3NBIA

Crystal structure of human rmi1 n-terminus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
203
structure length
193
Chain Sequence
NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of RMI1 and RMI2, Two OB-Fold Regulatory Subunits of the BLM Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords RecQ-mediated genome instability protein 1
total genus 44
structure length 193
sequence length 203
ec nomenclature
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3nbiA01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nbiA02
3NBIA 4CHTB 4CGYB
chains in the Genus database with same CATH superfamily
5KGUA 3NWLA 4JN6A 1X3PA 1Z7TA 4IBIA 3S1NB 3MXPA 3SAWA 3VYTA 2JA9A 3OTOM 4HIOA 3VFDA 2K5WA 2K9DA 1VCIA 3H0GG 3KJPA 1HUNA 1PH4A 3CCVA 4GH9A 1K83B 3LWEA 5E6JA 4DV1M 3CQZH 3PGZA 3J80c 2NVXB 1IXSA 3KF8A 2QDBA 3QIAA 3SHGB 3CGWA 1DD2A 1PJIA 3QR8A 3FYCA 4XT3B 1N9WA 2O5JC 2B3TA 4BY1B 3NTKA 1NSFA 1I3QH 4ULLA 3CCEA 2DUDA 4R4CA 1HQYE 3DEOA 2LVNC 4X3TA 5C3EB 3HHWA 4DR1Q 4GEWA 4B3SL 3A55A 2KCMA 5IP7H 3PFIA 1XMOQ 2PNHA 1IBLQ 1LTID 5EXTA 3R3OA 4AKIA 4A3KB 4RKUF 3FPUB 1EIGA 4LFBQ 1XMOL 4F1IA 5DNYA 1HFGA 4GC9A 1EE8A 2FFKB 4DNRB 3CC2A 3QOJA 3U6DA 2YU9H 1VDLA 4G4QA 2BE5D 2K14A 3RD4A 1AUAA 1UNSA 2F3IA 1B2TA 4MTKA 1EY7A 4BBSH 3CCQA 1NR4A 2PQEA 1L1OC 2DNCA 4H44C 2LH0A 4IIWA 4QHTA 1X55A 1BR9A 1KRTA 1YNJC 1T6OA 2XSCA 1KRSA 3K5OA 3IG5A 5LMNM 4UPAA 5C4HA 1L2DA 1FL0A 3HS0C 3HOWH 1PTOB 4HJAA 4ALPA 1BXTA 3FD9A 5IREB 2PMZB 1QZGA 4XGIA 2J7OA 3RGSA 3DEPA 4BBRG 2G5DA 3A54A 5C3EG 2A6HD 3BZKA 3PIP3 3BOSA 4MB7A 4L5SA 1XMOM 1PTOH 4NOOB 3CCSA 1NJGA 1R7RA 1R4QB 1N32M 4NPSA 1AFPA 3SEBA 4GS3A 5BN4A 2WSEF 4DR1L 2YR0A 1V43A 4GLAC 4CJ2C 3HHYA 4KK7A 1J9OA 4OXPA 4GOPB 2UUBM 2E5LQ 1B8AA 2J0TD 2N55A 3JAMi 1MBYA 2BDOA 1AE2A 3HGBA 3MTSA 3J7BA 4UN2B 2GVBA 1E94E 1KSFX 1G2SA 5D3IB 3S1RB 4KODA 1TY2A 2XIWA 4DR5M 2E5LL 3HOYB 4KHPQ 1NY5A 5EP3A 5KPZA 3A45A 3GLIB 3C9PA 1K3BC 4A3GG 3J81j 3A5UA 4LF8L 4HR7B 5IT9E 5F2DA 2VQEM 1CI3M 4GOPC 1M4VA 3H15A 3QB3A 2AQ3B 4KHPL 1PZKD 1VF5C 2I46A 3OIQA 1VQNA 4B3RQ 1VS0A 1MU5A 1AN8A 4RKBA 3VR2A 3S15H 2PI2A 2K0BX 1OFIA 3M6AA 3CPFA 3K0XA 1PH7A 2R7ZG 5IY0A 5LMNQ 4AQYM 1Q3CA 3MXGA 4RAUC 5KEEA 4JI4M 1E32A 3U9OA 2JA6G 3FP9A 4B7FA 2K7VA 2PCFB 2R6GA 3K5LA 1PTOD 3PIOA 4GOPA 2M2LA 1VQCA 4ZKCB 1NR2A 3OTOL 1I50H 1DGBA 5GKNA 4JOIA 1DGGA 4LY6A 1NJFA 1LTGD 5EKKA 2DY7A 2EJGC 2HWJA 5EXPA 5IWAM 3U61B 4MGHA 4LFAQ 2CE7A 4MHEA 1SG9A 1Q8KA 4BBAA 3D6CA 2B2TA 4F87A 2EKKA 4QJFA 4A3CG 3HEJA 5EAYA 1TS2A 1HZCA 4OWTB 1N34M 2FE8A 1QYRA 3NSWA 1G71A 4LF8M 3QAUA 4OVZB 5ELCA 2DN8A 1PJSA 3RN2A 5IYDH 2NQ8C 4KHPM 4A3IB 2F03A 4AZFA 4P75A 4ZUJA 2CH4W 1TF0B 3UJNA 1B3AA 2WFWA 4PZ6A 2VQEQ 1PJTA 1D6EC 4C1NI 1PH2A 1FJGQ 4JV5L 1QWYA 3I4VA 2WACA 4AQYL 4BY7B 1PJJA 3HY5A 2KW0A 2BCOA 3A8KE 4JI3Q 4XDXA 4C3IH 3ND9A 1XPUA 1PRTF 1G91A 1Y1VB 1YVCA 2DHRA 3KF6B 3ER0A 5C44B 4BB9A 1Z5AA 2YTXA 1H9MA 1STAA 4IJHA 1QVGA 4K14A 3HX3A 5IGDA 1XWEA 5JJKA 3DOAA 2F5PA 1VMPA 3L7ZC 1UWVA 1Y1VH 3PIPA 4DR4L 2O5RA 4G4OA 4NXNL 1HT1E 1XMQM 5FO9B 2NN6H 1BQQT 2ZTCA 3CW2C 4HMJA 4X3UA 4GKKQ 3KK7A 2O4XA 3GLGA 1QDRA 1Q8IA 4X66Q 3CKIB 2XRSD 4LJ8A 4HTHA 3GV3A 1QZMA 3OTOQ 4JI2Q 4WJ4A 2Z4RA 3FVQA 3CF5A 1N36M 3HKZB 3NQTA 1JB7A 2DJGC 1PM5A 5C5LA 1F4IA 5LL6X 3H3VC 2Y0TA 2DWZB 5BN3A 4MGKE 1DZ1A 1RTOA 2NBFA 3PVSA 2EYFA 2RHSB 3HOZG 4OIJA 4IBKA 4REZA 1EZ8A 1P16A 2JA8B 3VKHA 4HEDA 4A3DH 1JJCB 2R4JA 4QNMA 3WHLA 4X62M 5M3MB 3FE3A 4AYBG 4J8QA 4LF9L 1L8QA 3H09A 1LTAD 4A3BG 3KOJA 1Y1WG 1U4LA 2UUAM 5FO8B 1SFOH 1TWAH 1Z6TA 2F3VA 1KNAA 1SRUA 1KHIA 2MO0A 4I7ZC 3TBIB 1VQ4A 1GO5A 1XTDA 4XBOA 3KLWA 1HNZM 1O7ZA 1NNJA 3A7LA 1JICA 3MAQA 4LF6M 3I4LA 1F77A 2E2HH 4ABNA 2FOIC 3NENA 4JI1M 3RZOH 5EJCA 4IBEA 1GD7A 3BZCA 1GHKA 2O2LD 5G3LD 1STEA 2KEEA 4U673 1TT2A 4X65M 4JCVE 4PMBA 4QL5A 2HHHQ 1OAIA 3HJQA 3GLIA 4BXXH 5CBEE 4CKBA 4FF1A 5IT9L 1HR0Q 4A3EB 1I6VC 5C5MA 1ET6A 1N78A 1KFVA 2EYHA 4A3MB 4GKKL 1JJGA 2F4VM 3ZC7B 1PV4A 2EXZA 1J5EQ 5AJ3L 2PW5A 4AI6A 1SYEA 4RKLA 1WJJA 2A73B 3MHVC 2CHGA 1Y1VG 5L37A 3J7AV 4KJNA 5ELNA 4KN7C 1GL6A 2ZXRA 1GLNA 3BZDB 3SDZA 5FJ8H 4JI2L 2K28A 5FTNA 3NELA 1YUBA 1SNQA 4IBJA 3JAML 4M1UB 4LFBM 2N78A 1IW7C 3T38A 1IN7A 3QWLA 1CTMA 3NQIA 2Q2UA 3PO3H 3MMPA 2B2UC 2UXDL 1E22A 1ONLA 2K32A 4OX9L 2CWBA 3CRLC 4P2CB 3I4MH 4QQBX 4CISA 3NWSA 2F0QA 4FF2A 2F0NA 4FCWA 3K5MA 1A5TA 2EYMA 4C3JH 2JP7A 3CCUA 1PFBA 2KEBA 5H37D 3I70A 1CZGA 1ASYA 3L29A 2KOLA 3OWFA 2EZVA 2DAKA 3HU2A 3NPPA 4F88A 2JNHA 4PV1C 4FCVA 2NZ1D 3K8AA 2HQLA 3STBD 4DV3M 3L2AA 4PCZA 3BU2A 3MA2B 4KD3A 2NVTB 3GQ3A 3CF2A 7CATA 2IPKD 4X64L 4DFAA 2KVMA 1TWGH 3D0FA 2CW0C 1A3UA 1MX0A 1EQRA 2F0MA 1D5XC 3UI2A 3SARA 1IBMM 4PZ7A 3H0GB 3K6OA 2F0WA 2CUZA 2KCNA 3SYKA 1LM0A 1RKNA 1SBBB 1HR0L 3L25A 1CHPD 4NXNM 5M5WH 4MM3B 1VQEA 4LF7L 2R18A 4M9XA 3KOXE 1NHWC 2F52A 2JN4A 1Y14B 2MNAA 2SNSA 3GRUA 2CP8A 2RGHA 2HDLA 2L5TA 1KL9A 3GV6A 2PQAB 2VNUD 4FWDA 5FTLA 4N9TA 4NW2A 3P20A 4DAPA 2JA5H 2LVOC 1HTPA 4TSSA 1QG7A 2FMMA 4JC0A 2OO9A 2NVYB 3F2UA 2LHGA 1ZYRD 4B3SM 2IL8A 3DXJC 3DM1A 2K5VA 3KYHC 2XSZD 3IFTA 1XNRM 2M00A 1DOMA 1F2ZA 5FJ8G 2K47A 3HJSA 1C4QA 4BA2I 3S2DB 2G9HD 1SXTA 3GTMH 1EWHA 4S12A 2HIXA 5IOCA 3GTQB 1S40A 1IY2A 2N88A 1HZAA 4JI4Q 3W3AA 1MHWC 2MH8A 2PZUA 1IXRC 3ULPA 3TP8A 3GLFB 5IWAL 4JI7Q 4RHRA 2B2WA 2Z1CA 1IXRA 5J1ZA 1OTCA 3K80C 1T5EA 2RDHA 4CKCA 4I7AA 4LUVA 1N34L 4L6V6 2DAMA 4EQ5A 4LJZC 1SXJE 3SGIA 4LF6L 3FUXA 1VMCA 3LQRA 4WORA 1VQ9A 1BO0A 3HHXA 3MJ5A 3VK7A 1DJRD 3T56B 4FYDA 2K6BA 5HGTA 3S1NH 3X3NA 2VIIA 1N34Q 1BBXC 4YCVA 3P7JA 4DAVA 5M5XH 5C4JH 3BDLA 4DV2Q 1KIXA 3S1QH 2EPBA 2KCCA 4QCLA 3OOCA 4BBRB 3GTLB 1DO0A 2C9OA 5IYBG 4ODGA 2E2JB 1XNRQ 2LXEA 2GNOA 4D82A 1NAPA 5FLXc 1VQIA 1G6PA 4XK8F 1NBWA 1B50A 4NSOB 2B63H 3KDSE 1OXXK 2XTIA 3WOEA 4B9XA 1TR8A 4LFBL 3U6PA 1DM0B 2F0VA 4OW0A 4NXML 2WB1B 3LWUA 3HOXG 1RODA 1S5DD 2LXJA 3BYTB 1DGSA 2R92B 5M3FB 5GQOA 5IZ7D 4JI7M 1FYCA 5CV8A 2HQEA 3AFPA 3S1RH 1F9SA 5C4XB 2R6FA 3THGA 3I4NH 2KNZA 5KYLA 4PDIA 4OU7A 1TVXA 4DV6M 2CH4A 4I8OA 1N77A 3GTGB 2F0GA 2GQFA 4NB3A 1PZJD 1NJIC 3A5ZB 2NVTH 4JI5Q 4MN3A 4C3HH 4I4LA 4LF6Q 4BY7G 1D2BA 4W5WA 2JA6B 5A2QE 2WV6D 1E7ZA 4KMUC 1HJPA 2QZ4A 2HIVA 3E5SA 4CJ0B 2FINB 4L8RC 4MNOA 4LG2A 4AKGA 3RFWA 2N35A 2I0QA 1KXLA 4LF4Q 2B2UA 1NHGC 1HR0M 3ICEA 4QIWE 4UY8C 2BH2A 3FKIB 1VEKA 2CHQA 1ILPA 2MJ8A 3A8JE 3TE6A 4HIMA 2CKZB 4LGMA 1EY9A 1BVSA 4GITA 1RF2D 1GJXA 4JI1L 4AIMA 1GUTA 2D7HA 2LY7A 4MZ9A 4Y7NH 1FNVA 2VUMG 2YYZA 4X6AH 2WAQG 2Y0SE 2UXBM 2JP1A 4MTNA 2JA5B 1TDZA 2MFIA 3I51A 4JI1Q 1TKWB 2NVYH 4EQOA 1MJEA 1JOOA 2DWNA 4JI0M 4ZQ3A 1WCMB 3WOFA 3GO8A 2JA7G 4IFDG 2K75A 4N8X1 1STGA 3K1JA 2JZ0A 1I94M 5KNCA 2F1MA 2RSOA 1SNDA 4R8IA 4C3JB 1MGSA 3U58A 2VY3A 4R9WA 3ITPA 4C2MH 1JR3A 4K6LA 1SEBD 1SYCA 2EQSA 3HOWB 3UDGA 1OO9B 1D5MC 1SXJB 1TWFB 3FPPA 3K81C 5JPNC 3JR4A 1PXUA 1K9MC 1WTQA 1WTHA 5FLMG 3I72A 1QAOA 2N3SA 4JI5L 1AIPC 3J80E 1L1ZA 1ZMWA 3KF6A 2FH0A 1DGHA 1DV0A 1CZWA 1SAPA 4UP8A 5CYUA 4WW0A 5LMUM 2QA4A 3GPYA 1U0LA 2R7FA 3URYA 3J80S 3GP1A 2F0EA 2RDGA 5J3BA 5BPVA 1SMYC 5F3WA 2EY2A 3MEFA 4JI0L 4J1MA 4DN4M 5M5YB 5M5WB 3TWMA 2HDMA 2F0KA 3E46A 1QZEA 2CFOA 4HIKA 4JI0Q 1CQVA 4IUVA 1QUTA 5HGQA 4DNTB 2AHOB 1SXJA 1MSHA 1OIZA 2M9VA 4IQZA 4A3BB 3QYEA 2O25A 4I65A 2LFNA 2QDLA 1CHQD 4IBFA 2F0OA 1I4RA 5GAHC 2N49A 3TZUA 1SFOB 1DGHB 1TDHA 2EY5A 4YHHM 5A2QL 1FJGM 1N33Q 3NP8A 1JOKA 4DR4Q 4HCEA 4NL4H 4BY1H 1S5ED 4NRVA 5CV7A 4XQJA 2IX1A 2E74C 1N33L 4P72A 4DNIA 4R71A 3S2DH 2EJMA 1K3RA 2L1BA 1GJTA 2A19A 2AQ1B 4X65L 2NB0A 3VKGA 2B2YA 4JBMA 1CKOA 1A3TA 1D2NA 1EEID 3KW6A 4YY3Q 3HGIA 1LYLA 3KLRA 4YWLA 3SHLA 4I81A 3L3OC 5ELEA 4KI0A 1B53A 3SC3A 3T1HQ 1TWAB 2QQ8A 4JI2M 3O13A 2KRUA 4YCWA 4GN5A 1LTMA 1BOSA 4C56C 1VQKA 4RHSA 2WKCA 4JV5Q 2APLA 2UUBL 3I73A 2RHQB 1IW7D 3M3YH 3UDXA 3SMPA 1BUVT 4YHHQ 1I4WA 1Y8OB 2XWJB 1N33M 4G7ZC 2KDLA 3LCVB 1OXUA 1UEAB 4FDBA 4EQPA 1E1OA 5JVH3 1ENCA 3U5ZB 1PTOF 3A8IE 3CMAA 1YBYA 1NNUC 3HKSA 2H1RA 1VQHA 4IUTA 3HOUG 3PUXA 1XWIA 1PVOA 3NBHA 4WJ3M 4PT5A 1UFZA 1V1PA 2NVQH 1I94L 5J39A 1BDOA 5EBCA 2K01A 3GRRA 1R9TH 2V1UA 2CWAA 1JR3E 3GTPH 2ALYB 3HOVH 5BR8L 1E2WA 1QUQB 5ITQA 3K9PA 3FTDA 1HNXQ 2HL7A 4G7OC 2MUYA 4X66L 3K9OA 1BBWA 5IGGA 2BWBA 2QILA 4ME5A 4YY3L 2Y0SB 2BOSA 1J6QA 1Q39A 3C1FA 4JBWA 5JEAH 1IHZA 1OXTA 2JEBI 4DGZA 3F1ZA 4S3SA 4LW1A 1WIVA 3UDIA 1K83H 1KQSA 4DA2A 5GAGC 1UE7A 1WGNA 4LF9Q 3H3VH 2R4EA 3AOEA 4DR3M 3NTIA 4FWGA 5C0XJ 4FCTA 4KY6A 4LWCA 1YE9A 3VA7A 2F0LA 4K5XA 4LZZA 4OO1G 1BKBA 1V1PB 1Z9FA 2Z0SA 4A3FG 1H6UA 2J7NA 3J2PB 1XB2B 5CV9A 4B08A 2KZUA 3GPXA 2B63G 2BE5C 2C99A 1LACA 1STNA 1CA6A 1DYQA 1IN5A 2F0TA 3PUVA 5JVG3 4FWHA 4PG3A 1XMQQ 2A5HA 4XYOA 1PDQA 3DA1A 1MKHA 2B8GA 2VB2X 3GTQH 4R8NA 5C1BA 3M4QA 4DR6L 1HQRD 2R7DA 5M3MG 1TY0A 2L0CA 4A3MG 2C98A 4B3TM 2QBYB 1TTEA 4F8MA 1Y1WB 2C96A 3I8ZA 1QNUA 2I5HA 4DAMA 1X3QA 2K5DA 1PTOC 1EL0A 4IJEA 2I07B 3IKJA 4DR3L 1M8AA 1NTGA 2VF8A 2UXBL 1IBMQ 1Q46A 2QKIC 5FKAC 1FNWA 3L0OA 1N36L 3RZDB 1J5EL 4OX9Q 5C4XG 3GTOH 2OOAA 2VB3X 4X62Q 4G4NA 2JQOA 1SJHD 1SYBA 1B9MA 4M0DA 1X65A 4IZ8A 4RGNA 3CMEA 1EWIA 3SK5A 1W3SA 3VA5A 1OTRA 4G57A 2MO1A 5DAUA 4A76A 3L9AX 1NY6A 3K92A 5LMUQ 2RRUA 1EQTA 1H9KA 2UXDQ 3KOZE 2E2IB 4EGVA 1Z47A 2R46A 5K36G 5JEAG 4GZYC 3PXGA 4DR6M 2NYZD 2DAGA 1RD9D 3PUWA 5EPKA 1NCVA 2GA4B 5T1IA 4AYBE 1EQVA 3OWEB 3SVMA 4A3IH 4IBGA 1JCKB 5CV6A 2CHVA 2YNMD 3Q8GA 4KD4A 3M0EA 4QY7A 3SK6A 3M9BA 3PF4A 4A3DG 3HKZE 1YJNA 1B1ZA 3J81S 4ZKBB 1WI5A 5FLXS 3M4OB 1X3GA 4K2KA 2K5HA 4PNYA 4DV5M 3DWAA 2UU9Q 5ELBA 5M5XB 4HLQA 4RF0A 1L2CA 1EY4A 1GUNA 3J7ZC 1J5EM 2F4VQ 3E9IA 1PRBA 1TS3A 1HNWQ 3MXUA 3CPWA 1O78A 3J7AF 4IJLA 3ULJA 3CCJA 2F4VL 2UXCQ 3SE0A 1WCMG 3CF6E 1TQOA 1SNOA 1K3XA 1QILA 2Q8IB 4L6TB 3RLOA 3V05A 1N32L 4A93G 2F0FA 1EIYB 1D7QA 4BXXG 3E3XA 4ILWA 4FVMA 2UXDM 2MJ5B 1X9NA 4L5TA 3JC66 3FKIG 4LK1C 5D3DA 3A46A 4G6ZA 5E7NA 1ZEQX 1HHVA 2ZM6M 1WHCA 3I4YA 4RFBA 3JR5A 3BXWA 3NEMA 5C3EH 3F2DA 2ZJRA 4A3GH 4KLNA 1SNMA 4DAYA 3UMMA 4A3CH 2N8NA 3C1EA 4B3RM 1D0LA 2X4AA 2V1CC 1J8IA 1OXSC 1L1OA 1GOZA 2KENA 1K8GA 1KLGD 1UUPA 3GQ4A 2PYKA 5CMDA 1LTBD 1G41A 3U6EA 4UDUC 1O7LA 2A74C 1U4RA 1XX8A 3D6WA 3GLFE 3STBC 2KHJA 2H5XA 4AH6A 1PHJA 3KS4A 1SR3A 3A0JA 5IYCH 2CHBD 1QUSA 3PNVA 1Q1BA 4LFCQ 4HEOA 1WFQA 2JA6H 5IT9c 5C0XH 3OW7A 1PH6A 2Y20A 4GKJM 4KN4C 3F2BA 2L6OA 2KQ3A 4A3JB 4JI4L 1EY5A 5FLXE 1ICFB 4FNFA 1G291 4Q5VA 1IN6A 3SHFA 4JBJA 3T6PA 1YI2A 1NV8A 2UU9L 2HCCA 1ASZA 3K57A 3JAMc 2XH9A 3MWYW 3PO2B 1WTOA 8CATA 4WURA 2R93G 3G7LA 2D9UA 2A69D 1SROA 2QEJC 5C4JB 1IZ6A 3GLGB 2L7HA 4DR7M 1FR3A 4D80A 3E6ZX 1IKLA 3SYLA 4LF4L 4RCOA 4RCNA 4PD2A 5ITXE 4JI5M 1NE3A 5IYDG 4LAAA 5E1FA 1K0SA 2NWGA 1GUOA 2F0SA 4LF5Q 1UE5A 4QF4A 5KRUA 3GQ5A 4YWMA 1KAAA 1LLRD 4DK6C 3CTWB 2DWMA 1I4GA 2I5LX 3DWPA 5C4ZA 3CXCA 1A63A 2L9HA 2QSFX 1YLAA 3MFYA 4LNQA 1YHQA 5C6AA 4LJAA 3KP0E 2QF7A 4U68A 2D2CC 4L8JA 1FGBD 5E4XA 1XNRL 5FOBB 1WR1B 2PQAA 3RLFA 4JI3L 4KJOA 1ZQ9A 3S17H 2K52A 1VDDA 1AE3A 2IX0A 5I9OA 1VQ7A 4M9ZA 3MXNB 4A93B 4D81A 2CW0D 3GTJB 2A6EC 4A3JG 1Q81C 2HT1A 3S14H 1EOVA 3EA6A 4QHSA 3M85A 3S17B 2D7EA 1HQMC 1LTTD 4DK1A 2F0UA 1YJWA 1KLUD 2NTTA 2LSSA 5M9OA 3FUTA 2A8VA 3S14B 1JORA 1VQFA 1IN4A 3HRZC 1IYUA 3GLIE 1D5ZC 3BS1A 4DV2M 3MVVA 1O7IA 1RJTA 4O42A 2QGQA 5E26A 3S16H 1TH2A 2HKJA 5KQDA 1VQMA 2KNAA 2X49A 1L0YB 1ZYRC 2GN5A 3K8ZA 3TPZA 4CJ6A 1VQDA 3GQBA 3OMCA 1OFHA 4G3OA 2B2VC 2OQ0A 4Y7NB 4LF5L 2JA8G 2XEPA 1LO5D 2VUMB 2XLJA 3B7NA 1MSGA 2WP8J 1QVRA 1MIUA 1S5BD 3J80i 4AYBB 1LTSD 3TS0A 1CSPA 3T1YQ 2F5SA 3KDFA 1MD2D 2WKDA 3LGJA 5FTJA 4A3KG 3CF0A 3I04M 1E9SA 1KDBA 1ZAEA 1R4PB 2NZOA 1ZKOA 2FNAA 2F0JA 4B3TL 3SR1A 2G3QA 3TQYA 1MJGM 4R1JA 2CV1A 2ZJPA 5IYBH 3I4MG 3AFQA 2WAQE 3EIHA 2YTYA 4WRDA 4IUUA 4PQXA 1TGUA 1F9PA 5ITYA 2QCUA 1I4XA 3WDNA 5I9PA 4B3TQ 1J09A 4B3RL 1YNJD 3B6YA 2KZSA 2MPMA 1JT8A 3W5OA 4CHTB 3HOYH 1NVMA 4X3SA 5KIXA 1K8OA 2Z8LA 1W6JA 3R8BA 4KKTA 3ZCBB 4BBRH 4F7XA 3GTLH 1SE2A 2E75C 1FNUA 4JI8M 1ZMVA 4G4RA 1NSNS 1WD1A 4RGMA 1TWCH 1EZ6A 4A3FB 5NUCA 2OQ4A 1F2YA 4DUZQ 1Q86C 3M4OH 3U60A 1TIID 2NN6I 3AV0A 5T1GA 2AUJD 4ANRA 5EP2A 1VQ6A 1HNWM 4L78A 1UE1A 5FTMA 1SMXA 4O2DA 2YV5A 3RGPA 4C3JG 2DZLA 1YNND 1XYIA 3HZJA 2ZT9C 4C3IB 1G8PA 5EKLA 4IPDA 2RSNA 2DZNB 1IXZA 3C58A 5JI3E 3UE0A 2KEDA 5CGKA 3J7YW 3LVVA 1E9RA 2PW7A 3U6OA 2VQEL 1NNXA 1WD0A 2ID0A 4IALA 1QJOA 3PO3G 5CBAE 2EVBA 1EY6A 4G7HC 4JW0A 1PH1A 4DXFA 2CWPA 1IL8A 1L2BA 2XN9C 3PO2H 1LUZA 1ESFA 4X64Q 2PZTA 2P5ZX 3W0LB 3GLFA 4JI8Q 1JE5A 4FXDA 4GHAA 4WJWA 1QNKA 4A3IG 2ZXPA 3D8GA 1Z5CA 3D8BA 5AFWA 3DZDA 2ZTEA 1KNEA 3U9SA 5DNFA 4A3LH 3M7GA 2DGYA 1G6ZA 4OGQC 2KBNA 2C35B 3MXNA 3T53B 4IFDH 2NN6G 1R6BX 4DV1Q 1CQFA 1HNXL 2JA5G 1SYGA 3Q24A 2K1BA 3T1HL 4A3DB 3I91A 3C3LA 1TWHH 3G48A 4DUZL 2Z8YM 2ZTDA 4ZK9B 2VQFQ 2X69A 1S72A 4P16A 1E24A 1N75A 3GLHA 4ZYSA 2D7GA 4ID6A 2UUBQ 3IECA 4IUPA 4RNAA 1MI2A 3CD6A 1GL7A 1OIPA 2F3WA 1A2TA 1FD7D 2R45A 1CM9A 4A93H 4DV0L 1YHAA 3RE8A 2XFTA 3TSSA 5EBDA 4ZUIA 2P5TA 3SATA 2PZWA 3A7AB 3KVWA 2Z6BA 5EP4A 1IQPA 1E0BA 1K3WA 2CQAA 2K03A 4DV0Q 3M7NA 3OIPA 3P75A 4X3KA 4DR4M 3UZUA 4K5VA 2EJSA 3KS8A 3B7ZA 4Y52H 4R4QA 1IKMA 1GUGA 4BA1I 4YHHL 3HOUB 4F2LA 4K5WA 3K2LA 3OHXC 3I55A 2WINB 3H4MA 4IBCA 2EJFC 3MFGA 5CV5A 2VL6A 3M4YA 1L1TA 4JXJA 1S3OA 2B39A 4JPBW 2XSZA 1JOQA 1V8QA 4B3MM 2F0DA 1DGFA 4LJ5A 1U4PA 2MROB 1KTKA 1DONA 1JWSD 1FGUA 1T5XD 4YCUA 1JB3A 2E2HB 5G3LF 1SMYD 4OONA 5JJIA 3OPOA 3BDCA 3LVWA 4AW4A 1VEGA 4HSPA 4YWKA 2PNRC 3MEHA 1HT2E 2RKOA 1UAPA 5E3FA 2JY6B 3K5NA 3ERQA 1PZID 5IGCA 2F4IA 2V1CA 3BJUA 4L15A 4NXMM 5IODA 3S15B 2NTSA 5DLQE 2RVLA 5C3XA 3E21A 5I6WA 3D3RA 4E6IA 1TS5A 1HNZL 1JWUD 1HFNA 1VG5A 2Z4SA 3CAMA 3PO3B 3TWLA 1NMGA 5IP7G 4DV6Q 2AWNA 5A2QS 1I4HA 2H1EA 2JWSA 4Z6YA 4IURA 3PIO3 2QENA 3FRPB 3NBXX 5DYGA 1I4QA 3HOXH 3FMCA 4IO9A 1A62A 1D1KA 1WTXA 4DPGA 2EXDA 4H7BA 3C2PA 2WIIB 4LMQD 2QW7A 3VYSA 1RDPD 2R62A 1C48A 4A75A 3RR5A 3FTCA 1QAQA 1MN3A 1L1OB 2VDBB 2HAKA 2L11A 1OJLA 3U5ZA 1CT1D 1Q3LA 5GADC 3BYYB 4IPGA 4II7A 3R93A 1PRTC 1N36Q 4POGA 4DR1M 4HSVA 1AEXA 4R3DA 2K04A 5M5YH 3P1HA 2JUJA 1WOCA 3RLNA 2JY7A 1GXDC 3S24A 2IY5B 1IYVA 2E2DC 2AUKA 2WB1E 3U61A 4XYQA 4HJ5A 2FHTA 4DR3Q 2L09A 4BY7H 2R7ZB 1V1QA 1B3QA 2Y0SG 3I7FA 5EKIA 4RWSC 2LS01 1PYWD 2RKSA 3S1QB 2XFSA 4FF4A 1HZBA 2RF4A 2VW9A 2OF1A 4OVZA 2A68C 3H4JA 2A5YB 2WAQB 1Q1EA 3AOEC 3KSJA 4UAIA 3W2DA 2LMCB 1VDZA 5COYA 5KPTA 2BH8A 4HAEA 3PV0A 3EIEA 2K6AA 4DF7A 4BBSG 3TEHB 1QDTA 1SJED 2EYLA 4POFA 3W68A 2OTLA 1HRJA 3IG8A 4JI3M 5M3FH 2PO4A 4HMIA 5ITRA 1KYIA 5IGFA 2K5QA 1SE4A 2Z7JA 2SNMA 2G5GX 4L63B 5DM63 2XWBB 2LTUA 2EY6A 2YU9B 3HU1A 3HOWG 2CV2A 2EYJA 4EVOA 1EFUB 3L2PA 4KHVA 4JI6Q 1GUSA 1KD1C 1B7YB 1CK1A 5LMNW 1SYDA 3CCRA 1M1KC 3RUZA 2FXQA 1G8ZD 4R7GA 1ORYB 5C44G 3TP7A 4FD2A 4DV2L 4RMFA 1STHA 4QOSA 4DR2M 3I3CA 1V33A 5FLMH 2MQHA 2F5NA 1KABA 4ZAIA 1VQ1A 1TH4A 1XC8A 3U50C 4GLVB 2EA0A 1F9QA 1A15A 5FTKA 3DLLA 5L8RF 3SBJA 1UEBA 1L0XB 1HR0W 4LF5M 3CHBD 3VDUA 3D31A 3DHQA 4LJ9A 4K2LA 3FKEA 1Y69U 1B44D 1DOKA 3OSOA 4YIJA 3FRIA 4APVA 2YTVA 1IY0A 3D4DA 1UE6A 1TXYA 1JQJC 2ZJQA 1QCBD 2EDGA 2BJVA 2ZANA 4GNXC 1A2UA 4GIPA 1CKNA 3NBIA 4XXEA 2PI2E 3BVZA 1WTPA 1RIPA 3OW2A 1XPOA 1AH9A 2UUCQ 3K0YA 2XGTA 1A8VA 1EU4A 5HURA 4ITQA 1G51A 3L28A 3VYRA 3BDOA 5ITTA 1YHBA 2UUCL 1B70B 1X56A 1WJ7A 5D65A 2R93B 5IWAQ 1S5FD 1Q7YC 4UHVA 3D4RA 4XQNA 4TQUS 4QIWB 4TRDA 3E0JA 3GTKB 3EVQA 2HCBA 2F5QA 5M3FG 1XXHA 1TWFH 5LL6S 1YSYA 4DV4Q 1WVLA 3TMEA 1WXQA 3KFUG 1SDFA 4C3HG 3I01M 1A3VA 2ERCA 3KBXA 4WP2A 4BLCA 4QNRA 1RCVD 4K8IA 4QB4A 4DV4L 1PYSB 2RA4A 4GN4B 3EN2A 2I5MX 5C0XI 1SXJC 1STYA 1HA6A 3I4OA 1LV7A 4XT1B 2HCIA 2L55A 1GUWA 1XXHE 2Z6KA 3I4NG 3NWTA 1Q82C 2EY1A 1ILQA 4N8FA 4H13C 3GTOB 4QUFA 3IL8A 4H0LC 4IPHA 2EUCA 2UUCM 3CQZB 1IBKL 2R0IA 3T1YM 4LRTA 1W5TA 3U6MA 3H0GH 3FRHA 1PA6A 4QOZC 3TQSA 4NXMQ 3GLHE 2JSOA 2UUAL 4CJ1B 3R9XB 4GKKM 1JQYD 3R2TA 3EFXD 3PUYA 4DAYB 3J80L 1T9HA 2I7NA 1RU3A 3AL0C 5EQ0A 4NSRA 1ML0D 2EIFA 3KXEC 2B2YC 3GLGE 3GD7A 2Q8RE 5C3WA 2X6LA 2ES2A 1BCPD 1Q3BA 3I90A 3ZJYC 5JJLA 4MGZE 4DR7Q 1II3A 1LTRD 5LHY1 3W0FA 1BCPB 1JC7A 3FTFA 2IT1A 4CKEA 2L4FA 4BS9A 3U6CA 1SN8A 2KECA 3KJOA 1QZHA 1W5SA 2XZFA 3EBEA 3IAYA 3VR3A 4IOAA 3AQQA 3E9SA 1HXYD 5HY6A 3DMUA 3J27B 3ZQJA 4EQNA 3KBGA 4AKHA 2FMCA 2LVPC 3TREA 2E2IH 2KHIA 1O7YA 2QNJA 1Y1WH 4P74A 3HOVG 4NP5A 3OYYA 4MIUA 2M60A 5ISRA 1JMCA 2ZBKB 2B29A 1PMRA 1X3EA 4PDGA 1VQGA 1PFMA 3PUZA 4UP7A 3RZOB 2LVQD 1H9SA 1DOLA 2CVRA 3LCUA 2Z9HA 2EE1A 3LNNA 1IM2A 2JE6I 2E5LM 4DR5L 5EP1A 2FFJA 1SNPA 2DKLA 1E1TA 3MC0B 3LQQA 1GKHA 2TMPA 3S2HH 3NUCA 3TP6A 3ERSX 4DV7L 1A6XA 1T43A 2K33A 4OWXB 1LABA 1IY1A 2XF3A 2C5CA 2E76C 4HJ9A 1KDAA 3BG3A 5ELFA 1HQCA 1WGLA 3Q23A 3G6EA 4B7GA 4DV3L 4RGTA 2LKVA 4DKAC 3VR4A 3QJYA 1YZ6A 1YJ9A 4L5RC 4A3JH 1HH2P 2A69C 3I4MB 1EOTA 5J22A 2LBCA 2ZAMA 3NHHA 3Q8DA 2O5IC 4MGIE 3T51B 1SLJA 4CIZA 3PQIA 1PGYA 3SK8A 1X37A 1D0KA 4Z9CB 4J15A 4GLXA 3HJ8A 1XXHB 2OWOA 1HCZA 1TWHB 3U6SA 2L12A 1LT6D 4O0AA 1EYCA 4FP5D 1QOHA 1QE6A 2DJFC 1EEFD 2R61A 1FJGL 2XVSA 5IE8A 4QMGA 2DZOB 3GPUA 4B7HA 4JV5M 4QUCA 4P71A 2W82A 2AHMA 2Q2IA 3LMMA 2EOTA 2R65A 1IXSB 3KF8B 4HN7A 4V0BA 4ZCKA 2DAIA 2AKWB 2A6ED 3HFZB 4DV5L 1ESRA 1XXGA 1IBKM 2RDFA 4A3KH 1EIFA 1EU3A 4NXNQ 4CDEC 2HD3A 1K8AC 1NV9A 3TP5A 1EIJA 2Y21A 4JBKA 1K28A 1ZV1A 2DNAA 5E4WC 4R4TA 3X3MA 4HIDA 4DV1L 2KA7A 2E8GA 3E0EA 2D62A 4JI8L 2KRKA 2H4OA 3I56A 2L15A 3SAVA 2G9DA 1V1OA 1W6KA 2UXCL 3K58A 3DFZA 1HZ9A 2NZHA 2JZ1A 2ZM6Q 4NKLA 1OKSA 4LJ7A 1PH5A 1S3SA 1U5KA 3AOGA 1I50B 2JY8A 3HP3A 1EIHA 4DK3C 2ZM6L 2F0IA 1U9RA 1WCMH 2EYPA 1HUMA 1JE4A 3HOVB 2VQFL 1V9PA 3OMGA 5A35A 2A1AA 1EY8A 3GLHB 4K8JA 3K7AB 3HOZH 3U60B 1SXJD 4IPCA 3T16A 3HOXB 4XTCS 3FHWA 2JEAI 3EJIA 4DV6L 1I6HH 3UGJA 3R8FA 4ZRZA 5ITUA 5GROA 4O1NA 4AG6A 3FEWX 1EFWA 4KY7A 1EYAA 4K0KM 3BVMA 4FF3A 4OEMB 1PLFA 1EYDA 4AG5A 3F92A 1N8RC 2MGSA 4IN3A 4JI7L 3FUVA 3Q22A 3A42A 4K6DA 3MZ5A 2BNKA 4JYAL 4DV4M 4JOIC 1SSOA 4A3EG 1NMFA 3S16B 2CV0A 2K05A 2Z6KC 1I4PA 1WYDA 2LXKA 3W1BA 3S2HB 2XZUA 4L4UA 5C0XG 5M3MH 4YY3M 3SK4A 1BCPC 1Y8PB 4J6HA 3ZH9B 3PO2G 2VQFM 4KHZA 3EQLC 2B2WC 2RCFA 2HHHM 4KY5A 2XNAC 4OL7A 3TRZA 1H9JA 2ZXOA 3SXHA 3ND8A 4KKSA 1ENFA 3ZYYX 1QANA 4A3BH 3GO5A 4OO1I 3FYDA 2K4KA 5D14A 3UE1A 4XQQA 1R2ZA 1C1KA 2O01F 4KKUA 1RTNA 5FK9C 4NMZA 2LHCA 3DUZA 3K7UC 5BR8M 1YNNC 3CU7A 5CV4A 5EXXA 4K0KL 2C5RA 4UP9A 3QOLA 2CEAA 4DV0M 5C18A 2ICIA 4OWWB 2D0PA 1EQQA 1PYBA 1IBLL 2BA0A 2R7ZH 2RBMA 3F8TA 3AMUA 5I2YA 5KNBA 2LVAA 4JYAM 4K0KQ 3KLSX 5KYIA 4DUYQ 2VF7A 1IL2A 4PMCA 3CCLA 4GNXA 3B9PA 3I2ZA 2VUMH 4PZ8A 2LWXA 1P3QQ 1GABA 3J81c 4B3MQ 3B7QA 2B2TC 4C1NK 1H9RA 3WHKA 4LJ6A 4LJ4A 5ELOA 1T3TA 2AMCB 1C8CA 3TZDA 5FSWA 1G59A 5TSSA 1XPRA 2SDFA 3AFHA 3WWVA 3B74A 1K8MA 1E2VA 2L2DA 4MH0E 2JK8A 4ME3A 1YITA 2OTJA 1OAOC 2MGWA 3RN5A 3VR6A 2TSSA 1G2TA 1PRTB 5KQ8A 3CP0A 1QUQA 1XHBA 3J7A5 4DBGB 3HOYG 1CKNB 3T4AC 4LF7M 3GTGH 2PMZE 1MJCA 1GKIA 3V2TA 4LFAM 2OCEA 3G6JB 5K36H 2UXCM 2EO2A 2L7IA 2J4XA 4G4KA 1KAWA 2UXBQ 3J81i 1RHPA 4JK1C 4IUNA 1PH3A 2IX3A 1R9TB 1D8LA 2F0PA 2D0OA 1SE8A 3GTPB 4CBVA 1Z6HA 4OHJA 3KUPA 2MHVA 3TS2A 1X3FA 1GVNA 5IT9S 1F9RA 1K73C 1JJ2A 1TWGB 4QGUA 4LF8Q 3BVGA 3FKIH 2ENBA 3PSIA 1CKMA 3MHBA 1IN8A 3G71A 1B9NA 3QG1A 1VQBA 3FTEA 3J7AS 4LRSA 3QYBA 1Y8GA 4EIWA 4TUWA 3K7AH 3HOZB 2ASBA 5DEHA 2QEXA 2DXIA 2JXMB 1SNCA 3GTKH 4LUZA 2KHHA 3CCMA 2DAEA 4GHLA 1GHJA 4ZLTF 1R2YA 1J7KA 1C9OA 1RL2A 1EFID 4TVAB 1HPCA 4EX5A 3NBHB 1VQAA 5IP9G 1PRTD 3S9WA 4LFAL 1YEZA 3QO2A 4Q7JA 2GVAA 3HG9A 4L16A 1I3QB 3IFDA 3B89A 2F0HA 1TS4A 1JR0D 3D8LA 1XNQM 4RGOS 4JI6L 5DYIA 1PH9A 4GMQA 3TWKA 5ELDA 1PFNA 4B9WA 5BN5A 1HNWL 5ITXA 2CQOA 4BWGB 4I5SA 4HJ8A 1HA5A 1F2LA 4GRIA 1IYJB 1HTLD 2RQXA 1VF7A 4PMWA 4L5QA 4HCSA 1VQ5A 4CDDC 2CCZA 2JY5A 3C3DA 2IWHA 4A4IA 2R3ZA 4FXKC 1ZMUA 4Q0FA 3CC7A 3PF5A 3KLSA 2Y0QA 4LF9M 2C9CA 5JAVA 3GPPA 1K82A 1S5CD 2R92G 1Z5BA 2FS1A 1GM5A 1IBKQ 3SFZA 3UDFA 1BCPF 3ULLA 2KJXA 4GKJL 4BY1G 4FW9A 2EYOA 2UUAQ 4BBSB 2XGNA 2VS1A 2R44A 4NC6A 1ZXTA 4LUOA 4AQYQ 2Z4HA 5KNDA 4GC5A 3V76A 2UU9M 5I4DA 1S4ZA 4LZJA 4IUQA 3H6MA 3NXWA 2V4DA 4JI6M 3AYHB 3ONAB 1XNQL 5GAEC 1LT4D 4DR7L 1FVIA 5LMNL 2VZAA 4KT0F 3TL4X 3AKZA 4DV7M 4IOCA 1Z59A 4LFCL 2E2JH 3C46A 1H9SB 2X8AA 1XNQQ 2DI0A 1SE3A 2RCNA 3AU7A 3JAME 1GO3E 2IJ0A 5CORA 4X65Q 2SOBA 1K0RA 3T1HM 1G4AE 1D1IA 4KV6A 4DR2Q 3LW5F 2Z4IA 4RA8A 1W2BA 3HOUH 1O80A 1DO2A 3A74A 4FXGC 2ZAOA 2J5YA 2DY8A 2OEOA 3H94A 1QQWA 4DR2L 3HZXA 2KA6B 4LGYA 1CUKA 4Z8XA 2A68D 5IP9H 5FLXL 3J81L 1XTCD 3AB9A 4MGYE 4OX9M 1XJVA 3HU3A 2Q2TA 4V190 2IW3A 4M0WA 5C44H 2LNHC 3KP1E 1FNNA 2XRQD 5EGTA 1M90C 4DU9A 2JA8H 4OIKA 2JA2A 3A98B 3VYUA 5CR3A 5IGBA 3S1MH 2HUGA 3KDFB 1JR3D 2NVXH 3LX0A 2K5NA 4DR6Q 4GKJQ 2JYOA 3QWNA 4CGYB 4HL4A 2HHHL 2IHFA 1WTVA 2EKFA 1LTLA 3NK9A 4WFN3 4DV7Q 1BF4A 2AWOA 2R92H 1YIJA 2RGOA 3GP7A 1E2ZA 3Q6SA 1R4GA 2JA7H 4H02A 4DV3Q 2QPAA 1U4MA 4Y28F 2Q8TA 1IBML 2X6GA 2SEBD 1I94Q 1SYFA 4RF1A 2OT2A 3GRYA 2KHSA 1AZQA 1B4OA 1IFYA 3VLFB 3N52A 4A3GB 4A3EH 1IBLM 5CC4A 5BR8Q 3R2IA 1H95A 3U6QA 1PJQA 2NVQB 4HJ7A 4KTAA 1JB0F 2B2VA 2JJQA 1Q12A 5LMUL 2I7PA 1L2FA 3J81E 4OO1H 3HWSA 1NUCA 4ZPXA 2D5DA 4JG2A 3HKPA 1C0AA 4DUYM 3EROA 1KC8C 3FDTA 2BWEA 3PMFA 3HHZA 1Q90A 1TU2B 5EQTA 3NE5B 4R4IA 5JEAJ 1TH3A 2WSCF 4IBBA 4DXGA 2WSFF 2J7ZA 3DM3A 2BDNA 3H3VI 1G3IA 2DHYA 3I4NB 1HNZQ 2K50A 1EUJA 1KDCA 4JVZA 1BNZA 1OXVA 2QP9X 3PNYA 5I2XA 2Z3XA 3T1YL 3JAMS 4IFDJ 2DVWB 2B8FA 1AW7A 1R5LA 1AP0A 2YQZA 2BJWA 1PH8A 1QAMA 2DWLA 1I5FA 3VK8A 5IGEA 5IIFA 4A3MH 2KCTA 4C3HB 1XMQL 3CC4A 2QBYA 4GN3B 1CA5A 3D4WA 4DR5Q 1QVFA 1QVCA 5EPLA 3L26A 2V6ZM 3NTHA 3AJIB 5H1SE 4A3VB 4LF7Q 4IFDI 3MK6A 3E9HA 4NDXA 1L0WA 2KNVA 4R4OA 3T13A 3RMHA 3UK6A 5FO7B 1CSQA 2KUMA 4P73A 3V96A 1N32Q 3IRBA 4LCBA 1EWCA 1DXMA 2A6HC 2OQKA 1YNXA 4DK0A 3GTJH 1C7YA 5C4XH 1X54A 3G4SA 3C3EA 5AJ3Q 3EIVA 3VDYA 2WZJA 3ILKA 4KLKA 1VEJA 4A3LG 3KOWE 3KSXA 2L4EA 5KO3A 1VQ8A 3A56A 2MR9A 2MP1A 3KOYE 1JWMD 2OPFA 1I6HB 4P17A 4X62L 1LT5D 5KPRA 1ET9A 3AEVA 3Q0AA 4N9PA 4C3IG 3Q8XA 2CFMA 4OELB 1WTWA 2BA1A 1CFMA 2DNEA 1Y8NB 2Q2EB 2JXNA 2B3GA 1UM8A 2IHEA 5JOBA 1DCZA 2ICEC 1X6OA 2DENA 1NY4A 4M8AA 4IBDA 1A0IA 2NUCA 2QHOB 1ENAA 4XIGS 2CRUA 3M4PA 4C2MB 4FO2A 4DV5Q 1V92A 5DFLA 2G8LA 1WTRA 3W1GA 3FUWA 3SMSA 3TN2A 3U4ZA 3GDEA 5JJZA 1VQPA 2F5OA 3HKZG 1GJSA 1F2MA 1STBA 3K59A 2M5ZA 2QCPX 3CRKC 3DWQA 3BBZA 3TDQA 4CDFC 3F2CA 5EXSA 3W67A 3U4VA 1VQLA 4M9SA 1OQYA 3KFUA 3SASA 2Q2HA 4RH6A 4DUZM 5IYCG 1PFSA 1VQOA 3H91A 2WB1G 3U6LA 3RZDH 2JA7B 2L4NA 2AQ2B 4CDCC 4TKOB 4GNXB 1EYGA 1BBUA 1AZPA 2YFQA 5EPJA 1LT3D 3VDPA 1X32A 4B3SQ 1VQJA 3GRVA 4X66M 4NRWA 2FJ2A 1TR5A 1E3PA 1ICWA 2R93H 1GVPA 2ATWA 4LF4M 4IJFA 3T15A 3GTMB 2VXWA 3S1MB 5JI2E 1HNXM 4KO8A 1EY0A 1LV9A 2OXPA 3FUUA 3L27A 3RNUA 5EJWA 3PCOB 5DM73 4RG1A 5JPMC 3VR5A 5I6YA 2PPBC 1P8LA 2B63B 4LFCM 2KXEA 2OOBA 4DUYL 1NO1A 3N6RA 1Q02A 1D0MA 3E4RA 3IHPA 3SAUA 5K5PA 4X64M 1QB5D 1TWCB 4A3FH 3M3YB 4B3ML 4JYAQ 1V34A
chains in the Genus database with same CATH topology
5KGUA 3NWLA 4JN6A 1X3PA 1Z7TA 4IBIA 3S1NB 3MXPA 3SAWA 3VYTA 3OTOM 3VFDA 2K5WA 1VCIA 1HUNA 4GH9A 1K83B 3LWEA 5E6JA 4DV1M 2NVXB 3KF8A 2QDBA 3QIAA 3SHGB 1DD2A 1PJIA 3FYCA 4XT3B 2O5JC 4BY1B 3NTKA 1NSFA 4ULLA 1HQYE 3DEOA 4X3TA 5C3EB 3HHWA 3A55A 3PFIA 1LTID 5EXTA 3R3OA 4AKIA 4A3KB 3FPUB 1EIGA 5DNYA 1HFGA 4GC9A 1EE8A 2FFKB 4DNRB 3QOJA 3U6DA 4G4QA 2BE5D 3RD4A 1UNSA 1B2TA 1EY7A 1NR4A 2PQEA 2DNCA 4H44C 2LH0A 4IIWA 4QHTA 1BR9A 1YNJC 2XSCA 3K5OA 3IG5A 5LMNM 5C4HA 1L2DA 3HS0C 1PTOB 1BXTA 3FD9A 5IREB 2PMZB 4XGIA 2J7OA 3RGSA 3DEPA 3PIP3 3A54A 2A6HD 3BOSA 4MB7A 1XMOM 1PTOH 4NOOB 1NJGA 1R7RA 1R4QB 1N32M 1AFPA 3SEBA 5BN4A 2YR0A 1V43A 4CJ2C 3HHYA 4KK7A 1J9OA 2UUBM 2J0TD 2N55A 1MBYA 2BDOA 3HGBA 3MTSA 3J7BA 1E94E 1KSFX 1G2SA 5D3IB 3S1RB 4KODA 1TY2A 2XIWA 4DR5M 3HOYB 1NY5A 5EP3A 5KPZA 3A45A 3GLIB 4HR7B 5IT9E 5F2DA 2VQEM 1CI3M 1M4VA 3QB3A 2AQ3B 1PZKD 1VF5C 2I46A 3OIQA 1MU5A 1AN8A 4RKBA 3VR2A 1OFIA 3M6AA 4AQYM 1Q3CA 3MXGA 4RAUC 5KEEA 4JI4M 1E32A 3U9OA 4B7FA 2K7VA 2PCFB 2R6GA 3K5LA 1PTOD 2M2LA 4ZKCB 1NR2A 1DGBA 5GKNA 1DGGA 4LY6A 1NJFA 1LTGD 5EKKA 2DY7A 2EJGC 5EXPA 5IWAM 3U61B 4MGHA 2CE7A 4MHEA 4BBAA 3D6CA 2B2TA 4F87A 3HEJA 1TS2A 1N34M 2FE8A 1QYRA 3NSWA 4LF8M 3QAUA 4OVZB 5ELCA 2DN8A 2NQ8C 4KHPM 4A3IB 2F03A 4AZFA 4ZUJA 1B3AA 3UJNA 1D6EC 4C1NI 1QWYA 3I4VA 2WACA 4BY7B 1PJJA 2KW0A 2BCOA 3A8KE 4XDXA 3ND9A 1PRTF 1G91A 1Y1VB 2DHRA 5C44B 4BB9A 1Z5AA 1H9MA 1STAA 4K14A 5IGDA 1XWEA 3DOAA 2F5PA 1VMPA 3L7ZC 2O5RA 4G4OA 1HT1E 1XMQM 5FO9B 2NN6H 1BQQT 4HMJA 4X3UA 3KK7A 2O4XA 3GLGA 1Q8IA 3CKIB 2XRSD 4LJ8A 4HTHA 3GV3A 1QZMA 2Z4RA 3FVQA 1N36M 3HKZB 3NQTA 1PM5A 5C5LA 5LL6X 3H3VC 2Y0TA 2DWZB 5BN3A 4MGKE 1DZ1A 1RTOA 2NBFA 3PVSA 2EYFA 4OIJA 4IBKA 4REZA 1EZ8A 2JA8B 3VKHA 4HEDA 2R4JA 4QNMA 3WHLA 4X62M 5M3MB 4J8QA 1L8QA 3H09A 1LTAD 1U4LA 2UUAM 5FO8B 1Z6TA 2F3VA 1KNAA 4I7ZC 3TBIB 4XBOA 1HNZM 1O7ZA 1NNJA 3A7LA 1JICA 3MAQA 4LF6M 3I4LA 1F77A 4ABNA 2FOIC 4JI1M 5EJCA 4IBEA 1GHKA 2O2LD 5G3LD 1STEA 2KEEA 4U673 1TT2A 4X65M 4PMBA 3GLIA 3HJQA 5CBEE 4CKBA 4FF1A 5IT9L 4A3EB 1I6VC 5C5MA 1ET6A 1N78A 1KFVA 2EYHA 4A3MB 2F4VM 3ZC7B 2EXZA 2PW5A 4AI6A 1SYEA 4RKLA 2A73B 3MHVC 2CHGA 3J7AV 4KJNA 4KN7C 1GL6A 2ZXRA 1GLNA 3BZDB 3SDZA 2K28A 5FTNA 1YUBA 1SNQA 4IBJA 3JAML 4M1UB 4LFBM 1IW7C 3T38A 1IN7A 3QWLA 1CTMA 3NQIA 2B2UC 1ONLA 2K32A 3CRLC 4P2CB 4CISA 3NWSA 2F0QA 4FF2A 2F0NA 4FCWA 3K5MA 2EYMA 1PFBA 2KEBA 5H37D 3I70A 1CZGA 3L29A 2KOLA 3OWFA 2EZVA 3HU2A 3NPPA 4F88A 4PV1C 4FCVA 2NZ1D 4DV3M 3L2AA 4PCZA 3MA2B 4KD3A 2NVTB 3GQ3A 3CF2A 7CATA 2IPKD 4DFAA 2KVMA 2CW0C 1A3UA 1MX0A 2F0MA 1D5XC 3UI2A 3SARA 1IBMM 3H0GB 3K6OA 2F0WA 2CUZA 2KCNA 3SYKA 1RKNA 1SBBB 3L25A 1CHPD 4NXNM 4MM3B 2R18A 4M9XA 3KOXE 1NHWC 2SNSA 3GRUA 2RGHA 2HDLA 2L5TA 3GV6A 2VNUD 4FWDA 5FTLA 4N9TA 4NW2A 3P20A 4DAPA 1HTPA 4TSSA 1QG7A 2FMMA 2NVYB 3F2UA 1ZYRD 4B3SM 2IL8A 3DXJC 3DM1A 2XSZD 3IFTA 1XNRM 2M00A 1DOMA 1F2ZA 2K47A 3HJSA 1C4QA 4BA2I 3S2DB 2G9HD 1SXTA 1EWHA 4S12A 5IOCA 3GTQB 1IY2A 2N88A 3W3AA 2PZUA 1IXRC 3TP8A 3GLFB 4RHRA 2B2WA 2Z1CA 5J1ZA 1T5EA 2RDHA 4CKCA 4LJZC 1SXJE 3FUXA 1VMCA 3LQRA 4WORA 1BO0A 3HHXA 3MJ5A 3VK7A 1DJRD 3T56B 4FYDA 5HGTA 3X3NA 2VIIA 1BBXC 3P7JA 4DAVA 3BDLA 2EPBA 2KCCA 4QCLA 3OOCA 4BBRB 3GTLB 1DO0A 2C9OA 4ODGA 2E2JB 2LXEA 1NAPA 4D82A 1B50A 4NSOB 3KDSE 1OXXK 3WOEA 4B9XA 3U6PA 1DM0B 2F0VA 4OW0A 2WB1B 3LWUA 1RODA 1S5DD 3BYTB 2R92B 5M3FB 5IZ7D 4JI7M 1FYCA 5CV8A 2HQEA 1F9SA 5C4XB 3THGA 5KYLA 4PDIA 4OU7A 1TVXA 4DV6M 4I8OA 1N77A 3GTGB 2F0GA 1PZJD 4MN3A 4I4LA 1D2BA 4W5WA 2JA6B 5A2QE 2WV6D 4KMUC 2QZ4A 3E5SA 4CJ0B 2FINB 4L8RC 4LG2A 4AKGA 3RFWA 2B2UA 1NHGC 1HR0M 3FKIB 2CHQA 1ILPA 2MJ8A 3A8JE 3TE6A 4LGMA 1EY9A 4GITA 1RF2D 1GJXA 1GUTA 2D7HA 2LY7A 1FNVA 2YYZA 2UXBM 2JP1A 2JA5B 1TDZA 3I51A 1TKWB 4EQOA 1JOOA 2DWNA 4JI0M 4ZQ3A 1WCMB 3WOFA 3GO8A 4IFDG 1STGA 3K1JA 1I94M 5KNCA 2F1MA 2RSOA 1SNDA 4R8IA 4C3JB 1MGSA 4R9WA 3ITPA 1JR3A 4K6LA 1SEBD 1SYCA 3HOWB 1OO9B 1D5MC 1SXJB 1TWFB 3FPPA 5JPNC 3JR4A 1PXUA 1WTQA 3I72A 1QAOA 3J80E 1L1ZA 1DGHA 1CZWA 1SAPA 5CYUA 4WW0A 5LMUM 3GPYA 3URYA 3J80S 3GP1A 2F0EA 2RDGA 5BPVA 1SMYC 5F3WA 2EY2A 4J1MA 4DN4M 5M5YB 5M5WB 3TWMA 2HDMA 2F0KA 2CFOA 1CQVA 4IUVA 4DNTB 1SXJA 1MSHA 2M9VA 4IQZA 4A3BB 4I65A 2LFNA 1CHQD 4IBFA 2F0OA 1I4RA 1SFOB 3TZUA 1DGHB 1TDHA 2EY5A 4YHHM 5A2QL 1FJGM 3NP8A 1JOKA 4HCEA 4NL4H 1S5ED 4NRVA 5CV7A 4XQJA 2IX1A 2E74C 2EJMA 2L1BA 2AQ1B 2NB0A 3VKGA 2B2YA 1A3TA 1D2NA 1EEID 3KW6A 3HGIA 3KLRA 3SHLA 4I81A 3L3OC 5ELEA 4KI0A 1B53A 3SC3A 1TWAB 4JI2M 3O13A 2KRUA 1BOSA 4C56C 4RHSA 2WKCA 3I73A 1IW7D 3SMPA 1BUVT 1I4WA 1Y8OB 2XWJB 1N33M 4G7ZC 1OXUA 1UEAB 4EQPA 5JVH3 1ENCA 3U5ZB 1PTOF 3A8IE 1NNUC 2H1RA 4IUTA 3PUXA 1XWIA 3NBHA 4PT5A 1V1PA 5J39A 1BDOA 5EBCA 2K01A 3GRRA 2V1UA 1E2WA 5ITQA 3FTDA 2HL7A 4G7OC 2MUYA 5IGGA 2QILA 4ME5A 2Y0SB 2BOSA 3C1FA 1Q39A 4JBWA 5JEAH 1IHZA 1OXTA 2JEBI 4DGZA 4S3SA 4DA2A 2R4EA 3AOEA 4DR3M 3NTIA 4FWGA 5C0XJ 4FCTA 4KY6A 1YE9A 3VA7A 2F0LA 4K5XA 4LZZA 4OO1G 1V1PB 1H6UA 2J7NA 3J2PB 5CV9A 4B08A 2KZUA 3GPXA 2BE5C 2C99A 1LACA 1STNA 1CA6A 1DYQA 1IN5A 2F0TA 3PUVA 5JVG3 4FWHA 2A5HA 4XYOA 1PDQA 3DA1A 2VB2X 2B8GA 4R8NA 5C1BA 1HQRD 1TY0A 2L0CA 2C98A 4B3TM 2QBYB 4F8MA 1Y1WB 2C96A 3I8ZA 1QNUA 1X3QA 2K5DA 1PTOC 1EL0A 4IJEA 2I07B 3IKJA 1M8AA 2QKIC 5FKAC 1FNWA 3RZDB 2VB3X 4G4NA 1SJHD 1SYBA 1B9MA 4M0DA 4IZ8A 4RGNA 3SK5A 3VA5A 4G57A 5DAUA 3L9AX 1NY6A 3K92A 1EQTA 1H9KA 3KOZE 2E2IB 4EGVA 1Z47A 2R46A 5K36G 5JEAG 4GZYC 3PXGA 4DR6M 2NYZD 1RD9D 3PUWA 5EPKA 1NCVA 2GA4B 5T1IA 1EQVA 3OWEB 3SVMA 4IBGA 1JCKB 5CV6A 2CHVA 2YNMD 4KD4A 3M0EA 3SK6A 1B1ZA 3J81S 4ZKBB 5FLXS 3M4OB 4K2KA 4PNYA 4DV5M 3DWAA 5ELBA 5M5XB 4HLQA 4RF0A 1L2CA 1EY4A 1GUNA 1J5EM 1TS3A 3MXUA 1O78A 3J7AF 3SE0A 3CF6E 1TQOA 1SNOA 1K3XA 1QILA 2Q8IB 4L6TB 3V05A 2F0FA 4ILWA 4FVMA 2UXDM 4LK1C 5D3DA 3A46A 4G6ZA 1ZEQX 1HHVA 2ZM6M 3I4YA 4RFBA 3JR5A 4KLNA 1SNMA 4DAYA 3UMMA 3C1EA 4B3RM 2X4AA 1J8IA 1OXSC 1GOZA 1KLGD 1UUPA 3GQ4A 2PYKA 5CMDA 1LTBD 1G41A 3U6EA 4UDUC 1O7LA 2A74C 1U4RA 1XX8A 3D6WA 3KS4A 2CHBD 3PNVA 1Q1BA 5C0XH 3OW7A 2Y20A 4GKJM 4KN4C 2L6OA 2KQ3A 4A3JB 1EY5A 5FLXE 4FNFA 1G291 4Q5VA 1IN6A 3SHFA 2HCCA 3K57A 2XH9A 3MWYW 3PO2B 1WTOA 8CATA 4WURA 3G7LA 2D9UA 2A69D 2QEJC 5C4JB 3GLGB 2L7HA 4DR7M 4D80A 1FR3A 3E6ZX 1IKLA 3SYLA 4RCOA 4RCNA 4PD2A 5ITXE 4JI5M 4LAAA 5E1FA 2NWGA 1GUOA 2F0SA 4QF4A 5KRUA 3GQ5A 1KAAA 1LLRD 3CTWB 2DWMA 1I4GA 3DWPA 5C4ZA 2L9HA 3MFYA 5C6AA 4LJAA 3KP0E 2QF7A 4U68A 2D2CC 4L8JA 1FGBD 5E4XA 5FOBB 3RLFA 4KJOA 1ZQ9A 1VDDA 2IX0A 5I9OA 4M9ZA 4A93B 4D81A 2CW0D 3GTJB 2A6EC 3EA6A 4QHSA 3M85A 3S17B 2D7EA 1HQMC 1LTTD 4DK1A 2F0UA 1KLUD 2NTTA 5M9OA 3FUTA 3S14B 1JORA 1IN4A 3HRZC 1IYUA 3BS1A 1D5ZC 4DV2M 3MVVA 1RJTA 4O42A 5E26A 1TH2A 2HKJA 5KQDA 2X49A 1L0YB 1ZYRC 3K8ZA 3TPZA 3GQBA 3OMCA 1OFHA 2B2VC 4Y7NB 2XEPA 1LO5D 2VUMB 2XLJA 1MSGA 2WP8J 1QVRA 1S5BD 4AYBB 1LTSD 2F5SA 1MD2D 2WKDA 5FTJA 3CF0A 1E9SA 1KDBA 1ZAEA 1R4PB 1ZKOA 2FNAA 2F0JA 3SR1A 2CV1A 3EIHA 4WRDA 4IUUA 4PQXA 1TGUA 1F9PA 5ITYA 2QCUA 1I4XA 3WDNA 5I9PA 1J09A 1YNJD 2KZSA 2MPMA 4CHTB 1NVMA 4X3SA 5KIXA 1K8OA 2Z8LA 1W6JA 3R8BA 4KKTA 3ZCBB 4F7XA 1SE2A 2E75C 1FNUA 4JI8M 4G4RA 1NSNS 1WD1A 4RGMA 4A3FB 1EZ6A 5NUCA 2OQ4A 1F2YA 3U60A 1TIID 2NN6I 3AV0A 5T1GA 2AUJD 5EP2A 1HNWM 4L78A 5FTMA 3RGPA 4C3JG 1YNND 1XYIA 2ZT9C 4C3IB 1G8PA 5EKLA 2RSNA 2DZNB 1IXZA 3C58A 5JI3E 2KEDA 5CGKA 3J7YW 3LVVA 1E9RA 2PW7A 3U6OA 1WD0A 2ID0A 4IALA 1QJOA 5CBAE 2EVBA 1EY6A 4G7HC 4DXFA 1IL8A 1L2BA 2XN9C 1ESFA 2PZTA 3W0LB 3GLFA 4FXDA 4GHAA 4WJWA 1QNKA 2ZXPA 3D8GA 1Z5CA 3D8BA 5AFWA 3DZDA 1KNEA 3U9SA 5DNFA 3M7GA 1G6ZA 4OGQC 3T53B 3MXNA 4IFDH 2NN6G 1R6BX 1CQFA 1SYGA 3Q24A 2K1BA 4A3DB 3I91A 3C3LA 4ZK9B 2X69A 4P16A 1N75A 3GLHA 4ZYSA 2D7GA 4ID6A 4IUPA 4RNAA 1MI2A 1GL7A 2F3WA 1A2TA 1FD7D 2R45A 1CM9A 3RE8A 2XFTA 3TSSA 5EBDA 4ZUIA 2P5TA 3SATA 2PZWA 3A7AB 3KVWA 5EP4A 1IQPA 1E0BA 1K3WA 2CQAA 2K03A 3M7NA 3OIPA 3P75A 4X3KA 4DR4M 3UZUA 4K5VA 3KS8A 1IKMA 1GUGA 4BA1I 3HOUB 4K5WA 3K2LA 3OHXC 2WINB 3H4MA 4IBCA 2EJFC 3MFGA 5CV5A 3M4YA 1L1TA 4JXJA 2B39A 2XSZA 1JOQA 1V8QA 4B3MM 2F0DA 1DGFA 4LJ5A 1U4PA 1DONA 1KTKA 1JWSD 1T5XD 1JB3A 2E2HB 5G3LF 1SMYD 3OPOA 3BDCA 3LVWA 4AW4A 4HSPA 2PNRC 3MEHA 1HT2E 2RKOA 1UAPA 5E3FA 3K5NA 3ERQA 1PZID 5IGCA 2F4IA 2V1CA 4L15A 4NXMM 5IODA 3S15B 2NTSA 2RVLA 5C3XA 5I6WA 3D3RA 4E6IA 1TS5A 1JWUD 1HFNA 2Z4SA 3PO3B 3TWLA 2AWNA 5A2QS 1I4HA 2H1EA 4Z6YA 4IURA 3PIO3 2QENA 3FRPB 5DYGA 1I4QA 3FMCA 1D1KA 1WTXA 4H7BA 3C2PA 2WIIB 4LMQD 3VYSA 1RDPD 2R62A 1C48A 3FTCA 1QAQA 2L11A 1OJLA 3U5ZA 1CT1D 1Q3LA 3BYYB 4II7A 3R93A 1PRTC 4DR1M 4HSVA 1AEXA 4R3DA 2K04A 3P1HA 1GXDC 1IYVA 2E2DC 2AUKA 3U61A 4XYQA 2FHTA 2L09A 2R7ZB 5EKIA 4RWSC 2LS01 1PYWD 2RKSA 3S1QB 2XFSA 4FF4A 2OF1A 4OVZA 2A68C 2WAQB 2A5YB 1Q1EA 3AOEC 3KSJA 4UAIA 3W2DA 2LMCB 1VDZA 5COYA 5KPTA 4HAEA 3PV0A 3EIEA 2K6AA 4DF7A 1SJED 2EYLA 1HRJA 3IG8A 4JI3M 2PO4A 4HMIA 5ITRA 1KYIA 5IGFA 2K5QA 1SE4A 2Z7JA 2SNMA 2G5GX 4L63B 5DM63 2XWBB 2EY6A 2YU9B 3HU1A 2CV2A 2EYJA 4EVOA 4KHVA 1GUSA 1CK1A 1SYDA 3RUZA 1G8ZD 4R7GA 1ORYB 3TP7A 4FD2A 1STHA 4QOSA 4DR2M 3I3CA 2F5NA 1KABA 4ZAIA 1TH4A 1XC8A 2EA0A 1F9QA 1A15A 5FTKA 3SBJA 1L0XB 4LF5M 3CHBD 3VDUA 3D31A 3DHQA 4LJ9A 4K2LA 3FKEA 1Y69U 1B44D 1DOKA 3OSOA 4YIJA 1IY0A 3D4DA 1JQJC 1QCBD 2EDGA 2BJVA 2ZANA 1A2UA 4GIPA 3NBIA 4XXEA 3BVZA 1WTPA 3K0YA 1EU4A 5HURA 4ITQA 3VYRA 3L28A 3BDOA 5ITTA 5D65A 2R93B 1S5FD 3D4RA 4XQNA 4TQUS 4QIWB 4TRDA 3E0JA 3GTKB 3EVQA 2HCBA 2F5QA 1XXHA 5LL6S 1YSYA 1WVLA 3TMEA 1WXQA 3KFUG 1SDFA 4C3HG 1A3VA 2ERCA 3KBXA 4BLCA 4QNRA 1RCVD 4K8IA 4QB4A 2RA4A 5C0XI 1SXJC 1STYA 1HA6A 1LV7A 4XT1B 2HCIA 2L55A 1GUWA 3NWTA 2EY1A 1ILQA 4H13C 3GTOB 4QUFA 3IL8A 4H0LC 2EUCA 2UUCM 3CQZB 3T1YM 4LRTA 1W5TA 3U6MA 4QOZC 3TQSA 2JSOA 4CJ1B 3R9XB 4GKKM 1JQYD 3R2TA 3EFXD 3PUYA 3J80L 2I7NA 3AL0C 5EQ0A 4NSRA 1ML0D 3KXEC 2B2YC 3GD7A 5C3WA 2Q8RE 2X6LA 1BCPD 1Q3BA 3I90A 4MGZE 1II3A 1LTRD 5LHY1 3W0FA 1BCPB 1JC7A 3FTFA 2IT1A 4CKEA 4BS9A 3U6CA 2KECA 1W5SA 2XZFA 3IAYA 3VR3A 3E9SA 1HXYD 3DMUA 3J27B 4EQNA 3KBGA 4AKHA 2FMCA 1O7YA 4NP5A 4MIUA 2M60A 5ISRA 2ZBKB 1PMRA 4PDGA 1PFMA 3PUZA 3RZOB 1H9SA 1DOLA 2CVRA 2EE1A 3LNNA 1IM2A 2JE6I 2E5LM 5EP1A 2FFJA 1SNPA 3MC0B 3LQQA 2TMPA 3NUCA 3TP6A 1A6XA 2K33A 1LABA 1IY1A 2XF3A 2C5CA 2E76C 1KDAA 3BG3A 5ELFA 1HQCA 3Q23A 4B7GA 4RGTA 2LKVA 3VR4A 3QJYA 2A69C 3I4MB 1EOTA 5J22A 2ZAMA 3NHHA 2O5IC 4MGIE 3T51B 3SK8A 1X37A 4Z9CB 3HJ8A 1XXHB 2L12A 1TWHB 1HCZA 3U6SA 1LT6D 1EYCA 4FP5D 1QOHA 1QE6A 1EEFD 2R61A 2XVSA 4QMGA 2DZOB 3GPUA 4B7HA 4JV5M 4QUCA 2W82A 2AHMA 3LMMA 2EOTA 2R65A 1IXSB 4HN7A 4V0BA 2A6ED 1ESRA 1XXGA 1IBKM 2RDFA 1EU3A 3TP5A 2Y21A 5E4WC 3X3MA 2KA7A 2D62A 2KRKA 2H4OA 3SAVA 2G9DA 1V1OA 1W6KA 3K58A 3DFZA 4NKLA 4LJ7A 1S3SA 3AOGA 1I50B 3HP3A 1EIHA 2F0IA 1U9RA 2EYPA 1HUMA 1JE4A 3HOVB 3OMGA 5A35A 1EY8A 3GLHB 4K8JA 3K7AB 3U60B 1SXJD 3T16A 3HOXB 4XTCS 2JEAI 3EJIA 3UGJA 3R8FA 4ZRZA 5ITUA 4O1NA 4AG6A 3FEWX 4KY7A 1EYAA 4K0KM 3BVMA 4FF3A 1PLFA 1EYDA 4AG5A 2MGSA 4IN3A 3FUVA 3Q22A 3A42A 4K6DA 3MZ5A 2BNKA 4DV4M 1SSOA 3S16B 2CV0A 2K05A 1I4PA 3S2HB 2XZUA 4L4UA 5C0XG 4YY3M 3SK4A 1BCPC 1Y8PB 4J6HA 3ZH9B 2VQFM 4KHZA 3EQLC 2B2WC 2HHHM 4KY5A 2XNAC 4OL7A 1H9JA 2ZXOA 3SXHA 3ND8A 4KKSA 1ENFA 3ZYYX 1QANA 3GO5A 4OO1I 3FYDA 5D14A 4XQQA 1R2ZA 1C1KA 4KKUA 1RTNA 5FK9C 4NMZA 3DUZA 5BR8M 1YNNC 3CU7A 5CV4A 5EXXA 2C5RA 3QOLA 2CEAA 4DV0M 5C18A 2ICIA 2BA0A 2RBMA 3AMUA 5I2YA 5KNBA 4JYAM 3KLSX 5KYIA 4PMCA 3B9PA 2LWXA 2B2TC 4C1NK 1H9RA 3WHKA 4LJ6A 4LJ4A 1T3TA 1C8CA 3TZDA 5FSWA 1G59A 5TSSA 2SDFA 3AFHA 1K8MA 1E2VA 4MH0E 3VR6A 2TSSA 1G2TA 1PRTB 5KQ8A 1XHBA 3T4AC 4LF7M 1GKIA 3V2TA 4LFAM 3G6JB 5K36H 2UXCM 2EO2A 2L7IA 2J4XA 4G4KA 1RHPA 4JK1C 4IUNA 2IX3A 1R9TB 2F0PA 3GTPB 4CBVA 1Z6HA 4OHJA 3KUPA 2MHVA 1GVNA 5IT9S 1F9RA 1TWGB 3BVGA 2ENBA 3MHBA 1IN8A 1B9NA 3QG1A 3FTEA 3J7AS 4LRSA 4EIWA 4TUWA 3HOZB 5DEHA 2DXIA 2JXMB 1SNCA 4GHLA 1GHJA 4ZLTF 1R2YA 1J7KA 1EFID 1HPCA 1PRTD 3S9WA 3QO2A 3HG9A 4L16A 1I3QB 3IFDA 2F0HA 1TS4A 1JR0D 3D8LA 1XNQM 4RGOS 5DYIA 4GMQA 3TWKA 5ELDA 1PFNA 4B9WA 5BN5A 5ITXA 4BWGB 4I5SA 1HA5A 1F2LA 4GRIA 1HTLD 2RQXA 1VF7A 4PMWA 4HCSA 2IWHA 2R3ZA 4FXKC 4Q0FA 3KLSA 2Y0QA 4LF9M 2C9CA 5JAVA 3GPPA 1K82A 1S5CD 1Z5BA 3SFZA 1BCPF 2KJXA 4FW9A 2EYOA 4BBSB 2XGNA 1ZXTA 2Z4HA 5KNDA 4GC5A 2UU9M 5I4DA 1S4ZA 4LZJA 4IUQA 3H6MA 3NXWA 2V4DA 4JI6M 3ONAB 1LT4D 3TL4X 3AKZA 4DV7M 1Z59A 3C46A 1H9SB 2X8AA 1SE3A 3AU7A 3JAME 2IJ0A 5CORA 2SOBA 3T1HM 1G4AE 1D1IA 4KV6A 2Z4IA 4RA8A 1O80A 1DO2A 4FXGC 2ZAOA 2DY8A 2OEOA 3H94A 1QQWA 3HZXA 2KA6B 4LGYA 4Z8XA 2A68D 5FLXL 3J81L 1XTCD 3AB9A 4MGYE 4OX9M 3HU3A 4V190 2IW3A 4M0WA 2LNHC 3KP1E 1FNNA 2XRQD 5EGTA 4DU9A 4OIKA 2JA2A 3A98B 3VYUA 5CR3A 5IGBA 2HUGA 1JR3D 3LX0A 2JYOA 3QWNA 4CGYB 4HL4A 1WTVA 3NK9A 4WFN3 1BF4A 2AWOA 2RGOA 3GP7A 1E2ZA 3Q6SA 2QPAA 1U4MA 2Q8TA 2X6GA 2SEBD 1SYFA 4RF1A 2OT2A 3GRYA 2KHSA 1AZQA 1B4OA 3VLFB 3N52A 4A3GB 1IBLM 5CC4A 3R2IA 3U6QA 2NVQB 4KTAA 2B2VA 1Q12A 2I7PA 3J81E 4OO1H 3HWSA 4ZPXA 1NUCA 2D5DA 3HKPA 4DUYM 3EROA 3FDTA 3PMFA 3HHZA 1Q90A 1TU2B 5EQTA 3NE5B 5JEAJ 1CA5A 1TH3A 4IBBA 4DXGA 2J7ZA 2BDNA 3I4NB 1G3IA 1BNZA 1KDCA 1OXVA 2QP9X 3PNYA 5I2XA 2Z3XA 3JAMS 4IFDJ 2DVWB 2B8FA 1AW7A 1AP0A 2YQZA 2BJWA 1QAMA 2DWLA 5IGEA 3VK8A 5IIFA 4C3HB 2QBYA 3D4WA 5EPLA 3L26A 2V6ZM 3NTHA 3AJIB 4A3VB 4IFDI 3MK6A 4NDXA 3T13A 3RMHA 3UK6A 5FO7B 2KUMA 3V96A 4LCBA 1EWCA 1DXMA 2A6HC 4DK0A 3ILKA 3KOWE 3KSXA 5KO3A 3A56A 2MP1A 3KOYE 1JWMD 2OPFA 1I6HB 1LT5D 5KPRA 1ET9A 3Q0AA 4N9PA 4C3IG 3Q8XA 1WTWA 2BA1A 1CFMA 2DNEA 1Y8NB 2Q2EB 1UM8A 5JOBA 1DCZA 2ICEC 4M8AA 4IBDA 2NUCA 1ENAA 4XIGS 4C2MB 4FO2A 1WTRA 2G8LA 3FUWA 3SMSA 3TN2A 5JJZA 2F5OA 1STBA 1F2MA 3K59A 2M5ZA 2QCPX 3CRKC 3DWQA 3TDQA 5EXSA 4M9SA 3SASA 4RH6A 4DUZM 3H91A 3U6LA 2JA7B 2L4NA 2AQ2B 4TKOB 1AZPA 2YFQA 5EPJA 1LT3D 3VDPA 1X32A 3GRVA 4X66M 4NRWA 2FJ2A 1TR5A 1ICWA 4LF4M 4IJFA 3T15A 3GTMB 2VXWA 3S1MB 5JI2E 1HNXM 4KO8A 1EY0A 2OXPA 1LV9A 3FUUA 3L27A 5EJWA 5DM73 5JPMC 3VR5A 5I6YA 2PPBC 2B63B 4LFCM 2KXEA 3N6RA 3E4RA 3SAUA 5K5PA 4X64M 1QB5D 1TWCB 3M3YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NBI A;  4CHT B;  4CGY B; 
#chains in the Genus database with same CATH topology
 5KGU A;  3NWL A;  4JN6 A;  1X3P A;  1Z7T A;  4IBI A;  3S1N B;  3MXP A;  3SAW A;  3VYT A;  2JA9 A;  3OTO M;  4HIO A;  3VFD A;  2K5W A;  2K9D A;  1VCI A;  3H0G G;  3KJP A;  1HUN A;  1PH4 A;  3CCV A;  4GH9 A;  1K83 B;  3LWE A;  5E6J A;  4DV1 M;  3CQZ H;  3PGZ A;  3J80 c;  2NVX B;  1IXS A;  3KF8 A;  2QDB A;  3QIA A;  3SHG B;  3CGW A;  1DD2 A;  1PJI A;  3QR8 A;  3FYC A;  4XT3 B;  1N9W A;  2O5J C;  2B3T A;  4BY1 B;  3NTK A;  1NSF A;  1I3Q H;  4ULL A;  3CCE A;  2DUD A;  4R4C A;  1HQY E;  3DEO A;  2LVN C;  4X3T A;  5C3E B;  3HHW A;  4DR1 Q;  4GEW A;  4B3S L;  3A55 A;  2KCM A;  5IP7 H;  3PFI A;  1XMO Q;  2PNH A;  1IBL Q;  1LTI D;  5EXT A;  3R3O A;  4AKI A;  4A3K B;  4RKU F;  3FPU B;  1EIG A;  4LFB Q;  1XMO L;  4F1I A;  5DNY A;  1HFG A;  4GC9 A;  1EE8 A;  2FFK B;  4DNR B;  3CC2 A;  3QOJ A;  3U6D A;  2YU9 H;  1VDL A;  4G4Q A;  2BE5 D;  2K14 A;  3RD4 A;  1AUA A;  1UNS A;  2F3I A;  1B2T A;  4MTK A;  1EY7 A;  4BBS H;  3CCQ A;  1NR4 A;  2PQE A;  1L1O C;  2DNC A;  4H44 C;  2LH0 A;  4IIW A;  4QHT A;  1X55 A;  1BR9 A;  1KRT A;  1YNJ C;  1T6O A;  2XSC A;  1KRS A;  3K5O A;  3IG5 A;  5LMN M;  4UPA A;  5C4H A;  1L2D A;  1FL0 A;  3HS0 C;  3HOW H;  1PTO B;  4HJA A;  4ALP A;  1BXT A;  3FD9 A;  5IRE B;  2PMZ B;  1QZG A;  4XGI A;  2J7O A;  3RGS A;  3DEP A;  4BBR G;  2G5D A;  3A54 A;  5C3E G;  2A6H D;  3BZK A;  3PIP 3;  3BOS A;  4MB7 A;  4L5S A;  1XMO M;  1PTO H;  4NOO B;  3CCS A;  1NJG A;  1R7R A;  1R4Q B;  1N32 M;  4NPS A;  1AFP A;  3SEB A;  4GS3 A;  5BN4 A;  2WSE F;  4DR1 L;  2YR0 A;  1V43 A;  4GLA C;  4CJ2 C;  3HHY A;  4KK7 A;  1J9O A;  4OXP A;  4GOP B;  2UUB M;  2E5L Q;  1B8A A;  2J0T D;  2N55 A;  3JAM i;  1MBY A;  2BDO A;  1AE2 A;  3HGB A;  3MTS A;  3J7B A;  4UN2 B;  2GVB A;  1E94 E;  1KSF X;  1G2S A;  5D3I B;  3S1R B;  4KOD A;  1TY2 A;  2XIW A;  4DR5 M;  2E5L L;  3HOY B;  4KHP Q;  1NY5 A;  5EP3 A;  5KPZ A;  3A45 A;  3GLI B;  3C9P A;  1K3B C;  4A3G G;  3J81 j;  3A5U A;  4LF8 L;  4HR7 B;  5IT9 E;  5F2D A;  2VQE M;  1CI3 M;  4GOP C;  1M4V A;  3H15 A;  3QB3 A;  2AQ3 B;  4KHP L;  1PZK D;  1VF5 C;  2I46 A;  3OIQ A;  1VQN A;  4B3R Q;  1VS0 A;  1MU5 A;  1AN8 A;  4RKB A;  3VR2 A;  3S15 H;  2PI2 A;  2K0B X;  1OFI A;  3M6A A;  3CPF A;  3K0X A;  1PH7 A;  2R7Z G;  5IY0 A;  5LMN Q;  4AQY M;  1Q3C A;  3MXG A;  4RAU C;  5KEE A;  4JI4 M;  1E32 A;  3U9O A;  2JA6 G;  3FP9 A;  4B7F A;  2K7V A;  2PCF B;  2R6G A;  3K5L A;  1PTO D;  3PIO A;  4GOP A;  2M2L A;  1VQC A;  4ZKC B;  1NR2 A;  3OTO L;  1I50 H;  1DGB A;  5GKN A;  4JOI A;  1DGG A;  4LY6 A;  1NJF A;  1LTG D;  5EKK A;  2DY7 A;  2EJG C;  2HWJ A;  5EXP A;  5IWA M;  3U61 B;  4MGH A;  4LFA Q;  2CE7 A;  4MHE A;  1SG9 A;  1Q8K A;  4BBA A;  3D6C A;  2B2T A;  4F87 A;  2EKK A;  4QJF A;  4A3C G;  3HEJ A;  5EAY A;  1TS2 A;  1HZC A;  4OWT B;  1N34 M;  2FE8 A;  1QYR A;  3NSW A;  1G71 A;  4LF8 M;  3QAU A;  4OVZ B;  5ELC A;  2DN8 A;  1PJS A;  3RN2 A;  5IYD H;  2NQ8 C;  4KHP M;  4A3I B;  2F03 A;  4AZF A;  4P75 A;  4ZUJ A;  2CH4 W;  1TF0 B;  3UJN A;  1B3A A;  2WFW A;  4PZ6 A;  2VQE Q;  1PJT A;  1D6E C;  4C1N I;  1PH2 A;  1FJG Q;  4JV5 L;  1QWY A;  3I4V A;  2WAC A;  4AQY L;  4BY7 B;  1PJJ A;  3HY5 A;  2KW0 A;  2BCO A;  3A8K E;  4JI3 Q;  4XDX A;  4C3I H;  3ND9 A;  1XPU A;  1PRT F;  1G91 A;  1Y1V B;  1YVC A;  2DHR A;  3KF6 B;  3ER0 A;  5C44 B;  4BB9 A;  1Z5A A;  2YTX A;  1H9M A;  1STA A;  4IJH A;  1QVG A;  4K14 A;  3HX3 A;  5IGD A;  1XWE A;  5JJK A;  3DOA A;  2F5P A;  1VMP A;  3L7Z C;  1UWV A;  1Y1V H;  3PIP A;  4DR4 L;  2O5R A;  4G4O A;  4NXN L;  1HT1 E;  1XMQ M;  5FO9 B;  2NN6 H;  1BQQ T;  2ZTC A;  3CW2 C;  4HMJ A;  4X3U A;  4GKK Q;  3KK7 A;  2O4X A;  3GLG A;  1QDR A;  1Q8I A;  4X66 Q;  3CKI B;  2XRS D;  4LJ8 A;  4HTH A;  3GV3 A;  1QZM A;  3OTO Q;  4JI2 Q;  4WJ4 A;  2Z4R A;  3FVQ A;  3CF5 A;  1N36 M;  3HKZ B;  3NQT A;  1JB7 A;  2DJG C;  1PM5 A;  5C5L A;  1F4I A;  5LL6 X;  3H3V C;  2Y0T A;  2DWZ B;  5BN3 A;  4MGK E;  1DZ1 A;  1RTO A;  2NBF A;  3PVS A;  2EYF A;  2RHS B;  3HOZ G;  4OIJ A;  4IBK A;  4REZ A;  1EZ8 A;  1P16 A;  2JA8 B;  3VKH A;  4HED A;  4A3D H;  1JJC B;  2R4J A;  4QNM A;  3WHL A;  4X62 M;  5M3M B;  3FE3 A;  4AYB G;  4J8Q A;  4LF9 L;  1L8Q A;  3H09 A;  1LTA D;  4A3B G;  3KOJ A;  1Y1W G;  1U4L A;  2UUA M;  5FO8 B;  1SFO H;  1TWA H;  1Z6T A;  2F3V A;  1KNA A;  1SRU A;  1KHI A;  2MO0 A;  4I7Z C;  3TBI B;  1VQ4 A;  1GO5 A;  1XTD A;  4XBO A;  3KLW A;  1HNZ M;  1O7Z A;  1NNJ A;  3A7L A;  1JIC A;  3MAQ A;  4LF6 M;  3I4L A;  1F77 A;  2E2H H;  4ABN A;  2FOI C;  3NEN A;  4JI1 M;  3RZO H;  5EJC A;  4IBE A;  1GD7 A;  3BZC A;  1GHK A;  2O2L D;  5G3L D;  1STE A;  2KEE A;  4U67 3;  1TT2 A;  4X65 M;  4JCV E;  4PMB A;  4QL5 A;  2HHH Q;  1OAI A;  3HJQ A;  3GLI A;  4BXX H;  5CBE E;  4CKB A;  4FF1 A;  5IT9 L;  1HR0 Q;  4A3E B;  1I6V C;  5C5M A;  1ET6 A;  1N78 A;  1KFV A;  2EYH A;  4A3M B;  4GKK L;  1JJG A;  2F4V M;  3ZC7 B;  1PV4 A;  2EXZ A;  1J5E Q;  5AJ3 L;  2PW5 A;  4AI6 A;  1SYE A;  4RKL A;  1WJJ A;  2A73 B;  3MHV C;  2CHG A;  1Y1V G;  5L37 A;  3J7A V;  4KJN A;  5ELN A;  4KN7 C;  1GL6 A;  2ZXR A;  1GLN A;  3BZD B;  3SDZ A;  5FJ8 H;  4JI2 L;  2K28 A;  5FTN A;  3NEL A;  1YUB A;  1SNQ A;  4IBJ A;  3JAM L;  4M1U B;  4LFB M;  2N78 A;  1IW7 C;  3T38 A;  1IN7 A;  3QWL A;  1CTM A;  3NQI A;  2Q2U A;  3PO3 H;  3MMP A;  2B2U C;  2UXD L;  1E22 A;  1ONL A;  2K32 A;  4OX9 L;  2CWB A;  3CRL C;  4P2C B;  3I4M H;  4QQB X;  4CIS A;  3NWS A;  2F0Q A;  4FF2 A;  2F0N A;  4FCW A;  3K5M A;  1A5T A;  2EYM A;  4C3J H;  2JP7 A;  3CCU A;  1PFB A;  2KEB A;  5H37 D;  3I70 A;  1CZG A;  1ASY A;  3L29 A;  2KOL A;  3OWF A;  2EZV A;  2DAK A;  3HU2 A;  3NPP A;  4F88 A;  2JNH A;  4PV1 C;  4FCV A;  2NZ1 D;  3K8A A;  2HQL A;  3STB D;  4DV3 M;  3L2A A;  4PCZ A;  3BU2 A;  3MA2 B;  4KD3 A;  2NVT B;  3GQ3 A;  3CF2 A;  7CAT A;  2IPK D;  4X64 L;  4DFA A;  2KVM A;  1TWG H;  3D0F A;  2CW0 C;  1A3U A;  1MX0 A;  1EQR A;  2F0M A;  1D5X C;  3UI2 A;  3SAR A;  1IBM M;  4PZ7 A;  3H0G B;  3K6O A;  2F0W A;  2CUZ A;  2KCN A;  3SYK A;  1LM0 A;  1RKN A;  1SBB B;  1HR0 L;  3L25 A;  1CHP D;  4NXN M;  5M5W H;  4MM3 B;  1VQE A;  4LF7 L;  2R18 A;  4M9X A;  3KOX E;  1NHW C;  2F52 A;  2JN4 A;  1Y14 B;  2MNA A;  2SNS A;  3GRU A;  2CP8 A;  2RGH A;  2HDL A;  2L5T A;  1KL9 A;  3GV6 A;  2PQA B;  2VNU D;  4FWD A;  5FTL A;  4N9T A;  4NW2 A;  3P20 A;  4DAP A;  2JA5 H;  2LVO C;  1HTP A;  4TSS A;  1QG7 A;  2FMM A;  4JC0 A;  2OO9 A;  2NVY B;  3F2U A;  2LHG A;  1ZYR D;  4B3S M;  2IL8 A;  3DXJ C;  3DM1 A;  2K5V A;  3KYH C;  2XSZ D;  3IFT A;  1XNR M;  2M00 A;  1DOM A;  1F2Z A;  5FJ8 G;  2K47 A;  3HJS A;  1C4Q A;  4BA2 I;  3S2D B;  2G9H D;  1SXT A;  3GTM H;  1EWH A;  4S12 A;  2HIX A;  5IOC A;  3GTQ B;  1S40 A;  1IY2 A;  2N88 A;  1HZA A;  4JI4 Q;  3W3A A;  1MHW C;  2MH8 A;  2PZU A;  1IXR C;  3ULP A;  3TP8 A;  3GLF B;  5IWA L;  4JI7 Q;  4RHR A;  2B2W A;  2Z1C A;  1IXR A;  5J1Z A;  1OTC A;  3K80 C;  1T5E A;  2RDH A;  4CKC A;  4I7A A;  4LUV A;  1N34 L;  4L6V 6;  2DAM A;  4EQ5 A;  4LJZ C;  1SXJ E;  3SGI A;  4LF6 L;  3FUX A;  1VMC A;  3LQR A;  4WOR A;  1VQ9 A;  1BO0 A;  3HHX A;  3MJ5 A;  3VK7 A;  1DJR D;  3T56 B;  4FYD A;  2K6B A;  5HGT A;  3S1N H;  3X3N A;  2VII A;  1N34 Q;  1BBX C;  4YCV A;  3P7J A;  4DAV A;  5M5X H;  5C4J H;  3BDL A;  4DV2 Q;  1KIX A;  3S1Q H;  2EPB A;  2KCC A;  4QCL A;  3OOC A;  4BBR B;  3GTL B;  1DO0 A;  2C9O A;  5IYB G;  4ODG A;  2E2J B;  1XNR Q;  2LXE A;  2GNO A;  4D82 A;  1NAP A;  5FLX c;  1VQI A;  1G6P A;  4XK8 F;  1NBW A;  1B50 A;  4NSO B;  2B63 H;  3KDS E;  1OXX K;  2XTI A;  3WOE A;  4B9X A;  1TR8 A;  4LFB L;  3U6P A;  1DM0 B;  2F0V A;  4OW0 A;  4NXM L;  2WB1 B;  3LWU A;  3HOX G;  1ROD A;  1S5D D;  2LXJ A;  3BYT B;  1DGS A;  2R92 B;  5M3F B;  5GQO A;  5IZ7 D;  4JI7 M;  1FYC A;  5CV8 A;  2HQE A;  3AFP A;  3S1R H;  1F9S A;  5C4X B;  2R6F A;  3THG A;  3I4N H;  2KNZ A;  5KYL A;  4PDI A;  4OU7 A;  1TVX A;  4DV6 M;  2CH4 A;  4I8O A;  1N77 A;  3GTG B;  2F0G A;  2GQF A;  4NB3 A;  1PZJ D;  1NJI C;  3A5Z B;  2NVT H;  4JI5 Q;  4MN3 A;  4C3H H;  4I4L A;  4LF6 Q;  4BY7 G;  1D2B A;  4W5W A;  2JA6 B;  5A2Q E;  2WV6 D;  1E7Z A;  4KMU C;  1HJP A;  2QZ4 A;  2HIV A;  3E5S A;  4CJ0 B;  2FIN B;  4L8R C;  4MNO A;  4LG2 A;  4AKG A;  3RFW A;  2N35 A;  2I0Q A;  1KXL A;  4LF4 Q;  2B2U A;  1NHG C;  1HR0 M;  3ICE A;  4QIW E;  4UY8 C;  2BH2 A;  3FKI B;  1VEK A;  2CHQ A;  1ILP A;  2MJ8 A;  3A8J E;  3TE6 A;  4HIM A;  2CKZ B;  4LGM A;  1EY9 A;  1BVS A;  4GIT A;  1RF2 D;  1GJX A;  4JI1 L;  4AIM A;  1GUT A;  2D7H A;  2LY7 A;  4MZ9 A;  4Y7N H;  1FNV A;  2VUM G;  2YYZ A;  4X6A H;  2WAQ G;  2Y0S E;  2UXB M;  2JP1 A;  4MTN A;  2JA5 B;  1TDZ A;  2MFI A;  3I51 A;  4JI1 Q;  1TKW B;  2NVY H;  4EQO A;  1MJE A;  1JOO A;  2DWN A;  4JI0 M;  4ZQ3 A;  1WCM B;  3WOF A;  3GO8 A;  2JA7 G;  4IFD G;  2K75 A;  4N8X 1;  1STG A;  3K1J A;  2JZ0 A;  1I94 M;  5KNC A;  2F1M A;  2RSO A;  1SND A;  4R8I A;  4C3J B;  1MGS A;  3U58 A;  2VY3 A;  4R9W A;  3ITP A;  4C2M H;  1JR3 A;  4K6L A;  1SEB D;  1SYC A;  2EQS A;  3HOW B;  3UDG A;  1OO9 B;  1D5M C;  1SXJ B;  1TWF B;  3FPP A;  3K81 C;  5JPN C;  3JR4 A;  1PXU A;  1K9M C;  1WTQ A;  1WTH A;  5FLM G;  3I72 A;  1QAO A;  2N3S A;  4JI5 L;  1AIP C;  3J80 E;  1L1Z A;  1ZMW A;  3KF6 A;  2FH0 A;  1DGH A;  1DV0 A;  1CZW A;  1SAP A;  4UP8 A;  5CYU A;  4WW0 A;  5LMU M;  2QA4 A;  3GPY A;  1U0L A;  2R7F A;  3URY A;  3J80 S;  3GP1 A;  2F0E A;  2RDG A;  5J3B A;  5BPV A;  1SMY C;  5F3W A;  2EY2 A;  3MEF A;  4JI0 L;  4J1M A;  4DN4 M;  5M5Y B;  5M5W B;  3TWM A;  2HDM A;  2F0K A;  3E46 A;  1QZE A;  2CFO A;  4HIK A;  4JI0 Q;  1CQV A;  4IUV A;  1QUT A;  5HGQ A;  4DNT B;  2AHO B;  1SXJ A;  1MSH A;  1OIZ A;  2M9V A;  4IQZ A;  4A3B B;  3QYE A;  2O25 A;  4I65 A;  2LFN A;  2QDL A;  1CHQ D;  4IBF A;  2F0O A;  1I4R A;  5GAH C;  2N49 A;  3TZU A;  1SFO B;  1DGH B;  1TDH A;  2EY5 A;  4YHH M;  5A2Q L;  1FJG M;  1N33 Q;  3NP8 A;  1JOK A;  4DR4 Q;  4HCE A;  4NL4 H;  4BY1 H;  1S5E D;  4NRV A;  5CV7 A;  4XQJ A;  2IX1 A;  2E74 C;  1N33 L;  4P72 A;  4DNI A;  4R71 A;  3S2D H;  2EJM A;  1K3R A;  2L1B A;  1GJT A;  2A19 A;  2AQ1 B;  4X65 L;  2NB0 A;  3VKG A;  2B2Y A;  4JBM A;  1CKO A;  1A3T A;  1D2N A;  1EEI D;  3KW6 A;  4YY3 Q;  3HGI A;  1LYL A;  3KLR A;  4YWL A;  3SHL A;  4I81 A;  3L3O C;  5ELE A;  4KI0 A;  1B53 A;  3SC3 A;  3T1H Q;  1TWA B;  2QQ8 A;  4JI2 M;  3O13 A;  2KRU A;  4YCW A;  4GN5 A;  1LTM A;  1BOS A;  4C56 C;  1VQK A;  4RHS A;  2WKC A;  4JV5 Q;  2APL A;  2UUB L;  3I73 A;  2RHQ B;  1IW7 D;  3M3Y H;  3UDX A;  3SMP A;  1BUV T;  4YHH Q;  1I4W A;  1Y8O B;  2XWJ B;  1N33 M;  4G7Z C;  2KDL A;  3LCV B;  1OXU A;  1UEA B;  4FDB A;  4EQP A;  1E1O A;  5JVH 3;  1ENC A;  3U5Z B;  1PTO F;  3A8I E;  3CMA A;  1YBY A;  1NNU C;  3HKS A;  2H1R A;  1VQH A;  4IUT A;  3HOU G;  3PUX A;  1XWI A;  1PVO A;  3NBH A;  4WJ3 M;  4PT5 A;  1UFZ A;  1V1P A;  2NVQ H;  1I94 L;  5J39 A;  1BDO A;  5EBC A;  2K01 A;  3GRR A;  1R9T H;  2V1U A;  2CWA A;  1JR3 E;  3GTP H;  2ALY B;  3HOV H;  5BR8 L;  1E2W A;  1QUQ B;  5ITQ A;  3K9P A;  3FTD A;  1HNX Q;  2HL7 A;  4G7O C;  2MUY A;  4X66 L;  3K9O A;  1BBW A;  5IGG A;  2BWB A;  2QIL A;  4ME5 A;  4YY3 L;  2Y0S B;  2BOS A;  1J6Q A;  1Q39 A;  3C1F A;  4JBW A;  5JEA H;  1IHZ A;  1OXT A;  2JEB I;  4DGZ A;  3F1Z A;  4S3S A;  4LW1 A;  1WIV A;  3UDI A;  1K83 H;  1KQS A;  4DA2 A;  5GAG C;  1UE7 A;  1WGN A;  4LF9 Q;  3H3V H;  2R4E A;  3AOE A;  4DR3 M;  3NTI A;  4FWG A;  5C0X J;  4FCT A;  4KY6 A;  4LWC A;  1YE9 A;  3VA7 A;  2F0L A;  4K5X A;  4LZZ A;  4OO1 G;  1BKB A;  1V1P B;  1Z9F A;  2Z0S A;  4A3F G;  1H6U A;  2J7N A;  3J2P B;  1XB2 B;  5CV9 A;  4B08 A;  2KZU A;  3GPX A;  2B63 G;  2BE5 C;  2C99 A;  1LAC A;  1STN A;  1CA6 A;  1DYQ A;  1IN5 A;  2F0T A;  3PUV A;  5JVG 3;  4FWH A;  4PG3 A;  1XMQ Q;  2A5H A;  4XYO A;  1PDQ A;  3DA1 A;  1MKH A;  2B8G A;  2VB2 X;  3GTQ H;  4R8N A;  5C1B A;  3M4Q A;  4DR6 L;  1HQR D;  2R7D A;  5M3M G;  1TY0 A;  2L0C A;  4A3M G;  2C98 A;  4B3T M;  2QBY B;  1TTE A;  4F8M A;  1Y1W B;  2C96 A;  3I8Z A;  1QNU A;  2I5H A;  4DAM A;  1X3Q A;  2K5D A;  1PTO C;  1EL0 A;  4IJE A;  2I07 B;  3IKJ A;  4DR3 L;  1M8A A;  1NTG A;  2VF8 A;  2UXB L;  1IBM Q;  1Q46 A;  2QKI C;  5FKA C;  1FNW A;  3L0O A;  1N36 L;  3RZD B;  1J5E L;  4OX9 Q;  5C4X G;  3GTO H;  2OOA A;  2VB3 X;  4X62 Q;  4G4N A;  2JQO A;  1SJH D;  1SYB A;  1B9M A;  4M0D A;  1X65 A;  4IZ8 A;  4RGN A;  3CME A;  1EWI A;  3SK5 A;  1W3S A;  3VA5 A;  1OTR A;  4G57 A;  2MO1 A;  5DAU A;  4A76 A;  3L9A X;  1NY6 A;  3K92 A;  5LMU Q;  2RRU A;  1EQT A;  1H9K A;  2UXD Q;  3KOZ E;  2E2I B;  4EGV A;  1Z47 A;  2R46 A;  5K36 G;  5JEA G;  4GZY C;  3PXG A;  4DR6 M;  2NYZ D;  2DAG A;  1RD9 D;  3PUW A;  5EPK A;  1NCV A;  2GA4 B;  5T1I A;  4AYB E;  1EQV A;  3OWE B;  3SVM A;  4A3I H;  4IBG A;  1JCK B;  5CV6 A;  2CHV A;  2YNM D;  3Q8G A;  4KD4 A;  3M0E A;  4QY7 A;  3SK6 A;  3M9B A;  3PF4 A;  4A3D G;  3HKZ E;  1YJN A;  1B1Z A;  3J81 S;  4ZKB B;  1WI5 A;  5FLX S;  3M4O B;  1X3G A;  4K2K A;  2K5H A;  4PNY A;  4DV5 M;  3DWA A;  2UU9 Q;  5ELB A;  5M5X B;  4HLQ A;  4RF0 A;  1L2C A;  1EY4 A;  1GUN A;  3J7Z C;  1J5E M;  2F4V Q;  3E9I A;  1PRB A;  1TS3 A;  1HNW Q;  3MXU A;  3CPW A;  1O78 A;  3J7A F;  4IJL A;  3ULJ A;  3CCJ A;  2F4V L;  2UXC Q;  3SE0 A;  1WCM G;  3CF6 E;  1TQO A;  1SNO A;  1K3X A;  1QIL A;  2Q8I B;  4L6T B;  3RLO A;  3V05 A;  1N32 L;  4A93 G;  2F0F A;  1EIY B;  1D7Q A;  4BXX G;  3E3X A;  4ILW A;  4FVM A;  2UXD M;  2MJ5 B;  1X9N A;  4L5T A;  3JC6 6;  3FKI G;  4LK1 C;  5D3D A;  3A46 A;  4G6Z A;  5E7N A;  1ZEQ X;  1HHV A;  2ZM6 M;  1WHC A;  3I4Y A;  4RFB A;  3JR5 A;  3BXW A;  3NEM A;  5C3E H;  3F2D A;  2ZJR A;  4A3G H;  4KLN A;  1SNM A;  4DAY A;  3UMM A;  4A3C H;  2N8N A;  3C1E A;  4B3R M;  1D0L A;  2X4A A;  2V1C C;  1J8I A;  1OXS C;  1L1O A;  1GOZ A;  2KEN A;  1K8G A;  1KLG D;  1UUP A;  3GQ4 A;  2PYK A;  5CMD A;  1LTB D;  1G41 A;  3U6E A;  4UDU C;  1O7L A;  2A74 C;  1U4R A;  1XX8 A;  3D6W A;  3GLF E;  3STB C;  2KHJ A;  2H5X A;  4AH6 A;  1PHJ A;  3KS4 A;  1SR3 A;  3A0J A;  5IYC H;  2CHB D;  1QUS A;  3PNV A;  1Q1B A;  4LFC Q;  4HEO A;  1WFQ A;  2JA6 H;  5IT9 c;  5C0X H;  3OW7 A;  1PH6 A;  2Y20 A;  4GKJ M;  4KN4 C;  3F2B A;  2L6O A;  2KQ3 A;  4A3J B;  4JI4 L;  1EY5 A;  5FLX E;  1ICF B;  4FNF A;  1G29 1;  4Q5V A;  1IN6 A;  3SHF A;  4JBJ A;  3T6P A;  1YI2 A;  1NV8 A;  2UU9 L;  2HCC A;  1ASZ A;  3K57 A;  3JAM c;  2XH9 A;  3MWY W;  3PO2 B;  1WTO A;  8CAT A;  4WUR A;  2R93 G;  3G7L A;  2D9U A;  2A69 D;  1SRO A;  2QEJ C;  5C4J B;  1IZ6 A;  3GLG B;  2L7H A;  4DR7 M;  1FR3 A;  4D80 A;  3E6Z X;  1IKL A;  3SYL A;  4LF4 L;  4RCO A;  4RCN A;  4PD2 A;  5ITX E;  4JI5 M;  1NE3 A;  5IYD G;  4LAA A;  5E1F A;  1K0S A;  2NWG A;  1GUO A;  2F0S A;  4LF5 Q;  1UE5 A;  4QF4 A;  5KRU A;  3GQ5 A;  4YWM A;  1KAA A;  1LLR D;  4DK6 C;  3CTW B;  2DWM A;  1I4G A;  2I5L X;  3DWP A;  5C4Z A;  3CXC A;  1A63 A;  2L9H A;  2QSF X;  1YLA A;  3MFY A;  4LNQ A;  1YHQ A;  5C6A A;  4LJA A;  3KP0 E;  2QF7 A;  4U68 A;  2D2C C;  4L8J A;  1FGB D;  5E4X A;  1XNR L;  5FOB B;  1WR1 B;  2PQA A;  3RLF A;  4JI3 L;  4KJO A;  1ZQ9 A;  3S17 H;  2K52 A;  1VDD A;  1AE3 A;  2IX0 A;  5I9O A;  1VQ7 A;  4M9Z A;  3MXN B;  4A93 B;  4D81 A;  2CW0 D;  3GTJ B;  2A6E C;  4A3J G;  1Q81 C;  2HT1 A;  3S14 H;  1EOV A;  3EA6 A;  4QHS A;  3M85 A;  3S17 B;  2D7E A;  1HQM C;  1LTT D;  4DK1 A;  2F0U A;  1YJW A;  1KLU D;  2NTT A;  2LSS A;  5M9O A;  3FUT A;  2A8V A;  3S14 B;  1JOR A;  1VQF A;  1IN4 A;  3HRZ C;  1IYU A;  3GLI E;  1D5Z C;  3BS1 A;  4DV2 M;  3MVV A;  1O7I A;  1RJT A;  4O42 A;  2QGQ A;  5E26 A;  3S16 H;  1TH2 A;  2HKJ A;  5KQD A;  1VQM A;  2KNA A;  2X49 A;  1L0Y B;  1ZYR C;  2GN5 A;  3K8Z A;  3TPZ A;  4CJ6 A;  1VQD A;  3GQB A;  3OMC A;  1OFH A;  4G3O A;  2B2V C;  2OQ0 A;  4Y7N B;  4LF5 L;  2JA8 G;  2XEP A;  1LO5 D;  2VUM B;  2XLJ A;  3B7N A;  1MSG A;  2WP8 J;  1QVR A;  1MIU A;  1S5B D;  3J80 i;  4AYB B;  1LTS D;  3TS0 A;  1CSP A;  3T1Y Q;  2F5S A;  3KDF A;  1MD2 D;  2WKD A;  3LGJ A;  5FTJ A;  4A3K G;  3CF0 A;  3I04 M;  1E9S A;  1KDB A;  1ZAE A;  1R4P B;  2NZO A;  1ZKO A;  2FNA A;  2F0J A;  4B3T L;  3SR1 A;  2G3Q A;  3TQY A;  1MJG M;  4R1J A;  2CV1 A;  2ZJP A;  5IYB H;  3I4M G;  3AFQ A;  2WAQ E;  3EIH A;  2YTY A;  4WRD A;  4IUU A;  4PQX A;  1TGU A;  1F9P A;  5ITY A;  2QCU A;  1I4X A;  3WDN A;  5I9P A;  4B3T Q;  1J09 A;  4B3R L;  1YNJ D;  3B6Y A;  2KZS A;  2MPM A;  1JT8 A;  3W5O A;  4CHT B;  3HOY H;  1NVM A;  4X3S A;  5KIX A;  1K8O A;  2Z8L A;  1W6J A;  3R8B A;  4KKT A;  3ZCB B;  4BBR H;  4F7X A;  3GTL H;  1SE2 A;  2E75 C;  1FNU A;  4JI8 M;  1ZMV A;  4G4R A;  1NSN S;  1WD1 A;  4RGM A;  1TWC H;  1EZ6 A;  4A3F B;  5NUC A;  2OQ4 A;  1F2Y A;  4DUZ Q;  1Q86 C;  3M4O H;  3U60 A;  1TII D;  2NN6 I;  3AV0 A;  5T1G A;  2AUJ D;  4ANR A;  5EP2 A;  1VQ6 A;  1HNW M;  4L78 A;  1UE1 A;  5FTM A;  1SMX A;  4O2D A;  2YV5 A;  3RGP A;  4C3J G;  2DZL A;  1YNN D;  1XYI A;  3HZJ A;  2ZT9 C;  4C3I B;  1G8P A;  5EKL A;  4IPD A;  2RSN A;  2DZN B;  1IXZ A;  3C58 A;  5JI3 E;  3UE0 A;  2KED A;  5CGK A;  3J7Y W;  3LVV A;  1E9R A;  2PW7 A;  3U6O A;  2VQE L;  1NNX A;  1WD0 A;  2ID0 A;  4IAL A;  1QJO A;  3PO3 G;  5CBA E;  2EVB A;  1EY6 A;  4G7H C;  4JW0 A;  1PH1 A;  4DXF A;  2CWP A;  1IL8 A;  1L2B A;  2XN9 C;  3PO2 H;  1LUZ A;  1ESF A;  4X64 Q;  2PZT A;  2P5Z X;  3W0L B;  3GLF A;  4JI8 Q;  1JE5 A;  4FXD A;  4GHA A;  4WJW A;  1QNK A;  4A3I G;  2ZXP A;  3D8G A;  1Z5C A;  3D8B A;  5AFW A;  3DZD A;  2ZTE A;  1KNE A;  3U9S A;  5DNF A;  4A3L H;  3M7G A;  2DGY A;  1G6Z A;  4OGQ C;  2KBN A;  2C35 B;  3MXN A;  3T53 B;  4IFD H;  2NN6 G;  1R6B X;  4DV1 Q;  1CQF A;  1HNX L;  2JA5 G;  1SYG A;  3Q24 A;  2K1B A;  3T1H L;  4A3D B;  3I91 A;  3C3L A;  1TWH H;  3G48 A;  4DUZ L;  2Z8Y M;  2ZTD A;  4ZK9 B;  2VQF Q;  2X69 A;  1S72 A;  4P16 A;  1E24 A;  1N75 A;  3GLH A;  4ZYS A;  2D7G A;  4ID6 A;  2UUB Q;  3IEC A;  4IUP A;  4RNA A;  1MI2 A;  3CD6 A;  1GL7 A;  1OIP A;  2F3W A;  1A2T A;  1FD7 D;  2R45 A;  1CM9 A;  4A93 H;  4DV0 L;  1YHA A;  3RE8 A;  2XFT A;  3TSS A;  5EBD A;  4ZUI A;  2P5T A;  3SAT A;  2PZW A;  3A7A B;  3KVW A;  2Z6B A;  5EP4 A;  1IQP A;  1E0B A;  1K3W A;  2CQA A;  2K03 A;  4DV0 Q;  3M7N A;  3OIP A;  3P75 A;  4X3K A;  4DR4 M;  3UZU A;  4K5V A;  2EJS A;  3KS8 A;  3B7Z A;  4Y52 H;  4R4Q A;  1IKM A;  1GUG A;  4BA1 I;  4YHH L;  3HOU B;  4F2L A;  4K5W A;  3K2L A;  3OHX C;  3I55 A;  2WIN B;  3H4M A;  4IBC A;  2EJF C;  3MFG A;  5CV5 A;  2VL6 A;  3M4Y A;  1L1T A;  4JXJ A;  1S3O A;  2B39 A;  4JPB W;  2XSZ A;  1JOQ A;  1V8Q A;  4B3M M;  2F0D A;  1DGF A;  4LJ5 A;  1U4P A;  2MRO B;  1KTK A;  1DON A;  1JWS D;  1FGU A;  1T5X D;  4YCU A;  1JB3 A;  2E2H B;  5G3L F;  1SMY D;  4OON A;  5JJI A;  3OPO A;  3BDC A;  3LVW A;  4AW4 A;  1VEG A;  4HSP A;  4YWK A;  2PNR C;  3MEH A;  1HT2 E;  2RKO A;  1UAP A;  5E3F A;  2JY6 B;  3K5N A;  3ERQ A;  1PZI D;  5IGC A;  2F4I A;  2V1C A;  3BJU A;  4L15 A;  4NXM M;  5IOD A;  3S15 B;  2NTS A;  5DLQ E;  2RVL A;  5C3X A;  3E21 A;  5I6W A;  3D3R A;  4E6I A;  1TS5 A;  1HNZ L;  1JWU D;  1HFN A;  1VG5 A;  2Z4S A;  3CAM A;  3PO3 B;  3TWL A;  1NMG A;  5IP7 G;  4DV6 Q;  2AWN A;  5A2Q S;  1I4H A;  2H1E A;  2JWS A;  4Z6Y A;  4IUR A;  3PIO 3;  2QEN A;  3FRP B;  3NBX X;  5DYG A;  1I4Q A;  3HOX H;  3FMC A;  4IO9 A;  1A62 A;  1D1K A;  1WTX A;  4DPG A;  2EXD A;  4H7B A;  3C2P A;  2WII B;  4LMQ D;  2QW7 A;  3VYS A;  1RDP D;  2R62 A;  1C48 A;  4A75 A;  3RR5 A;  3FTC A;  1QAQ A;  1MN3 A;  1L1O B;  2VDB B;  2HAK A;  2L11 A;  1OJL A;  3U5Z A;  1CT1 D;  1Q3L A;  5GAD C;  3BYY B;  4IPG A;  4II7 A;  3R93 A;  1PRT C;  1N36 Q;  4POG A;  4DR1 M;  4HSV A;  1AEX A;  4R3D A;  2K04 A;  5M5Y H;  3P1H A;  2JUJ A;  1WOC A;  3RLN A;  2JY7 A;  1GXD C;  3S24 A;  2IY5 B;  1IYV A;  2E2D C;  2AUK A;  2WB1 E;  3U61 A;  4XYQ A;  4HJ5 A;  2FHT A;  4DR3 Q;  2L09 A;  4BY7 H;  2R7Z B;  1V1Q A;  1B3Q A;  2Y0S G;  3I7F A;  5EKI A;  4RWS C;  2LS0 1;  1PYW D;  2RKS A;  3S1Q B;  2XFS A;  4FF4 A;  1HZB A;  2RF4 A;  2VW9 A;  2OF1 A;  4OVZ A;  2A68 C;  3H4J A;  2A5Y B;  2WAQ B;  1Q1E A;  3AOE C;  3KSJ A;  4UAI A;  3W2D A;  2LMC B;  1VDZ A;  5COY A;  5KPT A;  2BH8 A;  4HAE A;  3PV0 A;  3EIE A;  2K6A A;  4DF7 A;  4BBS G;  3TEH B;  1QDT A;  1SJE D;  2EYL A;  4POF A;  3W68 A;  2OTL A;  1HRJ A;  3IG8 A;  4JI3 M;  5M3F H;  2PO4 A;  4HMI A;  5ITR A;  1KYI A;  5IGF A;  2K5Q A;  1SE4 A;  2Z7J A;  2SNM A;  2G5G X;  4L63 B;  5DM6 3;  2XWB B;  2LTU A;  2EY6 A;  2YU9 B;  3HU1 A;  3HOW G;  2CV2 A;  2EYJ A;  4EVO A;  1EFU B;  3L2P A;  4KHV A;  4JI6 Q;  1GUS A;  1KD1 C;  1B7Y B;  1CK1 A;  5LMN W;  1SYD A;  3CCR A;  1M1K C;  3RUZ A;  2FXQ A;  1G8Z D;  4R7G A;  1ORY B;  5C44 G;  3TP7 A;  4FD2 A;  4DV2 L;  4RMF A;  1STH A;  4QOS A;  4DR2 M;  3I3C A;  1V33 A;  5FLM H;  2MQH A;  2F5N A;  1KAB A;  4ZAI A;  1VQ1 A;  1TH4 A;  1XC8 A;  3U50 C;  4GLV B;  2EA0 A;  1F9Q A;  1A15 A;  5FTK A;  3DLL A;  5L8R F;  3SBJ A;  1UEB A;  1L0X B;  1HR0 W;  4LF5 M;  3CHB D;  3VDU A;  3D31 A;  3DHQ A;  4LJ9 A;  4K2L A;  3FKE A;  1Y69 U;  1B44 D;  1DOK A;  3OSO A;  4YIJ A;  3FRI A;  4APV A;  2YTV A;  1IY0 A;  3D4D A;  1UE6 A;  1TXY A;  1JQJ C;  2ZJQ A;  1QCB D;  2EDG A;  2BJV A;  2ZAN A;  4GNX C;  1A2U A;  4GIP A;  1CKN A;  3NBI A;  4XXE A;  2PI2 E;  3BVZ A;  1WTP A;  1RIP A;  3OW2 A;  1XPO A;  1AH9 A;  2UUC Q;  3K0Y A;  2XGT A;  1A8V A;  1EU4 A;  5HUR A;  4ITQ A;  1G51 A;  3L28 A;  3VYR A;  3BDO A;  5ITT A;  1YHB A;  2UUC L;  1B70 B;  1X56 A;  1WJ7 A;  5D65 A;  2R93 B;  5IWA Q;  1S5F D;  1Q7Y C;  4UHV A;  3D4R A;  4XQN A;  4TQU S;  4QIW B;  4TRD A;  3E0J A;  3GTK B;  3EVQ A;  2HCB A;  2F5Q A;  5M3F G;  1XXH A;  1TWF H;  5LL6 S;  1YSY A;  4DV4 Q;  1WVL A;  3TME A;  1WXQ A;  3KFU G;  1SDF A;  4C3H G;  3I01 M;  1A3V A;  2ERC A;  3KBX A;  4WP2 A;  4BLC A;  4QNR A;  1RCV D;  4K8I A;  4QB4 A;  4DV4 L;  1PYS B;  2RA4 A;  4GN4 B;  3EN2 A;  2I5M X;  5C0X I;  1SXJ C;  1STY A;  1HA6 A;  3I4O A;  1LV7 A;  4XT1 B;  2HCI A;  2L55 A;  1GUW A;  1XXH E;  2Z6K A;  3I4N G;  3NWT A;  1Q82 C;  2EY1 A;  1ILQ A;  4N8F A;  4H13 C;  3GTO B;  4QUF A;  3IL8 A;  4H0L C;  4IPH A;  2EUC A;  2UUC M;  3CQZ B;  1IBK L;  2R0I A;  3T1Y M;  4LRT A;  1W5T A;  3U6M A;  3H0G H;  3FRH A;  1PA6 A;  4QOZ C;  3TQS A;  4NXM Q;  3GLH E;  2JSO A;  2UUA L;  4CJ1 B;  3R9X B;  4GKK M;  1JQY D;  3R2T A;  3EFX D;  3PUY A;  4DAY B;  3J80 L;  1T9H A;  2I7N A;  1RU3 A;  3AL0 C;  5EQ0 A;  4NSR A;  1ML0 D;  2EIF A;  3KXE C;  2B2Y C;  3GLG E;  3GD7 A;  2Q8R E;  5C3W A;  2X6L A;  2ES2 A;  1BCP D;  1Q3B A;  3I90 A;  3ZJY C;  5JJL A;  4MGZ E;  4DR7 Q;  1II3 A;  1LTR D;  5LHY 1;  3W0F A;  1BCP B;  1JC7 A;  3FTF A;  2IT1 A;  4CKE A;  2L4F A;  4BS9 A;  3U6C A;  1SN8 A;  2KEC A;  3KJO A;  1QZH A;  1W5S A;  2XZF A;  3EBE A;  3IAY A;  3VR3 A;  4IOA A;  3AQQ A;  3E9S A;  1HXY D;  5HY6 A;  3DMU A;  3J27 B;  3ZQJ A;  4EQN A;  3KBG A;  4AKH A;  2FMC A;  2LVP C;  3TRE A;  2E2I H;  2KHI A;  1O7Y A;  2QNJ A;  1Y1W H;  4P74 A;  3HOV G;  4NP5 A;  3OYY A;  4MIU A;  2M60 A;  5ISR A;  1JMC A;  2ZBK B;  2B29 A;  1PMR A;  1X3E A;  4PDG A;  1VQG A;  1PFM A;  3PUZ A;  4UP7 A;  3RZO B;  2LVQ D;  1H9S A;  1DOL A;  2CVR A;  3LCU A;  2Z9H A;  2EE1 A;  3LNN A;  1IM2 A;  2JE6 I;  2E5L M;  4DR5 L;  5EP1 A;  2FFJ A;  1SNP A;  2DKL A;  1E1T A;  3MC0 B;  3LQQ A;  1GKH A;  2TMP A;  3S2H H;  3NUC A;  3TP6 A;  3ERS X;  4DV7 L;  1A6X A;  1T43 A;  2K33 A;  4OWX B;  1LAB A;  1IY1 A;  2XF3 A;  2C5C A;  2E76 C;  4HJ9 A;  1KDA A;  3BG3 A;  5ELF A;  1HQC A;  1WGL A;  3Q23 A;  3G6E A;  4B7G A;  4DV3 L;  4RGT A;  2LKV A;  4DKA C;  3VR4 A;  3QJY A;  1YZ6 A;  1YJ9 A;  4L5R C;  4A3J H;  1HH2 P;  2A69 C;  3I4M B;  1EOT A;  5J22 A;  2LBC A;  2ZAM A;  3NHH A;  3Q8D A;  2O5I C;  4MGI E;  3T51 B;  1SLJ A;  4CIZ A;  3PQI A;  1PGY A;  3SK8 A;  1X37 A;  1D0K A;  4Z9C B;  4J15 A;  4GLX A;  3HJ8 A;  1XXH B;  2OWO A;  1HCZ A;  1TWH B;  3U6S A;  2L12 A;  1LT6 D;  4O0A A;  1EYC A;  4FP5 D;  1QOH A;  1QE6 A;  2DJF C;  1EEF D;  2R61 A;  1FJG L;  2XVS A;  5IE8 A;  4QMG A;  2DZO B;  3GPU A;  4B7H A;  4JV5 M;  4QUC A;  4P71 A;  2W82 A;  2AHM A;  2Q2I A;  3LMM A;  2EOT A;  2R65 A;  1IXS B;  3KF8 B;  4HN7 A;  4V0B A;  4ZCK A;  2DAI A;  2AKW B;  2A6E D;  3HFZ B;  4DV5 L;  1ESR A;  1XXG A;  1IBK M;  2RDF A;  4A3K H;  1EIF A;  1EU3 A;  4NXN Q;  4CDE C;  2HD3 A;  1K8A C;  1NV9 A;  3TP5 A;  1EIJ A;  2Y21 A;  4JBK A;  1K28 A;  1ZV1 A;  2DNA A;  5E4W C;  4R4T A;  3X3M A;  4HID A;  4DV1 L;  2KA7 A;  2E8G A;  3E0E A;  2D62 A;  4JI8 L;  2KRK A;  2H4O A;  3I56 A;  2L15 A;  3SAV A;  2G9D A;  1V1O A;  1W6K A;  2UXC L;  3K58 A;  3DFZ A;  1HZ9 A;  2NZH A;  2JZ1 A;  2ZM6 Q;  4NKL A;  1OKS A;  4LJ7 A;  1PH5 A;  1S3S A;  1U5K A;  3AOG A;  1I50 B;  2JY8 A;  3HP3 A;  1EIH A;  4DK3 C;  2ZM6 L;  2F0I A;  1U9R A;  1WCM H;  2EYP A;  1HUM A;  1JE4 A;  3HOV B;  2VQF L;  1V9P A;  3OMG A;  5A35 A;  2A1A A;  1EY8 A;  3GLH B;  4K8J A;  3K7A B;  3HOZ H;  3U60 B;  1SXJ D;  4IPC A;  3T16 A;  3HOX B;  4XTC S;  3FHW A;  2JEA I;  3EJI A;  4DV6 L;  1I6H H;  3UGJ A;  3R8F A;  4ZRZ A;  5ITU A;  5GRO A;  4O1N A;  4AG6 A;  3FEW X;  1EFW A;  4KY7 A;  1EYA A;  4K0K M;  3BVM A;  4FF3 A;  4OEM B;  1PLF A;  1EYD A;  4AG5 A;  3F92 A;  1N8R C;  2MGS A;  4IN3 A;  4JI7 L;  3FUV A;  3Q22 A;  3A42 A;  4K6D A;  3MZ5 A;  2BNK A;  4JYA L;  4DV4 M;  4JOI C;  1SSO A;  4A3E G;  1NMF A;  3S16 B;  2CV0 A;  2K05 A;  2Z6K C;  1I4P A;  1WYD A;  2LXK A;  3W1B A;  3S2H B;  2XZU A;  4L4U A;  5C0X G;  5M3M H;  4YY3 M;  3SK4 A;  1BCP C;  1Y8P B;  4J6H A;  3ZH9 B;  3PO2 G;  2VQF M;  4KHZ A;  3EQL C;  2B2W C;  2RCF A;  2HHH M;  4KY5 A;  2XNA C;  4OL7 A;  3TRZ A;  1H9J A;  2ZXO A;  3SXH A;  3ND8 A;  4KKS A;  1ENF A;  3ZYY X;  1QAN A;  4A3B H;  3GO5 A;  4OO1 I;  3FYD A;  2K4K A;  5D14 A;  3UE1 A;  4XQQ A;  1R2Z A;  1C1K A;  2O01 F;  4KKU A;  1RTN A;  5FK9 C;  4NMZ A;  2LHC A;  3DUZ A;  3K7U C;  5BR8 M;  1YNN C;  3CU7 A;  5CV4 A;  5EXX A;  4K0K L;  2C5R A;  4UP9 A;  3QOL A;  2CEA A;  4DV0 M;  5C18 A;  2ICI A;  4OWW B;  2D0P A;  1EQQ A;  1PYB A;  1IBL L;  2BA0 A;  2R7Z H;  2RBM A;  3F8T A;  3AMU A;  5I2Y A;  5KNB A;  2LVA A;  4JYA M;  4K0K Q;  3KLS X;  5KYI A;  4DUY Q;  2VF7 A;  1IL2 A;  4PMC A;  3CCL A;  4GNX A;  3B9P A;  3I2Z A;  2VUM H;  4PZ8 A;  2LWX A;  1P3Q Q;  1GAB A;  3J81 c;  4B3M Q;  3B7Q A;  2B2T C;  4C1N K;  1H9R A;  3WHK A;  4LJ6 A;  4LJ4 A;  5ELO A;  1T3T A;  2AMC B;  1C8C A;  3TZD A;  5FSW A;  1G59 A;  5TSS A;  1XPR A;  2SDF A;  3AFH A;  3WWV A;  3B74 A;  1K8M A;  1E2V A;  2L2D A;  4MH0 E;  2JK8 A;  4ME3 A;  1YIT A;  2OTJ A;  1OAO C;  2MGW A;  3RN5 A;  3VR6 A;  2TSS A;  1G2T A;  1PRT B;  5KQ8 A;  3CP0 A;  1QUQ A;  1XHB A;  3J7A 5;  4DBG B;  3HOY G;  1CKN B;  3T4A C;  4LF7 M;  3GTG H;  2PMZ E;  1MJC A;  1GKI A;  3V2T A;  4LFA M;  2OCE A;  3G6J B;  5K36 H;  2UXC M;  2EO2 A;  2L7I A;  2J4X A;  4G4K A;  1KAW A;  2UXB Q;  3J81 i;  1RHP A;  4JK1 C;  4IUN A;  1PH3 A;  2IX3 A;  1R9T B;  1D8L A;  2F0P A;  2D0O A;  1SE8 A;  3GTP B;  4CBV A;  1Z6H A;  4OHJ A;  3KUP A;  2MHV A;  3TS2 A;  1X3F A;  1GVN A;  5IT9 S;  1F9R A;  1K73 C;  1JJ2 A;  1TWG B;  4QGU A;  4LF8 Q;  3BVG A;  3FKI H;  2ENB A;  3PSI A;  1CKM A;  3MHB A;  1IN8 A;  3G71 A;  1B9N A;  3QG1 A;  1VQB A;  3FTE A;  3J7A S;  4LRS A;  3QYB A;  1Y8G A;  4EIW A;  4TUW A;  3K7A H;  3HOZ B;  2ASB A;  5DEH A;  2QEX A;  2DXI A;  2JXM B;  1SNC A;  3GTK H;  4LUZ A;  2KHH A;  3CCM A;  2DAE A;  4GHL A;  1GHJ A;  4ZLT F;  1R2Y A;  1J7K A;  1C9O A;  1RL2 A;  1EFI D;  4TVA B;  1HPC A;  4EX5 A;  3NBH B;  1VQA A;  5IP9 G;  1PRT D;  3S9W A;  4LFA L;  1YEZ A;  3QO2 A;  4Q7J A;  2GVA A;  3HG9 A;  4L16 A;  1I3Q B;  3IFD A;  3B89 A;  2F0H A;  1TS4 A;  1JR0 D;  3D8L A;  1XNQ M;  4RGO S;  4JI6 L;  5DYI A;  1PH9 A;  4GMQ A;  3TWK A;  5ELD A;  1PFN A;  4B9W A;  5BN5 A;  1HNW L;  5ITX A;  2CQO A;  4BWG B;  4I5S A;  4HJ8 A;  1HA5 A;  1F2L A;  4GRI A;  1IYJ B;  1HTL D;  2RQX A;  1VF7 A;  4PMW A;  4L5Q A;  4HCS A;  1VQ5 A;  4CDD C;  2CCZ A;  2JY5 A;  3C3D A;  2IWH A;  4A4I A;  2R3Z A;  4FXK C;  1ZMU A;  4Q0F A;  3CC7 A;  3PF5 A;  3KLS A;  2Y0Q A;  4LF9 M;  2C9C A;  5JAV A;  3GPP A;  1K82 A;  1S5C D;  2R92 G;  1Z5B A;  2FS1 A;  1GM5 A;  1IBK Q;  3SFZ A;  3UDF A;  1BCP F;  3ULL A;  2KJX A;  4GKJ L;  4BY1 G;  4FW9 A;  2EYO A;  2UUA Q;  4BBS B;  2XGN A;  2VS1 A;  2R44 A;  4NC6 A;  1ZXT A;  4LUO A;  4AQY Q;  2Z4H A;  5KND A;  4GC5 A;  3V76 A;  2UU9 M;  5I4D A;  1S4Z A;  4LZJ A;  4IUQ A;  3H6M A;  3NXW A;  2V4D A;  4JI6 M;  3AYH B;  3ONA B;  1XNQ L;  5GAE C;  1LT4 D;  4DR7 L;  1FVI A;  5LMN L;  2VZA A;  4KT0 F;  3TL4 X;  3AKZ A;  4DV7 M;  4IOC A;  1Z59 A;  4LFC L;  2E2J H;  3C46 A;  1H9S B;  2X8A A;  1XNQ Q;  2DI0 A;  1SE3 A;  2RCN A;  3AU7 A;  3JAM E;  1GO3 E;  2IJ0 A;  5COR A;  4X65 Q;  2SOB A;  1K0R A;  3T1H M;  1G4A E;  1D1I A;  4KV6 A;  4DR2 Q;  3LW5 F;  2Z4I A;  4RA8 A;  1W2B A;  3HOU H;  1O80 A;  1DO2 A;  3A74 A;  4FXG C;  2ZAO A;  2J5Y A;  2DY8 A;  2OEO A;  3H94 A;  1QQW A;  4DR2 L;  3HZX A;  2KA6 B;  4LGY A;  1CUK A;  4Z8X A;  2A68 D;  5IP9 H;  5FLX L;  3J81 L;  1XTC D;  3AB9 A;  4MGY E;  4OX9 M;  1XJV A;  3HU3 A;  2Q2T A;  4V19 0;  2IW3 A;  4M0W A;  5C44 H;  2LNH C;  3KP1 E;  1FNN A;  2XRQ D;  5EGT A;  1M90 C;  4DU9 A;  2JA8 H;  4OIK A;  2JA2 A;  3A98 B;  3VYU A;  5CR3 A;  5IGB A;  3S1M H;  2HUG A;  3KDF B;  1JR3 D;  2NVX H;  3LX0 A;  2K5N A;  4DR6 Q;  4GKJ Q;  2JYO A;  3QWN A;  4CGY B;  4HL4 A;  2HHH L;  2IHF A;  1WTV A;  2EKF A;  1LTL A;  3NK9 A;  4WFN 3;  4DV7 Q;  1BF4 A;  2AWO A;  2R92 H;  1YIJ A;  2RGO A;  3GP7 A;  1E2Z A;  3Q6S A;  1R4G A;  2JA7 H;  4H02 A;  4DV3 Q;  2QPA A;  1U4M A;  4Y28 F;  2Q8T A;  1IBM L;  2X6G A;  2SEB D;  1I94 Q;  1SYF A;  4RF1 A;  2OT2 A;  3GRY A;  2KHS A;  1AZQ A;  1B4O A;  1IFY A;  3VLF B;  3N52 A;  4A3G B;  4A3E H;  1IBL M;  5CC4 A;  5BR8 Q;  3R2I A;  1H95 A;  3U6Q A;  1PJQ A;  2NVQ B;  4HJ7 A;  4KTA A;  1JB0 F;  2B2V A;  2JJQ A;  1Q12 A;  5LMU L;  2I7P A;  1L2F A;  3J81 E;  4OO1 H;  3HWS A;  1NUC A;  4ZPX A;  2D5D A;  4JG2 A;  3HKP A;  1C0A A;  4DUY M;  3ERO A;  1KC8 C;  3FDT A;  2BWE A;  3PMF A;  3HHZ A;  1Q90 A;  1TU2 B;  5EQT A;  3NE5 B;  4R4I A;  5JEA J;  1TH3 A;  2WSC F;  4IBB A;  4DXG A;  2WSF F;  2J7Z A;  3DM3 A;  2BDN A;  3H3V I;  1G3I A;  2DHY A;  3I4N B;  1HNZ Q;  2K50 A;  1EUJ A;  1KDC A;  4JVZ A;  1BNZ A;  1OXV A;  2QP9 X;  3PNY A;  5I2X A;  2Z3X A;  3T1Y L;  3JAM S;  4IFD J;  2DVW B;  2B8F A;  1AW7 A;  1R5L A;  1AP0 A;  2YQZ A;  2BJW A;  1PH8 A;  1QAM A;  2DWL A;  1I5F A;  3VK8 A;  5IGE A;  5IIF A;  4A3M H;  2KCT A;  4C3H B;  1XMQ L;  3CC4 A;  2QBY A;  4GN3 B;  1CA5 A;  3D4W A;  4DR5 Q;  1QVF A;  1QVC A;  5EPL A;  3L26 A;  2V6Z M;  3NTH A;  3AJI B;  5H1S E;  4A3V B;  4LF7 Q;  4IFD I;  3MK6 A;  3E9H A;  4NDX A;  1L0W A;  2KNV A;  4R4O A;  3T13 A;  3RMH A;  3UK6 A;  5FO7 B;  1CSQ A;  2KUM A;  4P73 A;  3V96 A;  1N32 Q;  3IRB A;  4LCB A;  1EWC A;  1DXM A;  2A6H C;  2OQK A;  1YNX A;  4DK0 A;  3GTJ H;  1C7Y A;  5C4X H;  1X54 A;  3G4S A;  3C3E A;  5AJ3 Q;  3EIV A;  3VDY A;  2WZJ A;  3ILK A;  4KLK A;  1VEJ A;  4A3L G;  3KOW E;  3KSX A;  2L4E A;  5KO3 A;  1VQ8 A;  3A56 A;  2MR9 A;  2MP1 A;  3KOY E;  1JWM D;  2OPF A;  1I6H B;  4P17 A;  4X62 L;  1LT5 D;  5KPR A;  1ET9 A;  3AEV A;  3Q0A A;  4N9P A;  4C3I G;  3Q8X A;  2CFM A;  4OEL B;  1WTW A;  2BA1 A;  1CFM A;  2DNE A;  1Y8N B;  2Q2E B;  2JXN A;  2B3G A;  1UM8 A;  2IHE A;  5JOB A;  1DCZ A;  2ICE C;  1X6O A;  2DEN A;  1NY4 A;  4M8A A;  4IBD A;  1A0I A;  2NUC A;  2QHO B;  1ENA A;  4XIG S;  2CRU A;  3M4P A;  4C2M B;  4FO2 A;  4DV5 Q;  1V92 A;  5DFL A;  2G8L A;  1WTR A;  3W1G A;  3FUW A;  3SMS A;  3TN2 A;  3U4Z A;  3GDE A;  5JJZ A;  1VQP A;  2F5O A;  3HKZ G;  1GJS A;  1F2M A;  1STB A;  3K59 A;  2M5Z A;  2QCP X;  3CRK C;  3DWQ A;  3BBZ A;  3TDQ A;  4CDF C;  3F2C A;  5EXS A;  3W67 A;  3U4V A;  1VQL A;  4M9S A;  1OQY A;  3KFU A;  3SAS A;  2Q2H A;  4RH6 A;  4DUZ M;  5IYC G;  1PFS A;  1VQO A;  3H91 A;  2WB1 G;  3U6L A;  3RZD H;  2JA7 B;  2L4N A;  2AQ2 B;  4CDC C;  4TKO B;  4GNX B;  1EYG A;  1BBU A;  1AZP A;  2YFQ A;  5EPJ A;  1LT3 D;  3VDP A;  1X32 A;  4B3S Q;  1VQJ A;  3GRV A;  4X66 M;  4NRW A;  2FJ2 A;  1TR5 A;  1E3P A;  1ICW A;  2R93 H;  1GVP A;  2ATW A;  4LF4 M;  4IJF A;  3T15 A;  3GTM B;  2VXW A;  3S1M B;  5JI2 E;  1HNX M;  4KO8 A;  1EY0 A;  1LV9 A;  2OXP A;  3FUU A;  3L27 A;  3RNU A;  5EJW A;  3PCO B;  5DM7 3;  4RG1 A;  5JPM C;  3VR5 A;  5I6Y A;  2PPB C;  1P8L A;  2B63 B;  4LFC M;  2KXE A;  2OOB A;  4DUY L;  1NO1 A;  3N6R A;  1Q02 A;  1D0M A;  3E4R A;  3IHP A;  3SAU A;  5K5P A;  4X64 M;  1QB5 D;  1TWC B;  4A3F H;  3M3Y B;  4B3M L;  4JYA Q;  1V34 A; 
#chains in the Genus database with same CATH homology
 5KGU A;  3NWL A;  4JN6 A;  1X3P A;  1Z7T A;  4IBI A;  3S1N B;  3MXP A;  3SAW A;  3VYT A;  3OTO M;  3VFD A;  2K5W A;  1VCI A;  1HUN A;  4GH9 A;  1K83 B;  3LWE A;  5E6J A;  4DV1 M;  2NVX B;  3KF8 A;  2QDB A;  3QIA A;  3SHG B;  1DD2 A;  1PJI A;  3FYC A;  4XT3 B;  2O5J C;  4BY1 B;  3NTK A;  1NSF A;  4ULL A;  1HQY E;  3DEO A;  4X3T A;  5C3E B;  3HHW A;  3A55 A;  3PFI A;  1LTI D;  5EXT A;  3R3O A;  4AKI A;  4A3K B;  3FPU B;  1EIG A;  5DNY A;  1HFG A;  4GC9 A;  1EE8 A;  2FFK B;  4DNR B;  3QOJ A;  3U6D A;  4G4Q A;  2BE5 D;  3RD4 A;  1UNS A;  1B2T A;  1EY7 A;  1NR4 A;  2PQE A;  2DNC A;  4H44 C;  2LH0 A;  4IIW A;  4QHT A;  1BR9 A;  1YNJ C;  2XSC A;  3K5O A;  3IG5 A;  5LMN M;  5C4H A;  1L2D A;  3HS0 C;  1PTO B;  1BXT A;  3FD9 A;  5IRE B;  2PMZ B;  4XGI A;  2J7O A;  3RGS A;  3DEP A;  3PIP 3;  3A54 A;  2A6H D;  3BOS A;  4MB7 A;  1XMO M;  1PTO H;  4NOO B;  1NJG A;  1R7R A;  1R4Q B;  1N32 M;  1AFP A;  3SEB A;  5BN4 A;  2YR0 A;  1V43 A;  4CJ2 C;  3HHY A;  4KK7 A;  1J9O A;  2UUB M;  2J0T D;  2N55 A;  1MBY A;  2BDO A;  3HGB A;  3MTS A;  3J7B A;  1E94 E;  1KSF X;  1G2S A;  5D3I B;  3S1R B;  4KOD A;  1TY2 A;  2XIW A;  4DR5 M;  3HOY B;  1NY5 A;  5EP3 A;  5KPZ A;  3A45 A;  3GLI B;  4HR7 B;  5IT9 E;  5F2D A;  2VQE M;  1CI3 M;  1M4V A;  3QB3 A;  2AQ3 B;  1PZK D;  1VF5 C;  2I46 A;  3OIQ A;  1MU5 A;  1AN8 A;  4RKB A;  3VR2 A;  1OFI A;  3M6A A;  4AQY M;  1Q3C A;  3MXG A;  4RAU C;  5KEE A;  4JI4 M;  1E32 A;  3U9O A;  4B7F A;  2K7V A;  2PCF B;  2R6G A;  3K5L A;  1PTO D;  2M2L A;  4ZKC B;  1NR2 A;  1DGB A;  5GKN A;  1DGG A;  4LY6 A;  1NJF A;  1LTG D;  5EKK A;  2DY7 A;  2EJG C;  5EXP A;  5IWA M;  3U61 B;  4MGH A;  2CE7 A;  4MHE A;  4BBA A;  3D6C A;  2B2T A;  4F87 A;  3HEJ A;  1TS2 A;  1N34 M;  2FE8 A;  1QYR A;  3NSW A;  4LF8 M;  3QAU A;  4OVZ B;  5ELC A;  2DN8 A;  2NQ8 C;  4KHP M;  4A3I B;  2F03 A;  4AZF A;  4ZUJ A;  1B3A A;  3UJN A;  1D6E C;  4C1N I;  1QWY A;  3I4V A;  2WAC A;  4BY7 B;  1PJJ A;  2KW0 A;  2BCO A;  3A8K E;  4XDX A;  3ND9 A;  1PRT F;  1G91 A;  1Y1V B;  2DHR A;  5C44 B;  4BB9 A;  1Z5A A;  1H9M A;  1STA A;  4K14 A;  5IGD A;  1XWE A;  3DOA A;  2F5P A;  1VMP A;  3L7Z C;  2O5R A;  4G4O A;  1HT1 E;  1XMQ M;  5FO9 B;  2NN6 H;  1BQQ T;  4HMJ A;  4X3U A;  3KK7 A;  2O4X A;  3GLG A;  1Q8I A;  3CKI B;  2XRS D;  4LJ8 A;  4HTH A;  3GV3 A;  1QZM A;  2Z4R A;  3FVQ A;  1N36 M;  3HKZ B;  3NQT A;  1PM5 A;  5C5L A;  5LL6 X;  3H3V C;  2Y0T A;  2DWZ B;  5BN3 A;  4MGK E;  1DZ1 A;  1RTO A;  2NBF A;  3PVS A;  2EYF A;  4OIJ A;  4IBK A;  4REZ A;  1EZ8 A;  2JA8 B;  3VKH A;  4HED A;  2R4J A;  4QNM A;  3WHL A;  4X62 M;  5M3M B;  4J8Q A;  1L8Q A;  3H09 A;  1LTA D;  1U4L A;  2UUA M;  5FO8 B;  1Z6T A;  2F3V A;  1KNA A;  4I7Z C;  3TBI B;  4XBO A;  1HNZ M;  1O7Z A;  1NNJ A;  3A7L A;  1JIC A;  3MAQ A;  4LF6 M;  3I4L A;  1F77 A;  4ABN A;  2FOI C;  4JI1 M;  5EJC A;  4IBE A;  1GHK A;  2O2L D;  5G3L D;  1STE A;  2KEE A;  4U67 3;  1TT2 A;  4X65 M;  4PMB A;  3GLI A;  3HJQ A;  5CBE E;  4CKB A;  4FF1 A;  5IT9 L;  4A3E B;  1I6V C;  5C5M A;  1ET6 A;  1N78 A;  1KFV A;  2EYH A;  4A3M B;  2F4V M;  3ZC7 B;  2EXZ A;  2PW5 A;  4AI6 A;  1SYE A;  4RKL A;  2A73 B;  3MHV C;  2CHG A;  3J7A V;  4KJN A;  4KN7 C;  1GL6 A;  2ZXR A;  1GLN A;  3BZD B;  3SDZ A;  2K28 A;  5FTN A;  1YUB A;  1SNQ A;  4IBJ A;  3JAM L;  4M1U B;  4LFB M;  1IW7 C;  3T38 A;  1IN7 A;  3QWL A;  1CTM A;  3NQI A;  2B2U C;  1ONL A;  2K32 A;  3CRL C;  4P2C B;  4CIS A;  3NWS A;  2F0Q A;  4FF2 A;  2F0N A;  4FCW A;  3K5M A;  2EYM A;  1PFB A;  2KEB A;  5H37 D;  3I70 A;  1CZG A;  3L29 A;  2KOL A;  3OWF A;  2EZV A;  3HU2 A;  3NPP A;  4F88 A;  4PV1 C;  4FCV A;  2NZ1 D;  4DV3 M;  3L2A A;  4PCZ A;  3MA2 B;  4KD3 A;  2NVT B;  3GQ3 A;  3CF2 A;  7CAT A;  2IPK D;  4DFA A;  2KVM A;  2CW0 C;  1A3U A;  1MX0 A;  2F0M A;  1D5X C;  3UI2 A;  3SAR A;  1IBM M;  3H0G B;  3K6O A;  2F0W A;  2CUZ A;  2KCN A;  3SYK A;  1RKN A;  1SBB B;  3L25 A;  1CHP D;  4NXN M;  4MM3 B;  2R18 A;  4M9X A;  3KOX E;  1NHW C;  2SNS A;  3GRU A;  2RGH A;  2HDL A;  2L5T A;  3GV6 A;  2VNU D;  4FWD A;  5FTL A;  4N9T A;  4NW2 A;  3P20 A;  4DAP A;  1HTP A;  4TSS A;  1QG7 A;  2FMM A;  2NVY B;  3F2U A;  1ZYR D;  4B3S M;  2IL8 A;  3DXJ C;  3DM1 A;  2XSZ D;  3IFT A;  1XNR M;  2M00 A;  1DOM A;  1F2Z A;  2K47 A;  3HJS A;  1C4Q A;  4BA2 I;  3S2D B;  2G9H D;  1SXT A;  1EWH A;  4S12 A;  5IOC A;  3GTQ B;  1IY2 A;  2N88 A;  3W3A A;  2PZU A;  1IXR C;  3TP8 A;  3GLF B;  4RHR A;  2B2W A;  2Z1C A;  5J1Z A;  1T5E A;  2RDH A;  4CKC A;  4LJZ C;  1SXJ E;  3FUX A;  1VMC A;  3LQR A;  4WOR A;  1BO0 A;  3HHX A;  3MJ5 A;  3VK7 A;  1DJR D;  3T56 B;  4FYD A;  5HGT A;  3X3N A;  2VII A;  1BBX C;  3P7J A;  4DAV A;  3BDL A;  2EPB A;  2KCC A;  4QCL A;  3OOC A;  4BBR B;  3GTL B;  1DO0 A;  2C9O A;  4ODG A;  2E2J B;  2LXE A;  1NAP A;  4D82 A;  1B50 A;  4NSO B;  3KDS E;  1OXX K;  3WOE A;  4B9X A;  3U6P A;  1DM0 B;  2F0V A;  4OW0 A;  2WB1 B;  3LWU A;  1ROD A;  1S5D D;  3BYT B;  2R92 B;  5M3F B;  5IZ7 D;  4JI7 M;  1FYC A;  5CV8 A;  2HQE A;  1F9S A;  5C4X B;  3THG A;  5KYL A;  4PDI A;  4OU7 A;  1TVX A;  4DV6 M;  4I8O A;  1N77 A;  3GTG B;  2F0G A;  1PZJ D;  4MN3 A;  4I4L A;  1D2B A;  4W5W A;  2JA6 B;  5A2Q E;  2WV6 D;  4KMU C;  2QZ4 A;  3E5S A;  4CJ0 B;  2FIN B;  4L8R C;  4LG2 A;  4AKG A;  3RFW A;  2B2U A;  1NHG C;  1HR0 M;  3FKI B;  2CHQ A;  1ILP A;  2MJ8 A;  3A8J E;  3TE6 A;  4LGM A;  1EY9 A;  4GIT A;  1RF2 D;  1GJX A;  1GUT A;  2D7H A;  2LY7 A;  1FNV A;  2YYZ A;  2UXB M;  2JP1 A;  2JA5 B;  1TDZ A;  3I51 A;  1TKW B;  4EQO A;  1JOO A;  2DWN A;  4JI0 M;  4ZQ3 A;  1WCM B;  3WOF A;  3GO8 A;  4IFD G;  1STG A;  3K1J A;  1I94 M;  5KNC A;  2F1M A;  2RSO A;  1SND A;  4R8I A;  4C3J B;  1MGS A;  4R9W A;  3ITP A;  1JR3 A;  4K6L A;  1SEB D;  1SYC A;  3HOW B;  1OO9 B;  1D5M C;  1SXJ B;  1TWF B;  3FPP A;  5JPN C;  3JR4 A;  1PXU A;  1WTQ A;  3I72 A;  1QAO A;  3J80 E;  1L1Z A;  1DGH A;  1CZW A;  1SAP A;  5CYU A;  4WW0 A;  5LMU M;  3GPY A;  3URY A;  3J80 S;  3GP1 A;  2F0E A;  2RDG A;  5BPV A;  1SMY C;  5F3W A;  2EY2 A;  4J1M A;  4DN4 M;  5M5Y B;  5M5W B;  3TWM A;  2HDM A;  2F0K A;  2CFO A;  1CQV A;  4IUV A;  4DNT B;  1SXJ A;  1MSH A;  2M9V A;  4IQZ A;  4A3B B;  4I65 A;  2LFN A;  1CHQ D;  4IBF A;  2F0O A;  1I4R A;  1SFO B;  3TZU A;  1DGH B;  1TDH A;  2EY5 A;  4YHH M;  5A2Q L;  1FJG M;  3NP8 A;  1JOK A;  4HCE A;  4NL4 H;  1S5E D;  4NRV A;  5CV7 A;  4XQJ A;  2IX1 A;  2E74 C;  2EJM A;  2L1B A;  2AQ1 B;  2NB0 A;  3VKG A;  2B2Y A;  1A3T A;  1D2N A;  1EEI D;  3KW6 A;  3HGI A;  3KLR A;  3SHL A;  4I81 A;  3L3O C;  5ELE A;  4KI0 A;  1B53 A;  3SC3 A;  1TWA B;  4JI2 M;  3O13 A;  2KRU A;  1BOS A;  4C56 C;  4RHS A;  2WKC A;  3I73 A;  1IW7 D;  3SMP A;  1BUV T;  1I4W A;  1Y8O B;  2XWJ B;  1N33 M;  4G7Z C;  1OXU A;  1UEA B;  4EQP A;  5JVH 3;  1ENC A;  3U5Z B;  1PTO F;  3A8I E;  1NNU C;  2H1R A;  4IUT A;  3PUX A;  1XWI A;  3NBH A;  4PT5 A;  1V1P A;  5J39 A;  1BDO A;  5EBC A;  2K01 A;  3GRR A;  2V1U A;  1E2W A;  5ITQ A;  3FTD A;  2HL7 A;  4G7O C;  2MUY A;  5IGG A;  2QIL A;  4ME5 A;  2Y0S B;  2BOS A;  3C1F A;  1Q39 A;  4JBW A;  5JEA H;  1IHZ A;  1OXT A;  2JEB I;  4DGZ A;  4S3S A;  4DA2 A;  2R4E A;  3AOE A;  4DR3 M;  3NTI A;  4FWG A;  5C0X J;  4FCT A;  4KY6 A;  1YE9 A;  3VA7 A;  2F0L A;  4K5X A;  4LZZ A;  4OO1 G;  1V1P B;  1H6U A;  2J7N A;  3J2P B;  5CV9 A;  4B08 A;  2KZU A;  3GPX A;  2BE5 C;  2C99 A;  1LAC A;  1STN A;  1CA6 A;  1DYQ A;  1IN5 A;  2F0T A;  3PUV A;  5JVG 3;  4FWH A;  2A5H A;  4XYO A;  1PDQ A;  3DA1 A;  2VB2 X;  2B8G A;  4R8N A;  5C1B A;  1HQR D;  1TY0 A;  2L0C A;  2C98 A;  4B3T M;  2QBY B;  4F8M A;  1Y1W B;  2C96 A;  3I8Z A;  1QNU A;  1X3Q A;  2K5D A;  1PTO C;  1EL0 A;  4IJE A;  2I07 B;  3IKJ A;  1M8A A;  2QKI C;  5FKA C;  1FNW A;  3RZD B;  2VB3 X;  4G4N A;  1SJH D;  1SYB A;  1B9M A;  4M0D A;  4IZ8 A;  4RGN A;  3SK5 A;  3VA5 A;  4G57 A;  5DAU A;  3L9A X;  1NY6 A;  3K92 A;  1EQT A;  1H9K A;  3KOZ E;  2E2I B;  4EGV A;  1Z47 A;  2R46 A;  5K36 G;  5JEA G;  4GZY C;  3PXG A;  4DR6 M;  2NYZ D;  1RD9 D;  3PUW A;  5EPK A;  1NCV A;  2GA4 B;  5T1I A;  1EQV A;  3OWE B;  3SVM A;  4IBG A;  1JCK B;  5CV6 A;  2CHV A;  2YNM D;  4KD4 A;  3M0E A;  3SK6 A;  1B1Z A;  3J81 S;  4ZKB B;  5FLX S;  3M4O B;  4K2K A;  4PNY A;  4DV5 M;  3DWA A;  5ELB A;  5M5X B;  4HLQ A;  4RF0 A;  1L2C A;  1EY4 A;  1GUN A;  1J5E M;  1TS3 A;  3MXU A;  1O78 A;  3J7A F;  3SE0 A;  3CF6 E;  1TQO A;  1SNO A;  1K3X A;  1QIL A;  2Q8I B;  4L6T B;  3V05 A;  2F0F A;  4ILW A;  4FVM A;  2UXD M;  4LK1 C;  5D3D A;  3A46 A;  4G6Z A;  1ZEQ X;  1HHV A;  2ZM6 M;  3I4Y A;  4RFB A;  3JR5 A;  4KLN A;  1SNM A;  4DAY A;  3UMM A;  3C1E A;  4B3R M;  2X4A A;  1J8I A;  1OXS C;  1GOZ A;  1KLG D;  1UUP A;  3GQ4 A;  2PYK A;  5CMD A;  1LTB D;  1G41 A;  3U6E A;  4UDU C;  1O7L A;  2A74 C;  1U4R A;  1XX8 A;  3D6W A;  3KS4 A;  2CHB D;  3PNV A;  1Q1B A;  5C0X H;  3OW7 A;  2Y20 A;  4GKJ M;  4KN4 C;  2L6O A;  2KQ3 A;  4A3J B;  1EY5 A;  5FLX E;  4FNF A;  1G29 1;  4Q5V A;  1IN6 A;  3SHF A;  2HCC A;  3K57 A;  2XH9 A;  3MWY W;  3PO2 B;  1WTO A;  8CAT A;  4WUR A;  3G7L A;  2D9U A;  2A69 D;  2QEJ C;  5C4J B;  3GLG B;  2L7H A;  4DR7 M;  4D80 A;  1FR3 A;  3E6Z X;  1IKL A;  3SYL A;  4RCO A;  4RCN A;  4PD2 A;  5ITX E;  4JI5 M;  4LAA A;  5E1F A;  2NWG A;  1GUO A;  2F0S A;  4QF4 A;  5KRU A;  3GQ5 A;  1KAA A;  1LLR D;  3CTW B;  2DWM A;  1I4G A;  3DWP A;  5C4Z A;  2L9H A;  3MFY A;  5C6A A;  4LJA A;  3KP0 E;  2QF7 A;  4U68 A;  2D2C C;  4L8J A;  1FGB D;  5E4X A;  5FOB B;  3RLF A;  4KJO A;  1ZQ9 A;  1VDD A;  2IX0 A;  5I9O A;  4M9Z A;  4A93 B;  4D81 A;  2CW0 D;  3GTJ B;  2A6E C;  3EA6 A;  4QHS A;  3M85 A;  3S17 B;  2D7E A;  1HQM C;  1LTT D;  4DK1 A;  2F0U A;  1KLU D;  2NTT A;  5M9O A;  3FUT A;  3S14 B;  1JOR A;  1IN4 A;  3HRZ C;  1IYU A;  3BS1 A;  1D5Z C;  4DV2 M;  3MVV A;  1RJT A;  4O42 A;  5E26 A;  1TH2 A;  2HKJ A;  5KQD A;  2X49 A;  1L0Y B;  1ZYR C;  3K8Z A;  3TPZ A;  3GQB A;  3OMC A;  1OFH A;  2B2V C;  4Y7N B;  2XEP A;  1LO5 D;  2VUM B;  2XLJ A;  1MSG A;  2WP8 J;  1QVR A;  1S5B D;  4AYB B;  1LTS D;  2F5S A;  1MD2 D;  2WKD A;  5FTJ A;  3CF0 A;  1E9S A;  1KDB A;  1ZAE A;  1R4P B;  1ZKO A;  2FNA A;  2F0J A;  3SR1 A;  2CV1 A;  3EIH A;  4WRD A;  4IUU A;  4PQX A;  1TGU A;  1F9P A;  5ITY A;  2QCU A;  1I4X A;  3WDN A;  5I9P A;  1J09 A;  1YNJ D;  2KZS A;  2MPM A;  4CHT B;  1NVM A;  4X3S A;  5KIX A;  1K8O A;  2Z8L A;  1W6J A;  3R8B A;  4KKT A;  3ZCB B;  4F7X A;  1SE2 A;  2E75 C;  1FNU A;  4JI8 M;  4G4R A;  1NSN S;  1WD1 A;  4RGM A;  4A3F B;  1EZ6 A;  5NUC A;  2OQ4 A;  1F2Y A;  3U60 A;  1TII D;  2NN6 I;  3AV0 A;  5T1G A;  2AUJ D;  5EP2 A;  1HNW M;  4L78 A;  5FTM A;  3RGP A;  4C3J G;  1YNN D;  1XYI A;  2ZT9 C;  4C3I B;  1G8P A;  5EKL A;  2RSN A;  2DZN B;  1IXZ A;  3C58 A;  5JI3 E;  2KED A;  5CGK A;  3J7Y W;  3LVV A;  1E9R A;  2PW7 A;  3U6O A;  1WD0 A;  2ID0 A;  4IAL A;  1QJO A;  5CBA E;  2EVB A;  1EY6 A;  4G7H C;  4DXF A;  1IL8 A;  1L2B A;  2XN9 C;  1ESF A;  2PZT A;  3W0L B;  3GLF A;  4FXD A;  4GHA A;  4WJW A;  1QNK A;  2ZXP A;  3D8G A;  1Z5C A;  3D8B A;  5AFW A;  3DZD A;  1KNE A;  3U9S A;  5DNF A;  3M7G A;  1G6Z A;  4OGQ C;  3T53 B;  3MXN A;  4IFD H;  2NN6 G;  1R6B X;  1CQF A;  1SYG A;  3Q24 A;  2K1B A;  4A3D B;  3I91 A;  3C3L A;  4ZK9 B;  2X69 A;  4P16 A;  1N75 A;  3GLH A;  4ZYS A;  2D7G A;  4ID6 A;  4IUP A;  4RNA A;  1MI2 A;  1GL7 A;  2F3W A;  1A2T A;  1FD7 D;  2R45 A;  1CM9 A;  3RE8 A;  2XFT A;  3TSS A;  5EBD A;  4ZUI A;  2P5T A;  3SAT A;  2PZW A;  3A7A B;  3KVW A;  5EP4 A;  1IQP A;  1E0B A;  1K3W A;  2CQA A;  2K03 A;  3M7N A;  3OIP A;  3P75 A;  4X3K A;  4DR4 M;  3UZU A;  4K5V A;  3KS8 A;  1IKM A;  1GUG A;  4BA1 I;  3HOU B;  4K5W A;  3K2L A;  3OHX C;  2WIN B;  3H4M A;  4IBC A;  2EJF C;  3MFG A;  5CV5 A;  3M4Y A;  1L1T A;  4JXJ A;  2B39 A;  2XSZ A;  1JOQ A;  1V8Q A;  4B3M M;  2F0D A;  1DGF A;  4LJ5 A;  1U4P A;  1DON A;  1KTK A;  1JWS D;  1T5X D;  1JB3 A;  2E2H B;  5G3L F;  1SMY D;  3OPO A;  3BDC A;  3LVW A;  4AW4 A;  4HSP A;  2PNR C;  3MEH A;  1HT2 E;  2RKO A;  1UAP A;  5E3F A;  3K5N A;  3ERQ A;  1PZI D;  5IGC A;  2F4I A;  2V1C A;  4L15 A;  4NXM M;  5IOD A;  3S15 B;  2NTS A;  2RVL A;  5C3X A;  5I6W A;  3D3R A;  4E6I A;  1TS5 A;  1JWU D;  1HFN A;  2Z4S A;  3PO3 B;  3TWL A;  2AWN A;  5A2Q S;  1I4H A;  2H1E A;  4Z6Y A;  4IUR A;  3PIO 3;  2QEN A;  3FRP B;  5DYG A;  1I4Q A;  3FMC A;  1D1K A;  1WTX A;  4H7B A;  3C2P A;  2WII B;  4LMQ D;  3VYS A;  1RDP D;  2R62 A;  1C48 A;  3FTC A;  1QAQ A;  2L11 A;  1OJL A;  3U5Z A;  1CT1 D;  1Q3L A;  3BYY B;  4II7 A;  3R93 A;  1PRT C;  4DR1 M;  4HSV A;  1AEX A;  4R3D A;  2K04 A;  3P1H A;  1GXD C;  1IYV A;  2E2D C;  2AUK A;  3U61 A;  4XYQ A;  2FHT A;  2L09 A;  2R7Z B;  5EKI A;  4RWS C;  2LS0 1;  1PYW D;  2RKS A;  3S1Q B;  2XFS A;  4FF4 A;  2OF1 A;  4OVZ A;  2A68 C;  2WAQ B;  2A5Y B;  1Q1E A;  3AOE C;  3KSJ A;  4UAI A;  3W2D A;  2LMC B;  1VDZ A;  5COY A;  5KPT A;  4HAE A;  3PV0 A;  3EIE A;  2K6A A;  4DF7 A;  1SJE D;  2EYL A;  1HRJ A;  3IG8 A;  4JI3 M;  2PO4 A;  4HMI A;  5ITR A;  1KYI A;  5IGF A;  2K5Q A;  1SE4 A;  2Z7J A;  2SNM A;  2G5G X;  4L63 B;  5DM6 3;  2XWB B;  2EY6 A;  2YU9 B;  3HU1 A;  2CV2 A;  2EYJ A;  4EVO A;  4KHV A;  1GUS A;  1CK1 A;  1SYD A;  3RUZ A;  1G8Z D;  4R7G A;  1ORY B;  3TP7 A;  4FD2 A;  1STH A;  4QOS A;  4DR2 M;  3I3C A;  2F5N A;  1KAB A;  4ZAI A;  1TH4 A;  1XC8 A;  2EA0 A;  1F9Q A;  1A15 A;  5FTK A;  3SBJ A;  1L0X B;  4LF5 M;  3CHB D;  3VDU A;  3D31 A;  3DHQ A;  4LJ9 A;  4K2L A;  3FKE A;  1Y69 U;  1B44 D;  1DOK A;  3OSO A;  4YIJ A;  1IY0 A;  3D4D A;  1JQJ C;  1QCB D;  2EDG A;  2BJV A;  2ZAN A;  1A2U A;  4GIP A;  3NBI A;  4XXE A;  3BVZ A;  1WTP A;  3K0Y A;  1EU4 A;  5HUR A;  4ITQ A;  3VYR A;  3L28 A;  3BDO A;  5ITT A;  5D65 A;  2R93 B;  1S5F D;  3D4R A;  4XQN A;  4TQU S;  4QIW B;  4TRD A;  3E0J A;  3GTK B;  3EVQ A;  2HCB A;  2F5Q A;  1XXH A;  5LL6 S;  1YSY A;  1WVL A;  3TME A;  1WXQ A;  3KFU G;  1SDF A;  4C3H G;  1A3V A;  2ERC A;  3KBX A;  4BLC A;  4QNR A;  1RCV D;  4K8I A;  4QB4 A;  2RA4 A;  5C0X I;  1SXJ C;  1STY A;  1HA6 A;  1LV7 A;  4XT1 B;  2HCI A;  2L55 A;  1GUW A;  3NWT A;  2EY1 A;  1ILQ A;  4H13 C;  3GTO B;  4QUF A;  3IL8 A;  4H0L C;  2EUC A;  2UUC M;  3CQZ B;  3T1Y M;  4LRT A;  1W5T A;  3U6M A;  4QOZ C;  3TQS A;  2JSO A;  4CJ1 B;  3R9X B;  4GKK M;  1JQY D;  3R2T A;  3EFX D;  3PUY A;  3J80 L;  2I7N A;  3AL0 C;  5EQ0 A;  4NSR A;  1ML0 D;  3KXE C;  2B2Y C;  3GD7 A;  5C3W A;  2Q8R E;  2X6L A;  1BCP D;  1Q3B A;  3I90 A;  4MGZ E;  1II3 A;  1LTR D;  5LHY 1;  3W0F A;  1BCP B;  1JC7 A;  3FTF A;  2IT1 A;  4CKE A;  4BS9 A;  3U6C A;  2KEC A;  1W5S A;  2XZF A;  3IAY A;  3VR3 A;  3E9S A;  1HXY D;  3DMU A;  3J27 B;  4EQN A;  3KBG A;  4AKH A;  2FMC A;  1O7Y A;  4NP5 A;  4MIU A;  2M60 A;  5ISR A;  2ZBK B;  1PMR A;  4PDG A;  1PFM A;  3PUZ A;  3RZO B;  1H9S A;  1DOL A;  2CVR A;  2EE1 A;  3LNN A;  1IM2 A;  2JE6 I;  2E5L M;  5EP1 A;  2FFJ A;  1SNP A;  3MC0 B;  3LQQ A;  2TMP A;  3NUC A;  3TP6 A;  1A6X A;  2K33 A;  1LAB A;  1IY1 A;  2XF3 A;  2C5C A;  2E76 C;  1KDA A;  3BG3 A;  5ELF A;  1HQC A;  3Q23 A;  4B7G A;  4RGT A;  2LKV A;  3VR4 A;  3QJY A;  2A69 C;  3I4M B;  1EOT A;  5J22 A;  2ZAM A;  3NHH A;  2O5I C;  4MGI E;  3T51 B;  3SK8 A;  1X37 A;  4Z9C B;  3HJ8 A;  1XXH B;  2L12 A;  1TWH B;  1HCZ A;  3U6S A;  1LT6 D;  1EYC A;  4FP5 D;  1QOH A;  1QE6 A;  1EEF D;  2R61 A;  2XVS A;  4QMG A;  2DZO B;  3GPU A;  4B7H A;  4JV5 M;  4QUC A;  2W82 A;  2AHM A;  3LMM A;  2EOT A;  2R65 A;  1IXS B;  4HN7 A;  4V0B A;  2A6E D;  1ESR A;  1XXG A;  1IBK M;  2RDF A;  1EU3 A;  3TP5 A;  2Y21 A;  5E4W C;  3X3M A;  2KA7 A;  2D62 A;  2KRK A;  2H4O A;  3SAV A;  2G9D A;  1V1O A;  1W6K A;  3K58 A;  3DFZ A;  4NKL A;  4LJ7 A;  1S3S A;  3AOG A;  1I50 B;  3HP3 A;  1EIH A;  2F0I A;  1U9R A;  2EYP A;  1HUM A;  1JE4 A;  3HOV B;  3OMG A;  5A35 A;  1EY8 A;  3GLH B;  4K8J A;  3K7A B;  3U60 B;  1SXJ D;  3T16 A;  3HOX B;  4XTC S;  2JEA I;  3EJI A;  3UGJ A;  3R8F A;  4ZRZ A;  5ITU A;  4O1N A;  4AG6 A;  3FEW X;  4KY7 A;  1EYA A;  4K0K M;  3BVM A;  4FF3 A;  1PLF A;  1EYD A;  4AG5 A;  2MGS A;  4IN3 A;  3FUV A;  3Q22 A;  3A42 A;  4K6D A;  3MZ5 A;  2BNK A;  4DV4 M;  1SSO A;  3S16 B;  2CV0 A;  2K05 A;  1I4P A;  3S2H B;  2XZU A;  4L4U A;  5C0X G;  4YY3 M;  3SK4 A;  1BCP C;  1Y8P B;  4J6H A;  3ZH9 B;  2VQF M;  4KHZ A;  3EQL C;  2B2W C;  2HHH M;  4KY5 A;  2XNA C;  4OL7 A;  1H9J A;  2ZXO A;  3SXH A;  3ND8 A;  4KKS A;  1ENF A;  3ZYY X;  1QAN A;  3GO5 A;  4OO1 I;  3FYD A;  5D14 A;  4XQQ A;  1R2Z A;  1C1K A;  4KKU A;  1RTN A;  5FK9 C;  4NMZ A;  3DUZ A;  5BR8 M;  1YNN C;  3CU7 A;  5CV4 A;  5EXX A;  2C5R A;  3QOL A;  2CEA A;  4DV0 M;  5C18 A;  2ICI A;  2BA0 A;  2RBM A;  3AMU A;  5I2Y A;  5KNB A;  4JYA M;  3KLS X;  5KYI A;  4PMC A;  3B9P A;  2LWX A;  2B2T C;  4C1N K;  1H9R A;  3WHK A;  4LJ6 A;  4LJ4 A;  1T3T A;  1C8C A;  3TZD A;  5FSW A;  1G59 A;  5TSS A;  2SDF A;  3AFH A;  1K8M A;  1E2V A;  4MH0 E;  3VR6 A;  2TSS A;  1G2T A;  1PRT B;  5KQ8 A;  1XHB A;  3T4A C;  4LF7 M;  1GKI A;  3V2T A;  4LFA M;  3G6J B;  5K36 H;  2UXC M;  2EO2 A;  2L7I A;  2J4X A;  4G4K A;  1RHP A;  4JK1 C;  4IUN A;  2IX3 A;  1R9T B;  2F0P A;  3GTP B;  4CBV A;  1Z6H A;  4OHJ A;  3KUP A;  2MHV A;  1GVN A;  5IT9 S;  1F9R A;  1TWG B;  3BVG A;  2ENB A;  3MHB A;  1IN8 A;  1B9N A;  3QG1 A;  3FTE A;  3J7A S;  4LRS A;  4EIW A;  4TUW A;  3HOZ B;  5DEH A;  2DXI A;  2JXM B;  1SNC A;  4GHL A;  1GHJ A;  4ZLT F;  1R2Y A;  1J7K A;  1EFI D;  1HPC A;  1PRT D;  3S9W A;  3QO2 A;  3HG9 A;  4L16 A;  1I3Q B;  3IFD A;  2F0H A;  1TS4 A;  1JR0 D;  3D8L A;  1XNQ M;  4RGO S;  5DYI A;  4GMQ A;  3TWK A;  5ELD A;  1PFN A;  4B9W A;  5BN5 A;  5ITX A;  4BWG B;  4I5S A;  1HA5 A;  1F2L A;  4GRI A;  1HTL D;  2RQX A;  1VF7 A;  4PMW A;  4HCS A;  2IWH A;  2R3Z A;  4FXK C;  4Q0F A;  3KLS A;  2Y0Q A;  4LF9 M;  2C9C A;  5JAV A;  3GPP A;  1K82 A;  1S5C D;  1Z5B A;  3SFZ A;  1BCP F;  2KJX A;  4FW9 A;  2EYO A;  4BBS B;  2XGN A;  1ZXT A;  2Z4H A;  5KND A;  4GC5 A;  2UU9 M;  5I4D A;  1S4Z A;  4LZJ A;  4IUQ A;  3H6M A;  3NXW A;  2V4D A;  4JI6 M;  3ONA B;  1LT4 D;  3TL4 X;  3AKZ A;  4DV7 M;  1Z59 A;  3C46 A;  1H9S B;  2X8A A;  1SE3 A;  3AU7 A;  3JAM E;  2IJ0 A;  5COR A;  2SOB A;  3T1H M;  1G4A E;  1D1I A;  4KV6 A;  2Z4I A;  4RA8 A;  1O80 A;  1DO2 A;  4FXG C;  2ZAO A;  2DY8 A;  2OEO A;  3H94 A;  1QQW A;  3HZX A;  2KA6 B;  4LGY A;  4Z8X A;  2A68 D;  5FLX L;  3J81 L;  1XTC D;  3AB9 A;  4MGY E;  4OX9 M;  3HU3 A;  4V19 0;  2IW3 A;  4M0W A;  2LNH C;  3KP1 E;  1FNN A;  2XRQ D;  5EGT A;  4DU9 A;  4OIK A;  2JA2 A;  3A98 B;  3VYU A;  5CR3 A;  5IGB A;  2HUG A;  1JR3 D;  3LX0 A;  2JYO A;  3QWN A;  4CGY B;  4HL4 A;  1WTV A;  3NK9 A;  4WFN 3;  1BF4 A;  2AWO A;  2RGO A;  3GP7 A;  1E2Z A;  3Q6S A;  2QPA A;  1U4M A;  2Q8T A;  2X6G A;  2SEB D;  1SYF A;  4RF1 A;  2OT2 A;  3GRY A;  2KHS A;  1AZQ A;  1B4O A;  3VLF B;  3N52 A;  4A3G B;  1IBL M;  5CC4 A;  3R2I A;  3U6Q A;  2NVQ B;  4KTA A;  2B2V A;  1Q12 A;  2I7P A;  3J81 E;  4OO1 H;  3HWS A;  4ZPX A;  1NUC A;  2D5D A;  3HKP A;  4DUY M;  3ERO A;  3FDT A;  3PMF A;  3HHZ A;  1Q90 A;  1TU2 B;  5EQT A;  3NE5 B;  5JEA J;  1CA5 A;  1TH3 A;  4IBB A;  4DXG A;  2J7Z A;  2BDN A;  3I4N B;  1G3I A;  1BNZ A;  1KDC A;  1OXV A;  2QP9 X;  3PNY A;  5I2X A;  2Z3X A;  3JAM S;  4IFD J;  2DVW B;  2B8F A;  1AW7 A;  1AP0 A;  2YQZ A;  2BJW A;  1QAM A;  2DWL A;  5IGE A;  3VK8 A;  5IIF A;  4C3H B;  2QBY A;  3D4W A;  5EPL A;  3L26 A;  2V6Z M;  3NTH A;  3AJI B;  4A3V B;  4IFD I;  3MK6 A;  4NDX A;  3T13 A;  3RMH A;  3UK6 A;  5FO7 B;  2KUM A;  3V96 A;  4LCB A;  1EWC A;  1DXM A;  2A6H C;  4DK0 A;  3ILK A;  3KOW E;  3KSX A;  5KO3 A;  3A56 A;  2MP1 A;  3KOY E;  1JWM D;  2OPF A;  1I6H B;  1LT5 D;  5KPR A;  1ET9 A;  3Q0A A;  4N9P A;  4C3I G;  3Q8X A;  1WTW A;  2BA1 A;  1CFM A;  2DNE A;  1Y8N B;  2Q2E B;  1UM8 A;  5JOB A;  1DCZ A;  2ICE C;  4M8A A;  4IBD A;  2NUC A;  1ENA A;  4XIG S;  4C2M B;  4FO2 A;  1WTR A;  2G8L A;  3FUW A;  3SMS A;  3TN2 A;  5JJZ A;  2F5O A;  1STB A;  1F2M A;  3K59 A;  2M5Z A;  2QCP X;  3CRK C;  3DWQ A;  3TDQ A;  5EXS A;  4M9S A;  3SAS A;  4RH6 A;  4DUZ M;  3H91 A;  3U6L A;  2JA7 B;  2L4N A;  2AQ2 B;  4TKO B;  1AZP A;  2YFQ A;  5EPJ A;  1LT3 D;  3VDP A;  1X32 A;  3GRV A;  4X66 M;  4NRW A;  2FJ2 A;  1TR5 A;  1ICW A;  4LF4 M;  4IJF A;  3T15 A;  3GTM B;  2VXW A;  3S1M B;  5JI2 E;  1HNX M;  4KO8 A;  1EY0 A;  2OXP A;  1LV9 A;  3FUU A;  3L27 A;  5EJW A;  5DM7 3;  5JPM C;  3VR5 A;  5I6Y A;  2PPB C;  2B63 B;  4LFC M;  2KXE A;  3N6R A;  3E4R A;  3SAU A;  5K5P A;  4X64 M;  1QB5 D;  1TWC B;  3M3Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...