5A 4P16A 1IY0A 2G8LA 1BCPB 1S3SA 4DK0A 2Y0SB 2OEOA 1Y8PB 4L63B 5EP1A 3FPUB 4KHVA 3GLGB 4DF7A 3DXJC 2BA0A 1YUBA 4R8NA 4MB7A 5E4WC 4IBCA 1KDCA 3I3CA 3FKEA 1E94E 3TQSA 3R9XB 3LQQA 4AG6A 2L12A 3V2TA 3VLFB 3K0YA 2YNMD 3QOJA 2E75C 3MA2B 3GPPA 1SNMA 4LFBM 1KLUD 1S5BD 1EY0A 4BY1B 3DMUA 4X3SA 3DUZA 5CR3A 4JI5M 1DGBA 5I2YA 2RSOA 2NWGA 2VIIA 3I73A 1C8CA 4XQNA 3FPPA 4DGZA 2EY1A 2ZM6M 1HFGA 4OO1H 3PIO3 4KKTA 1SE2A 2J0TD 4ZYSA 3SHLA 1GHJA 2OF1A 4FWHA 5NUCA 1IBLM 4YIJA 3HHXA 2R4JA 1EEID 2WP8J 3J7AV 1N78A 1X3QA 4IBJA 4C3IB 1IHZA 2YR0A 1RD9D 1H9RA 3I51A 1JQYD 3LX0A 4G4OA 1EQTA 4M8AA 2HDMA 5ELCA 1OXUA 3UI2A 3A45A 3PNYA 3K5NA 1C48A 1ENAA 4KODA 5EGTA 4JXJA 3C46A 1EYAA 4LJ7A 1LTBD 4XT3B 4Q0FA 1F2ZA 4J1MA 2MJ8A 4LCBA 3SK5A 1F9QA 3MHBA 8CATA 1O80A 4LRTA 2N88A 2NB0A 2V4DA 3M4OB 3EA6A 3VR6A 4QNRA 3OMGA 4JI2M 4N9TA 3OIPA 4K2LA 1IM2A 3TZDA 1HQMC 1JR0D 1TS4A 5DAUA 1I50B 2B2YA 2AQ3B 1DGGA 1TS2A 5G3LD 1X3PA 1SXJA 1PLFA 1TT2A 1A6XA 4RGOS 3HKZB 4NSRA 5C1BA 1NNJA 3VKGA 2OT2A 5JEAH 2JYOA 3U61A 5D65A 3E0JA 2YU9B 3T38A 1GL6A 4LAAA 3MK6A 1F9RA 2A73B 3GLFA 2B2YC 3J80E 1H9SA 1UM8A 3HJ8A 3M85A 2TSSA 1J7KA 4L78A 3HHYA 4LK1C 4RF0A 5EPLA 3S1NB 4XT1B 5M3FB 4GITA 4KI0A 2M5ZA 3K6OA 4K5WA 3DOAA 3BDOA 3WOFA 3D6CA 1YNJD 2JA8B 1N33M 5E3FA 3TWKA 2EZVA 3GLIA 2DWNA 4XQJA 4IN3A 4OGQC 4KY7A 3OTOM 1R2YA 4FP5D 1GJXA 5EKIA 4EQNA 1SXJD 1KABA 5JI3E 4NSOB 1BBXC 1SYBA 1OJLA 1UUPA 1AFPA 1FNWA 3JR5A 3SAWA 1BF4A 5D3IB 1GHKA 4Z9CB 1D5MC 4WURA 3SFZA 5FTMA 1H9SB 2F0UA 1MGSA 5CC4A 1VDDA 1SYCA 1EU4A 2F0SA 3M0EA 4I8OA 3S1RB 1SXJB 5C4HA 1IQPA 1ICWA 3J7AS 4BLCA 1KNAA 1T3TA 1PJIA 4RHRA 2DWMA 1FD7D 1HNZM 2NN6I 1EWCA 1LTAD 1STAA 2PW7A 3HJSA 5I9PA 1K3WA 1SYEA 3RD4A 3SC3A 5KYIA 5HGTA 2EJGC 5LL6X 1OFHA 2F0OA 1PRTB 2H1EA 3KSJA 4EIWA 4HEDA 3H09A 3S15B 3SHFA 4L8JA 4RCNA 4KHZA 2IT1A 3HRZC 2F3WA 4BS9A 3A7AB 5CV8A 2WKDA 2XWJB 1RF2D 3I4MB 5COYA 1EY7A 4RCOA 1ML0D 3J2PB 3MXNA 1L8QA 1YE9A 3J7YW 3HOZB 4MM3B 2OXPA 4TQUS 2J4XA 5FO7B 5DM73 1SNDA 4PMWA 3VK8A 1D5XC 2IW3A 5JPNC 1VF5C 1B50A 3A98B 2A6HD 1VF7A 5FOBB 2F0TA 3A8IE 4QUCA 2PO4A 2PYKA 1G2SA 5ELBA 2XSZD 1JOQA 1S5FD 4MIUA 3E4RA 3GLGA 3L28A 4OU7A 4IBEA 2CV2A 5ITTA 2Y21A 1E9SA 1XNRM 1S5ED 4D81A 1TH2A 1N36M 5CORA 1LT4D 1Q1BA 5FK9C 2MPMA 4X3UA 4X62M 3M4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGY B;  3NBI A;  4CHT B; 
#chains in the Genus database with same CATH topology
 1PFS A;  1Z7T A;  3I4N H;  2LNH C;  4LFC Q;  2F0W A;  2VB3 X;  4UAI A;  1F2Y A;  2HHH M;  1QVC A;  3VR5 A;  3KFU A;  2PZW A;  5JJK A;  2XGN A;  4ZQ3 A;  2ERC A;  3GLH A;  3GTM B;  2KJX A;  1XMQ M;  4P71 A;  1XMO M;  3HU3 A;  4MHE A;  2KA6 B;  2IX0 A;  1VQ7 A;  4KD3 A;  1E0B A;  2JA7 G;  1PGY A;  3DLL A;  2K01 A;  3GV6 A;  4EQ5 A;  4DR4 L;  4S12 A;  1G8Z D;  1Y1W B;  2E2J B;  2CRU A;  3SHG B;  1X3F A;  1YJ9 A;  3U6Q A;  4CIS A;  2BH8 A;  1YNN C;  3M3Y H;  2G9D A;  1MKH A;  2M2L A;  3KDF A;  3Q0A A;  1A3U A;  3CQZ B;  2WZJ A;  4RA8 A;  4GNX A;  3HOY G;  4DR4 Q;  4IPD A;  2DJG C;  3WOE A;  1D1I A;  1L0Y B;  3FKI H;  2R92 B;  3ZC7 B;  3NXW A;  4NMZ A;  1LUZ A;  4RNA A;  1FJG M;  4IJL A;  4H13 C;  4KK7 A;  1TF0 B;  4L6T B;  4X66 L;  4JW0 A;  3T51 B;  4DR1 L;  1JOR A;  1G8P A;  5DFL A;  3GQ4 A;  4JI0 Q;  2N3S A;  2DZN B;  3DHQ A;  4LF5 M;  2DAI A;  1CKO A;  1ZQ9 A;  1X3E A;  4G7Z C;  1JWM D;  1VQP A;  1KYI A;  1Q86 C;  3HOU H;  4GIP A;  4DR2 M;  1SMX A;  4FO2 A;  2F5O A;  4HEO A;  3S2H H;  2WV6 D;  3MAQ A;  3C1F A;  4LJ8 A;  3HOX G;  1IXS A;  1IYJ B;  1Z47 A;  1HZB A;  4OWT B;  2B3G A;  5IP9 H;  1QZM A;  3FE3 A;  5EQT A;  3M6A A;  3KOZ E;  1U4L A;  2D2C C;  2ZM6 L;  1G29 1;  1T9H A;  3FMC A;  5K5P A;  4FCW A;  3G7L A;  2YU9 H;  5JEA J;  1STH A;  4DV0 L;  2HD3 A;  2IHE A;  2CHG A;  2XZU A;  3SAR A;  2JXM B;  1A8V A;  4LF5 Q;  1TDZ A;  2KQ3 A;  2XF3 A;  4JBJ A;  2QW7 A;  5KNC A;  2LVO C;  1EE8 A;  1P16 A;  2NVY B;  1VQL A;  2PW5 A;  1YIT A;  2EXD A;  1PYW D;  4E6I A;  3PUZ A;  5ITU A;  1JR3 E;  4HCE A;  4A93 G;  1GUO A;  1QCB D;  2F5N A;  3CPF A;  4N9P A;  4ITQ A;  4C3J G;  4MNO A;  2DHR A;  5KO3 A;  1TQO A;  2EUC A;  2ZBK B;  4EX5 A;  2KRK A;  1J09 A;  4JI3 Q;  1PH1 A;  4DR1 M;  3S14 B;  3IAY A;  3HOU G;  4A3D B;  1WTW A;  4IJF A;  3RFW A;  1KHI A;  3CCJ A;  2KBN A;  3PO3 H;  4RH6 A;  4DV4 M;  2QZ4 A;  1QJO A;  1VQD A;  1XNQ L;  3F8T A;  3CRL C;  5IY0 A;  2BOS A;  2KEC A;  1IN7 A;  2RRU A;  4JOI C;  3P7J A;  2WAQ G;  3NTI A;  3ND8 A;  4F1I A;  5IYC G;  5CV9 A;  4A3E B;  1FGB D;  4HSP A;  3K1J A;  3KBG A;  3ILK A;  1XMO Q;  4LF9 Q;  4YWM A;  1N75 A;  1MBY A;  1V1Q A;  4DBG B;  4DR4 M;  1OXV A;  2CW0 D;  2AUK A;  4GLA C;  4O42 A;  3GLF B;  2H4O A;  3KLS X;  4DV5 M;  1IYV A;  4QMG A;  1QWY A;  4WFN 3;  3D8B A;  2Q8R E;  3KLW A;  4LFC M;  1QB5 D;  1A62 A;  5HY6 A;  4IOA A;  4YHH L;  1S5C D;  1CSQ A;  1V1O A;  1HA5 A;  1G59 A;  3HKZ G;  4DUZ M;  1L1Z A;  1I3Q B;  4ZUJ A;  5M5X B;  3GLF E;  3SVM A;  1SEB D;  2F3V A;  4DV3 M;  4YHH Q;  1DJR D;  1GVN A;  3J7B A;  3GRV A;  3TRZ A;  5GKN A;  1Y69 U;  5FLX E;  1HCZ A;  1WTQ A;  3U50 C;  3V76 A;  4Y28 F;  3R93 A;  3CC2 A;  2O5R A;  3Q8X A;  1L0X B;  5IYC H;  1PTO F;  5BN5 A;  4JI1 Q;  1NVM A;  4FNF A;  2B63 H;  1PFM A;  4R4Q A;  2B8G A;  2HQL A;  4F88 A;  1W5S A;  3BU2 A;  3TWL A;  2QEN A;  4DR2 Q;  3H0G B;  2DKL A;  2EJM A;  2F0K A;  3MZ5 A;  3OWF A;  1KTK A;  5C3E B;  3U6O A;  5C6A A;  4K8J A;  5ELN A;  4IFD H;  5ITR A;  1R4G A;  1K8O A;  1TS5 A;  1K3B C;  5ELO A;  5EBD A;  2XVS A;  4A3L H;  3PSI A;  4C1N I;  3KP0 E;  4MZ9 A;  4QL5 A;  2LH0 A;  3RN2 A;  3PO3 B;  4YY3 Q;  4NRW A;  2RKS A;  3LMM A;  1I50 H;  4AYB E;  4XXE A;  4GKJ L;  2VQF M;  1X6O A;  4O2D A;  2XSC A;  1V92 A;  3KF8 B;  1GUT A;  4JK1 C;  4DV0 Q;  4IUQ A;  1P3Q Q;  4DV2 L;  5DNY A;  4I65 A;  1WD0 A;  5JVG 3;  5LMN M;  1X56 A;  2I7P A;  3SAV A;  4OVZ A;  2L15 A;  3CRK C;  1WTO A;  2XRS D;  4DFA A;  1YHQ A;  3FRH A;  3TBI B;  3I4N B;  1EY4 A;  2JJQ A;  3D3R A;  5CV6 A;  1UFZ A;  2D62 A;  1SRU A;  4DNR B;  1X55 A;  1Y1V H;  4B3T M;  2K47 A;  2R7Z B;  4N8X 1;  2EJF C;  2QBY B;  2XTI A;  4LF9 M;  4DR7 L;  2XH9 A;  3D4W A;  1T5X D;  1IW7 D;  1K0R A;  5GRO A;  1HQY E;  4IJE A;  1S4Z A;  3P75 A;  3MVV A;  1M90 C;  3KUP A;  2JNH A;  4ME3 A;  4H44 C;  4A3L G;  4HIK A;  3TEH B;  2F5S A;  1I5F A;  4AIM A;  3NWT A;  1LT6 D;  4DN4 M;  5D3D A;  1M8A A;  4UP7 A;  2K52 A;  4ABN A;  1TKW B;  1TH3 A;  2G9H D;  4XDX A;  5L37 A;  3IL8 A;  4OWX B;  4K5X A;  3FUT A;  1KDB A;  3PF5 A;  1DGS A;  1CZW A;  1EUJ A;  4CKE A;  2N35 A;  4B7F A;  2ZXP A;  3PCO B;  1PV4 A;  1MD2 D;  1ZEQ X;  1OAO C;  1B70 B;  2ZJP A;  1A2T A;  3MXU A;  3C3L A;  2CFM A;  5EQ0 A;  4QB4 A;  2ZJR A;  1EIY B;  1B3Q A;  4REZ A;  3GLI E;  2EVB A;  2O4X A;  5C5M A;  5ITY A;  4DV6 Q;  4X3T A;  4DV7 Q;  1WTP A;  3S16 H;  2MGS A;  3B7Q A;  2A69 C;  2IHF A;  1NY6 A;  2KHH A;  3HOW H;  3RGS A;  2VDB B;  4CGY B;  2K14 A;  1IN6 A;  1E2W A;  3QG1 A;  4K6D A;  1WVL A;  4BXX G;  1HNW M;  1SNP A;  3RUZ A;  1TU2 B;  1U4R A;  3CCM A;  3W0F A;  5IYD G;  1K9M C;  3J80 S;  1D0K A;  1HXY D;  2Q2I A;  2FJ2 A;  3VR4 A;  3DFZ A;  3HU2 A;  2DUD A;  3SR1 A;  3GTL B;  1Q3C A;  3S2D H;  4LJ9 A;  4PDI A;  4JG2 A;  1Q8I A;  2K03 A;  1B2T A;  2RQX A;  1IY2 A;  2FMC A;  1Z5C A;  2H1R A;  4LF6 L;  4QOZ C;  1CZG A;  4KHP Q;  4LJ6 A;  2XGT A;  5IZ7 D;  1BCP D;  5ELF A;  4OHJ A;  1Z5B A;  1TWA H;  5IGG A;  2QBY A;  5C4J B;  1VEG A;  2VQE Q;  1IXS B;  1FNN A;  5JI2 E;  2CWP A;  4A3I G;  4GC5 A;  4GHL A;  1W6K A;  3B7Z A;  1VQC A;  1STN A;  2VQE M;  2JA6 B;  4HJ7 A;  3W2D A;  2H5X A;  4JI8 Q;  3PMF A;  4GKJ Q;  4ZRZ A;  2W82 A;  3U6E A;  1DGH A;  3HX3 A;  3J80 i;  1VQ8 A;  2BJW A;  3HEJ A;  2V1C A;  3OPO A;  4TKO B;  3W1G A;  3E9I A;  4JI5 Q;  2YQZ A;  3K8Z A;  3AFQ A;  4WJ3 M;  3EQL C;  1TII D;  1GLN A;  1TWC B;  5M3M B;  3JAM c;  3FKI B;  1NJG A;  1IBK M;  4AQY L;  1PTO H;  4A3F G;  1DOM A;  1SNC A;  2KNV A;  3DEP A;  3CCE A;  1G71 A;  4AQY M;  2CHQ A;  1JE5 A;  4LMQ D;  4ZUI A;  4KJO A;  2CE7 A;  1ZYR D;  4DAP A;  4A3J B;  1HNX Q;  4K0K Q;  5C4X H;  1SNQ A;  1MSH A;  3D4D A;  4S3S A;  1QZG A;  2Z0S A;  3VFD A;  1J6Q A;  1QOH A;  3A8J E;  4PV1 C;  1PJT A;  1U4P A;  2C96 A;  1B4O A;  1WJ7 A;  1TR5 A;  2B2T C;  4L8R C;  1IBL L;  4Y7N H;  2QPA A;  3KOW E;  2R46 A;  2RDH A;  3DM3 A;  4DV1 L;  1K73 C;  4XYO A;  5BN4 A;  3VK7 A;  2F0N A;  5CYU A;  2LHG A;  2F0H A;  2DNA A;  2DN8 A;  1D5Z C;  3SAU A;  5BPV A;  2A5H A;  4IAL A;  1II3 A;  5C3E H;  1HHV A;  4JI8 L;  5E7N A;  1E9R A;  3A74 A;  1DM0 B;  1DCZ A;  2HQE A;  5J22 A;  5M3F H;  3TWM A;  3FKI G;  5ELE A;  4CDD C;  4G4N A;  1TVX A;  1EZ8 A;  1SYD A;  4A3B B;  4P17 A;  5EJC A;  4BBS H;  1VQ1 A;  1VG5 A;  2QF7 A;  3NK9 A;  1L2D A;  5C3X A;  1QUT A;  1KFV A;  1EQQ A;  2N49 A;  2VB2 X;  3UDI A;  4P75 A;  1NJF A;  3CF0 A;  3KBX A;  3K57 A;  5K36 H;  4BA1 I;  3HZX A;  2JY7 A;  4R4I A;  3A56 A;  3IFT A;  3HS0 C;  1UE6 A;  4QF4 A;  2FE8 A;  4MGH A;  2MP1 A;  2QIL A;  4B3T Q;  2VUM B;  5JJL A;  3E3X A;  1HT2 E;  3K9P A;  1Z6H A;  1S40 A;  3FUW A;  2WB1 E;  2EKK A;  4IOC A;  1MN3 A;  2E2D C;  1NJI C;  3GTG B;  3GRR A;  2O5I C;  2HCB A;  5I6Y A;  3EVQ A;  3WDN A;  2C9C A;  4K6L A;  2B63 G;  4IBK A;  1HR0 L;  5ISR A;  1DYQ A;  3LVW A;  2Z7J A;  4IBB A;  1HR0 M;  3PO2 G;  1SJE D;  4HR7 B;  4JPB W;  4BB9 A;  1ZYR C;  3V96 A;  4DAY A;  3PF4 A;  2I7N A;  4R7G A;  1IBM M;  4OXP A;  1HR0 Q;  1LT3 D;  2M00 A;  1ONL A;  1D0M A;  3J27 B;  2LKV A;  3CQZ H;  5EXS A;  1BVS A;  1U9R A;  2X6G A;  4B9X A;  5AJ3 L;  4R3D A;  3U6P A;  4WW0 A;  1KQS A;  2EIF A;  3WHK A;  3AU7 A;  3HP3 A;  1NR4 A;  1TWF H;  3K58 A;  1VQM A;  3HOV G;  2RHS B;  1WJJ A;  1ZXT A;  4XQQ A;  1GM5 A;  2E2H B;  3SMP A;  3OSO A;  3VYT A;  2EYO A;  3V05 A;  1YIJ A;  3BDL A;  5A35 A;  4LGM A;  1DO2 A;  4A3G G;  3CC7 A;  3GTM H;  3J81 S;  2K1B A;  2CHV A;  1UEB A;  2RVL A;  5A2Q E;  3OTO Q;  2DZO B;  3JAM E;  1J5E Q;  1R2Z A;  4D82 A;  1KDA A;  3MWY W;  1Q1E A;  1C4Q A;  3CD6 A;  1JB7 A;  2VY3 A;  1O7Y A;  2XFS A;  3FRI A;  1CI3 M;  3A55 A;  5DM6 3;  5LMU M;  3K59 A;  4RHS A;  1F9P A;  2DEN A;  2UUC M;  3C2P A;  5C0X I;  3K5L A;  2D7G A;  4KN7 C;  1K28 A;  1X32 A;  1YBY A;  4QHT A;  2LVQ D;  1Z6T A;  2ENB A;  1JE4 A;  3GLH E;  3G4S A;  5ITX E;  3UE1 A;  4GRI A;  1I6H H;  2AWN A;  2OQ4 A;  4NKL A;  4IO9 A;  4G7H C;  4AKH A;  2UU9 L;  1HTP A;  5CBA E;  1HT1 E;  5JOB A;  3HHW A;  2OQK A;  4NW2 A;  3GTK H;  2DWZ B;  2IJ0 A;  2NVX B;  4WRD A;  1AP0 A;  5DNF A;  2NTS A;  1A3V A;  5A2Q S;  4IPH A;  1I6V C;  2R7Z G;  4IBG A;  2ZAO A;  1F9S A;  3BVZ A;  2VF8 A;  4NXM Q;  2EE1 A;  1ZMW A;  1XTC D;  4P74 A;  1JR3 A;  2QCU A;  2RGH A;  3BZD B;  1NE3 A;  2VQE L;  3GLG E;  2OCE A;  2E5L M;  2G5D A;  1YHA A;  1L1O B;  2C35 B;  2RSN A;  1YSY A;  4OVZ B;  4RGN A;  3KLR A;  2PI2 E;  2NBF A;  3HKP A;  1VMP A;  3D8G A;  4LF4 Q;  1HZ9 A;  2JN4 A;  3I4V A;  3U9S A;  1EQV A;  2K5V A;  5LL6 S;  3RGP A;  4R1J A;  4FF4 A;  1JWS D;  1SR3 A;  1XPO A;  1PYB A;  3D31 A;  3TP5 A;  4K2K A;  3I56 A;  5LMU L;  4HJ8 A;  3GTP B;  3PIP 3;  4IFD G;  5F3W A;  2CQA A;  1N36 L;  2V1U A;  2A19 A;  1VQK A;  3CCR A;  3HKS A;  4HSV A;  3TPZ A;  4X3K A;  4JI2 Q;  2R93 B;  1O78 A;  4MGI E;  3NSW A;  2KNZ A;  2D0O A;  2EDG A;  2F5P A;  2MJ5 B;  2HUG A;  3EN2 A;  1AIP C;  4DUY M;  3PFI A;  4RGT A;  2M9V A;  1N36 Q;  1F2M A;  4X6A H;  1ESR A;  1TWF B;  1BR9 A;  3FDT A;  4KV6 A;  5C4X G;  5IT9 L;  1PZJ D;  2B29 A;  4LFB Q;  4C56 C;  5FSW A;  3JAM S;  4B3R L;  1XB2 B;  2AKW B;  1JMC A;  4RKL A;  1KNE A;  4ILW A;  5I6W A;  2ZJQ A;  2F4I A;  2QEX A;  3B9P A;  1FNV A;  3A7L A;  4MH0 E;  3BYY B;  1OIZ A;  2HKJ A;  1D6E C;  1U4M A;  3CU7 A;  3HOX H;  5IGD A;  2UUC Q;  2B2V A;  4AI6 A;  4D80 A;  4JV5 L;  5EP2 A;  1G4A E;  4Q5V A;  4FXG C;  2LVA A;  2DAK A;  3I55 A;  3KOX E;  3NTH A;  2EKF A;  4DR6 Q;  1HRJ A;  2JP1 A;  4L16 A;  1MJC A;  1BKB A;  1UE1 A;  4ZKC B;  3GTG H;  2I5L X;  5IP9 G;  3I4M H;  1TY0 A;  1SE3 A;  3X3M A;  2JA5 H;  3NEL A;  2CP8 A;  1RIP A;  3O13 A;  5C4J H;  1TXY A;  3EFX D;  2QDB A;  2JUJ A;  2JY8 A;  1FYC A;  2QQ8 A;  5GQO A;  3JAM i;  4X65 M;  3MXG A;  4QQB X;  1CA6 A;  3I7F A;  1QVF A;  3TRE A;  1EFI D;  3ZQJ A;  2VL6 A;  5J3B A;  1XXH A;  5M5W B;  4FF3 A;  4DAM A;  1PMR A;  4KMU C;  2EYF A;  5FLX L;  5IT9 E;  5LMN W;  3J80 c;  1GJT A;  4G6Z A;  2F0I A;  3ULL A;  1TDH A;  4P2C B;  3J81 L;  1XNR L;  2X4A A;  5FLM G;  2ES2 A;  1IBK Q;  4QOS A;  4ALP A;  2F4V Q;  2CFO A;  5L8R F;  2LTU A;  4A75 A;  1VQN A;  3KF6 B;  1EYC A;  3K7U C;  3NEN A;  3AFP A;  4X62 L;  3HOW B;  3PIP A;  2FS1 A;  1ASY A;  3K7A B;  4C3I H;  3CP0 A;  1AN8 A;  3UGJ A;  1Y1V G;  2HCC A;  2HIV A;  4JI4 M;  4NOO B;  4R4T A;  2LSS A;  1T6O A;  3T6P A;  4KLN A;  2A74 C;  4UDU C;  3E5S A;  1BOS A;  3S16 B;  1XMO L;  4A93 B;  3W0L B;  4KKU A;  3U4Z A;  3K92 A;  4G3O A;  2UUB M;  2Z4H A;  5IOC A;  3S1R H;  2R45 A;  3ZCB B;  2ALY B;  3BJU A;  3N52 A;  5C0X H;  4YCV A;  4L5T A;  5IWA M;  1UAP A;  4KHP M;  5LHY 1;  2KRU A;  4A3J H;  3KVW A;  4POG A;  3QAU A;  3LVV A;  1SMY C;  2R3Z A;  1IY1 A;  1LTS D;  4FCT A;  3L25 A;  1FNU A;  1OXS C;  1R4P B;  4U68 A;  2YTY A;  5FLX S;  1RU3 A;  1E24 A;  2WAC A;  3KOJ A;  1I4Q A;  2E2J H;  3GTK B;  1N32 M;  3C1E A;  1MSG A;  1E22 A;  4LFA M;  5KPR A;  4MGK E;  2EY5 A;  2QSF X;  4TUW A;  5F2D A;  2OO9 A;  2F0M A;  1AZQ A;  5EKK A;  3H3V C;  4F7X A;  1I6H B;  1YZ6 A;  3OTO L;  5ITX A;  2GA4 B;  1JCK B;  3SAS A;  2K33 A;  1PH8 A;  2OPF A;  1C0A A;  1J5E M;  4J6H A;  2Y0T A;  2R93 H;  2QKI C;  2DY8 A;  3BYT B;  1EIH A;  4OO1 I;  3HJQ A;  1J5E L;  2E2I B;  4LJ5 A;  4JVZ A;  2JQO A;  1OKS A;  2JEA I;  2ICE C;  3A46 A;  5DYG A;  1XPR A;  2PQA A;  3T16 A;  2UU9 M;  3ERS X;  1IKL A;  4KKS A;  4BBR H;  1FJG Q;  4A3V B;  1NUC A;  2R92 G;  1Z9F A;  1B53 A;  3KK7 A;  2F0D A;  3VYR A;  2NVY H;  1N33 Q;  3HOY B;  3Q24 A;  4WJ4 A;  4FYD A;  4A3C G;  2KVM A;  2K4K A;  3VR3 A;  3S2D B;  3D6W A;  2LVN C;  1EQR A;  1GD7 A;  4FD2 A;  3F2D A;  2RA4 A;  3S1M B;  4KHP L;  1D2N A;  2R4E A;  2VS1 A;  2KHS A;  3TL4 X;  3RZO H;  1CHP D;  3A5Z B;  3A54 A;  2HCI A;  4L15 A;  4GNX C;  1R7R A;  5CV7 A;  4NDX A;  3STB D;  4FVM A;  1WI5 A;  2XZF A;  4ZLT F;  2BA1 A;  4QIW B;  2HHH L;  5I4D A;  1V1P A;  1QUS A;  3DZD A;  4GKK Q;  1DV0 A;  1OTR A;  4QUF A;  3T1H M;  1JB0 F;  5J1Z A;  4DK3 C;  4H02 A;  3HOV B;  3TP7 A;  3LW5 F;  4HIM A;  4F2L A;  3HG9 A;  3ZJY C;  4EQO A;  4ZKB B;  2L6O A;  1KC8 C;  2UU9 Q;  5FLX c;  1S72 A;  2UUB L;  2OOA A;  4P72 A;  3CW2 C;  2B2W A;  4RAU C;  1YJN A;  1ILQ A;  1VMC A;  2LY7 A;  3J7A 5;  2A6H C;  5IGE A;  4AH6 A;  3M3Y B;  1IFY A;  4M9X A;  2PMZ B;  1STY A;  2M60 A;  4DV5 L;  2SNS A;  4LUV A;  4DR7 Q;  4IBF A;  1ILP A;  3LCV B;  3I70 A;  3AOE A;  1C7Y A;  3NBI A;  2KCC A;  2B2U A;  3QB3 A;  3H15 A;  4IFD J;  2BWB A;  3QYB A;  2K7V A;  1CQV A;  2PCF B;  3I90 A;  4GN5 A;  1R4Q B;  2HDL A;  5BR8 Q;  2ZAN A;  3C3D A;  2QEJ C;  3SEB A;  4JYA M;  3T56 B;  1MI2 A;  1YJW A;  4DR7 M;  1WOC A;  4PMC A;  5J39 A;  1ICF B;  2TMP A;  3FEW X;  3J7A F;  1MX0 A;  1OXT A;  5ELD A;  3MEH A;  1CKN B;  4BBR B;  2VUM G;  4ANR A;  5IWA Q;  2ZXR A;  4G4R A;  2EJS A;  2NYZ D;  1KAW A;  2RHQ B;  5ITQ A;  1JWU D;  4IUV A;  3C58 A;  2EYJ A;  3GTO H;  3TN2 A;  2JXN A;  3ND9 A;  5LMU Q;  4X65 L;  3U4V A;  2XN9 C;  2MNA A;  4GKK L;  2GN5 A;  1LTM A;  4UPA A;  3HU1 A;  5E4X A;  2JA5 B;  2JZ0 A;  2A1A A;  4LG2 A;  1BBU A;  1I4G A;  2JA2 A;  5EPJ A;  4DAY B;  3TZU A;  1V8Q A;  4C3J H;  2F03 A;  4OIK A;  4DV3 Q;  1LT5 D;  4JI0 M;  2YTX A;  1ZV1 A;  1RCV D;  3AL0 C;  1NY4 A;  4R4C A;  4JI3 L;  2A5Y B;  2KW0 A;  1QYR A;  1WTR A;  2WIN B;  1YVC A;  4X64 Q;  3I4O A;  3CCQ A;  4HL4 A;  1PFN A;  3ONA B;  2UXD Q;  1NSF A;  1Q39 A;  4JN6 A;  5IP7 H;  4X64 M;  2I46 A;  3RNU A;  4A3M H;  3RLO A;  1WTV A;  4JI7 L;  2NQ8 C;  1IW7 C;  2F0Q A;  3L0O A;  2K0B X;  3D8L A;  2UXC L;  4OX9 M;  1GUS A;  1LO5 D;  2R6F A;  2CQO A;  3CKI B;  1N34 L;  3HY5 A;  2Q2U A;  1HFN A;  1QE6 A;  2J5Y A;  1I4R A;  1SLJ A;  3W67 A;  4H7B A;  2EYL A;  2KHJ A;  4XK8 F;  2R61 A;  3K7A H;  1PJS A;  4A3F H;  3X3N A;  3MTS A;  7CAT A;  3NP8 A;  1AH9 A;  1HPC A;  4FCV A;  1B44 D;  2A69 D;  2EXZ A;  5KNB A;  3FUX A;  2JP7 A;  3BG3 A;  4DR6 M;  3VR2 A;  1QIL A;  1R9T B;  4GS3 A;  3KXE C;  1DD2 A;  4HMI A;  3KP1 E;  2E2I H;  4LF7 M;  2CV1 A;  5EXP A;  1WFQ A;  2FFJ A;  1Y8O B;  1JJG A;  1VQ4 A;  4PNY A;  3GRU A;  2K5D A;  4QNM A;  1TGU A;  3BOS A;  3VA7 A;  3QWL A;  1H9M A;  3PUY A;  2DAG A;  3ITP A;  1PA6 A;  1STG A;  3I4L A;  1X9N A;  3DEO A;  4R9W A;  1E3P A;  5C0X J;  5M5W H;  4DR5 M;  5DEH A;  1GUN A;  2VW9 A;  4NRV A;  2EOT A;  1HTL D;  1NHG C;  1HJP A;  1KLG D;  4V19 0;  1SN8 A;  3HOW G;  4IUU A;  1EZ6 A;  2X6L A;  2B39 A;  3K8A A;  1PRT C;  3U9O A;  2KCN A;  1PTO D;  1ENF A;  3WHL A;  2B2T A;  2XWB B;  3BVG A;  3T1Y Q;  2EYH A;  4JCV E;  2Z8L A;  2FNA A;  3G48 A;  2FFK B;  1QAQ A;  3G6E A;  5M3F G;  2DZL A;  2I0Q A;  4A3D H;  1K82 A;  4CDE C;  4A3K B;  2KA7 A;  1LAB A;  1QNU A;  2D7H A;  3F1Z A;  3R2I A;  3FVQ A;  3U6L A;  3MXN B;  5M5Y H;  1KD1 C;  4KD4 A;  1I4P A;  1VDZ A;  4QCL A;  4RKB A;  1ASZ A;  1BNZ A;  1CK1 A;  4JI5 L;  1F2L A;  1QUQ A;  5E26 A;  1Q3B A;  1BDO A;  3R8F A;  4FWG A;  3FTC A;  1VQJ A;  1GUG A;  3BS1 A;  2IY5 B;  4WP2 A;  5KQD A;  1CM9 A;  1MHW C;  3OWE B;  5HUR A;  2C99 A;  3KF6 A;  3KJP A;  4PCZ A;  1E1O A;  2K04 A;  1STE A;  1L2F A;  1NY5 A;  4NXN L;  3TDQ A;  1L0W A;  4NB3 A;  3B74 A;  2D0P A;  4A4I A;  5A2Q L;  2LMC B;  4NXN M;  2PQA B;  1HQC A;  2E2H H;  1N34 M;  2B8F A;  3LQR A;  4L6V 6;  1LV9 A;  3H94 A;  2X8A A;  2PI2 A;  4NXN Q;  4JI6 L;  5D14 A;  4CKB A;  3J81 c;  4P73 A;  1EIG A;  3HGI A;  2PZU A;  4XTC S;  2MQH A;  2BDN A;  3GLI B;  2OWO A;  2QP9 X;  2R62 A;  2ICI A;  4MGZ E;  3W1B A;  4HMJ A;  4RWS C;  1SXT A;  3PQI A;  4DR1 Q;  3EIH A;  5C18 A;  1K3X A;  1F4I A;  4BWG B;  1NHW C;  4G7O C;  3R3O A;  1K8A C;  4HID A;  1N32 L;  2F1M A;  4L5R C;  3CF6 E;  3GRY A;  1NV8 A;  4X66 M;  5KPT A;  4NP5 A;  4B9W A;  1CA5 A;  3TS2 A;  2OTL A;  4I7Z C;  5EP3 A;  5C4X B;  1QAN A;  1TY2 A;  1PJJ A;  1SRO A;  1HA6 A;  3PUV A;  1H9J A;  2JWS A;  3UJN A;  4C2M B;  2UUA M;  3CF5 A;  2RDF A;  1V43 A;  5CMD A;  3T53 B;  1RTN A;  3I4N G;  2LHC A;  5E6J A;  1LTR D;  4WOR A;  4B08 A;  2E76 C;  2PMZ E;  2AWO A;  2FIN B;  2VQF Q;  1NAP A;  2LS0 1;  2D7E A;  4CJ2 C;  2LXK A;  1PM5 A;  1EWI A;  2P5T A;  4C3I G;  2OOB A;  3PGZ A;  3UZU A;  1QAM A;  3L3O C;  3FTD A;  1UWV A;  1NSN S;  4LF8 Q;  1DGF A;  4JI4 L;  3VA5 A;  1GO3 E;  4JI1 M;  2AMC B;  3GQ5 A;  4ME5 A;  4CBV A;  1IN8 A;  3SYL A;  5C4Z A;  4OO1 G;  1AEX A;  2K50 A;  1NR2 A;  1EYG A;  3FYD A;  4LFC L;  2YYZ A;  4AKI A;  2B2V C;  3JC6 6;  2A8V A;  5KRU A;  4DV6 M;  2DGY A;  1G2T A;  1JOO A;  1LTT D;  3VDP A;  1DGH B;  3GO5 A;  5FKA C;  3GV3 A;  3DM1 A;  5GAD C;  2F3I A;  2N8N A;  2DWL A;  3Q22 A;  4C1N K;  3E6Z X;  4DNT B;  3H4J A;  1QG7 A;  4EQP A;  1Q90 A;  3RN5 A;  3MJ5 A;  3B89 A;  1OIP A;  1BCP F;  1C1K A;  5BR8 L;  3QJY A;  1IN4 A;  4ULL A;  2O01 F;  1A5T A;  3H0G G;  1SYG A;  5IYB G;  4JI7 M;  1MU5 A;  1ZKO A;  4KJN A;  3TP6 A;  4X64 L;  5FLM H;  1PH7 A;  1A63 A;  4BY1 G;  5AFW A;  1X37 A;  1L1O A;  2F4V M;  3F2B A;  4GMQ A;  1Q7Y C;  3PIO A;  1TS3 A;  3QOL A;  1Z5A A;  1K83 B;  1EFU B;  1I4H A;  2Z9H A;  1RDP D;  2JEB I;  1XXH E;  4MGY E;  2RDG A;  4IZ8 A;  1FL0 A;  4LF8 L;  4G57 A;  5IYD H;  4JBK A;  1GXD C;  3OW7 A;  4JC0 A;  1AZP A;  3K81 C;  5KPZ A;  4X65 Q;  3HOZ H;  2KZU A;  3H4M A;  4DUZ L;  4O1N A;  1EYD A;  5DLQ E;  3ER0 A;  3B6Y A;  1DXM A;  2Q2T A;  1DO0 A;  1CFM A;  3S14 H;  5LMN Q;  4DV3 L;  3KFU G;  1GJS A;  1XHB A;  1BO0 A;  2SNM A;  5KEE A;  4DK6 C;  2NVQ H;  1R6B X;  4A3G H;  3MFG A;  1KIX A;  1G41 A;  1PXU A;  1NV9 A;  4F87 A;  1IN5 A;  5C44 H;  1SAP A;  5GAH C;  4A3K G;  1CQF A;  2XFT A;  1PFB A;  1XC8 A;  2F0E A;  1EY9 A;  1TWH H;  4I7A A;  1QZE A;  2JA7 H;  1HZC A;  4ID6 A;  1VQ5 A;  2D9U A;  1TWA B;  4XYQ A;  4I4L A;  3TSS A;  3BBZ A;  3LNN A;  5JJI A;  3SE0 A;  2BH2 A;  1SSO A;  1F77 A;  3JR4 A;  1CSP A;  5JPM C;  5EKL A;  1WXQ A;  1BBW A;  1IBL Q;  4DR5 Q;  1GAB A;  1PRT D;  2B63 B;  5GAE C;  3HFZ B;  2QNJ A;  2F5Q A;  3GTL H;  3NPP A;  3BXW A;  2CCZ A;  2R6G A;  2UUA Q;  5E1F A;  4QJF A;  3TE6 A;  4DUY Q;  5EXT A;  3STB C;  1KAA A;  1QVG A;  1HNW L;  1G91 A;  1PTO B;  3GLH B;  1EOV A;  2D5D A;  4XIG S;  3ULP A;  4DR3 M;  3AB9 A;  3GTQ H;  2KXE A;  1B9M A;  2GVB A;  4JI4 Q;  4F8M A;  4GKJ M;  3GO8 A;  3HGB A;  1EY6 A;  1QVR A;  1QNK A;  1K8G A;  3OHX C;  1Z59 A;  1CKM A;  3OW2 A;  3MHV C;  4LNQ A;  3EIV A;  4IUR A;  4A3B G;  3FD9 A;  4II7 A;  1ET9 A;  2I5M X;  4UP9 A;  3GQ3 A;  3KJO A;  5CV5 A;  2JY6 B;  4BBA A;  4CJ0 B;  2PQE A;  4DUZ Q;  1OXX K;  2CKZ B;  5M5Y B;  2L09 A;  3U60 B;  2PNH A;  2NZ1 D;  4PZ7 A;  3R8B A;  4Z8X A;  1XTD A;  3VDU A;  4JI8 M;  4R71 A;  1S5D D;  4IFD I;  1JR3 D;  1BXT A;  4JI6 Q;  1HZA A;  1B9N A;  1D0L A;  4IQZ A;  2IWH A;  2L2D A;  1SE4 A;  1JOK A;  2KOL A;  3LGJ A;  4X62 Q;  1FR3 A;  4PQX A;  2FXQ A;  4K8I A;  4CKC A;  4LF7 L;  2PZT A;  3HZJ A;  2CHB D;  4IBI A;  3GTJ H;  4DV4 L;  1E1T A;  4XBO A;  2MRO B;  1XMQ Q;  5IRE B;  3U61 B;  2XIW A;  2IX1 A;  2JA7 B;  3PVS A;  3A8K E;  4A3F B;  1TWH B;  3PUX A;  2F0F A;  3U6D A;  2AQ1 B;  5EAY A;  2NZH A;  5JEA G;  4LF8 M;  4G4K A;  2QGQ A;  4JBM A;  1AUA A;  4M1U B;  2LVP C;  1PTO C;  3TS0 A;  1ENC A;  2L4F A;  1XWE A;  4B3R M;  4GC9 A;  3F2U A;  2KED A;  1YNJ C;  2B2U C;  4DV2 Q;  3AOE C;  1Q8K A;  4BBR G;  2ID0 A;  1RHP A;  4A3I B;  3NE5 B;  3NWS A;  1VCI A;  1XX8 A;  3MEF A;  3I4Y A;  4JV5 M;  3PUW A;  1HNX L;  4K0K L;  2Z3X A;  3MXP A;  3N6R A;  3TQY A;  1HNX M;  4K0K M;  1Y8G A;  3RZO B;  3KW6 A;  4LWC A;  4ZK9 B;  2VNU D;  1IL8 A;  5EPK A;  2QA4 A;  1H9K A;  1JIC A;  1I94 L;  4PG3 A;  3S9W A;  1HQR D;  2DY7 A;  1SYF A;  2L0C A;  4LZZ A;  1B1Z A;  3NEM A;  1RTO A;  3ICE A;  1YI2 A;  1NMF A;  2WSC F;  5EJW A;  2KEN A;  1TR8 A;  1PJQ A;  4LJA A;  5EBC A;  3Q6S A;  2SOB A;  2E8G A;  2NTT A;  2ZAM A;  3L7Z C;  3FUU A;  1SMY D;  2Z1C A;  3UDG A;  2L11 A;  2MUY A;  2Z6B A;  4JI6 M;  4KY5 A;  4CJ1 B;  1HH2 P;  3J7Z C;  2EYM A;  3DWQ A;  5CBE E;  1GL7 A;  3CTW B;  2L4N A;  1W3S A;  3GQB A;  3G71 A;  3U5Z A;  2G5G X;  1DOL A;  1KXL A;  3E9H A;  2L5T A;  3BDC A;  1M1K C;  2R7D A;  3I4M G;  2MO1 A;  2LXE A;  4JI2 L;  3HHZ A;  3RE8 A;  1EFW A;  2Z4S A;  1SNO A;  4LF4 L;  1ROD A;  1L1T A;  5CV4 A;  1LYL A;  4DV2 M;  1RJT A;  4DV7 M;  1EY8 A;  1KSF X;  1ESF A;  5LMN L;  1JJ2 A;  3T4A C;  4DV7 L;  1SXJ C;  2WB1 G;  5IOD A;  5DYI A;  3IG8 A;  2RCF A;  4C3H B;  1SE8 A;  5TSS A;  2FOI C;  5C44 G;  3GPX A;  1EU3 A;  1IXZ A;  5M9O A;  2KUM A;  3J81 E;  3K0X A;  3VKH A;  3SXH A;  4A3K H;  3UK6 A;  2B2W C;  2KEE A;  1J8I A;  1IKM A;  2A68 D;  4MN3 A;  5JVH 3;  1W6J A;  2HL7 A;  2WII B;  4GOP A;  3KDS E;  1LAC A;  3EJI A;  1QAO A;  1LLR D;  3NHH A;  2DAE A;  4AG5 A;  3AQQ A;  3NQI A;  4H0L C;  4UN2 B;  1Y1W H;  2DVW B;  3T1Y M;  4B3M M;  1O7Z A;  2VUM H;  1SXJ E;  2RGO A;  3CF2 A;  2K5H A;  3AYH B;  1PZK D;  2NVT B;  2MR9 A;  3U6S A;  2DXI A;  2E74 C;  2HWJ A;  4TRD A;  3FHW A;  1L1O C;  1CTM A;  2MGW A;  4I81 A;  3T13 A;  2BWE A;  5IIF A;  1J9O A;  4BBS B;  1A2U A;  1WTX A;  1XXH B;  2V1C C;  4OWW B;  2SDF A;  3AOG A;  1IBM Q;  3C9P A;  2CVR A;  4CDF C;  3IHP A;  2KNA A;  1G6Z A;  2Q2E B;  3SK8 A;  2AUJ D;  1HUM A;  2IPK D;  4LRS A;  1LV7 A;  2EO2 A;  4XGI A;  2K28 A;  4A3M B;  4FWD A;  2NN6 G;  3EIE A;  3U6M A;  2DI0 A;  2FHT A;  2F4V L;  2QDL A;  3J81 j;  3S2H B;  1H95 A;  3U5Z B;  4PMB A;  2C98 A;  4I5S A;  1PH2 A;  2PNR C;  3H6M A;  4DV5 Q;  1UE5 A;  2N78 A;  3SYK A;  4DKA C;  1OQY A;  4OL7 A;  3JAM L;  2DNC A;  1OFI A;  4YCU A;  1VQB A;  1WGL A;  5C3E G;  4DR3 Q;  2GQF A;  4GHA A;  3M9B A;  1EWH A;  1Y1V B;  2XRQ D;  1Q3L A;  1D1K A;  5M5X H;  2WKC A;  3OYY A;  4DNI A;  4B3M L;  4LY6 A;  2C5C A;  2YTV A;  3MC0 B;  2BE5 D;  3D4R A;  1WCM G;  4LF4 M;  2O5J C;  3RLF A;  3OMC A;  2JE6 I;  1GO5 A;  4KY6 A;  1STB A;  5C5L A;  3UDF A;  4GN3 B;  4JI0 L;  1EL0 A;  3SK4 A;  2UXD L;  4JI3 M;  1VQI A;  1V34 A;  2IL8 A;  1ORY B;  1E7Z A;  3PXG A;  2F0V A;  1AW7 A;  2NUC A;  3Q23 A;  3GD7 A;  1K83 H;  5K36 G;  4M0W A;  2FH0 A;  5FO8 B;  4L4U A;  2Q8T A;  4JV5 Q;  1V1P B;  1DOK A;  4HLQ A;  3FUV A;  1SDF A;  3E46 A;  2JA8 H;  1SBB B;  3L9A X;  3MMP A;  1W2B A;  5C3W A;  3AEV A;  3I91 A;  1WD1 A;  4BY7 B;  3U60 A;  3GPU A;  3AJI B;  2K9D A;  3OOC A;  2F0G A;  1Q82 C;  2EYP A;  1PH9 A;  1VS0 A;  2L9H A;  3I72 A;  2XNA C;  2CV0 A;  2Z8Y M;  3E0E A;  3AKZ A;  4L5Q A;  3SGI A;  4M0D A;  1GVP A;  1R9T H;  3GTQ B;  3VYU A;  1GUW A;  3KOY E;  1WYD A;  1JQJ C;  5IT9 c;  1RL2 A;  2VF7 A;  4A3E G;  3LWE A;  3GP1 A;  2PPB C;  3L29 A;  1E32 A;  1M4V A;  3J81 i;  3HWS A;  2WAQ B;  4AYB B;  3QO2 A;  3RMH A;  3PV0 A;  4DPG A;  4FDB A;  2OQ0 A;  3DWP A;  2EA0 A;  1WCM B;  4RFB A;  3L26 A;  5EP4 A;  4YHH M;  4DV1 Q;  4TVA B;  4ZAI A;  3HOU B;  1TWG B;  4RG1 A;  1ET6 A;  4M9S A;  2L55 A;  2KHI A;  3NQT A;  5KQ8 A;  1E2V A;  2QCP X;  4B7H A;  1H6U A;  1ZMU A;  4C3J B;  3GTJ B;  4DR6 L;  1G6P A;  3T15 A;  3E9S A;  5I2X A;  3T1Y L;  3SBJ A;  3KS8 A;  4PZ6 A;  4J8Q A;  4LW1 A;  2J7O A;  2Y0S E;  2C5R A;  3A5U A;  2F0P A;  3FP9 A;  3M7N A;  4OEM B;  3K5O A;  5IGC A;  2E5L L;  4FXK C;  3UMM A;  4ZCK A;  2F0J A;  4W5W A;  2L4E A;  1L2C A;  3I8Z A;  4DU9 A;  4Y7N B;  2R93 G;  1Y14 B;  1NO1 A;  2N55 A;  3QWN A;  5IP7 G;  4A3M G;  3LCU A;  2CEA A;  2AQ2 B;  2Z4I A;  4AKG A;  1PRT F;  1XWI A;  4LF9 L;  3K80 C;  2KEB A;  1ZMV A;  2KZS A;  2DAM A;  3I04 M;  1HNZ Q;  4GN4 B;  3HOX B;  3K5M A;  3BVM A;  4HCS A;  2MHV A;  4C3H H;  4EGV A;  4AW4 A;  4BBS G;  4PDG A;  1VQ6 A;  2EPB A;  2HHH Q;  1KRT A;  4TSS A;  3PNV A;  4B3S M;  4ODG A;  2YFQ A;  1HR0 W;  4HJA A;  1CT1 D;  5C0X G;  4LGY A;  2R65 A;  1XYI A;  4KO8 A;  2Q8I B;  2R18 A;  4RGM A;  1TTE A;  4IUN A;  3UDX A;  4LF6 Q;  2IX3 A;  1XXG A;  2A68 C;  5T1G A;  4GZY C;  1WGN A;  1C9O A;  3IRB A;  3P1H A;  1QQW A;  4FXD A;  2K32 A;  1B3A A;  4CHT B;  1IXR C;  2BJV A;  3ERO A;  4J15 A;  1XJV A;  3GTO B;  3DA1 A;  4RMF A;  2KCT A;  3BZK A;  3S1N H;  3CHB D;  5C44 B;  4X66 Q;  3IFD A;  4C3H G;  4DXF A;  4G4Q A;  3Q8D A;  4LF7 Q;  2WB1 B;  1D2B A;  2WAQ E;  2F0L A;  3KLS A;  1LTG D;  4V0B A;  1JB3 A;  1E2Z A;  3K2L A;  1SJH D;  2LFN A;  2O2L D;  1Q12 A;  2K5Q A;  2BDO A;  2VQF L;  3CME A;  5FTK A;  3P20 A;  2Z4R A;  3ZH9 B;  1A0I A;  3THG A;  4IIW A;  1PHJ A;  3SAT A;  1O7L A;  4NL4 H;  1SFO B;  4HTH A;  2XLJ A;  2APL A;  1VQF A;  4PT5 A;  1GKI A;  1VEJ A;  2GVA A;  5KGU A;  4A3G B;  4LF6 M;  2NVQ B;  3CC4 A;  4QHS A;  1NCV A;  5KYL A;  1LTI D;  3NWL A;  3QIA A;  3VDY A;  1EOT A;  1N77 A;  4DAV A;  2UUB Q;  3AMU A;  4LFA Q;  2Y0S G;  4FF1 A;  4OW0 A;  2RBM A;  3KF8 A;  4RF1 A;  1UNS A;  2Z6K A;  4QY7 A;  4GKK M;  3H3V H;  3FTF A;  4Z6Y A;  1KL9 A;  1WTH A;  2I5H A;  5G3L F;  4WJW A;  3S1Q B;  4IPC A;  5JJZ A;  2F52 A;  4IUP A;  1MJE A;  2RKO A;  3M4O H;  1CHQ D;  5IT9 S;  3LWU A;  4KN4 C;  1BUV T;  2JSO A;  1DZ1 A;  1BQQ T;  3KS4 A;  2X49 A;  4LJ4 A;  1G3I A;  1YEZ A;  1YNX A;  1Q46 A;  4EVO A;  2Y0Q A;  2XEP A;  4GH9 A;  4KTA A;  1W5T A;  4LF5 L;  4R4O A;  4AZF A;  4DV0 M;  2VXW A;  5H37 D;  2K6A A;  2L1B A;  4DV4 Q;  3PO2 B;  2A6E C;  1I4X A;  2X69 A;  2A6E D;  3NBH A;  2GNO A;  3L27 A;  4KLK A;  4LJZ C;  3IG5 A;  1Y8N B;  1OO9 B;  3SK6 A;  2KCM A;  1JC7 A;  2UXD M;  1UE7 A;  1RKN A;  2I07 B;  2BCO A;  2ZXO A;  5KND A;  1VQ9 A;  4GNX B;  5H1S E;  1I3Q H;  3A42 A;  2AHM A;  4FW9 A;  2J7Z A;  3HOZ G;  2K5N A;  3SMS A;  1I94 M;  1HNZ L;  2L7H A;  1OTC A;  1NNU C;  2R7Z H;  1Q02 A;  3BZC A;  3GPY A;  5FTL A;  3OIQ A;  4B7G A;  4OIJ A;  1TH4 A;  1ZAE A;  4DV1 M;  1BCP C;  2MH8 A;  5I9O A;  3VYS A;  1VQG A;  5IGB A;  3B7N A;  2R44 A;  4IBD A;  5BR8 M;  1NBW A;  5KIX A;  3GP7 A;  1L2B A;  1K8M A;  3AFH A;  4M9Z A;  1T5E A;  2B3T A;  3RZD B;  2HT1 A;  1CUK A;  1XNQ M;  4K14 A;  4QGU A;  4BXX H;  2BNK A;  3F92 A;  5EXX A;  2O25 A;  4N8F A;  2JA6 H;  3NBH B;  5FTJ A;  3M7G A;  1I4W A;  4PD2 A;  2C9O A;  2UXB L;  3J80 L;  3GDE A;  3AV0 A;  2CUZ A;  2WFW A;  5BN3 A;  3NUC A;  2UXB M;  1YNN D;  3IKJ A;  1XNQ Q;  3H91 A;  2EY2 A;  4ZPX A;  2BE5 C;  4HAE A;  4JI1 L;  3UE0 A;  1EEF D;  4NC6 A;  3R2T A;  3KSX A;  3L2A A;  1PH5 A;  5HGQ A;  3FYC A;  1A15 A;  4IUT A;  4A3B H;  2K5W A;  3I01 M;  1QUQ B;  1GOZ A;  3ZYY X;  4A3J G;  4JBW A;  2DNE A;  5IWA L;  5T1I A;  2J7N A;  3NBX X;  4U67 3;  1P8L A;  4DA2 A;  1N34 Q;  4DK1 A;  1UEA B;  2SEB D;  5M3M G;  2Y20 A;  2K05 A;  4JYA L;  3U6C A;  1FGU A;  1MIU A;  1XPU A;  5FO9 B;  1WHC A;  2JZ1 A;  1DON A;  2ZT9 C;  3PO2 H;  3URY A;  4YY3 M;  2L7I A;  4YCW A;  1IBM L;  3MFY A;  4LZJ A;  4YY3 L;  1PZI D;  2UXC M;  2NVX H;  2LWX A;  2JA6 G;  3FRP B;  3TP8 A;  1PYS B;  2XSZ A;  3SDZ A;  3W3A A;  1A3T A;  5JAV A;  1NMG A;  3NTK A;  4FF2 A;  2EY6 A;  1VQA A;  3G6J B;  3I2Z A;  2UXB Q;  1PDQ A;  2FMM A;  3DWA A;  4K5V A;  3HOV H;  2V6Z M;  5FTN A;  2CW0 C;  3ERQ A;  4DXG A;  4R8I A;  2R0I A;  2JA8 G;  1IYU A;  1CKN A;  4HN7 A;  4DR3 L;  3TME A;  3S17 B;  5FJ8 G;  2NN6 H;  1YHB A;  3D0F A;  3M4Q A;  4BA2 I;  5IGF A;  1B7Y B;  2LXJ A;  3FTE A;  4NXM M;  1HUN A;  1KRS A;  5CGK A;  1HNW Q;  2MO0 A;  1G51 A;  4IJH A;  2ASB A;  1EY5 A;  1QZH A;  1K0S A;  4P16 A;  1IY0 A;  2G8L A;  2UUC L;  1BCP B;  1S3S A;  4DK0 A;  2Z6K C;  2Y0S B;  2P5Z X;  2OEO A;  2OTJ A;  1Y8P B;  4L63 B;  5EP1 A;  3FPU B;  3W68 A;  4KHV A;  4JYA Q;  3GLG B;  4DF7 A;  3W5O A;  3WWV A;  3DXJ C;  2BA0 A;  3A0J A;  3CCL A;  1YUB A;  4R8N A;  4MB7 A;  5E4W C;  4IBC A;  4JOI A;  1KDC A;  1PH4 A;  2JA9 A;  3I3C A;  3FKE A;  2YV5 A;  1VQO A;  1B8A A;  1E94 E;  3TQS A;  3R9X B;  3LQQ A;  4AG6 A;  2L12 A;  3V2T A;  3VLF B;  3K0Y A;  2YNM D;  3QOJ A;  1O7I A;  2E75 C;  3MA2 B;  3GPP A;  1SNM A;  4LFB M;  1KLU D;  1S5B D;  1EY0 A;  4BY1 B;  3DMU A;  1QDR A;  3DUZ A;  4X3S A;  5CR3 A;  4JI5 M;  2CWB A;  4GLV B;  4OX9 Q;  1DGB A;  1JT8 A;  5I2Y A;  2RSO A;  4JI7 Q;  2NWG A;  2VII A;  3CGW A;  3I73 A;  2ZTE A;  4XQN A;  1C8C A;  1IL2 A;  2UXC Q;  1PVO A;  4YWK A;  1FVI A;  3M4P A;  3FPP A;  4HIO A;  4DGZ A;  3U58 A;  2EY1 A;  2ZM6 M;  1HFG A;  1N8R C;  4OO1 H;  3PIO 3;  2HIX A;  4KKT A;  1SE2 A;  2J0T D;  1NTG A;  2DJF C;  4A3C H;  4ZYS A;  3SHL A;  4MTK A;  3EBE A;  2R92 H;  1GHJ A;  2HAK A;  2JK8 A;  2OF1 A;  1PH3 A;  4FWH A;  1EIJ A;  1IBL M;  5NUC A;  3HOY H;  3QR8 A;  2E5L Q;  3S24 A;  4MTN A;  4YIJ A;  3HHX A;  2R4J A;  1EEI D;  2WP8 J;  1LTL A;  3J7A V;  1U5K A;  3S15 H;  1N78 A;  1X3Q A;  4IBJ A;  2CH4 A;  4C3I B;  1IHZ A;  2YR0 A;  3S1M H;  1RD9 D;  1H9R A;  3PO3 G;  1PH6 A;  3I51 A;  1JQY D;  4YWL A;  3LX0 A;  4G4O A;  1EQT A;  4BY1 H;  4M8A A;  2HDM A;  5ELC A;  4UY8 C;  4BY7 H;  1OXU A;  3UI2 A;  3A45 A;  1MJG M;  3PNY A;  4UP8 A;  4A76 A;  4IPG A;  1T43 A;  3K5N A;  1C48 A;  1ENA A;  3CCS A;  4CDC C;  4KOD A;  4OEL B;  3GTP H;  5EGT A;  4JXJ A;  4GOP B;  1EYA A;  2R7F A;  4LJ7 A;  3C46 A;  1LTB D;  4DR5 L;  4XT3 B;  4NPS A;  1I94 Q;  4Q0F A;  1F2Z A;  1VQE A;  3HKZ E;  4J1M A;  2MJ8 A;  4LCB A;  1IBK L;  4A3E H;  3SK5 A;  1F9Q A;  3MHB A;  2ATW A;  1IXR A;  8CAT A;  2K75 A;  1O80 A;  4LRT A;  1N9W A;  2N88 A;  2NB0 A;  2V4D A;  3M4O B;  4B3S L;  3EA6 A;  3VR6 A;  4QNR A;  3OMG A;  3CPW A;  4JI2 M;  4N9T A;  3OIP A;  4K2L A;  4OON A;  4GLX A;  4NXM L;  1IM2 A;  3TZD A;  4AYB G;  1JR0 D;  1HQM C;  1TS4 A;  5DAU A;  1I50 B;  2B2Y A;  2AQ3 B;  3CXC A;  1DGG A;  4A93 H;  1TS2 A;  3IEC A;  2WSF F;  5G3L D;  1X65 A;  1X3P A;  1SXJ A;  4PZ8 A;  1PLF A;  1TT2 A;  1LM0 A;  2Q2H A;  1A6X A;  4CJ6 A;  1TWG H;  3T1H Q;  4RGO S;  4A3I H;  3HKZ B;  1TWC H;  5M3M H;  4NSR A;  5C1B A;  1NNJ A;  4BY7 G;  3VKG A;  2OT2 A;  5JEA H;  1Q81 C;  2JYO A;  3U61 A;  4C2M H;  4AQY Q;  5D65 A;  3E0J A;  2YU9 B;  3T38 A;  1GL6 A;  4LAA A;  3MK6 A;  1F9R A;  2A73 B;  3GLF A;  2B2Y C;  3J80 E;  1H9S A;  1V33 A;  1UM8 A;  3HJ8 A;  2TSS A;  3M85 A;  1XNR Q;  1D7Q A;  1J7K A;  1WCM H;  4L78 A;  3HHY A;  4LK1 C;  4RF0 A;  5EPL A;  3S1N B;  1PRB A;  4XT1 B;  5M3F B;  4GIT A;  3C3E A;  4KI0 A;  1X3G A;  2M5Z A;  3K6O A;  4K5W A;  2LBC A;  3DOA A;  3BDO A;  3WOF A;  3D6C A;  1YNJ D;  3F2C A;  2JA8 B;  1N33 M;  5E3F A;  4A3D G;  3TWK A;  2EZV A;  2ZTC A;  2QHO B;  3K9O A;  3GLI A;  5FJ8 H;  2DWN A;  4XQJ A;  4IN3 A;  4OGQ C;  4KY7 A;  3Q8G A;  3OTO M;  1X54 A;  2CH4 W;  1R2Y A;  4FP5 D;  3RR5 A;  3RZD H;  1GJX A;  3E21 A;  5EKI A;  3H3V I;  4EQN A;  1KAB A;  1SXJ D;  5JI3 E;  4NSO B;  4APV A;  4Q7J A;  1SYB A;  5IE8 A;  1BBX C;  1OJL A;  1UUP A;  4Y52 H;  1AFP A;  2NZO A;  1FNW A;  2MFI A;  3JR5 A;  3SAW A;  1BF4 A;  3QYE A;  4POF A;  5D3I B;  1GHK A;  4GEW A;  4Z9C B;  3T1H L;  1D5M C;  4WUR A;  3SFZ A;  4HJ9 A;  4B3T L;  5FTM A;  1H9S B;  2F0U A;  1MGS A;  5CC4 A;  1VDD A;  1SYC A;  1EU4 A;  2F0S A;  3M0E A;  4I8O A;  1K3R A;  3S1R B;  1SXJ B;  1GKH A;  5C4H A;  1IQP A;  1ICW A;  1VDL A;  4DV6 L;  3J7A S;  4BLC A;  1KNA A;  1T3T A;  1PJI A;  4RHR A;  2DWM A;  1FD7 D;  1V9P A;  1WIV A;  1U0L A;  3S17 H;  1HNZ M;  4LFB L;  2NN6 I;  2KDL A;  4CIZ A;  4KT0 F;  1VEK A;  1OAI A;  1EWC A;  2ZTD A;  1LTA D;  1STA A;  2PW7 A;  3HJS A;  1AE2 A;  4QIW E;  3CMA A;  5I9P A;  1D8L A;  1K3W A;  1SYE A;  1IZ6 A;  4B3S Q;  3RD4 A;  2RCN A;  1XMQ L;  4HJ5 A;  3SC3 A;  5KYI A;  1SG9 A;  5HGT A;  2UUA L;  1WR1 B;  2EJG C;  3RLN A;  5LL6 X;  3S1Q H;  1OFH A;  2F0O A;  1R5L A;  1Y1W G;  1PRT B;  2K6B A;  1S3O A;  2H1E A;  2NVT H;  3KSJ A;  4EIW A;  4HED A;  3H09 A;  5GAG C;  3S15 B;  3CAM A;  1QDT A;  1EIF A;  3CCV A;  2JA5 G;  4UHV A;  3SHF A;  2JY5 A;  2AHO B;  4O0A A;  4L8J A;  4RCN A;  2G3Q A;  4KHZ A;  2IT1 A;  1NNX A;  3HRZ C;  2F3W A;  4BS9 A;  3A7A B;  4LUO A;  5CV8 A;  2WKD A;  4LUZ A;  4LFA L;  2XWJ B;  1RF2 D;  3I4M B;  4RKU F;  5COY A;  1EY7 A;  2DHY A;  2EQS A;  1ML0 D;  4RCO A;  3J2P B;  3MXN A;  1L8Q A;  1YE9 A;  3J7Y W;  3HOZ B;  4MM3 B;  4L5S A;  3H0G H;  2OXP A;  4TQU S;  2J4X A;  3KYH C;  3CCU A;  4DR2 L;  5FO7 B;  2RF4 A;  5DM7 3;  1SND A;  4PMW A;  3VK8 A;  1D5X C;  2WSE F;  2IW3 A;  5IYB H;  5JPN C;  1VF5 C;  1B50 A;  3A98 B;  1AE3 A;  2A6H D;  3ULJ A;  1VF7 A;  5FOB B;  2F0T A;  3A8I E;  4OX9 L;  1N32 Q;  1JJC B;  4QUC A;  2PO4 A;  1SFO H;  3KDF B;  2PYK A;  1G2S A;  5ELB A;  4GOP C;  4B3M Q;  1N33 L;  2XSZ D;  1JOQ A;  1S5F D;  4MIU A;  3E4R A;  3GLG A;  4DUY L;  3L28 A;  4OU7 A;  1FJG L;  4IBE A;  1YLA A;  2VZA A;  4B3R Q;  2CV2 A;  1VQH A;  5ITT A;  3L2P A;  2Y21 A;  2CWA A;  1E9S A;  1XNR M;  1S5E D;  4D81 A;  1TH2 A;  1N36 M;  5COR A;  1LT4 D;  1Q1B A;  5FK9 C;  5AJ3 Q;  2MPM A;  2ZM6 Q;  4X3U A;  4X62 M;  3M4Y A; 
#chains in the Genus database with same CATH homology
 1Z7T A;  2LNH C;  2F0W A;  2VB3 X;  4UAI A;  1F2Y A;  2HHH M;  3VR5 A;  2PZW A;  2XGN A;  4ZQ3 A;  2ERC A;  3GLH A;  3GTM B;  2KJX A;  1XMQ M;  1XMO M;  3HU3 A;  4MHE A;  2KA6 B;  2IX0 A;  4KD3 A;  1E0B A;  2K01 A;  3GV6 A;  4S12 A;  1G8Z D;  1Y1W B;  2E2J B;  3SHG B;  3U6Q A;  4CIS A;  1YNN C;  2G9D A;  2M2L A;  3Q0A A;  1A3U A;  3CQZ B;  4RA8 A;  3WOE A;  1D1I A;  1L0Y B;  2R92 B;  3ZC7 B;  3NXW A;  4NMZ A;  4RNA A;  1FJG M;  4H13 C;  4KK7 A;  4L6T B;  1JOR A;  3T51 B;  1G8P A;  3GQ4 A;  2DZN B;  3DHQ A;  4LF5 M;  1ZQ9 A;  4G7Z C;  1JWM D;  1KYI A;  4GIP A;  4DR2 M;  4FO2 A;  2F5O A;  2WV6 D;  3MAQ A;  3C1F A;  4LJ8 A;  1Z47 A;  1QZM A;  2D2C C;  5EQT A;  3M6A A;  3KOZ E;  1U4L A;  1G29 1;  3FMC A;  5K5P A;  4FCW A;  3G7L A;  5JEA J;  1STH A;  2CHG A;  2XZU A;  3SAR A;  2JXM B;  1TDZ A;  2KQ3 A;  2XF3 A;  5KNC A;  1EE8 A;  2NVY B;  2PW5 A;  1PYW D;  4E6I A;  3PUZ A;  5ITU A;  4HCE A;  1GUO A;  1QCB D;  2F5N A;  4N9P A;  4ITQ A;  4C3J G;  2DHR A;  5KO3 A;  1TQO A;  2EUC A;  2ZBK B;  2KRK A;  1J09 A;  4DR1 M;  3S14 B;  3IAY A;  4A3D B;  1WTW A;  4IJF A;  3RFW A;  4RH6 A;  4DV4 M;  2QZ4 A;  1QJO A;  3CRL C;  2BOS A;  2KEC A;  1IN7 A;  3P7J A;  3NTI A;  3ND8 A;  5CV9 A;  4A3E B;  1FGB D;  4HSP A;  3K1J A;  3KBG A;  3ILK A;  1N75 A;  1MBY A;  4DR4 M;  1OXV A;  2CW0 D;  2AUK A;  4O42 A;  3GLF B;  2H4O A;  3KLS X;  4DV5 M;  1IYV A;  4QMG A;  1QWY A;  4WFN 3;  3D8B A;  2Q8R E;  4LFC M;  1QB5 D;  1S5C D;  1V1O A;  1HA5 A;  1G59 A;  4DUZ M;  1L1Z A;  1I3Q B;  4ZUJ A;  5M5X B;  3SVM A;  1SEB D;  2F3V A;  4DV3 M;  1DJR D;  1GVN A;  3J7B A;  3GRV A;  5GKN A;  1Y69 U;  5FLX E;  1HCZ A;  1WTQ A;  3R93 A;  2O5R A;  3Q8X A;  1L0X B;  1PTO F;  5BN5 A;  1NVM A;  4FNF A;  1PFM A;  4F88 A;  2B8G A;  1W5S A;  3TWL A;  2QEN A;  3H0G B;  2EJM A;  2F0K A;  3MZ5 A;  3OWF A;  1KTK A;  5C3E B;  3U6O A;  5C6A A;  4K8J A;  4IFD H;  5ITR A;  1K8O A;  1TS5 A;  5EBD A;  2XVS A;  4C1N I;  3KP0 E;  2LH0 A;  3PO3 B;  4NRW A;  2RKS A;  3LMM A;  4XXE A;  2VQF M;  2XSC A;  1GUT A;  4JK1 C;  4IUQ A;  5DNY A;  4I65 A;  1WD0 A;  5JVG 3;  5LMN M;  2I7P A;  3SAV A;  4OVZ A;  3CRK C;  1WTO A;  2XRS D;  4DFA A;  3TBI B;  3I4N B;  1EY4 A;  3D3R A;  5CV6 A;  2D62 A;  4DNR B;  4B3T M;  2K47 A;  2R7Z B;  2EJF C;  2QBY B;  4LF9 M;  2XH9 A;  3D4W A;  1T5X D;  1IW7 D;  1HQY E;  4IJE A;  1S4Z A;  3P75 A;  3MVV A;  3KUP A;  4H44 C;  2F5S A;  3NWT A;  1LT6 D;  4DN4 M;  5D3D A;  1M8A A;  4ABN A;  1TKW B;  1TH3 A;  2G9H D;  4XDX A;  3IL8 A;  4K5X A;  3FUT A;  1KDB A;  1CZW A;  4CKE A;  4B7F A;  2ZXP A;  1MD2 D;  1ZEQ X;  1A2T A;  3MXU A;  3C3L A;  5EQ0 A;  4QB4 A;  4REZ A;  2EVB A;  2O4X A;  5C5M A;  1WTP A;  5ITY A;  4X3T A;  2MGS A;  2A69 C;  1NY6 A;  3RGS A;  4CGY B;  1IN6 A;  1E2W A;  3QG1 A;  4K6D A;  1WVL A;  1HNW M;  1SNP A;  3RUZ A;  1TU2 B;  1U4R A;  3W0F A;  3J80 S;  1HXY D;  2FJ2 A;  3VR4 A;  3DFZ A;  3HU2 A;  3SR1 A;  3GTL B;  1Q3C A;  4LJ9 A;  4PDI A;  1Q8I A;  2K03 A;  1B2T A;  2RQX A;  1IY2 A;  2FMC A;  1Z5C A;  2H1R A;  4QOZ C;  1CZG A;  4LJ6 A;  5IZ7 D;  1BCP D;  5ELF A;  4OHJ A;  1Z5B A;  5IGG A;  2QBY A;  5C4J B;  1IXS B;  1FNN A;  5JI2 E;  4GC5 A;  4GHL A;  1W6K A;  1STN A;  2VQE M;  2JA6 B;  3W2D A;  3PMF A;  4ZRZ A;  2W82 A;  3U6E A;  1DGH A;  2BJW A;  3HEJ A;  2V1C A;  3OPO A;  4TKO B;  2YQZ A;  3K8Z A;  3EQL C;  1TII D;  1GLN A;  1TWC B;  5M3M B;  3FKI B;  1NJG A;  1IBK M;  1PTO H;  1DOM A;  1SNC A;  3DEP A;  4AQY M;  2CHQ A;  4LMQ D;  4ZUI A;  4KJO A;  2CE7 A;  1ZYR D;  4DAP A;  4A3J B;  1SNQ A;  1MSH A;  3D4D A;  4S3S A;  3VFD A;  1QOH A;  3A8J E;  4PV1 C;  1U4P A;  2C96 A;  1B4O A;  1TR5 A;  2B2T C;  4L8R C;  2QPA A;  3KOW E;  2R46 A;  2RDH A;  4XYO A;  5BN4 A;  3VK7 A;  2F0N A;  5CYU A;  2F0H A;  2DN8 A;  1D5Z C;  3SAU A;  5BPV A;  2A5H A;  4IAL A;  1II3 A;  1HHV A;  1E9R A;  1DM0 B;  1DCZ A;  2HQE A;  5J22 A;  3TWM A;  5ELE A;  4G4N A;  1TVX A;  1EZ8 A;  1SYD A;  4A3B B;  5EJC A;  2QF7 A;  3NK9 A;  1L2D A;  5C3X A;  1KFV A;  2VB2 X;  1NJF A;  3CF0 A;  3KBX A;  3K57 A;  5K36 H;  4BA1 I;  3HZX A;  3A56 A;  3IFT A;  3HS0 C;  4QF4 A;  2VUM B;  2FE8 A;  4MGH A;  2QIL A;  2MP1 A;  1HT2 E;  1Z6H A;  3FUW A;  2E2D C;  3GTG B;  3GRR A;  2O5I C;  2HCB A;  5I6Y A;  3EVQ A;  3WDN A;  2C9C A;  4K6L A;  4IBK A;  5ISR A;  1DYQ A;  3LVW A;  2Z7J A;  4IBB A;  1HR0 M;  1SJE D;  4HR7 B;  4BB9 A;  1ZYR C;  3V96 A;  4DAY A;  2I7N A;  4R7G A;  1IBM M;  1LT3 D;  2M00 A;  1ONL A;  3J27 B;  2LKV A;  5EXS A;  1U9R A;  2X6G A;  4B9X A;  4R3D A;  3U6P A;  4WW0 A;  3WHK A;  3AU7 A;  3HP3 A;  1NR4 A;  3K58 A;  1ZXT A;  4XQQ A;  2E2H B;  3SMP A;  3OSO A;  3VYT A;  2EYO A;  3V05 A;  3BDL A;  5A35 A;  4LGM A;  1DO2 A;  3J81 S;  2K1B A;  2CHV A;  5A2Q E;  2RVL A;  2DZO B;  3JAM E;  1R2Z A;  4D82 A;  1KDA A;  3MWY W;  1Q1E A;  1C4Q A;  1O7Y A;  2XFS A;  3A55 A;  1CI3 M;  5DM6 3;  3K59 A;  5LMU M;  4RHS A;  1F9P A;  2UUC M;  3C2P A;  5C0X I;  3K5L A;  2D7G A;  4KN7 C;  1X32 A;  2ENB A;  4QHT A;  1Z6T A;  1JE4 A;  5ITX E;  4GRI A;  2AWN A;  2OQ4 A;  4NKL A;  4G7H C;  4AKH A;  1HTP A;  5CBA E;  1HT1 E;  5JOB A;  3HHW A;  4NW2 A;  2DWZ B;  2IJ0 A;  2NVX B;  4WRD A;  1AP0 A;  5DNF A;  2NTS A;  1A3V A;  5A2Q S;  1I6V C;  4IBG A;  2ZAO A;  1F9S A;  3BVZ A;  2EE1 A;  1XTC D;  1JR3 A;  2QCU A;  2RGH A;  3BZD B;  2E5L M;  2RSN A;  1YSY A;  4OVZ B;  4RGN A;  3KLR A;  2NBF A;  3HKP A;  1VMP A;  3D8G A;  3I4V A;  3U9S A;  1EQV A;  5LL6 S;  3RGP A;  4FF4 A;  1JWS D;  3D31 A;  3TP5 A;  4K2K A;  3GTP B;  4IFD G;  3PIP 3;  5F3W A;  2CQA A;  2V1U A;  4HSV A;  3TPZ A;  4X3K A;  2R93 B;  1O78 A;  4MGI E;  3NSW A;  2EDG A;  2F5P A;  2HUG A;  4RGT A;  4DUY M;  3PFI A;  2M9V A;  1F2M A;  1ESR A;  1TWF B;  1BR9 A;  3FDT A;  4KV6 A;  5IT9 L;  1PZJ D;  4C56 C;  5FSW A;  3JAM S;  4RKL A;  1KNE A;  4ILW A;  5I6W A;  2F4I A;  3B9P A;  1FNV A;  3A7L A;  4MH0 E;  3BYY B;  2HKJ A;  1D6E C;  1U4M A;  3CU7 A;  5IGD A;  2B2V A;  4AI6 A;  4D80 A;  5EP2 A;  1G4A E;  4Q5V A;  4FXG C;  3KOX E;  3NTH A;  1HRJ A;  2JP1 A;  4L16 A;  4ZKC B;  1TY0 A;  1SE3 A;  3X3M A;  3O13 A;  3EFX D;  2QDB A;  1FYC A;  4X65 M;  3MXG A;  1CA6 A;  1EFI D;  1XXH A;  5M5W B;  4FF3 A;  1PMR A;  4KMU C;  2EYF A;  5FLX L;  5IT9 E;  4G6Z A;  2F0I A;  1TDH A;  4P2C B;  3J81 L;  2X4A A;  4QOS A;  2CFO A;  1EYC A;  3HOW B;  3K7A B;  1AN8 A;  3UGJ A;  2HCC A;  4JI4 M;  4NOO B;  4KLN A;  2A74 C;  4UDU C;  3E5S A;  1BOS A;  3S16 B;  4A93 B;  3W0L B;  4KKU A;  3K92 A;  2UUB M;  2Z4H A;  5IOC A;  2R45 A;  3ZCB B;  3N52 A;  5C0X H;  5IWA M;  1UAP A;  4KHP M;  5LHY 1;  2KRU A;  3KVW A;  3QAU A;  3LVV A;  1SMY C;  2R3Z A;  1IY1 A;  1LTS D;  4FCT A;  3L25 A;  1FNU A;  1OXS C;  1R4P B;  4U68 A;  5FLX S;  2WAC A;  1I4Q A;  3GTK B;  1N32 M;  3C1E A;  1MSG A;  4LFA M;  5KPR A;  4MGK E;  2EY5 A;  4TUW A;  5F2D A;  1AZQ A;  2F0M A;  5EKK A;  3H3V C;  4F7X A;  1I6H B;  5ITX A;  2GA4 B;  1JCK B;  3SAS A;  2K33 A;  2OPF A;  1J5E M;  4J6H A;  2Y0T A;  2QKI C;  2DY8 A;  3BYT B;  1EIH A;  4OO1 I;  3HJQ A;  2E2I B;  4LJ5 A;  2JEA I;  2ICE C;  3A46 A;  5DYG A;  3T16 A;  2UU9 M;  4KKS A;  1IKL A;  4A3V B;  1NUC A;  1B53 A;  3KK7 A;  2F0D A;  3VYR A;  3HOY B;  3Q24 A;  4FYD A;  2KVM A;  3VR3 A;  3S2D B;  3D6W A;  4FD2 A;  2RA4 A;  3S1M B;  1D2N A;  2R4E A;  2KHS A;  3TL4 X;  1CHP D;  3A54 A;  2HCI A;  4L15 A;  1R7R A;  5CV7 A;  4NDX A;  4FVM A;  2XZF A;  4ZLT F;  2BA1 A;  4QIW B;  5I4D A;  1V1P A;  3DZD A;  4QUF A;  3T1H M;  5J1Z A;  3HOV B;  3TP7 A;  3HG9 A;  4EQO A;  4ZKB B;  2L6O A;  2B2W A;  4RAU C;  1ILQ A;  1VMC A;  2LY7 A;  2A6H C;  5IGE A;  3M3Y B;  4M9X A;  2PMZ B;  1STY A;  2M60 A;  1ILP A;  2SNS A;  4IBF A;  3I70 A;  3AOE A;  3QB3 A;  3NBI A;  2KCC A;  2B2U A;  4IFD J;  2K7V A;  2PCF B;  1CQV A;  3I90 A;  1R4Q B;  2HDL A;  2ZAN A;  2QEJ C;  3SEB A;  4JYA M;  3T56 B;  1MI2 A;  4DR7 M;  4PMC A;  5J39 A;  2TMP A;  3FEW X;  3J7A F;  1MX0 A;  1OXT A;  5ELD A;  3MEH A;  4BBR B;  2ZXR A;  4G4R A;  2NYZ D;  5ITQ A;  1JWU D;  4IUV A;  3C58 A;  2EYJ A;  3TN2 A;  3ND9 A;  2XN9 C;  3HU1 A;  5E4X A;  2JA5 B;  4LG2 A;  1I4G A;  2JA2 A;  5EPJ A;  3TZU A;  1V8Q A;  2F03 A;  4OIK A;  1LT5 D;  4JI0 M;  1RCV D;  3AL0 C;  2A5Y B;  2KW0 A;  1QYR A;  1WTR A;  2WIN B;  4HL4 A;  1PFN A;  3ONA B;  1NSF A;  1Q39 A;  4JN6 A;  4X64 M;  2I46 A;  1WTV A;  2NQ8 C;  1IW7 C;  2F0Q A;  3D8L A;  4OX9 M;  1GUS A;  1LO5 D;  3CKI B;  1HFN A;  1QE6 A;  1I4R A;  4H7B A;  2EYL A;  2R61 A;  3X3N A;  3MTS A;  7CAT A;  3NP8 A;  1HPC A;  4FCV A;  1B44 D;  2A69 D;  2EXZ A;  5KNB A;  3FUX A;  3BG3 A;  4DR6 M;  3VR2 A;  1QIL A;  1R9T B;  3KXE C;  1DD2 A;  4HMI A;  3KP1 E;  4LF7 M;  2CV1 A;  5EXP A;  2FFJ A;  1Y8O B;  4PNY A;  3GRU A;  2K5D A;  4QNM A;  1TGU A;  3BOS A;  3VA7 A;  3QWL A;  1H9M A;  3PUY A;  3ITP A;  1STG A;  3I4L A;  3DEO A;  4R9W A;  5C0X J;  4DR5 M;  5DEH A;  1GUN A;  4NRV A;  2EOT A;  1HTL D;  1NHG C;  1KLG D;  4V19 0;  4IUU A;  1EZ6 A;  2X6L A;  2B39 A;  1PRT C;  3U9O A;  2KCN A;  1PTO D;  1ENF A;  3WHL A;  2B2T A;  2XWB B;  3BVG A;  2EYH A;  2Z8L A;  2FNA A;  2FFK B;  1QAQ A;  1K82 A;  4A3K B;  2KA7 A;  1LAB A;  1QNU A;  2D7H A;  3R2I A;  3FVQ A;  3U6L A;  4KD4 A;  1I4P A;  1VDZ A;  4QCL A;  4RKB A;  1BNZ A;  1CK1 A;  1F2L A;  5E26 A;  1Q3B A;  1BDO A;  3R8F A;  4FWG A;  3FTC A;  1GUG A;  3BS1 A;  5KQD A;  1CM9 A;  3OWE B;  5HUR A;  2C99 A;  4PCZ A;  2K04 A;  1STE A;  1NY5 A;  3TDQ A;  5A2Q L;  2LMC B;  4NXN M;  1HQC A;  1N34 M;  2B8F A;  3LQR A;  1LV9 A;  3H94 A;  2X8A A;  5D14 A;  4CKB A;  1EIG A;  3HGI A;  2PZU A;  4XTC S;  2BDN A;  3GLI B;  2QP9 X;  2R62 A;  2ICI A;  4MGZ E;  4HMJ A;  4RWS C;  1SXT A;  3EIH A;  5C18 A;  1K3X A;  4BWG B;  1NHW C;  4G7O C;  3R3O A;  2F1M A;  3CF6 E;  3GRY A;  4X66 M;  5KPT A;  4NP5 A;  4B9W A;  1CA5 A;  4I7Z C;  5EP3 A;  5C4X B;  1QAN A;  1TY2 A;  1PJJ A;  1HA6 A;  3PUV A;  1H9J A;  3UJN A;  4C2M B;  2UUA M;  2RDF A;  1V43 A;  5CMD A;  3T53 B;  1RTN A;  5E6J A;  4WOR A;  1LTR D;  4B08 A;  2E76 C;  2AWO A;  2FIN B;  1NAP A;  2LS0 1;  2D7E A;  4CJ2 C;  1PM5 A;  2P5T A;  4C3I G;  3UZU A;  1QAM A;  3L3O C;  3FTD A;  1NSN S;  1DGF A;  3VA5 A;  4JI1 M;  3GQ5 A;  4ME5 A;  4CBV A;  1IN8 A;  3SYL A;  5C4Z A;  4OO1 G;  1AEX A;  1NR2 A;  3FYD A;  2YYZ A;  4AKI A;  2B2V C;  5KRU A;  4DV6 M;  1G2T A;  1JOO A;  1LTT D;  3VDP A;  1DGH B;  3GO5 A;  5FKA C;  3GV3 A;  3DM1 A;  2DWL A;  3Q22 A;  4C1N K;  3E6Z X;  4DNT B;  4EQP A;  1QG7 A;  1Q90 A;  3MJ5 A;  1BCP F;  1C1K A;  3QJY A;  1IN4 A;  4ULL A;  1SYG A;  4JI7 M;  1MU5 A;  1ZKO A;  4KJN A;  3TP6 A;  5AFW A;  1X37 A;  2F4V M;  4GMQ A;  1TS3 A;  3QOL A;  1Z5A A;  1K83 B;  1I4H A;  1RDP D;  2JEB I;  4MGY E;  2RDG A;  4IZ8 A;  4G57 A;  1GXD C;  3OW7 A;  1AZP A;  5KPZ A;  2KZU A;  3H4M A;  4O1N A;  1EYD A;  1DXM A;  1DO0 A;  1CFM A;  3KFU G;  1XHB A;  1BO0 A;  2SNM A;  5KEE A;  1R6B X;  3MFG A;  1G41 A;  1PXU A;  4F87 A;  1IN5 A;  1SAP A;  1CQF A;  2XFT A;  1PFB A;  1XC8 A;  2F0E A;  1EY9 A;  4ID6 A;  2D9U A;  1TWA B;  4XYQ A;  4I4L A;  3TSS A;  3LNN A;  3SE0 A;  1SSO A;  1F77 A;  3JR4 A;  5JPM C;  5EKL A;  1WXQ A;  1PRT D;  2B63 B;  2F5Q A;  3NPP A;  2R6G A;  5E1F A;  3TE6 A;  5EXT A;  1KAA A;  1G91 A;  1PTO B;  3GLH B;  2D5D A;  4XIG S;  4DR3 M;  3AB9 A;  2KXE A;  1B9M A;  4F8M A;  4GKJ M;  3GO8 A;  3HGB A;  1EY6 A;  1QVR A;  1QNK A;  3OHX C;  1Z59 A;  3MHV C;  4IUR A;  3FD9 A;  4II7 A;  1ET9 A;  3GQ3 A;  5CV5 A;  4BBA A;  4CJ0 B;  2PQE A;  1OXX K;  5M5Y B;  2L09 A;  3U60 B;  2NZ1 D;  3R8B A;  4Z8X A;  3VDU A;  4JI8 M;  1S5D D;  4IFD I;  1JR3 D;  1BXT A;  1B9N A;  4IQZ A;  2IWH A;  1SE4 A;  1JOK A;  2KOL A;  1FR3 A;  4PQX A;  4K8I A;  4CKC A;  2PZT A;  2CHB D;  4IBI A;  4XBO A;  5IRE B;  3U61 B;  2XIW A;  2IX1 A;  2JA7 B;  3PVS A;  3A8K E;  4A3F B;  1TWH B;  3PUX A;  2F0F A;  3U6D A;  2AQ1 B;  5JEA G;  4LF8 M;  4G4K A;  4M1U B;  1PTO C;  1ENC A;  1XWE A;  4B3R M;  4GC9 A;  3F2U A;  2KED A;  1YNJ C;  2B2U C;  3AOE C;  2ID0 A;  1RHP A;  4A3I B;  3NE5 B;  3NWS A;  1VCI A;  1XX8 A;  3I4Y A;  4JV5 M;  3PUW A;  2Z3X A;  3MXP A;  3N6R A;  1HNX M;  4K0K M;  3RZO B;  3KW6 A;  4ZK9 B;  2VNU D;  1IL8 A;  5EPK A;  1H9K A;  1JIC A;  3S9W A;  1HQR D;  2DY7 A;  1SYF A;  2L0C A;  4LZZ A;  1B1Z A;  1RTO A;  5EJW A;  4LJA A;  5EBC A;  3Q6S A;  2SOB A;  2NTT A;  2ZAM A;  3L7Z C;  3FUU A;  1SMY D;  2Z1C A;  2L11 A;  2MUY A;  4JI6 M;  4KY5 A;  4CJ1 B;  2EYM A;  3DWQ A;  5CBE E;  1GL7 A;  3CTW B;  2L4N A;  3GQB A;  3U5Z A;  2G5G X;  1DOL A;  2L5T A;  3BDC A;  2LXE A;  3HHZ A;  3RE8 A;  2Z4S A;  1SNO A;  1ROD A;  1L1T A;  5CV4 A;  4DV2 M;  1RJT A;  4DV7 M;  1EY8 A;  1KSF X;  1ESF A;  3T4A C;  1SXJ C;  5IOD A;  5DYI A;  3IG8 A;  4C3H B;  5TSS A;  2FOI C;  3GPX A;  1EU3 A;  1IXZ A;  5M9O A;  2KUM A;  3J81 E;  3VKH A;  3SXH A;  1J8I A;  3UK6 A;  2B2W C;  2KEE A;  1IKM A;  2A68 D;  4MN3 A;  5JVH 3;  1W6J A;  2HL7 A;  2WII B;  3KDS E;  1LAC A;  3EJI A;  1QAO A;  1LLR D;  3NHH A;  4AG5 A;  3NQI A;  4H0L C;  2DVW B;  3T1Y M;  4B3M M;  1O7Z A;  1SXJ E;  2RGO A;  3CF2 A;  2NVT B;  1PZK D;  3U6S A;  2DXI A;  2E74 C;  4TRD A;  1CTM A;  4I81 A;  3T13 A;  5IIF A;  1J9O A;  4BBS B;  1A2U A;  1WTX A;  1XXH B;  2SDF A;  3AOG A;  2CVR A;  1G6Z A;  2Q2E B;  3SK8 A;  2AUJ D;  2IPK D;  1HUM A;  4LRS A;  1LV7 A;  2EO2 A;  4XGI A;  2K28 A;  4A3M B;  4FWD A;  2NN6 G;  3EIE A;  3U6M A;  2FHT A;  3S2H B;  3U5Z B;  4PMB A;  2C98 A;  4I5S A;  2PNR C;  3H6M A;  3SYK A;  4OL7 A;  3JAM L;  2DNC A;  1OFI A;  4GHA A;  1Y1V B;  1EWH A;  2XRQ D;  1Q3L A;  1D1K A;  2WKC A;  4LY6 A;  2C5C A;  3MC0 B;  2BE5 D;  3D4R A;  4LF4 M;  2O5J C;  3RLF A;  3OMC A;  2JE6 I;  4KY6 A;  1STB A;  5C5L A;  1EL0 A;  3SK4 A;  4JI3 M;  2IL8 A;  1ORY B;  3PXG A;  2F0V A;  1AW7 A;  2NUC A;  3Q23 A;  3GD7 A;  5K36 G;  4M0W A;  5FO8 B;  4L4U A;  2Q8T A;  1V1P B;  1DOK A;  4HLQ A;  3FUV A;  1SDF A;  1SBB B;  3L9A X;  5C3W A;  3I91 A;  1WD1 A;  4BY7 B;  3U60 A;  3GPU A;  3AJI B;  3OOC A;  2F0G A;  2EYP A;  2L9H A;  3I72 A;  2XNA C;  2CV0 A;  3AKZ A;  4M0D A;  3GTQ B;  3VYU A;  1GUW A;  3KOY E;  1JQJ C;  3LWE A;  3GP1 A;  2PPB C;  3L29 A;  1E32 A;  1M4V A;  3HWS A;  2WAQ B;  4AYB B;  3QO2 A;  3RMH A;  3PV0 A;  3DWP A;  2EA0 A;  1WCM B;  4RFB A;  3L26 A;  5EP4 A;  4YHH M;  4ZAI A;  3HOU B;  1TWG B;  1ET6 A;  4M9S A;  2L55 A;  3NQT A;  5KQ8 A;  1E2V A;  2QCP X;  4B7H A;  1H6U A;  4C3J B;  3GTJ B;  3T15 A;  3E9S A;  5I2X A;  3SBJ A;  3KS8 A;  4J8Q A;  2J7O A;  2C5R A;  3M7N A;  2F0P A;  3K5O A;  5IGC A;  4FXK C;  3UMM A;  4DU9 A;  2F0J A;  4W5W A;  1L2C A;  3I8Z A;  4Y7N B;  2N55 A;  3QWN A;  2CEA A;  2AQ2 B;  2Z4I A;  4AKG A;  1PRT F;  1XWI A;  2KEB A;  2KZS A;  3HOX B;  3K5M A;  3BVM A;  4HCS A;  2MHV A;  4EGV A;  4AW4 A;  4PDG A;  2EPB A;  4TSS A;  3PNV A;  4B3S M;  4ODG A;  2YFQ A;  1CT1 D;  5C0X G;  4LGY A;  2R65 A;  1XYI A;  4KO8 A;  2Q8I B;  2R18 A;  4RGM A;  4IUN A;  2IX3 A;  1XXG A;  2A68 C;  5T1G A;  4GZY C;  3P1H A;  1QQW A;  4FXD A;  2K32 A;  1B3A A;  4CHT B;  1IXR C;  2BJV A;  3ERO A;  3GTO B;  3DA1 A;  3CHB D;  5C44 B;  3IFD A;  4C3H G;  4DXF A;  4G4Q A;  2WB1 B;  1D2B A;  3KLS A;  2F0L A;  1LTG D;  4V0B A;  1JB3 A;  1E2Z A;  3K2L A;  1SJH D;  2LFN A;  2O2L D;  1Q12 A;  2K5Q A;  2BDO A;  5FTK A;  3P20 A;  2Z4R A;  3ZH9 B;  3THG A;  4IIW A;  3SAT A;  1O7L A;  4NL4 H;  1SFO B;  4HTH A;  2XLJ A;  4PT5 A;  1GKI A;  4A3G B;  2NVQ B;  5KGU A;  4LF6 M;  4QHS A;  1NCV A;  5KYL A;  1LTI D;  3NWL A;  3QIA A;  1EOT A;  1N77 A;  4DAV A;  3AMU A;  4FF1 A;  4OW0 A;  2RBM A;  3KF8 A;  4RF1 A;  1UNS A;  4GKK M;  3FTF A;  4Z6Y A;  5G3L F;  3S1Q B;  4WJW A;  5JJZ A;  4IUP A;  2RKO A;  1CHQ D;  5IT9 S;  3LWU A;  4KN4 C;  1BUV T;  2JSO A;  1DZ1 A;  1BQQ T;  3KS4 A;  2X49 A;  4LJ4 A;  1G3I A;  4EVO A;  2Y0Q A;  2XEP A;  4GH9 A;  4KTA A;  1W5T A;  4AZF A;  4DV0 M;  2VXW A;  5H37 D;  2K6A A;  2L1B A;  3PO2 B;  2A6E C;  1I4X A;  2X69 A;  2A6E D;  3NBH A;  3L27 A;  4LJZ C;  3IG5 A;  1Y8N B;  1OO9 B;  3SK6 A;  1JC7 A;  2UXD M;  1RKN A;  2I07 B;  2BCO A;  2ZXO A;  5KND A;  3A42 A;  2AHM A;  4FW9 A;  2J7Z A;  3SMS A;  1I94 M;  2L7H A;  1NNU C;  3GPY A;  5FTL A;  3OIQ A;  4B7G A;  4OIJ A;  1TH4 A;  1ZAE A;  4DV1 M;  1BCP C;  5I9O A;  3VYS A;  5IGB A;  5KIX A;  4IBD A;  5BR8 M;  3GP7 A;  1L2B A;  1K8M A;  3AFH A;  4M9Z A;  1T5E A;  3RZD B;  1XNQ M;  4K14 A;  2BNK A;  5EXX A;  5FTJ A;  3M7G A;  1I4W A;  4PD2 A;  2C9O A;  3J80 L;  3AV0 A;  2CUZ A;  5BN3 A;  3NUC A;  2UXB M;  1YNN D;  3IKJ A;  3H91 A;  2EY2 A;  4ZPX A;  2BE5 C;  4HAE A;  1EEF D;  3R2T A;  3KSX A;  3L2A A;  3FYC A;  1A15 A;  4IUT A;  2K5W A;  1GOZ A;  3ZYY X;  4JBW A;  2DNE A;  5T1I A;  2J7N A;  4U67 3;  4DA2 A;  4DK1 A;  1UEA B;  2SEB D;  2Y20 A;  2K05 A;  3U6C A;  5FO9 B;  1DON A;  2ZT9 C;  3URY A;  4YY3 M;  2L7I A;  3MFY A;  4LZJ A;  1PZI D;  2UXC M;  2LWX A;  3FRP B;  3TP8 A;  2XSZ A;  3SDZ A;  3W3A A;  1A3T A;  5JAV A;  3NTK A;  4FF2 A;  2EY6 A;  3G6J B;  1PDQ A;  2FMM A;  3DWA A;  4K5V A;  2V6Z M;  5FTN A;  2CW0 C;  3ERQ A;  4DXG A;  4R8I A;  1IYU A;  4HN7 A;  3TME A;  3S17 B;  2NN6 H;  4BA2 I;  5IGF A;  3FTE A;  4NXM M;  1HUN A;  5CGK A;  1EY5 A;  4P16 A;  1IY0 A;  2G8L A;  1BCP B;  1S3S A;  4DK0 A;  2Y0S B;  2OEO A;  1Y8P B;  4L63 B;  5EP1 A;  3FPU B;  4KHV A;  3GLG B;  4DF7 A;  3DXJ C;  2BA0 A;  1YUB A;  4R8N A;  4MB7 A;  5E4W C;  4IBC A;  1KDC A;  3I3C A;  3FKE A;  1E94 E;  3TQS A;  3R9X B;  3LQQ A;  4AG6 A;  2L12 A;  3V2T A;  3VLF B;  3K0Y A;  2YNM D;  3QOJ A;  2E75 C;  3MA2 B;  3GPP A;  1SNM A;  4LFB M;  1KLU D;  1S5B D;  1EY0 A;  4BY1 B;  3DMU A;  4X3S A;  3DUZ A;  5CR3 A;  4JI5 M;  1DGB A;  5I2Y A;  2RSO A;  2NWG A;  2VII A;  3I73 A;  1C8C A;  4XQN A;  3FPP A;  4DGZ A;  2EY1 A;  2ZM6 M;  1HFG A;  4OO1 H;  3PIO 3;  4KKT A;  1SE2 A;  2J0T D;  4ZYS A;  3SHL A;  1GHJ A;  2OF1 A;  4FWH A;  5NUC A;  1IBL M;  4YIJ A;  3HHX A;  2R4J A;  1EEI D;  2WP8 J;  3J7A V;  1N78 A;  1X3Q A;  4IBJ A;  4C3I B;  1IHZ A;  2YR0 A;  1RD9 D;  1H9R A;  3I51 A;  1JQY D;  3LX0 A;  4G4O A;  1EQT A;  4M8A A;  2HDM A;  5ELC A;  1OXU A;  3UI2 A;  3A45 A;  3PNY A;  3K5N A;  1C48 A;  1ENA A;  4KOD A;  5EGT A;  4JXJ A;  3C46 A;  1EYA A;  4LJ7 A;  1LTB D;  4XT3 B;  4Q0F A;  1F2Z A;  4J1M A;  2MJ8 A;  4LCB A;  3SK5 A;  1F9Q A;  3MHB A;  8CAT A;  1O80 A;  4LRT A;  2N88 A;  2NB0 A;  2V4D A;  3M4O B;  3EA6 A;  3VR6 A;  4QNR A;  3OMG A;  4JI2 M;  4N9T A;  3OIP A;  4K2L A;  1IM2 A;  3TZD A;  1HQM C;  1JR0 D;  1TS4 A;  5DAU A;  1I50 B;  2B2Y A;  2AQ3 B;  1DGG A;  1TS2 A;  5G3L D;  1X3P A;  1SXJ A;  1PLF A;  1TT2 A;  1A6X A;  4RGO S;  3HKZ B;  4NSR A;  5C1B A;  1NNJ A;  3VKG A;  2OT2 A;  5JEA H;  2JYO A;  3U61 A;  5D65 A;  3E0J A;  2YU9 B;  3T38 A;  1GL6 A;  4LAA A;  3MK6 A;  1F9R A;  2A73 B;  3GLF A;  2B2Y C;  3J80 E;  1H9S A;  1UM8 A;  3HJ8 A;  3M85 A;  2TSS A;  1J7K A;  4L78 A;  3HHY A;  4LK1 C;  4RF0 A;  5EPL A;  3S1N B;  4XT1 B;  5M3F B;  4GIT A;  4KI0 A;  2M5Z A;  3K6O A;  4K5W A;  3DOA A;  3BDO A;  3WOF A;  3D6C A;  1YNJ D;  2JA8 B;  1N33 M;  5E3F A;  3TWK A;  2EZV A;  3GLI A;  2DWN A;  4XQJ A;  4IN3 A;  4OGQ C;  4KY7 A;  3OTO M;  1R2Y A;  4FP5 D;  1GJX A;  5EKI A;  4EQN A;  1SXJ D;  1KAB A;  5JI3 E;  4NSO B;  1BBX C;  1SYB A;  1OJL A;  1UUP A;  1AFP A;  1FNW A;  3JR5 A;  3SAW A;  1BF4 A;  5D3I B;  1GHK A;  4Z9C B;  1D5M C;  4WUR A;  3SFZ A;  5FTM A;  1H9S B;  2F0U A;  1MGS A;  5CC4 A;  1VDD A;  1SYC A;  1EU4 A;  2F0S A;  3M0E A;  4I8O A;  3S1R B;  1SXJ B;  5C4H A;  1IQP A;  1ICW A;  3J7A S;  4BLC A;  1KNA A;  1T3T A;  1PJI A;  4RHR A;  2DWM A;  1FD7 D;  1HNZ M;  2NN6 I;  1EWC A;  1LTA D;  1STA A;  2PW7 A;  3HJS A;  5I9P A;  1K3W A;  1SYE A;  3RD4 A;  3SC3 A;  5KYI A;  5HGT A;  2EJG C;  5LL6 X;  1OFH A;  2F0O A;  1PRT B;  2H1E A;  3KSJ A;  4EIW A;  4HED A;  3H09 A;  3S15 B;  3SHF A;  4L8J A;  4RCN A;  4KHZ A;  2IT1 A;  3HRZ C;  2F3W A;  4BS9 A;  3A7A B;  5CV8 A;  2WKD A;  2XWJ B;  1RF2 D;  3I4M B;  5COY A;  1EY7 A;  4RCO A;  1ML0 D;  3J2P B;  3MXN A;  1L8Q A;  1YE9 A;  3J7Y W;  3HOZ B;  4MM3 B;  2OXP A;  4TQU S;  2J4X A;  5FO7 B;  5DM7 3;  1SND A;  4PMW A;  3VK8 A;  1D5X C;  2IW3 A;  5JPN C;  1VF5 C;  1B50 A;  3A98 B;  2A6H D;  1VF7 A;  5FOB B;  2F0T A;  3A8I E;  4QUC A;  2PO4 A;  2PYK A;  1G2S A;  5ELB A;  2XSZ D;  1JOQ A;  1S5F D;  4MIU A;  3E4R A;  3GLG A;  3L28 A;  4OU7 A;  4IBE A;  2CV2 A;  5ITT A;  2Y21 A;  1E9S A;  1XNR M;  1S5E D;  4D81 A;  1TH2 A;  1N36 M;  5COR A;  1LT4 D;  1Q1B A;  5FK9 C;  2MPM A;  4X3U A;  4X62 M;  3M4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...