3NBIA

Crystal structure of human rmi1 n-terminus
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
203
structure length
193
Chain Sequence
b'NVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAYSQIQKLRGKAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RecQ-mediated genome instability protein 1
publication title Crystal Structures of RMI1 and RMI2, Two OB-Fold Regulatory Subunits of the BLM Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 44
structure length 193
sequence length 203
ec nomenclature
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08585 RMI1_N RecQ mediated genome instability protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1020 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3nbiA01
2.40.50.770 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3nbiA02
4CGYB 4CHTB 3NBIA
chains in the Genus database with same CATH superfamily
4A3IB 2PW7A 4JI8Q 4IBKA 3C46A 1Q1BA 2EJFC 2QHOB 3M85A 4B3RM 3K5NA 1D1KA 1EOVA 1O80A 2Q2HA 4IPHA 3NK9A 4DV1Q 1TR5A 5IY0A 4ANRA 1G51A 2ZXPA 2KRKA 4A3IG 1XNQQ 1HHVA 1PYBA 4JG2A 1I6VC 1YE9A 2I7NA 1UEBA 4GLVB 1K28A 3K1JA 2O4XA 4HN7A 2CQAA 4ZUIA 2FMMA 4H0LC 5H37D 1HA6A 2K50A 2F0PA 5C3EH 2M9VA 1VDDA 4I5SA 3RD4A 1GUOA 4GH9A 3CMEA 4B3MQ 4L6TB 5FTMA 1FL0A 4CDEC 1XMQQ 3S14H 3EROA 4L16A 3K81C 3HOXB 4GS3A 1DYQA 2VXWA 3T4AC 1TH3A 3AOGA 1TKWB 4C3HB 3CF2A 1PYSB 3MXNA 5BPVA 1QG7A 1VQAA 2B3GA 4ZKBB 1YNJD 4K6DA 2WZJA 1E3PA 5T1GA 1HZBA 2JA9A 4S3SA 1TVXA 2WSEF 3MVVA 5IGDA 3HOXG 1HR0W 3GTMB 3S1NB 3S16H 1YHBA 4C3HG 3ZQJA 1L2CA 4JOIC 2UXCM 3QIAA 4FYDA 2RDFA 1HNZQ 3RLFA 2EYMA 1K8OA 1SXJC 3VK8A 3F2CA 1QDRA 2VZAA 2DNAA 3U58A 2B2VC 1NJIC 5IWAL 3HZJA 3GP1A 1EU4A 4N8X1 3VKGA 4JI8L 4LF7L 1OJLA 3SBJA 1PVOA 4EX5A 1XXHA 1P3QQ 2RDGA 3O13A 1K8MA 1YUBA 4A3KH 4DV1L 4V190 4L15A 3J81L 2KHJA 4HTHA 1HQCA 3KJOA 4RF0A 4JI7M 3BS1A 1XNQL 5C3EB 3M6AA 5JI2E 3DMUA 4JBJA 2KNZA 5H1SE 4M9SA 3CAMA 2O2LD 3GTLH 5EJWA 2YFQA 3LQQA 4NW2A 2E5LM 3ILKA 3KVWA 1IN8A 4K5VA 4JI6L 2EDGA 4DR1M 2FS1A 4CKEA 4DR3L 3R3OA 4IBBA 4A3GH 3E46A 4X65M 3SAVA 5C3EG 4NOOB 3F2UA 2KCMA 4KV6A 3MAQA 2VB3X 4JW0A 3OOCA 1MX0A 2EYJA 2E75C 4LUZA 3VR6A 2O01F 3G7LA 4KKUA 3S16B 2OEOA 2JY6B 2KBNA 2OPFA 1CK1A 2XRQD 5DM73 1TWGH 4IBEA 3RLOA 5C4JH 3ZC7B 1II3A 1OAIA 3HX3A 3M4YA 3TZUA 1UFZA 3I4VA 1QUTA 2UUCM 1SNMA 4DKAC 4DV0L 1MSGA 4HSPA 5KRUA 1HNZL 1CZWA 1QAOA 3PIO3 5EGTA 2I0QA 3FRHA 4GHAA 4GOPC 4NMZA 1NV8A 1SROA 1SNQA 2YTYA 2R62A 4DV6Q 1NV9A 1EL0A 5EQ0A 5C5MA 1TS4A 2DZNB 1KHIA 1X3QA 2B2YC 2QF7A 2JE6I 4DR5M 4BA2I 1SYFA 3GTQB 1PFBA 1I4HA 2AQ3B 3NBXX 1K82A 1F2LA 3GQ4A 4LFBM 1LO5D 1EFWA 3FP9A 2L2DA 2DNCA 3I2ZA 2E2IH 3MFYA 3CGWA 2EZVA 2KENA 2L12A 1X37A 4IIWA 4YY3L 3GTLB 2K32A 4JI5Q 4B3TM 1GJXA 2K9DA 3L27A 1PH7A 1OXTA 3CF5A 3I4NH 1EY9A 3E9SA 4A3GB 2E8GA 1XC8A 1QZGA 3FHWA 3RLNA 5CMDA 2J7NA 4IBIA 1HZ9A 1EQTA 4MGYE 1F4IA 2RCFA 3GQBA 2C98A 1JCKB 2K5WA 1QWYA 1OXXK 1V8QA 1YHQA 2R65A 4A93H 5A2QS 1WVLA 2L15A 1EZ6A 3SARA 5IT9S 5C4XH 2MHVA 3U6DA 3BYYB 1TWGB 2QDBA 2EOTA 3E9HA 5C4JB 4K8IA 4OWWB 4A3GG 5ISRA 1NSNS 3EIEA 1E9SA 2V1CC 4WJWA 1I6HH 1A8VA 4A4IA 1IXZA 2JSOA 1A3TA 1VQLA 2F4VQ 1GJSA 1IXSA 5C6AA 5GADC 1JJCB 2XGNA 1H9KA 3TPZA 1E0BA 2EVBA 4CJ0B 2K75A 3C2PA 3KBGA 4DV6L 2JUJA 3S2DH 5DEHA 1TWFB 1RODA 1IY1A 2E2IB 3VYTA 1I4XA 2PI2A 2PW5A 3NELA 3D4RA 4HIKA 2F0MA 2X4AA 4KMUC 4WURA 1N8RC 3KLWA 2I07B 3I4NB 2BH8A 4RGNA 4JI5L 1VDZA 3GLHB 5FO8B 2K47A 1HNXQ 2N49A 1CHPD 4GN3B 4BS9A 4LJZC 4JI4Q 5E1FA 3HJ8A 3OTOQ 1K8GA 4GZYC 1TQOA 2K1BA 2A1AA 3NP8A 4POFA 2JA6H 3BVGA 3WOEA 2OTJA 4L5SA 3J81j 4PZ8A 5JEAH 4A93B 3EBEA 3K7UC 4KD3A 3W0FA 1IBMQ 3I4NG 5C4XB 3NWLA 2LVPC 5DYGA 2LKVA 1WTPA 3B89A 2LHGA 1KLUD 1Z5AA 1WI5A 4DAYB 1VQ8A 3NEMA 5M3FH 1I6HB 2D5DA 1JOKA 3R8BA 4X66M 2EPBA 3RZOH 1V43A 5G3LD 1I94M 4RGMA 4A93G 3W2DA 1DO2A 2IW3A 5C4XG 3S1RB 3SK5A 2NQ8C 3PUZA 2LVNC 2RKOA 1G6ZA 3W0LB 3MXUA 2EJSA 2F4VL 3U6QA 3S2DB 3H94A 2HAKA 3X3NA 2FXQA 3FE3A 1SYCA 4GC9A 1E32A 1E9RA 1WR1B 4QNRA 5DNYA 3U6PA 3J7AS 4F87A 5IGFA 7CATA 1ZV1A 4CJ6A 1WGLA 1WJ7A 4GKJL 3X3MA 4QJFA 3Q23A 1EUJA 3J80c 1HQYE 3FD9A 4AQYQ 5E26A 2K7VA 1EEFD 3ZYYX 2A8VA 4JYAM 3JAME 1V33A 1D2NA 3KP1E 1FGBD 1HPCA 1BNZA 4JK1C 2JA6B 3GO5A 2B63B 1HNXL 1SLJA 3CCLA 5JJLA 2ZJQA 4HEOA 2HQEA 3OTOL 1LTLA 4KLKA 2N35A 1VQIA 1VQGA 4MM3B 1TXYA 3V2TA 5AJ3Q 2PPBC 2LXKA 1KNEA 4DNTB 3J80L 2C9CA 2NZ1D 1RU3A 1R4GA 5M3FB 1IBML 3AYHB 3I73A 2JA6G 2B63G 1NTGA 3RZOB 1JR3E 3FUXA 4O1NA 4XYOA 5JEAG 1RDPD 3T15A 4FF1A 3H3VC 2XSZD 1VQ9A 3MXPA 1IN4A 1KTKA 4IUUA 3TN2A 4HJAA 1NHGC 1LTBD 5M3FG 1G59A 4F7XA 4CKBA 4CGYB 2CV0A 1OXVA 2DAGA 1YLAA 4X64M 2FHTA 3BZKA 4JBKA 2R3ZA 4O42A 4C3IB 2BWBA 1GKIA 1AFPA 1SRUA 3LVVA 3U50C 4DU9A 4LG2A 2IPKD 4XIGS 2N3SA 1PTOD 5I9OA 1S5BD 1PRTF 2DJFC 2PZTA 4HMIA 4PMCA 3HP3A 3PF4A 2P5TA 4L5QA 1XNRQ 1X3FA 2CH4W 2JEBI 4TKOB 4AQYL 1JORA 4C3IG 2D2CC 2F0GA 5DLQE 1D6EC 4EVOA 1OTRA 4BBAA 4FF3A 2Y21A 1KDCA 4GKKM 1O7LA 2A6ED 3BYTB 3K6OA 2ZM6M 5ITXA 1IBKL 5E4WC 2JJQA 2BE5C 1KD1C 1LLRD 1P16A 3EA6A 5IP7H 4I7ZC 5AJ3L 3S1MH 1TWHH 2Q2UA 2Z4HA 3J2PB 3GPPA 2HCCA 2VQEM 4X62Q 1PDQA 1ILPA 4YWKA 1IN5A 2A19A 3P75A 4F88A 2LSSA 1Z47A 3GLIB 2XIWA 1E24A 2JA2A 5CORA 4OWXB 1Y1WH 4B3SQ 3DEOA 1K3RA 1L0YB 3SDZA 3U4ZA 4DR6Q 4XBOA 2K5VA 4DV4Q 4A3EH 2L4FA 4B7GA 2Z6KA 2B8FA 2UXBL 2IL8A 4NXNM 4DR2Q 4C3JH 4NRVA 2M5ZA 1Q8IA 4QF4A 2IX1A 3STBD 2WAQE 2XVSA 3RGPA 1AN8A 3T1HM 3L3OC 2L55A 3NBHB 1QZHA 3FTFA 3I4YA 1X65A 1IL2A 3D4WA 4KHPL 3HU3A 1HQRD 1CKNA 2PNRC 3F8TA 3GLIE 3PUXA 3KSXA 3I3CA 2OF1A 2GNOA 4I81A 4U68A 2VL6A 1ZYRD 1GUSA 2B3TA 4FP5D 5A35A 5IGCA 1WTHA 3OWFA 1XNRL 4B9WA 3RFWA 1CI3M 2F0NA 1YNJC 4X3SA 1O7IA 2BH2A 4JI2M 3AU7A 2CVRA 1SFOH 3UZUA 1LTTD 4IURA 4JCVE 5J39A 2CFOA 3H4JA 1VCIA 1H9SB 2DAKA 4AIMA 3GTOH 3S1MB 3DA1A 1TWHB 1MKHA 4LUOA 4A3FH 1R9TH 3NWTA 1U0LA 4DXFA 1B50A 2CUZA 4LF6M 1LYLA 2J7OA 2MFIA 5I9PA 2ICIA 1QUSA 1PJTA 1Y1WB 3AJIB 2YYZA 3TSSA 3VFDA 4M9XA 3MHBA 5GAEC 4A3EB 5IP7G 4HSVA 2MR9A 1PRTB 3CCMA 2E76C 4ULLA 3NWSA 2E2DC 4DUZQ 3KF8A 4DR6L 4AYBB 2AQ2B 4DV4L 1VF5C 2KQ3A 4G7OC 2UUAQ 4W5WA 2DN8A 4EGVA 1IY2A 2EKFA 1N36M 1CZGA 2ASBA 1Y1WG 2K5NA 2YQZA 1XMOQ 4DR2L 1LTGD 4A3EG 2NYZD 5GKNA 1HT2E 3Q0AA 1BF4A 4LJ4A 5HGTA 3Q8GA 2FH0A 1B9MA 1TH4A 1R4QB 3PQIA 4XQNA 4KJOA 1PGYA 4AYBG 4CBVA 4JI1Q 1I3QH 2XSCA 3D4DA 1PJSA 3TBIB 3IAYA 4NXMM 1SNPA 1M1KC 2XWJB 1C9OA 4GLAC 3IHPA 1EQRA 3PUYA 1HFGA 2BCOA 2R4EA 4L8JA 3H91A 2F5QA 1ZMWA 4IJFA 4RNAA 3K57A 2JNHA 2IT1A 3KYHC 1MJCA 3DEPA 3GTOB 5CV5A 4DXGA 4R4QA 2VF8A 4A3FB 2F0JA 1IBLQ 1R9TB 3HOWH 5IE8A 3TEHB 5HURA 2F0EA 4DUYM 1VQKA 2LS01 2KCCA 5I2XA 3CCRA 2OOAA 2ALYB 4JOIA 5K36H 4OONA 4FCTA 4DV5L 2SNSA 3DFZA 1JOOA 1TF0B 1SXJA 1H9JA 3J7A5 5M5WH 2FE8A 2I7PA 2GA4B 5IZ7D 2UUBM 3PV0A 3T51B 4GRIA 4A3FG 2B2VA 3HU1A 2Z3XA 4MHEA 1A5TA 1D2BA 4QHTA 2KEDA 4IBCA 1RHPA 4G4NA 2HUGA 3E6ZX 2SOBA 3W3AA 4DUZL 2Z7JA 5EXXA 3MXNB 3CF6E 4Z9CB 3SHLA 1NNJA 2UUAL 1A62A 3T1YQ 1F2ZA 3TL4X 4HIDA 2JEAI 2JY8A 2BDNA 2NWGA 1I4QA 2TSSA 1XMOL 4UDUC 2KHHA 4LMQD 4JBWA 3I01M 1I3QB 3A7LA 1SEBD 4M8AA 4FF4A 3AV0A 1TGUA 1SG9A 2KA7A 1UEAB 1IM2A 4H13C 2K52A 2OXPA 3NTKA 4YCVA 4DNIA 4JI1L 5JEAJ 1B9NA 2WKCA 3CRKC 3TWLA 3TP7A 2PMZB 3EJIA 3I56A 3I91A 3TP6A 3QJYA 1V1OA 2E2HH 1CA5A 4Y28F 2OTLA 3AKZA 3HOVH 2K4KA 3HOWB 4GC5A 3K7AH 1XXHB 3R9XB 2R7ZH 1HCZA 5C0XH 3UGJA 3HZXA 1NUCA 4TSSA 4KK7A 5KGUA 3L29A 3ZH9B 1VQ1A 1G291 3M4PA 3MC0B 1K3WA 3VR3A 1W3SA 3RNUA 3ULLA 4IFDH 3P1HA 5M5WB 4DK3C 1JB7A 2W82A 2KDLA 3SAWA 3HOWG 3OMCA 3A0JA 4FD2A 3UJNA 3CQZH 2R61A 1J7KA 3S9WA 3KOJA 1J5EQ 4GOPA 3D8GA 2KHSA 2PMZE 4L63B 4IUPA 2XZFA 3QG1A 5K36G 3V76A 2VY3A 2B2YA 4H7BA 5C0XI 1MD2D 5GAHC 2AHOB 2LWXA 2WKDA 5FKAC 1HR0Q 1KDBA 1XXHE 1BQQT 4IFDI 4RKBA 3T1YL 3E5SA 3GV6A 1E22A 2I5MX 2VB2X 2ATWA 4KN4C 3K8ZA 4B3RQ 2ZANA 4LY6A 3CD6A 4YWLA 5LL6X 2O5IC 2BJWA 2RA4A 1SMXA 1GABA 2HCBA 5A2QE 4LWCA 2RDHA 3KK7A 2NTTA 1YITA 1R5LA 1KL9A 1ICWA 5IT9E 2OT2A 4XT1B 2EJGC 1M90C 4ZYSA 1S5CD 2E2HB 3KF6B 1BBUA 2EYFA 1EY5A 1LTAD 1UM8A 5KNBA 5EAYA 3HOVB 1QJOA 3IRBA 4I4LA 3K7AB 3QOLA 3WDNA 4KKTA 2R7ZB 3HHZA 2WIIB 2K5QA 4PNYA 4B9XA 1ML0D 3L7ZC 4FDBA 4WFN3 1ASYA 1NY6A 1F2YA 4UP9A 2SEBD 5FLXc 3U61A 3AMUA 2V1CA 3K0YA 3HOVG 3J80i 1KC8C 4PMWA 2R7ZG 5C0XG 4UP8A 3L9AX 1TDHA 4R4TA 4N8FA 5DAUA 2F5PA 2RRUA 3HGIA 1N33M 3CMAA 4IFDG 1LV9A 1J5EL 3ERSX 4DV2M 4ZLTF 1LV7A 1VQBA 4HL4A 1G6PA 3BBZA 4J8QA 2DZLA 1BCPD 2UU9M 3IFDA 3FTCA 2UXCQ 3NQTA 5FTJA 3RMHA 3B7NA 2F3VA 3TMEA 3SVMA 2G5GX 5FLXL 1D0LA 1HR0L 3A56A 5EP3A 3NE5B 4C1NI 1B53A 3A54A 1OFIA 1KXLA 2DXIA 1LTID 1PH9A 1K9MC 5IWAQ 3D3RA 1SNDA 4B3RL 4DK6C 2ZTEA 4LF7Q 3OYYA 2X6GA 4JI3M 2NVQH 4LJ5A 1MHWC 3WOFA 4DAVA 1AEXA 2OOBA 3WWVA 3LCUA 4BBRH 3G71A 2VDBB 3J7AV 4QUCA 2M00A 3PIOA 1IXSB 3T38A 4JI7Q 2V1UA 1NVMA 1LABA 5IYCH 1W6KA 3U6SA 1M8AA 4DR4M 1EIGA 2JP7A 2BNKA 2L0CA 3UK6A 4RF1A 2E5LQ 4IN3A 1QAMA 4M0WA 4P75A 4DR1Q 1NJGA 1H9RA 3IKJA 1B1ZA 4X6AH 1S4ZA 4JI6Q 4X65Q 4DR3Q 2R46A 4ODGA 1CUKA 1N34M 1A0IA 3MK6A 4LF4M 5KIXA 3H15A 1HTLD 5ITUA 1EU3A 4QMGA 4YCWA 4RKLA 5IGGA 1W5SA 3HEJA 1BOSA 2FFKB 4ME5A 4GN4B 4A3DH 3I4OA 2F0SA 4Y52H 1PTOC 1AH9A 4PD2A 1BR9A 2K6AA 2JA8H 1WD0A 2UUCQ 1PFSA 2UXCL 1TWCH 5CGKA 4MGKE 2KXEA 3SE0A 3VR5A 4DV0Q 2HT1A 1MBYA 1QNUA 2PI2E 1W5TA 4XXEA 4K5XA 5JPMC 1V34A 3JAMc 4JV5M 1EFID 4JPBW 4IOCA 3UMMA 2NVQB 1XYIA 4DR5Q 4XQQA 3ONAB 1TY2A 3FUUA 4BBRB 2J7ZA 3W1BA 4LFBQ 4HAEA 4JC0A 2A6EC 1F9RA 1JWSD 3IECA 2N55A 3Q8DA 2CWBA 5JOBA 4F8MA 3DHQA 1ZKOA 3MTSA 1IZ6A 4BY7H 4QCLA 4JI7L 4YY3Q 3GTKH 4CISA 4BBRG 1DJRD 1I4RA 4LZJA 1U4MA 3KOYE 3FYDA 2RGHA 3HGBA 2F0HA 2E5LL 5IYCG 3S14B 1UE5A 2Z9HA 4DR1L 2EIFA 5BR8M 4U673 3J80S 1WOCA 4X65L 1VQEA 1C0AA 2EY5A 3EN2A 3E3XA 2LNHC 5KEEA 4H44C 2NVXH 3UE0A 4A3DB 4R71A 2RKSA 3KBXA 4KT0F 3STBC 2JA8B 5C5LA 4LFAM 1TWCB 3HFZB 2EYLA 2IHFA 4GNXA 1XNQM 1TU2B 1CFMA 2F3WA 1HRJA 3HHXA 2UUCL 1T5XD 1FD7D 4A3DG 4QB4A 1AE3A 4PT5A 1ZYRC 3CCUA 5ELEA 4APVA 3KOXE 4B3MM 3T53B 1GL6A 2JA8G 1NHWC 1XMQM 1EIJA 1KRTA 1VMPA 4HCSA 3K9OA 1SR3A 4QGUA 3HOUH 4DR5L 3KUPA 4A3KB 1VQPA 2VIIA 1HFNA 3SXHA 3SK8A 1SYGA 3EQLC 1E1OA 4LFBL 1S40A 2NZHA 2FFJA 4BY7B 3GPYA 3OW7A 3SC3A 1S3OA 3E21A 1OQYA 2PO4A 3MXGA 3BDLA 4A3KG 2QP9X 3FUVA 4WW0A 2XWBB 1A6XA 3AOEC 3C1EA 4BY7G 3KLSA 4NL4H 5IODA 2WSCF 1DOMA 2A68D 1K3BC 3VYRA 1EYAA 3VDUA 1A2UA 2YV5A 1TDZA 2DWNA 1TS3A 5EKKA 1E2WA 1W6JA 2F0DA 1STNA 4I65A 2VUMH 4LF9Q 2YU9H 4QQBX 4X66Q 2AMCB 2D62A 4IQZA 2JY5A 4A3LH 2K03A 1SE3A 2JA7H 1JMCA 3RGSA 5L8RF 3AQQA 4P17A 1CKMA 3Q22A 1WHCA 3LMMA 3ITPA 2Y0SB 1VEKA 4AKGA 4X3UA 2G8LA 5CR3A 2Q8TA 3L25A 1OIPA 2VNUD 1HT1E 4IJHA 5CV4A 3HOUB 1FNWA 3OIPA 3GRUA 3WHLA 3KJPA 1VQ7A 1YNND 2LH0A 5C0XJ 2QCUA 4N9PA 5BN4A 1Q12A 2Y0SG 2EY2A 1GKHA 2DWLA 3CF0A 1SYBA 4GKJQ 2K28A 2VW9A 5ELCA 1GD7A 1EY6A 3I8ZA 2Q8IB 3TS2A 3HOUG 4M1UB 4JYAQ 5ITXE 1IL8A 3PUVA 1U4PA 2L7IA 4B7HA 2Y0SE 1CTMA 1Z9FA 3HKPA 1WTQA 4DF7A 2XEPA 1FGUA 2XFTA 5FK9C 2RHSB 3RN2A 1F9PA 2LHCA 1CKNB 2KZUA 1QILA 2I5LX 5TSSA 2ZTCA 2N78A 2VUMB 1MI2A 2YU9B 2KVMA 2AWOA 5LMUM 4YWMA 1K3XA 1IY0A 2JA7B 5FJ8H 2G3QA 3GRRA 1STBA 4DV7M 3F2BA 4LF9L 1GUNA 4X66L 1LT6D 3GPXA 4O2DA 2NTSA 1I94L 3E9IA 4IBJA 5D3DA 2V6ZM 5NUCA 2VUMG 3MEHA 5ELDA 1UE1A 3GLHE 4X64Q 1FYCA 2JA7G 1JQJC 3SR1A 3VDPA 2WACA 3RZDH 2JWSA 4LF8M 2JQOA 3OW2A 2O25A 1G8ZD 4OX9M 3CPFA 1YIJA 3ZCBB 1WFQA 3SK6A 5ELNA 3TWKA 4RKUF 3KF8B 4IZ8A 4MNOA 4BA1I 1UE6A 1M4VA 3KP0E 1DGGA 4IBDA 3HHYA 4WP2A 2K14A 4P73A 4ALPA 4HEDA 2UXDM 1QYRA 5LMNM 4UAIA 1Q81C 1PH1A 2EXZA 4HR7B 4JYAL 1NE3A 1B3QA 4GLXA 2ZXRA 3D6CA 2DGYA 1CKOA 3KLRA 4GKKQ 1VQMA 2MO1A 1EIYB 4LF5M 1YJNA 2ZM6Q 5F2DA 1IBKQ 5CBAE 2KNAA 2WSFF 1G2TA 2Q2IA 1L1OC 4KY6A 3CP0A 1R2ZA 4R4CA 2B8GA 2DAMA 2VQEQ 3Q8XA 1R4PB 5I6YA 1HQMC 1DOKA 3J81E 1Z5CA 4ZK9B 2QNJA 3GD7A 2FOIC 5KPTA 2RCNA 1G4AE 4RG1A 2MNAA 1Q90A 3KDFA 5FJ8G 2K04A 3CKIB 3GDEA 4HJ5A 2EJMA 2R7FA 4K2KA 3D0FA 1N9WA 3RZDB 1KFVA 2UXBQ 5CBEE 4RWSC 2PQAA 1VG5A 3CC7A 3VA7A 2MGWA 4X64L 4LCBA 1SXJB 3GQ3A 4JI4M 3BU2A 4RAUC 2D7GA 2DAEA 2WV6D 5JJIA 3GTPH 4PCZA 1DGBA 1UNSA 3NPPA 3P20A 4R8IA 2EKKA 1JR3D 2MJ5B 2GN5A 3GP7A 1STAA 4RMFA 5LMNW 1PH4A 4FVMA 4KHPQ 3U4VA 2CP8A 4K5WA 2A5YB 2VQFM 1IQPA 4L6V6 1NBWA 2RBMA 1F77A 5KNDA 1RCVD 1WIVA 4CDDC 4OHJA 4JI2Q 8CATA 1Y1VH 3H09A 1Z5BA 3TP8A 5DNFA 1N77A 1QCBD 5JAVA 1SBBB 5C4ZA 1SXJE 5IIFA 4GKKL 1VQ5A 1GHJA 4LJ6A 1Z6HA 3KLSX 4YIJA 3SAUA 2ZM6L 3M7NA 1BCPC 4HJ9A 5ITRA 1IYVA 1ZXTA 2WFWA 2EO2A 2KNVA 4M0DA 2G9HD 4AKHA 1L2DA 3M4QA 2F03A 1FNNA 1SSOA 4TRDA 2VQEL 3H6MA 3NENA 1V1PA 4QNMA 3QYBA 4J15A 1IYUA 3I51A 2RVLA 1E2ZA 3RR5A 1SNOA 3MHVC 2I5HA 3LGJA 3M7GA 2G9DA 2Z1CA 2G5DA 1N36Q 2DNEA 1G8PA 2C96A 4AG5A 1CQVA 1XJVA 1EY7A 4NXNL 2RGOA 3GTPB 3F92A 3U60A 4ZUJA 3GLGB 4GOPB 1XTDA 2NBFA 2KJXA 1BKBA 2F0UA 3T1HL 3GRVA 3N52A 1XPOA 1FNVA 3KSJA 1JWMD 1EWHA 2F52A 3K5OA 5ELOA 3NHHA 1DCZA 1Y1VB 5HY6A 2DKLA 1JB0F 2ICEC 2YTXA 2IWHA 4NKLA 4KTAA 3L0OA 5DYIA 2QKIC 1WTOA 2EY6A 3I4LA 3JAMi 4FXGC 1Q02A 4JI2L 4REZA 4ITQA 1C4QA 1A15A 3U6CA 4DBGB 3GLGE 3TE6A 3DM1A 1Y1VG 3LWEA 3MZ5A 1HUMA 1JJGA 1VQNA 1WJJA 1LT5D 3J7BA 1DO0A 3KW6A 2L4NA 3T56B 3CC4A 4G4OA 4DV5Q 2UUBQ 1O7YA 2N88A 2QILA 2QZ4A 1GVNA 2R93H 1V9PA 1PYWD 3BXWA 1EQVA 4KI0A 5JJZA 1TS5A 1JB3A 2K5DA 1K83H 4CDFC 1QNKA 3U61B 3NQIA 1YI2A 4DA2A 5FLXS 4OO1H 4LRTA 3KFUA 2KCTA 1AIPC 2KCNA 1N36L 5C44H 4C3JB 1GHKA 1EFUB 1C7YA 1SAPA 2F0TA 1ILQA 3QOJA 1ZAEA 1UUPA 5CC4A 4K0KM 3IG5A 4ZQ3A 3TRZA 4R4IA 3HKZB 2EA0A 5EPLA 3CU7A 2XSZA 1S5FD 4C3JG 2D0OA 5C18A 4MGIE 2DENA 3RE8A 1STEA 4NXML 5FSWA 3PO2H 4OO1I 4KY7A 4X62M 3E0JA 4AKIA 4B3SM 2KECA 4QL5A 1K0RA 1DV0A 2F4IA 1PZKD 3A7AB 4ME3A 3HKZG 2PNHA 5IP9H 1SFOB 2Q8RE 4AYBE 5LL6S 1U4RA 4L5TA 2R6GA 5C3XA 1E1TA 2XF3A 1MU5A 4D82A 2MH8A 1MN3A 4NRWA 4DUYL 2CRUA 2J5YA 4RFBA 1Q46A 4LNQA 5FO9B 1IXRC 4Q5VA 2B2TC 2Z4IA 3HKZE 1PRTD 1GVPA 2R93B 1SXTA 3C3DA 2RQXA 2HWJA 4XT3B 4LZZA 1K83B 2NB0A 3LWUA 2UUBL 3VKHA 4TVAB 3U6EA 2Z4SA 1PJJA 1VEGA 2QEXA 5C44B 2Q2TA 4BY1H 2DUDA 3H3VH 4I7AA 2QQ8A 3D8BA 1N32M 1TS2A 2R93G 2NUCA 3GLFA 1RL2A 3BVMA 3QB3A 4FWHA 2MROB 3DOAA 2H5XA 4LJAA 3SASA 1BCPF 1Q3LA 3HHWA 4IUNA 1HXYD 3J7YW 2HD3A 2L4EA 4OO1G 1SYEA 2JYOA 3FTEA 1LTMA 3B6YA 3NSWA 3J80E 5KPRA 4PDIA 1WYDA 2FINB 3P7JA 5ELFA 4C56C 5L37A 4QIWB 5C44G 4DV3M 1TY0A 1XXGA 2B29A 3PO2B 3PNVA 5I2YA 1Y14B 1KDAA 2F5OA 1EYGA 4BXXH 2A68C 5ITTA 2A6HC 3L2AA 1FJGM 3PFIA 2XZUA 1FR3A 1VQFA 3D6WA 1TH2A 3G6JB 1STHA 4UHVA 1GM5A 3A5UA 3H3VI 4PZ6A 2X8AA 3SK4A 3UDGA 1R7RA 1HH2P 1OKSA 5EPJA 1K0SA 3JAMS 4MIUA 2F0LA 1D5MC 4N9TA 3PO2G 4EQOA 3PIP3 4CJ1B 4LRSA 3AL0C 2ZXOA 4JI0M 4EQNA 1U4LA 2X49A 4QOSA 2A5HA 2QBYA 2JY7A 3TDQA 5IP9G 1OXSC 3W1GA 1IN6A 4QIWE 1QZMA 4IUQA 5KYLA 1QVCA 4KHVA 4PMBA 3EFXD 3PSIA 3MMPA 5FTNA 4D81A 2EYOA 2CW0D 5KQ8A 4CHTB 4JI1M 3NUCA 2C9OA 1B70B 4DV2Q 2EXDA 4FWDA 3A46A 1YNNC 2LVAA 4UPAA 1YJWA 2A73B 5I4DA 1HNWM 2UU9Q 1EIHA 2KZSA 1AZPA 3LVWA 2LBCA 3TQYA 1ZQ9A 4PDGA 2HDMA 1T3TA 1CQFA 1Z59A 1IW7D 2D9UA 3ULPA 2YR0A 1YNXA 3OIQA 3U6MA 1QB5D 2FNAA 1IBLM 4QHSA 2ZAOA 3FUTA 2XN9C 3BG3A 2QSFX 4JI3Q 3PVSA 4GNXB 1BBXC 3H0GH 3K0XA 2R45A 1YEZA 1GO5A 1CSQA 4P72A 2XLJA 4LUVA 3AOEA 3DWQA 5J22A 1WCMH 2JZ1A 2H4OA 2KOLA 1QOHA 3U9OA 4Y7NH 4QY7A 4L5RC 1W2BA 3NTHA 4NSOB 1PV4A 4DR4Q 4DR7M 2F0VA 1U9RA 3NBHA 4S12A 1PH6A 2F0FA 4BXXG 1GO3E 4HCEA 2QDLA 5D3IB 4OW0A 1YBYA 3G4SA 4IPDA 4DGZA 4YHHM 2BOSA 3V05A 2DY8A 3C3LA 1B8AA 4EQPA 2RF4A 4LF4Q 1QE6A 4GN5A 2DI0A 3SMSA 5KPZA 3FUWA 1YJ9A 2QCPX 2CKZB 3CQZB 5JVH3 1CT1D 2NZOA 2HHHM 1YZ6A 2Z8LA 4GEWA 3UI2A 1D5ZC 2GQFA 4DV2L 3WHKA 1AUAA 4IPCA 2UU9L 4KN7C 4HJ8A 1LM0A 3HRZC 2CHVA 5GAGC 1G91A 2XFSA 1JICA 3S17H 2E74C 2MO0A 4FF2A 4R9WA 1Q7YC 3LQRA 4FXKC 1PJQA 3H0GB 4RGOS 4WJ4A 1Z7TA 2CH4A 1KQSA 4OIKA 3N6RA 4ZAIA 5IOCA 3RUZA 2IX0A 4G3OA 3GTJH 1EQQA 3W5OA 1WCMB 3GTGH 4JI3L 2JN4A 4Y7NB 2EY1A 4RGTA 4OWTB 4Q0FA 4OU7A 1AW7A 1Y8PB 4FO2A 4A3BH 4MTKA 2ZAMA 2DHYA 1OXUA 5C4HA 2X69A 3T6PA 1DGHA 3H0GG 4LFCM 2L11A 3Q6SA 1QZEA 2QA4A 2JK8A 3ICEA 4DR4L 2D7EA 1WCMG 3HWSA 3DZDA 1YSYA 5D14A 1ET9A 5EBCA 5BR8Q 4KY5A 2RSNA 3CCQA 2XH9A 4K6LA 1KRSA 1FNUA 5F3WA 1Y69U 1N34L 1MJEA 1XHBA 4LF4L 2Y0TA 1VMCA 5BN3A 2ZTDA 2PYKA 4IBGA 1RJTA 1DGSA 4G4RA 3AFQA 2RHQB 3FPPA 3TZDA 4DK1A 3I4MH 2D7HA 4EQ5A 1H9MA 4LFAQ 1PFNA 2XRSD 2KHIA 1BDOA 4G57A 1X3EA 4C1NK 5FOBB 2IJ0A 3LCVB 1NSFA 4LGYA 5KQDA 2VF7A 3S17B 1G41A 5FTKA 2DZOB 4V0BA 3QYEA 1NCVA 3JR5A 1J8IA 1LTRD 3R2IA 2CWPA 1PLFA 3U5ZA 5EPKA 3GTJB 3GTGB 4JV5L 2Q2EB 3U6LA 5D65A 3G48A 4KKSA 1JWUD 2GVAA 4JBMA 3ER0A 2NVYH 3B7ZA 4A3BB 2IHEA 2LMCB 3W67A 1UWVA 1T9HA 3TP5A 1IKLA 1PJIA 3MEFA 4DK0A 1EWCA 3MFGA 3UDIA 2NVTH 2DAIA 1QUQA 2BDOA 4UY8C 4Q7JA 3SGIA 2OWOA 1HJPA 3FVQA 1QVRA 1L1OA 5IREB 1SMYD 4B3TQ 4OVZA 1TWAH 2HDLA 3J81c 1C1KA 4A3BG 3PO3H 1NNUC 2HL7A 1A2TA 3JAML 1CSPA 2AKWB 1XTCD 3HOZH 4M9ZA 5BR8L 2A69D 1OIZA 2Y20A 4LW1A 1L1ZA 4HIOA 1SDFA 3VLFB 3ERQA 3I4MB 5IWAM 4BLCA 4JI8M 1PM5A 4LF7M 3DWAA 2MJ8A 3PCOB 1ASZA 3ND8A 2EQSA 1EYDA 4FWGA 3GTQH 1RF2D 1X32A 4DV1M 4GMQA 4IALA 4LFAL 5EXSA 2PZWA 4L78A 3UE1A 4G4KA 4R8NA 3HOYH 1V92A 3SYKA 2N8NA 3M4OH 3FEWX 3I4MG 3G6EA 2L1BA 3DXJC 1Q39A 1STYA 2K6BA 1MIUA 3FKEA 5G3LF 4ZKCB 2KEEA 1ONLA 4AG6A 2OQ0A 3J7ZC 2JA5H 4QOZC 1Y8NB 3CC2A 4B3ML 2NVYB 1XMQL 4ID6A 4JI6M 5EKLA 4DR3M 4IJEA 1L0XB 1PH2A 3S2HH 2NVTB 4MH0E 3KDFB 1D7QA 1Q8KA 2PQAB 1TWAB 2XTIA 3GTKB 1RKNA 1PHJA 2K05A 4P2CB 2F0IA 3PO3B 3KOWE 4DAPA 1LT3D 2YTVA 4B3TL 3JR4A 1WGNA 3J27B 4BB9A 3KDSE 1ENFA 3IL8A 3HOZB 2APLA 1NNXA 5EXTA 3KF6A 1Y8GA 2EYPA 4DV0M 1HNZM 5M3MH 3SATA 3LNNA 3OPOA 2KEBA 1UE7A 5C3WA 3CCEA 1A3VA 1IHZA 4A75A 2F0OA 4UN2B 2A6HD 3PO3G 3OWEB 5LMUQ 2JZ0A 1ZEQX 4DAMA 3KS4A 1EIFA 1WTXA 2NVXB 3HKSA 5J1ZA 2ES2A 3K92A 4DV7Q 3HOZG 4HLQA 1TWFH 4DFAA 2DWMA 4FCWA 3HOYB 3M4OB 3I70A 1NAPA 1U5KA 1Z6TA 2GVBA 1ESRA 4K2LA 1I94Q 2CQOA 1GUTA 3A8JE 4TUWA 4II7A 4YY3M 4G4QA 1ICFB 1GOZA 1JJ2A 2JA5B 1EOTA 1PRBA 5JVG3 1KNAA 4IBFA 4TQUS 1X3PA 3T13A 5FLMH 5FO7B 5IGBA 2B2WC 4LF8Q 1S72A 3HOYG 4OX9Q 1OAOC 4B08A 1V1PB 2A74C 2LXJA 1EY4A 4XDXA 3S2HB 5M5YH 1X3GA 3AFHA 4LAAA 1AZQA 1J9OA 1I5FA 2WINB 2JA5G 1GJTA 3NXWA 1ENAA 4KLNA 2HCIA 2UXDQ 5LMNQ 1A63A 1XWEA 1X6OA 4IFDJ 3U60B 2QGQA 1PTOF 3PGZA 3A55A 2D0PA 1PRTC 5FLXE 3EIVA 1YVCA 1P8LA 1DOLA 1X54A 4J6HA 5K5PA 1WTRA 4LF5Q 5M3MB 2CV1A 2QENA 1KABA 1STGA 3T16A 3F2DA 3EVQA 3S1RH 2R6FA 1NR2A 4WJ3M 2HIVA 4OIJA 4L4UA 1D8LA 4KO8A 1VQCA 4CIZA 3VK7A 3TS0A 2F0WA 1SYDA 4L8RC 3V96A 2KUMA 4H02A 4DV6M 2WP8J 5LMUL 1PH3A 1D0MA 5M3MG 3TWMA 1CHQD 3HG9A 3I7FA 4DV7L 3M0EA 4XGIA 1VQ6A 2ZT9C 1ZMVA 2B2UC 3K58A 2R4JA 1QVGA 4OEMB 5C1BA 2ZJPA 4POGA 1HZAA 1VS0A 3R93A 2CHBD 2IY5B 4XTCS 2BJVA 4JI5M 4WRDA 1PTOH 1F9SA 4A3LG 5M5YB 1RTNA 4NP5A 2B63H 4LF8L 3QR8A 1KAAA 4OX9L 2QEJC 2L7HA 4MZ9A 3CCVA 3AB9A 3KS8A 1X9NA 4GHLA 5FLMG 4MGHA 2C35B 1C8CA 2ZBKB 3BZDB 1X56A 1PA6A 1VQJA 2VQFQ 2DY7A 1SE2A 2UXDL 5LMNL 4AW4A 4LF9M 1IXRA 1VQOA 1MJGM 1JE5A 2B2TA 1E2VA 2CW0C 4G6ZA 3OSOA 2CWAA 2F5NA 3KFUG 4HJ7A 4LGMA 4NSRA 3MA2B 4LF5L 4R1JA 1GUGA 1PH5A 1PXUA 3VDYA 4XK8F 2L5TA 1VF7A 4DN4M 1MGSA 1DONA 3K5LA 2F4VM 2R18A 4DPGA 3L26A 4F2LA 3Q24A 4JVZA 4IOAA 1IW7C 5JJKA 4C3IH 3FKIH 1RTOA 4NDXA 4O0AA 4CKCA 3VYUA 1LT4D 2BWEA 4IUVA 1B7YB 4GKJM 4UP7A 4PZ7A 3RN5A 1PZJD 3FPUB 2C5CA 1O78A 1UAPA 2JP1A 3GV3A 3LX0A 3CPWA 3GQ5A 2C5RA 5EP2A 1PTOB 3CW2C 1HA5A 4G7HC 1L1TA 3F1ZA 5JPNC 4NXNQ 2ERCA 2F3IA 3I55A 1E94E 3B74A 1B44D 5EKIA 4E6IA 4JI4L 1HNXM 1JR0D 3W68A 1F2MA 2OCEA 4ABNA 2EYHA 3OTOM 4A3MH 3K2LA 2Y0QA 4J1MA 3EIHA 3ZJYC 3T1HQ 2HQLA 1L0WA 1Y8OB 5T1IA 2BA1A 3GLFB 1IBMM 5KO3A 3UDFA 2VQFL 2QW7A 4A3CH 3QAUA 2ID0A 4ILWA 5CV9A 2B39A 1JOQA 4G7ZC 2JXMB 4JN6A 3B7QA 1GL7A 3BVZA 1JE4A 3SYLA 1XPRA 2LFNA 4OGQC 1B2TA 5ELBA 4RHSA 4P74A 3URYA 4OELB 3FKIB 2AUKA 1C48A 2P5ZX 4GNXC 1GXDC 3B9PA 3KXEC 5CV7A 2R0IA 4LF6Q 4BWGB 2L6OA 1QAQA 3GLFE 2F0KA 1J09A 1D0KA 2YNMD 1WTVA 2RSOA 1Q86C 1XWIA 3A8KE 3M9BA 3ND9A 3IG8A 4RA8A 2QBYB 2H1EA 3PUWA 1SXJD 3FKIG 5IYBH 4RHRA 1F9QA 5FTLA 3HY5A 4AQYM 1EYCA 3BZCA 5J3BA 2CV2A 5EBDA 1GLNA 5ITYA 5IT9c 4D80A 2C99A 1QQWA 4A3MB 4KJNA 3GRYA 2PCFB 1QVFA 4K0KQ 1SN8A 1AP0A 5EP1A 1IBKM 2H1RA 3S15H 2WAQB 2M2LA 1NO1A 2EE1A 3UDXA 3A45A 2QPAA 1DD2A 2K33A 1JT8A 1BVSA 4A3MG 1KLGD 4NXMQ 3SFZA 1T5EA 2CFMA 3E4RA 3PNYA 1TIID 2CEAA 2Z8YM 5A2QL 5GROA 1TTEA 5IT9L 2WAQG 3A8IE 2WB1B 2O5JC 4A3CG 4KODA 4FW9A 1O7ZA 1Q3BA 5AFWA 2UXBM 3R2TA 3VYSA 1EWIA 4KD4A 3A98B 3THGA 4DUYQ 4I8OA 3K5MA 3C3EA 1K73C 2MP1A 1JQYD 3PXGA 4R4OA 4CJ2C 2MUYA 4AI6A 2WB1G 4YCUA 2M60A 3GLHA 4OL7A 3SMPA 1EY8A 1SJHD 2SNMA 3A74A 4FCVA 2V4DA 4LF6L 3J81i 3PIPA 4KHPM 1WD1A 1VDLA 2L09A 1VQ4A 4IUTA 4P71A 3AFPA 1WTWA 4F1IA 5BN5A 4Z8XA 2WB1E 1HTPA 2CHQA 1N32Q 3TQSA 1SE8A 1XNRM 3CRLC 4P16A 5E4XA 3A42A 3FYCA 1A3UA 1X55A 3CHBD 2KA6B 1EEID 2F0QA 5DM63 3S1QH 4DAYA 5I6WA 2XNAC 4MB7A 3S15B 4NC6A 1I50H 1VQDA 5EQTA 5IYBG 1SMYC 1Q82C 3HU2A 3C58A 4MN3A 4K0KL 1CM9A 1N78A 1TT2A 3D31A 4RH6A 2AHMA 4DV3Q 1QANA 4PV1C 3QO2A 4A76A 3U9SA 1LUZA 3HJQA 2X6LA 1FJGQ 2A69C 1EY0A 3PMFA 4X62L 1BBWA 2TMPA 1VEJA 2IX3A 2JXNA 5M5XH 4B3SL 4A3JH 1T43A 3NBIA 1B4OA 3DM3A 3K80C 3VR2A 1NJFA 1SE4A 1TR8A 4BBSH 1IKMA 4JI0Q 4DR6M 1N75A 4DV4M 1DXMA 2F1MA 2AQ1B 1JR3A 2KW0A 1DM0B 3C9PA 1NY5A 3FDTA 5E3FA 1G71A 2LXEA 3QWNA 2HKJA 2FJ2A 2DHRA 4DR2M 2CE7A 1DGHB 4GITA 3M3YH 1KIXA 1EZ8A 4LJ7A 1YHAA 1HNWQ 2PZUA 1H95A 4FXDA 1LTSD 2I46A 1AE2A 3S1QB 1N32L 4HMJA 1LACA 5E7NA 2J4XA 3BOSA 1OFHA 1I50B 3JC66 1VQHA 3CXCA 5KYIA 1SJED 4R7GA 1FVIA 2EUCA 4OXPA 1BUVT 4MGZE 3K59A 1RIPA 4C2MH 3TREA 4K14A 4DV3L 3BJUA 2LY7A 5IYDH 3I04M 5GQOA 4QUFA 1OTCA 1R6BX 2KRUA 3VR4A 3FMCA 4ZRZA 5M5XB 4DV5M 1FJGL 3K8AA 4PQXA 4RCOA 4A3JB 4DR7Q 2DWZB 2Z0SA 3U5ZB 1D1IA 4BBSB 4MTNA 2ENBA 3DUZA 4Z6YA 1IYJB 2Z4RA 4YHHQ 4DUZM 1PZID 4IJLA 5HGQA 2Z6BA 4JI0L 1Q3CA 1V1QA 4X3KA 3M3YB 2UUAM 2K0BX 2MQHA 1R2YA 1QUQB 4A3JG 4IO9A 1ESFA 5EXPA 1S3SA 3BDOA 5M9OA 4BBSG 3K9PA 1XMOM 5IGEA 3I90A 1L1OB 4OVZB 3SEBA 2HHHQ 2R7DA 2R92H 2AUJD 3J81S 4K8JA 2J0TD 3NTIA 3DLLA 1HZCA 3CCSA 1N33Q 4NPSA 1HNWL 5JI3E 2NN6H 1ET6A 4BY1B 4AH6A 2MPMA 1JC7A 3AEVA 4B7FA 4X3TA 4HIMA 1XB2B 3S24A 3DWPA 3MWYW 4PG3A 2SDFA 1SNCA 1NMFA 4C2MB 1ZMUA 1IBLL 3GLIA 5ITQA 1B3AA 3ULJA 1PH8A 3J7AF 4BY1G 1H6UA 2XGTA 2DJGC 5DFLA 4ZPXA 1NY4A 1ORYB 2LVOC 2NN6I 3SHFA 2E2JH 3GLGA 2LTUA 1T6OA 4AZFA 2OO9A 3FRIA 4LFCQ 3GO8A 2L9HA 1XX8A 1IFYA 4IPGA 5CYUA 4XQJA 3A5ZB 5IYDG 4KHZA 4DR7L 1DGFA 4WORA 4LJ8A 3PF5A 1NMGA 1CA6A 4NB3A 4YHHL 4GIPA 3CCJA 1KSFX 1NR4A 1G3IA 2BA0A 1K8AC 3L28A 4EIWA 1Q1EA 5EP4A 1BCPB 2CHGA 3GPUA 3T1YM 2R92B 1L8QA 1N34Q 2F5SA 1L2FA 4CDCC 1PFMA 4A3IH 2R44A 5EJCA 3SHGB 2HHHL 2ZJRA 1I4GA 2B2WA 2Z6KC 2K5HA 2DVWB 3CTWB 3C1FA 2OQ4A 1E7ZA 3H4MA 1H9SA 5COYA 1N33L 2O5RA 1DZ1A 1HUNA 3E0EA 4R3DA 4FNFA 3IFTA 1S5ED 1ENCA 4LK1C 2R92G 1G2SA 4XYQA 1XPUA 1EE8A 1WXQA 1S5DD 2AWNA 2VS1A 2K01A 3FRPB 3QWLA 1MSHA 2NN6G 1KAWA 5KNCA 1GUWA 2FMCA 2HIXA 2PQEA 4ZCKA 5CV8A 4JV5Q 4A3VB 3R8FA 1RD9D 5CV6A 3OMGA 2E2JB 3VA5A 4RCNA 1BO0A 1D5XC 2MGSA 3HOXH 1IN7A 3MJ5A 2CCZA 2LVQD 4C3HH 5LHY1 3KOZE 1L2BA 3OHXC 3U6OA 1PMRA 3FTDA 4LJ9A 2OQKA 1BXTA 1KYIA 4LFCL 1QDTA 1J5EM 1I4WA 4DNRB 5E6JA 3I72A 1I4PA 2BE5D 3BDCA 3GTMH 3LW5F 3S1NH 1OO9B 3HS0C 4JXJA 1HR0M 3L2PA 2B2UA 3HJSA 1J6QA 3D8LA
chains in the Genus database with same CATH topology
4A3IB 2PW7A 4IBKA 3C46A 1Q1BA 2EJFC 3M85A 4B3RM 3K5NA 1D1KA 1O80A 3NK9A 1TR5A 2ZXPA 2KRKA 1HHVA 1I6VC 1YE9A 2I7NA 3K1JA 2O4XA 4HN7A 2CQAA 4ZUIA 2FMMA 4H0LC 5H37D 1HA6A 2F0PA 2M9VA 1VDDA 4I5SA 3RD4A 1GUOA 4GH9A 4L6TB 5FTMA 3EROA 4L16A 3HOXB 1DYQA 2VXWA 3T4AC 1TH3A 3AOGA 1TKWB 4C3HB 3CF2A 3MXNA 5BPVA 1QG7A 4ZKBB 1YNJD 4K6DA 5T1GA 4S3SA 1TVXA 3MVVA 5IGDA 3GTMB 3S1NB 4C3HG 1L2CA 2UXCM 3QIAA 4FYDA 2RDFA 3RLFA 2EYMA 1K8OA 1SXJC 3VK8A 2B2VC 1EU4A 3GP1A 3VKGA 1OJLA 3SBJA 1XXHA 2RDGA 3O13A 1K8MA 1YUBA 4V190 4L15A 3J81L 4HTHA 1HQCA 4RF0A 4JI7M 3BS1A 5C3EB 3M6AA 5JI2E 3DMUA 4M9SA 2O2LD 5EJWA 2YFQA 3LQQA 4NW2A 2E5LM 3ILKA 3KVWA 1IN8A 4K5VA 2EDGA 4DR1M 4CKEA 3R3OA 4IBBA 4X65M 3SAVA 4NOOB 3F2UA 4KV6A 3MAQA 2VB3X 3OOCA 1MX0A 2EYJA 2E75C 3VR6A 4KKUA 3G7LA 3S16B 2OEOA 2OPFA 1CK1A 2XRQD 5DM73 4IBEA 3ZC7B 1II3A 3M4YA 3TZUA 3I4VA 1SNMA 2UUCM 1MSGA 4HSPA 5KRUA 1CZWA 1QAOA 3PIO3 5EGTA 4GHAA 4NMZA 1SNQA 2R62A 1EL0A 5EQ0A 5C5MA 1TS4A 2DZNB 1X3QA 2B2YC 2QF7A 2JE6I 4DR5M 4BA2I 1SYFA 3GTQB 1PFBA 1I4HA 2AQ3B 1K82A 1F2LA 4LFBM 3GQ4A 1LO5D 2DNCA 3MFYA 2EZVA 2L12A 1X37A 4IIWA 3GTLB 2K32A 4B3TM 1GJXA 3L27A 1OXTA 1EY9A 3E9SA 4A3GB 1XC8A 5CMDA 2J7NA 4IBIA 1EQTA 4MGYE 3GQBA 2C98A 1JCKB 2K5WA 1QWYA 1OXXK 1V8QA 2R65A 5A2QS 1WVLA 1EZ6A 3SARA 5IT9S 2MHVA 3U6DA 3BYYB 1TWGB 2QDBA 2EOTA 5C4JB 4K8IA 5ISRA 1NSNS 3EIEA 1E9SA 4WJWA 1IXZA 2JSOA 1A3TA 5C6AA 2XGNA 1H9KA 3TPZA 2EVBA 1E0BA 4CJ0B 3C2PA 3KBGA 5DEHA 1TWFB 1RODA 1IY1A 2E2IB 3VYTA 1I4XA 2PW5A 3D4RA 2F0MA 2X4AA 4KMUC 4WURA 2I07B 3I4NB 4RGNA 1VDZA 3GLHB 5FO8B 2K47A 1CHPD 4BS9A 4LJZC 5E1FA 3HJ8A 4GZYC 1TQOA 2K1BA 3NP8A 3BVGA 3WOEA 5JEAH 4A93B 4KD3A 3W0FA 5C4XB 3NWLA 2LKVA 5DYGA 1WTPA 1KLUD 1Z5AA 1I6HB 2D5DA 1JOKA 3R8BA 4X66M 2EPBA 1V43A 5G3LD 1I94M 4RGMA 3W2DA 1DO2A 2IW3A 3S1RB 3SK5A 2NQ8C 3PUZA 2RKOA 1G6ZA 3W0LB 3MXUA 3U6QA 3S2DB 3H94A 3X3NA 1SYCA 4GC9A 1E32A 1E9RA 3U6PA 4QNRA 5DNYA 3J7AS 4F87A 5IGFA 7CATA 3X3MA 3Q23A 1HQYE 3FD9A 5E26A 2K7VA 1EEFD 3ZYYX 4JYAM 3JAME 1D2NA 3KP1E 1FGBD 1HPCA 1BNZA 4JK1C 2JA6B 3GO5A 2B63B 2HQEA 4MM3B 3V2TA 2PPBC 1KNEA 4DNTB 3J80L 2C9CA 2NZ1D 5M3FB 3I73A 3RZOB 3FUXA 4O1NA 4XYOA 5JEAG 1RDPD 3T15A 4FF1A 3H3VC 2XSZD 3MXPA 1IN4A 1KTKA 4IUUA 3TN2A 1NHGC 1LTBD 1G59A 4F7XA 4CKBA 4CGYB 2CV0A 1OXVA 4X64M 2FHTA 2R3ZA 4O42A 4C3IB 1GKIA 1AFPA 3LVVA 4DU9A 4LG2A 2IPKD 4XIGS 1PTOD 5I9OA 1S5BD 1PRTF 2PZTA 4HMIA 4PMCA 3HP3A 2P5TA 2JEBI 4TKOB 1JORA 4C3IG 2D2CC 2F0GA 1D6EC 4EVOA 4BBAA 4FF3A 2Y21A 1KDCA 4GKKM 1O7LA 2A6ED 3BYTB 3K6OA 2ZM6M 5ITXA 5E4WC 2BE5C 1LLRD 3EA6A 4I7ZC 2Z4HA 3J2PB 3GPPA 2HCCA 2VQEM 1PDQA 1ILPA 1IN5A 4F88A 3P75A 2XIWA 1Z47A 3GLIB 2JA2A 5CORA 3DEOA 1L0YB 3SDZA 4XBOA 4B7GA 2B8FA 2IL8A 4NXNM 4NRVA 2M5ZA 1Q8IA 4QF4A 2IX1A 2XVSA 3RGPA 1AN8A 3T1HM 3L3OC 2L55A 3FTFA 3I4YA 3D4WA 3HU3A 1HQRD 2PNRC 3PUXA 3KSXA 3I3CA 2OF1A 4I81A 4U68A 5A35A 1ZYRD 1GUSA 4FP5D 5IGCA 3OWFA 4B9WA 3RFWA 1CI3M 2F0NA 1YNJC 4X3SA 4JI2M 3AU7A 2CVRA 3UZUA 1LTTD 4IURA 5J39A 2CFOA 1VCIA 1H9SB 3S1MB 3DA1A 1TWHB 3NWTA 1B50A 4DXFA 2CUZA 4LF6M 2J7OA 5I9PA 2ICIA 1Y1WB 3AJIB 2YYZA 3TSSA 3VFDA 4M9XA 3MHBA 4A3EB 4HSVA 1PRTB 2E76C 4ULLA 3NWSA 2E2DC 3KF8A 4AYBB 2AQ2B 1VF5C 2KQ3A 4G7OC 4W5WA 2DN8A 4EGVA 1IY2A 1N36M 1CZGA 2YQZA 1LTGD 2NYZD 5GKNA 1HT2E 3Q0AA 1BF4A 4LJ4A 5HGTA 1B9MA 1TH4A 1R4QB 4XQNA 4KJOA 4CBVA 2XSCA 3D4DA 3TBIB 3IAYA 4NXMM 1SNPA 2XWJB 3PUYA 1HFGA 2BCOA 2R4EA 4L8JA 3H91A 4IJFA 2F5QA 4RNAA 3K57A 2IT1A 3DEPA 3GTOB 5CV5A 4DXGA 4A3FB 2F0JA 1R9TB 5HURA 2F0EA 4DUYM 2LS01 2KCCA 5I2XA 5K36H 4FCTA 2SNSA 3DFZA 1JOOA 1SXJA 1H9JA 2FE8A 2I7PA 2GA4B 5IZ7D 2UUBM 3PV0A 3T51B 4GRIA 2B2VA 3HU1A 2Z3XA 4MHEA 1D2BA 4QHTA 2KEDA 4IBCA 1RHPA 4G4NA 2HUGA 3E6ZX 2SOBA 3W3AA 2Z7JA 5EXXA 4Z9CB 3CF6E 3SHLA 1NNJA 1F2ZA 3TL4X 2JEAI 2BDNA 2NWGA 1I4QA 2TSSA 4UDUC 4LMQD 4JBWA 1I3QB 3A7LA 1SEBD 4M8AA 4FF4A 3AV0A 1TGUA 2KA7A 1UEAB 1IM2A 4H13C 2OXPA 3NTKA 5JEAJ 1B9NA 2WKCA 3CRKC 3TWLA 3TP7A 2PMZB 3EJIA 3I91A 3TP6A 3QJYA 1V1OA 1CA5A 3AKZA 3HOWB 4GC5A 1XXHB 3R9XB 1HCZA 5C0XH 3UGJA 3HZXA 1NUCA 4TSSA 4KK7A 5KGUA 3L29A 3ZH9B 1G291 3MC0B 1K3WA 3VR3A 4IFDH 3P1HA 5M5WB 2W82A 3SAWA 3OMCA 4FD2A 3UJNA 2R61A 1J7KA 3S9WA 3D8GA 2KHSA 4L63B 4IUPA 2XZFA 3QG1A 5K36G 2B2YA 4H7BA 5C0XI 1MD2D 2LWXA 2WKDA 5FKAC 1KDBA 1BQQT 4IFDI 4RKBA 3E5SA 3GV6A 2VB2X 4KN4C 3K8ZA 2ZANA 4LY6A 5LL6X 2O5IC 2BJWA 2RA4A 2HCBA 5A2QE 2RDHA 3KK7A 2NTTA 1ICWA 5IT9E 2OT2A 4XT1B 2EJGC 4ZYSA 1S5CD 2E2HB 2EYFA 1EY5A 1LTAD 1UM8A 5KNBA 3HOVB 1QJOA 4I4LA 3K7AB 3QOLA 3WDNA 4KKTA 2R7ZB 3HHZA 2WIIB 2K5QA 4PNYA 4B9XA 1ML0D 3L7ZC 4WFN3 1NY6A 1F2YA 2SEBD 3U61A 3AMUA 2V1CA 3K0YA 4PMWA 5C0XG 3L9AX 1TDHA 5DAUA 2F5PA 3HGIA 1N33M 4IFDG 1LV9A 4DV2M 4ZLTF 1LV7A 4HL4A 4J8QA 1BCPD 2UU9M 3IFDA 3FTCA 3NQTA 5FTJA 3RMHA 3TMEA 2F3VA 3SVMA 5FLXL 2G5GX 3A56A 5EP3A 3NE5B 4C1NI 1B53A 3A54A 1OFIA 2DXIA 1LTID 3D3RA 1SNDA 2X6GA 4JI3M 4LJ5A 3WOFA 4DAVA 1AEXA 3J7AV 4QUCA 2M00A 1IXSB 3T38A 2V1UA 1NVMA 1LABA 1W6KA 3U6SA 1M8AA 4DR4M 1EIGA 2BNKA 2L0CA 3UK6A 4RF1A 4IN3A 1QAMA 4M0WA 1NJGA 1H9RA 3IKJA 1B1ZA 1S4ZA 2R46A 4ODGA 1N34M 3MK6A 4LF4M 5KIXA 1HTLD 5ITUA 1EU3A 4QMGA 4RKLA 5IGGA 1W5SA 3HEJA 1BOSA 2FFKB 4ME5A 2F0SA 1PTOC 4PD2A 1BR9A 2K6AA 1WD0A 5CGKA 4MGKE 2KXEA 3SE0A 3VR5A 1MBYA 1QNUA 1W5TA 4XXEA 4K5XA 5JPMC 4JV5M 1EFID 2NVQB 3UMMA 1XYIA 4XQQA 3ONAB 1TY2A 3FUUA 4BBRB 2J7ZA 4HAEA 2A6EC 1F9RA 1JWSD 2N55A 5JOBA 4F8MA 3DHQA 1ZKOA 3MTSA 4QCLA 4CISA 1DJRD 1I4RA 4LZJA 1U4MA 3KOYE 3FYDA 2RGHA 3HGBA 2F0HA 3S14B 5BR8M 4U673 3J80S 2EY5A 2LNHC 5KEEA 4H44C 4A3DB 2RKSA 3KBXA 2JA8B 5C5LA 4LFAM 1TWCB 2EYLA 1XNQM 1TU2B 1CFMA 2F3WA 1HRJA 3HHXA 1T5XD 1FD7D 4QB4A 4PT5A 1ZYRC 5ELEA 3KOXE 4B3MM 3T53B 1GL6A 1NHWC 1XMQM 1VMPA 4HCSA 3KUPA 4A3KB 2VIIA 1HFNA 3SXHA 3SK8A 1SYGA 3EQLC 4BY7B 2FFJA 3GPYA 3OW7A 3SC3A 2PO4A 3MXGA 3BDLA 2QP9X 3FUVA 4WW0A 2XWBB 1A6XA 3AOEC 3C1EA 3KLSA 4NL4H 5IODA 1DOMA 2A68D 3VYRA 1EYAA 3VDUA 1A2UA 1TDZA 2DWNA 1TS3A 5EKKA 1E2WA 1W6JA 2F0DA 1STNA 4I65A 2D62A 4IQZA 2K03A 1SE3A 3RGSA 3Q22A 3LMMA 3ITPA 2Y0SB 4AKGA 4X3UA 2G8LA 5CR3A 2Q8TA 3L25A 2VNUD 1HT1E 5CV4A 3HOUB 1FNWA 3OIPA 3GRUA 3WHLA 1YNND 2LH0A 5C0XJ 2QCUA 4N9PA 5BN4A 1Q12A 2EY2A 2DWLA 3CF0A 1SYBA 2K28A 5ELCA 1EY6A 3I8ZA 2Q8IB 4M1UB 5ITXE 1IL8A 3PUVA 1U4PA 2L7IA 4B7HA 1WTQA 1CTMA 3HKPA 4DF7A 2XEPA 2XFTA 5FK9C 1F9PA 1QILA 2KZUA 5TSSA 2VUMB 1MI2A 2YU9B 2KVMA 2AWOA 5LMUM 1K3XA 1IY0A 2JA7B 3GRRA 1STBA 4DV7M 1GUNA 1LT6D 3GPXA 2NTSA 4IBJA 5D3DA 2V6ZM 5NUCA 3MEHA 5ELDA 1FYCA 1JQJC 3SR1A 3VDPA 2WACA 4LF8M 1G8ZD 4OX9M 3ZCBB 3SK6A 3TWKA 4IZ8A 4BA1I 1M4VA 3KP0E 1DGGA 4IBDA 3HHYA 4HEDA 2UXDM 1QYRA 5LMNM 4UAIA 2EXZA 4HR7B 2ZXRA 3D6CA 3KLRA 4LF5M 5F2DA 5CBAE 1G2TA 4KY6A 1R2ZA 2B8GA 3Q8XA 1R4PB 5I6YA 1HQMC 1DOKA 3J81E 1Z5CA 4ZK9B 3GD7A 2FOIC 5KPTA 1G4AE 1Q90A 2K04A 3CKIB 2EJMA 4K2KA 3RZDB 1KFVA 5CBEE 4RWSC 3VA7A 4LCBA 1SXJB 3GQ3A 4JI4M 4RAUC 2D7GA 2WV6D 4PCZA 1DGBA 1UNSA 3NPPA 3P20A 4R8IA 1JR3D 3GP7A 1STAA 4FVMA 4K5WA 2A5YB 2VQFM 1IQPA 2RBMA 1F77A 5KNDA 1RCVD 4OHJA 8CATA 3H09A 1Z5BA 3TP8A 5DNFA 1N77A 1QCBD 5JAVA 1SBBB 5C4ZA 1SXJE 5IIFA 1GHJA 4LJ6A 1Z6HA 3KLSX 4YIJA 3SAUA 3M7NA 1BCPC 5ITRA 1IYVA 1ZXTA 2EO2A 4M0DA 2G9HD 4AKHA 1L2DA 2F03A 1FNNA 1SSOA 4TRDA 3H6MA 1V1PA 4QNMA 1IYUA 3I51A 2RVLA 1E2ZA 1SNOA 3MHVC 3M7GA 2G9DA 2Z1CA 2DNEA 1G8PA 2C96A 4AG5A 1CQVA 1EY7A 3GTPB 2RGOA 3U60A 4ZUJA 3GLGB 2NBFA 2KJXA 2F0UA 3GRVA 3N52A 1FNVA 3KSJA 1JWMD 1EWHA 3K5OA 3NHHA 1DCZA 1Y1VB 2IWHA 2ICEC 4NKLA 4KTAA 5DYIA 2QKIC 1WTOA 2EY6A 3I4LA 4FXGC 4REZA 4ITQA 1C4QA 1A15A 3U6CA 3TE6A 3DM1A 3LWEA 3MZ5A 1HUMA 1LT5D 3J7BA 1DO0A 3KW6A 2L4NA 3T56B 4G4OA 1O7YA 2N88A 2QILA 2QZ4A 1GVNA 1PYWD 4KI0A 1EQVA 5JJZA 1TS5A 1JB3A 2K5DA 1QNKA 3U61B 3NQIA 4DA2A 5FLXS 4OO1H 4LRTA 2KCNA 4C3JB 1GHKA 1SAPA 2F0TA 1ILQA 3QOJA 1ZAEA 1UUPA 5CC4A 4K0KM 3IG5A 4ZQ3A 3HKZB 2EA0A 5EPLA 3CU7A 2XSZA 1S5FD 4C3JG 5C18A 4MGIE 3RE8A 1STEA 4OO1I 5FSWA 4KY7A 4X62M 3E0JA 4AKIA 4B3SM 2KECA 2F4IA 3A7AB 1PZKD 1SFOB 2Q8RE 5LL6S 1U4RA 5C3XA 2R6GA 2XF3A 1MU5A 4D82A 4NRWA 4RFBA 5FO9B 1IXRC 4Q5VA 2B2TC 2Z4IA 1PRTD 2R93B 1SXTA 2RQXA 4XT3B 4LZZA 1K83B 2NB0A 3LWUA 3VKHA 3U6EA 2Z4SA 1PJJA 5C44B 3D8BA 1N32M 1TS2A 2NUCA 3GLFA 3BVMA 3QB3A 4FWHA 4LJAA 3DOAA 3SASA 1BCPF 1Q3LA 3HHWA 4IUNA 1HXYD 3J7YW 4OO1G 1SYEA 2JYOA 3FTEA 3NSWA 3J80E 5KPRA 4PDIA 2FINB 3P7JA 5ELFA 4C56C 4QIWB 4DV3M 1TY0A 1XXGA 3PO2B 3PNVA 5I2YA 1KDAA 2F5OA 2A68C 5ITTA 2A6HC 3L2AA 1FJGM 3PFIA 2XZUA 1FR3A 3D6WA 3G6JB 1TH2A 1STHA 2X8AA 3SK4A 1R7RA 5EPJA 3JAMS 4MIUA 2F0LA 1D5MC 4N9TA 4EQOA 3PIP3 4CJ1B 4LRSA 3AL0C 2ZXOA 4JI0M 4EQNA 1U4LA 2X49A 4QOSA 2A5HA 2QBYA 3TDQA 1OXSC 1IN6A 1QZMA 4IUQA 5KYLA 4KHVA 4PMBA 3EFXD 5FTNA 4D81A 2EYOA 2CW0D 5KQ8A 4CHTB 4JI1M 3NUCA 2C9OA 4FWDA 3A46A 1YNNC 2A73B 5I4DA 1HNWM 1EIHA 2KZSA 1AZPA 3LVWA 1ZQ9A 4PDGA 2HDMA 1T3TA 1CQFA 1Z59A 1IW7D 2D9UA 2YR0A 3OIQA 3U6MA 1QB5D 2FNAA 1IBLM 4QHSA 2ZAOA 3FUTA 2XN9C 3BG3A 3PVSA 1BBXC 2R45A 2XLJA 3AOEA 3DWQA 5J22A 2H4OA 2KOLA 1QOHA 3U9OA 3NTHA 4NSOB 4DR7M 2F0VA 1U9RA 3NBHA 4S12A 2F0FA 4HCEA 5D3IB 4OW0A 4DGZA 4YHHM 2BOSA 3V05A 2DY8A 3C3LA 4EQPA 1QE6A 3SMSA 5KPZA 3FUWA 2QCPX 3CQZB 5JVH3 1CT1D 2HHHM 2Z8LA 3UI2A 1D5ZC 3WHKA 4KN7C 3HRZC 2CHVA 1G91A 2XFSA 1JICA 2E74C 4FF2A 4R9WA 3LQRA 4FXKC 3H0GB 4RGOS 1Z7TA 4OIKA 3N6RA 4ZAIA 5IOCA 3RUZA 2IX0A 1WCMB 4Y7NB 2EY1A 4RGTA 4Q0FA 4OU7A 1AW7A 1Y8PB 4FO2A 2ZAMA 1OXUA 5C4HA 2X69A 1DGHA 4LFCM 2L11A 3Q6SA 2D7EA 3HWSA 3DZDA 1YSYA 5D14A 1ET9A 5EBCA 4KY5A 2RSNA 2XH9A 4K6LA 1FNUA 5F3WA 1Y69U 1XHBA 2Y0TA 1VMCA 5BN3A 2PYKA 4IBGA 1RJTA 4G4RA 3TZDA 4DK1A 3FPPA 2D7HA 1H9MA 1PFNA 2XRSD 4C1NK 1BDOA 4G57A 5FOBB 2IJ0A 1NSFA 4LGYA 5KQDA 3S17B 1G41A 5FTKA 2DZOB 4V0BA 1NCVA 3JR5A 1J8IA 1LTRD 3R2IA 1PLFA 3U5ZA 5EPKA 3GTJB 3GTGB 2Q2EB 3U6LA 5D65A 4KKSA 1JWUD 4A3BB 2LMCB 3TP5A 1IKLA 1PJIA 4DK0A 1EWCA 3MFGA 2BDOA 3FVQA 1QVRA 5IREB 1SMYD 4OVZA 2HDLA 1C1KA 1NNUC 2HL7A 1A2TA 3JAML 1XTCD 4M9ZA 2A69D 2Y20A 1L1ZA 1SDFA 3VLFB 3ERQA 3I4MB 5IWAM 4BLCA 4JI8M 1PM5A 4LF7M 3DWAA 2MJ8A 3ND8A 1EYDA 4FWGA 1RF2D 1X32A 4DV1M 4GMQA 4IALA 5EXSA 2PZWA 4L78A 4G4KA 4R8NA 3SYKA 3FEWX 2L1BA 3DXJC 1Q39A 1STYA 3FKEA 5G3LF 4ZKCB 2KEEA 1ONLA 4AG6A 4QOZC 1Y8NB 2NVYB 4ID6A 4JI6M 5EKLA 4DR3M 4IJEA 1L0XB 2NVTB 4MH0E 1TWAB 3GTKB 1RKNA 2K05A 4P2CB 2F0IA 3PO3B 3KOWE 4DAPA 1LT3D 3JR4A 3J27B 4BB9A 3KDSE 1ENFA 3IL8A 3HOZB 5EXTA 2EYPA 4DV0M 1HNZM 3SATA 3LNNA 3OPOA 2KEBA 5C3WA 1A3VA 1IHZA 2F0OA 2A6HD 3OWEB 1ZEQX 3KS4A 1WTXA 2NVXB 5J1ZA 3K92A 4HLQA 4DFAA 2DWMA 4FCWA 3HOYB 3M4OB 3I70A 1NAPA 1Z6TA 1ESRA 4K2LA 1GUTA 3A8JE 4TUWA 4II7A 4YY3M 4G4QA 1GOZA 2JA5B 1EOTA 5JVG3 1KNAA 4IBFA 4TQUS 1X3PA 3T13A 5FO7B 5IGBA 2B2WC 2A74C 4B08A 1V1PB 4XDXA 3S2HB 1EY4A 3AFHA 4LAAA 1AZQA 1J9OA 2WINB 3NXWA 1ENAA 4KLNA 2HCIA 1XWEA 4IFDJ 3U60B 1PTOF 3A55A 1PRTC 5FLXE 1DOLA 4J6HA 5K5PA 1WTRA 5M3MB 2CV1A 2QENA 1KABA 1STGA 3T16A 3EVQA 1NR2A 4OIJA 4L4UA 4KO8A 3VK7A 2F0WA 1SYDA 4L8RC 3V96A 2KUMA 4DV6M 2WP8J 3TWMA 1CHQD 3HG9A 3M0EA 4XGIA 2ZT9C 2B2UC 3K58A 2R4JA 5C1BA 3R93A 2CHBD 4XTCS 2BJVA 4JI5M 4WRDA 1PTOH 1F9SA 5M5YB 1RTNA 4NP5A 1KAAA 2QEJC 2L7HA 3AB9A 3KS8A 4GHLA 4MGHA 1C8CA 2ZBKB 3BZDB 2DY7A 1SE2A 4AW4A 4LF9M 2B2TA 1E2VA 2CW0C 4G6ZA 3OSOA 2F5NA 3KFUG 4LGMA 4NSRA 3MA2B 1GUGA 1PXUA 2L5TA 1VF7A 4DN4M 1MGSA 1DONA 3K5LA 2F4VM 2R18A 3L26A 3Q24A 1IW7C 1RTOA 4NDXA 4CKCA 3VYUA 1LT4D 4IUVA 4GKJM 1PZJD 3FPUB 2C5CA 1O78A 1UAPA 2JP1A 3GV3A 3LX0A 3GQ5A 2C5RA 5EP2A 1PTOB 1HA5A 4G7HC 1L1TA 5JPNC 2ERCA 1E94E 1B44D 5EKIA 4E6IA 1HNXM 1JR0D 1F2MA 4ABNA 2EYHA 3OTOM 3K2LA 2Y0QA 4J1MA 3EIHA 1Y8OB 5T1IA 2BA1A 3GLFB 1IBMM 5KO3A 3QAUA 2ID0A 4ILWA 5CV9A 2B39A 1JOQA 4G7ZC 2JXMB 4JN6A 1GL7A 3BVZA 1JE4A 3SYLA 2LFNA 4OGQC 1B2TA 5ELBA 4RHSA 3URYA 3FKIB 2AUKA 1C48A 1GXDC 3B9PA 3KXEC 5CV7A 4BWGB 1QAQA 2L6OA 2F0KA 1J09A 1WTVA 2YNMD 2RSOA 1XWIA 3A8KE 3ND9A 3IG8A 4RA8A 2QBYB 2H1EA 3PUWA 1SXJD 4RHRA 1F9QA 5FTLA 4AQYM 1EYCA 2CV2A 5EBDA 1GLNA 5ITYA 4D80A 2C99A 1QQWA 4A3MB 4KJNA 3GRYA 2PCFB 1AP0A 5EP1A 1IBKM 2H1RA 2WAQB 2M2LA 2EE1A 3A45A 2QPAA 1DD2A 2K33A 1KLGD 3SFZA 1T5EA 3E4RA 3PNYA 1TIID 2CEAA 5A2QL 5IT9L 3A8IE 2WB1B 2O5JC 4KODA 4FW9A 1O7ZA 1Q3BA 5AFWA 2UXBM 3R2TA 3VYSA 4KD4A 3A98B 3THGA 4I8OA 3K5MA 2MP1A 1JQYD 3PXGA 4CJ2C 2MUYA 4AI6A 2M60A 3GLHA 4OL7A 3SMPA 1EY8A 1SJHD 2SNMA 4FCVA 2V4DA 4KHPM 1WD1A 2L09A 4IUTA 1WTWA 5BN5A 4Z8XA 1HTPA 2CHQA 3TQSA 1XNRM 3CRLC 4P16A 5E4XA 3A42A 3FYCA 1A3UA 3CHBD 5DM63 2KA6B 1EEID 2F0QA 4DAYA 5I6WA 2XNAC 4MB7A 3S15B 5EQTA 1SMYC 3HU2A 3C58A 4MN3A 1CM9A 1N78A 1TT2A 3D31A 4RH6A 2AHMA 1QANA 4PV1C 3QO2A 3U9SA 3HJQA 2X6LA 2A69C 1EY0A 3PMFA 2TMPA 2IX3A 3NBIA 1B4OA 3VR2A 1NJFA 1SE4A 1IKMA 4DR6M 1N75A 4DV4M 1DXMA 2F1MA 2AQ1B 1JR3A 2KW0A 1DM0B 1NY5A 3FDTA 5E3FA 2LXEA 3QWNA 2HKJA 2FJ2A 2DHRA 4DR2M 2CE7A 1DGHB 4GITA 1EZ8A 4LJ7A 2PZUA 4FXDA 1LTSD 2I46A 3S1QB 4HMJA 1LACA 2J4XA 3BOSA 1OFHA 1I50B 5KYIA 1SJED 4R7GA 2EUCA 1BUVT 4MGZE 3K59A 4K14A 2LY7A 4QUFA 1R6BX 2KRUA 3VR4A 3FMCA 4ZRZA 5M5XB 4DV5M 4PQXA 4RCOA 4A3JB 2DWZB 3U5ZB 1D1IA 4BBSB 2ENBA 3DUZA 4Z6YA 2Z4RA 4DUZM 1PZID 1Q3CA 4X3KA 3M3YB 2UUAM 1R2YA 1ESFA 5EXPA 1S3SA 3BDOA 5M9OA 1XMOM 5IGEA 3I90A 4OVZB 3SEBA 2AUJD 3J81S 4K8JA 2J0TD 3NTIA 5JI3E 2NN6H 1ET6A 4BY1B 2MPMA 1JC7A 4B7FA 4X3TA 3DWPA 3MWYW 2SDFA 1SNCA 4C2MB 3GLIA 5ITQA 1B3AA 3J7AF 1H6UA 4ZPXA 1ORYB 2NN6I 3SHFA 4AZFA 3GLGA 3GO8A 2L9HA 1XX8A 5CYUA 4XQJA 4KHZA 1DGFA 4WORA 4LJ8A 1CA6A 4GIPA 1KSFX 1NR4A 1G3IA 2BA0A 3L28A 4EIWA 1Q1EA 5EP4A 3GPUA 2CHGA 3T1YM 1BCPB 2R92B 1L8QA 2F5SA 1PFMA 5EJCA 3SHGB 1I4GA 2B2WA 2DVWB 3CTWB 3C1FA 2OQ4A 5COYA 3H4MA 1H9SA 1DZ1A 1HUNA 2O5RA 4R3DA 4FNFA 3IFTA 1S5ED 1ENCA 4LK1C 1G2SA 4XYQA 1EE8A 1WXQA 1S5DD 2AWNA 2K01A 3FRPB 3QWLA 1MSHA 2NN6G 5KNCA 1GUWA 2FMCA 2PQEA 5CV8A 4A3VB 3R8FA 1RD9D 5CV6A 3OMGA 2E2JB 3VA5A 4RCNA 1BO0A 1D5XC 2MGSA 1IN7A 3MJ5A 5LHY1 3KOZE 1L2BA 3OHXC 3U6OA 1PMRA 3FTDA 4LJ9A 1BXTA 1KYIA 1J5EM 1I4WA 4DNRB 5E6JA 3I72A 1I4PA 2BE5D 3BDCA 1OO9B 3HS0C 4JXJA 1HR0M 2B2UA 3HJSA 3D8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CGY B;  4CHT B;  3NBI A; 
#chains in the Genus database with same CATH topology
 4A3I B;  2PW7 A;  4JI8 Q;  4IBK A;  3C46 A;  1Q1B A;  2EJF C;  2QHO B;  3M85 A;  4B3R M;  3K5N A;  1D1K A;  1EOV A;  1O80 A;  2Q2H A;  4IPH A;  3NK9 A;  4DV1 Q;  1TR5 A;  5IY0 A;  4ANR A;  1G51 A;  2ZXP A;  2KRK A;  4A3I G;  1XNQ Q;  1HHV A;  1PYB A;  4JG2 A;  1I6V C;  1YE9 A;  2I7N A;  1UEB A;  4GLV B;  1K28 A;  3K1J A;  2O4X A;  4HN7 A;  2CQA A;  4ZUI A;  2FMM A;  4H0L C;  5H37 D;  1HA6 A;  2K50 A;  2F0P A;  5C3E H;  2M9V A;  1VDD A;  4I5S A;  3RD4 A;  1GUO A;  4GH9 A;  3CME A;  4B3M Q;  4L6T B;  5FTM A;  1FL0 A;  4CDE C;  1XMQ Q;  3S14 H;  3ERO A;  4L16 A;  3K81 C;  3HOX B;  4GS3 A;  1DYQ A;  2VXW A;  3T4A C;  1TH3 A;  3AOG A;  1TKW B;  4C3H B;  3CF2 A;  1PYS B;  3MXN A;  5BPV A;  1QG7 A;  1VQA A;  2B3G A;  4ZKB B;  1YNJ D;  4K6D A;  2WZJ A;  1E3P A;  5T1G A;  1HZB A;  2JA9 A;  4S3S A;  1TVX A;  2WSE F;  3MVV A;  5IGD A;  3HOX G;  1HR0 W;  3GTM B;  3S1N B;  3S16 H;  1YHB A;  4C3H G;  3ZQJ A;  1L2C A;  4JOI C;  2UXC M;  3QIA A;  4FYD A;  2RDF A;  1HNZ Q;  3RLF A;  2EYM A;  1K8O A;  1SXJ C;  3VK8 A;  3F2C A;  1QDR A;  2VZA A;  2DNA A;  3U58 A;  2B2V C;  1NJI C;  5IWA L;  3HZJ A;  3GP1 A;  1EU4 A;  4N8X 1;  3VKG A;  4JI8 L;  4LF7 L;  1OJL A;  3SBJ A;  1PVO A;  4EX5 A;  1XXH A;  1P3Q Q;  2RDG A;  3O13 A;  1K8M A;  1YUB A;  4A3K H;  4DV1 L;  4V19 0;  4L15 A;  3J81 L;  2KHJ A;  4HTH A;  1HQC A;  3KJO A;  4RF0 A;  4JI7 M;  3BS1 A;  1XNQ L;  5C3E B;  3M6A A;  5JI2 E;  3DMU A;  4JBJ A;  2KNZ A;  5H1S E;  4M9S A;  3CAM A;  2O2L D;  3GTL H;  5EJW A;  2YFQ A;  3LQQ A;  4NW2 A;  2E5L M;  3ILK A;  3KVW A;  1IN8 A;  4K5V A;  4JI6 L;  2EDG A;  4DR1 M;  2FS1 A;  4CKE A;  4DR3 L;  3R3O A;  4IBB A;  4A3G H;  3E46 A;  4X65 M;  3SAV A;  5C3E G;  4NOO B;  3F2U A;  2KCM A;  4KV6 A;  3MAQ A;  2VB3 X;  4JW0 A;  3OOC A;  1MX0 A;  2EYJ A;  2E75 C;  4LUZ A;  3VR6 A;  2O01 F;  3G7L A;  4KKU A;  3S16 B;  2OEO A;  2JY6 B;  2KBN A;  2OPF A;  1CK1 A;  2XRQ D;  5DM7 3;  1TWG H;  4IBE A;  3RLO A;  5C4J H;  3ZC7 B;  1II3 A;  1OAI A;  3HX3 A;  3M4Y A;  3TZU A;  1UFZ A;  3I4V A;  1QUT A;  2UUC M;  1SNM A;  4DKA C;  4DV0 L;  1MSG A;  4HSP A;  5KRU A;  1HNZ L;  1CZW A;  1QAO A;  3PIO 3;  5EGT A;  2I0Q A;  3FRH A;  4GHA A;  4GOP C;  4NMZ A;  1NV8 A;  1SRO A;  1SNQ A;  2YTY A;  2R62 A;  4DV6 Q;  1NV9 A;  1EL0 A;  5EQ0 A;  5C5M A;  1TS4 A;  2DZN B;  1KHI A;  1X3Q A;  2B2Y C;  2QF7 A;  2JE6 I;  4DR5 M;  4BA2 I;  1SYF A;  3GTQ B;  1PFB A;  1I4H A;  2AQ3 B;  3NBX X;  1K82 A;  1F2L A;  3GQ4 A;  4LFB M;  1LO5 D;  1EFW A;  3FP9 A;  2L2D A;  2DNC A;  3I2Z A;  2E2I H;  3MFY A;  3CGW A;  2EZV A;  2KEN A;  2L12 A;  1X37 A;  4IIW A;  4YY3 L;  3GTL B;  2K32 A;  4JI5 Q;  4B3T M;  1GJX A;  2K9D A;  3L27 A;  1PH7 A;  1OXT A;  3CF5 A;  3I4N H;  1EY9 A;  3E9S A;  4A3G B;  2E8G A;  1XC8 A;  1QZG A;  3FHW A;  3RLN A;  5CMD A;  2J7N A;  4IBI A;  1HZ9 A;  1EQT A;  4MGY E;  1F4I A;  2RCF A;  3GQB A;  2C98 A;  1JCK B;  2K5W A;  1QWY A;  1OXX K;  1V8Q A;  1YHQ A;  2R65 A;  4A93 H;  5A2Q S;  1WVL A;  2L15 A;  1EZ6 A;  3SAR A;  5IT9 S;  5C4X H;  2MHV A;  3U6D A;  3BYY B;  1TWG B;  2QDB A;  2EOT A;  3E9H A;  5C4J B;  4K8I A;  4OWW B;  4A3G G;  5ISR A;  1NSN S;  3EIE A;  1E9S A;  2V1C C;  4WJW A;  1I6H H;  1A8V A;  4A4I A;  1IXZ A;  2JSO A;  1A3T A;  1VQL A;  2F4V Q;  1GJS A;  1IXS A;  5C6A A;  5GAD C;  1JJC B;  2XGN A;  1H9K A;  3TPZ A;  1E0B A;  2EVB A;  4CJ0 B;  2K75 A;  3C2P A;  3KBG A;  4DV6 L;  2JUJ A;  3S2D H;  5DEH A;  1TWF B;  1ROD A;  1IY1 A;  2E2I B;  3VYT A;  1I4X A;  2PI2 A;  2PW5 A;  3NEL A;  3D4R A;  4HIK A;  2F0M A;  2X4A A;  4KMU C;  4WUR A;  1N8R C;  3KLW A;  2I07 B;  3I4N B;  2BH8 A;  4RGN A;  4JI5 L;  1VDZ A;  3GLH B;  5FO8 B;  2K47 A;  1HNX Q;  2N49 A;  1CHP D;  4GN3 B;  4BS9 A;  4LJZ C;  4JI4 Q;  5E1F A;  3HJ8 A;  3OTO Q;  1K8G A;  4GZY C;  1TQO A;  2K1B A;  2A1A A;  3NP8 A;  4POF A;  2JA6 H;  3BVG A;  3WOE A;  2OTJ A;  4L5S A;  3J81 j;  4PZ8 A;  5JEA H;  4A93 B;  3EBE A;  3K7U C;  4KD3 A;  3W0F A;  1IBM Q;  3I4N G;  5C4X B;  3NWL A;  2LVP C;  5DYG A;  2LKV A;  1WTP A;  3B89 A;  2LHG A;  1KLU D;  1Z5A A;  1WI5 A;  4DAY B;  1VQ8 A;  3NEM A;  5M3F H;  1I6H B;  2D5D A;  1JOK A;  3R8B A;  4X66 M;  2EPB A;  3RZO H;  1V43 A;  5G3L D;  1I94 M;  4RGM A;  4A93 G;  3W2D A;  1DO2 A;  2IW3 A;  5C4X G;  3S1R B;  3SK5 A;  2NQ8 C;  3PUZ A;  2LVN C;  2RKO A;  1G6Z A;  3W0L B;  3MXU A;  2EJS A;  2F4V L;  3U6Q A;  3S2D B;  3H94 A;  2HAK A;  3X3N A;  2FXQ A;  3FE3 A;  1SYC A;  4GC9 A;  1E32 A;  1E9R A;  1WR1 B;  4QNR A;  5DNY A;  3U6P A;  3J7A S;  4F87 A;  5IGF A;  7CAT A;  1ZV1 A;  4CJ6 A;  1WGL A;  1WJ7 A;  4GKJ L;  3X3M A;  4QJF A;  3Q23 A;  1EUJ A;  3J80 c;  1HQY E;  3FD9 A;  4AQY Q;  5E26 A;  2K7V A;  1EEF D;  3ZYY X;  2A8V A;  4JYA M;  3JAM E;  1V33 A;  1D2N A;  3KP1 E;  1FGB D;  1HPC A;  1BNZ A;  4JK1 C;  2JA6 B;  3GO5 A;  2B63 B;  1HNX L;  1SLJ A;  3CCL A;  5JJL A;  2ZJQ A;  4HEO A;  2HQE A;  3OTO L;  1LTL A;  4KLK A;  2N35 A;  1VQI A;  1VQG A;  4MM3 B;  1TXY A;  3V2T A;  5AJ3 Q;  2PPB C;  2LXK A;  1KNE A;  4DNT B;  3J80 L;  2C9C A;  2NZ1 D;  1RU3 A;  1R4G A;  5M3F B;  1IBM L;  3AYH B;  3I73 A;  2JA6 G;  2B63 G;  1NTG A;  3RZO B;  1JR3 E;  3FUX A;  4O1N A;  4XYO A;  5JEA G;  1RDP D;  3T15 A;  4FF1 A;  3H3V C;  2XSZ D;  1VQ9 A;  3MXP A;  1IN4 A;  1KTK A;  4IUU A;  3TN2 A;  4HJA A;  1NHG C;  1LTB D;  5M3F G;  1G59 A;  4F7X A;  4CKB A;  4CGY B;  2CV0 A;  1OXV A;  2DAG A;  1YLA A;  4X64 M;  2FHT A;  3BZK A;  4JBK A;  2R3Z A;  4O42 A;  4C3I B;  2BWB A;  1GKI A;  1AFP A;  1SRU A;  3LVV A;  3U50 C;  4DU9 A;  4LG2 A;  2IPK D;  4XIG S;  2N3S A;  1PTO D;  5I9O A;  1S5B D;  1PRT F;  2DJF C;  2PZT A;  4HMI A;  4PMC A;  3HP3 A;  3PF4 A;  2P5T A;  4L5Q A;  1XNR Q;  1X3F A;  2CH4 W;  2JEB I;  4TKO B;  4AQY L;  1JOR A;  4C3I G;  2D2C C;  2F0G A;  5DLQ E;  1D6E C;  4EVO A;  1OTR A;  4BBA A;  4FF3 A;  2Y21 A;  1KDC A;  4GKK M;  1O7L A;  2A6E D;  3BYT B;  3K6O A;  2ZM6 M;  5ITX A;  1IBK L;  5E4W C;  2JJQ A;  2BE5 C;  1KD1 C;  1LLR D;  1P16 A;  3EA6 A;  5IP7 H;  4I7Z C;  5AJ3 L;  3S1M H;  1TWH H;  2Q2U A;  2Z4H A;  3J2P B;  3GPP A;  2HCC A;  2VQE M;  4X62 Q;  1PDQ A;  1ILP A;  4YWK A;  1IN5 A;  2A19 A;  3P75 A;  4F88 A;  2LSS A;  1Z47 A;  3GLI B;  2XIW A;  1E24 A;  2JA2 A;  5COR A;  4OWX B;  1Y1W H;  4B3S Q;  3DEO A;  1K3R A;  1L0Y B;  3SDZ A;  3U4Z A;  4DR6 Q;  4XBO A;  2K5V A;  4DV4 Q;  4A3E H;  2L4F A;  4B7G A;  2Z6K A;  2B8F A;  2UXB L;  2IL8 A;  4NXN M;  4DR2 Q;  4C3J H;  4NRV A;  2M5Z A;  1Q8I A;  4QF4 A;  2IX1 A;  3STB D;  2WAQ E;  2XVS A;  3RGP A;  1AN8 A;  3T1H M;  3L3O C;  2L55 A;  3NBH B;  1QZH A;  3FTF A;  3I4Y A;  1X65 A;  1IL2 A;  3D4W A;  4KHP L;  3HU3 A;  1HQR D;  1CKN A;  2PNR C;  3F8T A;  3GLI E;  3PUX A;  3KSX A;  3I3C A;  2OF1 A;  2GNO A;  4I81 A;  4U68 A;  2VL6 A;  1ZYR D;  1GUS A;  2B3T A;  4FP5 D;  5A35 A;  5IGC A;  1WTH A;  3OWF A;  1XNR L;  4B9W A;  3RFW A;  1CI3 M;  2F0N A;  1YNJ C;  4X3S A;  1O7I A;  2BH2 A;  4JI2 M;  3AU7 A;  2CVR A;  1SFO H;  3UZU A;  1LTT D;  4IUR A;  4JCV E;  5J39 A;  2CFO A;  3H4J A;  1VCI A;  1H9S B;  2DAK A;  4AIM A;  3GTO H;  3S1M B;  3DA1 A;  1TWH B;  1MKH A;  4LUO A;  4A3F H;  1R9T H;  3NWT A;  1U0L A;  4DXF A;  1B50 A;  2CUZ A;  4LF6 M;  1LYL A;  2J7O A;  2MFI A;  5I9P A;  2ICI A;  1QUS A;  1PJT A;  1Y1W B;  3AJI B;  2YYZ A;  3TSS A;  3VFD A;  4M9X A;  3MHB A;  5GAE C;  4A3E B;  5IP7 G;  4HSV A;  2MR9 A;  1PRT B;  3CCM A;  2E76 C;  4ULL A;  3NWS A;  2E2D C;  4DUZ Q;  3KF8 A;  4DR6 L;  4AYB B;  2AQ2 B;  4DV4 L;  1VF5 C;  2KQ3 A;  4G7O C;  2UUA Q;  4W5W A;  2DN8 A;  4EGV A;  1IY2 A;  2EKF A;  1N36 M;  1CZG A;  2ASB A;  1Y1W G;  2K5N A;  2YQZ A;  1XMO Q;  4DR2 L;  1LTG D;  4A3E G;  2NYZ D;  5GKN A;  1HT2 E;  3Q0A A;  1BF4 A;  4LJ4 A;  5HGT A;  3Q8G A;  2FH0 A;  1B9M A;  1TH4 A;  1R4Q B;  3PQI A;  4XQN A;  4KJO A;  1PGY A;  4AYB G;  4CBV A;  4JI1 Q;  1I3Q H;  2XSC A;  3D4D A;  1PJS A;  3TBI B;  3IAY A;  4NXM M;  1SNP A;  1M1K C;  2XWJ B;  1C9O A;  4GLA C;  3IHP A;  1EQR A;  3PUY A;  1HFG A;  2BCO A;  2R4E A;  4L8J A;  3H91 A;  2F5Q A;  1ZMW A;  4IJF A;  4RNA A;  3K57 A;  2JNH A;  2IT1 A;  3KYH C;  1MJC A;  3DEP A;  3GTO B;  5CV5 A;  4DXG A;  4R4Q A;  2VF8 A;  4A3F B;  2F0J A;  1IBL Q;  1R9T B;  3HOW H;  5IE8 A;  3TEH B;  5HUR A;  2F0E A;  4DUY M;  1VQK A;  2LS0 1;  2KCC A;  5I2X A;  3CCR A;  2OOA A;  2ALY B;  4JOI A;  5K36 H;  4OON A;  4FCT A;  4DV5 L;  2SNS A;  3DFZ A;  1JOO A;  1TF0 B;  1SXJ A;  1H9J A;  3J7A 5;  5M5W H;  2FE8 A;  2I7P A;  2GA4 B;  5IZ7 D;  2UUB M;  3PV0 A;  3T51 B;  4GRI A;  4A3F G;  2B2V A;  3HU1 A;  2Z3X A;  4MHE A;  1A5T A;  1D2B A;  4QHT A;  2KED A;  4IBC A;  1RHP A;  4G4N A;  2HUG A;  3E6Z X;  2SOB A;  3W3A A;  4DUZ L;  2Z7J A;  5EXX A;  3MXN B;  3CF6 E;  4Z9C B;  3SHL A;  1NNJ A;  2UUA L;  1A62 A;  3T1Y Q;  1F2Z A;  3TL4 X;  4HID A;  2JEA I;  2JY8 A;  2BDN A;  2NWG A;  1I4Q A;  2TSS A;  1XMO L;  4UDU C;  2KHH A;  4LMQ D;  4JBW A;  3I01 M;  1I3Q B;  3A7L A;  1SEB D;  4M8A A;  4FF4 A;  3AV0 A;  1TGU A;  1SG9 A;  2KA7 A;  1UEA B;  1IM2 A;  4H13 C;  2K52 A;  2OXP A;  3NTK A;  4YCV A;  4DNI A;  4JI1 L;  5JEA J;  1B9N A;  2WKC A;  3CRK C;  3TWL A;  3TP7 A;  2PMZ B;  3EJI A;  3I56 A;  3I91 A;  3TP6 A;  3QJY A;  1V1O A;  2E2H H;  1CA5 A;  4Y28 F;  2OTL A;  3AKZ A;  3HOV H;  2K4K A;  3HOW B;  4GC5 A;  3K7A H;  1XXH B;  3R9X B;  2R7Z H;  1HCZ A;  5C0X H;  3UGJ A;  3HZX A;  1NUC A;  4TSS A;  4KK7 A;  5KGU A;  3L29 A;  3ZH9 B;  1VQ1 A;  1G29 1;  3M4P A;  3MC0 B;  1K3W A;  3VR3 A;  1W3S A;  3RNU A;  3ULL A;  4IFD H;  3P1H A;  5M5W B;  4DK3 C;  1JB7 A;  2W82 A;  2KDL A;  3SAW A;  3HOW G;  3OMC A;  3A0J A;  4FD2 A;  3UJN A;  3CQZ H;  2R61 A;  1J7K A;  3S9W A;  3KOJ A;  1J5E Q;  4GOP A;  3D8G A;  2KHS A;  2PMZ E;  4L63 B;  4IUP A;  2XZF A;  3QG1 A;  5K36 G;  3V76 A;  2VY3 A;  2B2Y A;  4H7B A;  5C0X I;  1MD2 D;  5GAH C;  2AHO B;  2LWX A;  2WKD A;  5FKA C;  1HR0 Q;  1KDB A;  1XXH E;  1BQQ T;  4IFD I;  4RKB A;  3T1Y L;  3E5S A;  3GV6 A;  1E22 A;  2I5M X;  2VB2 X;  2ATW A;  4KN4 C;  3K8Z A;  4B3R Q;  2ZAN A;  4LY6 A;  3CD6 A;  4YWL A;  5LL6 X;  2O5I C;  2BJW A;  2RA4 A;  1SMX A;  1GAB A;  2HCB A;  5A2Q E;  4LWC A;  2RDH A;  3KK7 A;  2NTT A;  1YIT A;  1R5L A;  1KL9 A;  1ICW A;  5IT9 E;  2OT2 A;  4XT1 B;  2EJG C;  1M90 C;  4ZYS A;  1S5C D;  2E2H B;  3KF6 B;  1BBU A;  2EYF A;  1EY5 A;  1LTA D;  1UM8 A;  5KNB A;  5EAY A;  3HOV B;  1QJO A;  3IRB A;  4I4L A;  3K7A B;  3QOL A;  3WDN A;  4KKT A;  2R7Z B;  3HHZ A;  2WII B;  2K5Q A;  4PNY A;  4B9X A;  1ML0 D;  3L7Z C;  4FDB A;  4WFN 3;  1ASY A;  1NY6 A;  1F2Y A;  4UP9 A;  2SEB D;  5FLX c;  3U61 A;  3AMU A;  2V1C A;  3K0Y A;  3HOV G;  3J80 i;  1KC8 C;  4PMW A;  2R7Z G;  5C0X G;  4UP8 A;  3L9A X;  1TDH A;  4R4T A;  4N8F A;  5DAU A;  2F5P A;  2RRU A;  3HGI A;  1N33 M;  3CMA A;  4IFD G;  1LV9 A;  1J5E L;  3ERS X;  4DV2 M;  4ZLT F;  1LV7 A;  1VQB A;  4HL4 A;  1G6P A;  3BBZ A;  4J8Q A;  2DZL A;  1BCP D;  2UU9 M;  3IFD A;  3FTC A;  2UXC Q;  3NQT A;  5FTJ A;  3RMH A;  3B7N A;  2F3V A;  3TME A;  3SVM A;  2G5G X;  5FLX L;  1D0L A;  1HR0 L;  3A56 A;  5EP3 A;  3NE5 B;  4C1N I;  1B53 A;  3A54 A;  1OFI A;  1KXL A;  2DXI A;  1LTI D;  1PH9 A;  1K9M C;  5IWA Q;  3D3R A;  1SND A;  4B3R L;  4DK6 C;  2ZTE A;  4LF7 Q;  3OYY A;  2X6G A;  4JI3 M;  2NVQ H;  4LJ5 A;  1MHW C;  3WOF A;  4DAV A;  1AEX A;  2OOB A;  3WWV A;  3LCU A;  4BBR H;  3G71 A;  2VDB B;  3J7A V;  4QUC A;  2M00 A;  3PIO A;  1IXS B;  3T38 A;  4JI7 Q;  2V1U A;  1NVM A;  1LAB A;  5IYC H;  1W6K A;  3U6S A;  1M8A A;  4DR4 M;  1EIG A;  2JP7 A;  2BNK A;  2L0C A;  3UK6 A;  4RF1 A;  2E5L Q;  4IN3 A;  1QAM A;  4M0W A;  4P75 A;  4DR1 Q;  1NJG A;  1H9R A;  3IKJ A;  1B1Z A;  4X6A H;  1S4Z A;  4JI6 Q;  4X65 Q;  4DR3 Q;  2R46 A;  4ODG A;  1CUK A;  1N34 M;  1A0I A;  3MK6 A;  4LF4 M;  5KIX A;  3H15 A;  1HTL D;  5ITU A;  1EU3 A;  4QMG A;  4YCW A;  4RKL A;  5IGG A;  1W5S A;  3HEJ A;  1BOS A;  2FFK B;  4ME5 A;  4GN4 B;  4A3D H;  3I4O A;  2F0S A;  4Y52 H;  1PTO C;  1AH9 A;  4PD2 A;  1BR9 A;  2K6A A;  2JA8 H;  1WD0 A;  2UUC Q;  1PFS A;  2UXC L;  1TWC H;  5CGK A;  4MGK E;  2KXE A;  3SE0 A;  3VR5 A;  4DV0 Q;  2HT1 A;  1MBY A;  1QNU A;  2PI2 E;  1W5T A;  4XXE A;  4K5X A;  5JPM C;  1V34 A;  3JAM c;  4JV5 M;  1EFI D;  4JPB W;  4IOC A;  3UMM A;  2NVQ B;  1XYI A;  4DR5 Q;  4XQQ A;  3ONA B;  1TY2 A;  3FUU A;  4BBR B;  2J7Z A;  3W1B A;  4LFB Q;  4HAE A;  4JC0 A;  2A6E C;  1F9R A;  1JWS D;  3IEC A;  2N55 A;  3Q8D A;  2CWB A;  5JOB A;  4F8M A;  3DHQ A;  1ZKO A;  3MTS A;  1IZ6 A;  4BY7 H;  4QCL A;  4JI7 L;  4YY3 Q;  3GTK H;  4CIS A;  4BBR G;  1DJR D;  1I4R A;  4LZJ A;  1U4M A;  3KOY E;  3FYD A;  2RGH A;  3HGB A;  2F0H A;  2E5L L;  5IYC G;  3S14 B;  1UE5 A;  2Z9H A;  4DR1 L;  2EIF A;  5BR8 M;  4U67 3;  3J80 S;  1WOC A;  4X65 L;  1VQE A;  1C0A A;  2EY5 A;  3EN2 A;  3E3X A;  2LNH C;  5KEE A;  4H44 C;  2NVX H;  3UE0 A;  4A3D B;  4R71 A;  2RKS A;  3KBX A;  4KT0 F;  3STB C;  2JA8 B;  5C5L A;  4LFA M;  1TWC B;  3HFZ B;  2EYL A;  2IHF A;  4GNX A;  1XNQ M;  1TU2 B;  1CFM A;  2F3W A;  1HRJ A;  3HHX A;  2UUC L;  1T5X D;  1FD7 D;  4A3D G;  4QB4 A;  1AE3 A;  4PT5 A;  1ZYR C;  3CCU A;  5ELE A;  4APV A;  3KOX E;  4B3M M;  3T53 B;  1GL6 A;  2JA8 G;  1NHW C;  1XMQ M;  1EIJ A;  1KRT A;  1VMP A;  4HCS A;  3K9O A;  1SR3 A;  4QGU A;  3HOU H;  4DR5 L;  3KUP A;  4A3K B;  1VQP A;  2VII A;  1HFN A;  3SXH A;  3SK8 A;  1SYG A;  3EQL C;  1E1O A;  4LFB L;  1S40 A;  2NZH A;  2FFJ A;  4BY7 B;  3GPY A;  3OW7 A;  3SC3 A;  1S3O A;  3E21 A;  1OQY A;  2PO4 A;  3MXG A;  3BDL A;  4A3K G;  2QP9 X;  3FUV A;  4WW0 A;  2XWB B;  1A6X A;  3AOE C;  3C1E A;  4BY7 G;  3KLS A;  4NL4 H;  5IOD A;  2WSC F;  1DOM A;  2A68 D;  1K3B C;  3VYR A;  1EYA A;  3VDU A;  1A2U A;  2YV5 A;  1TDZ A;  2DWN A;  1TS3 A;  5EKK A;  1E2W A;  1W6J A;  2F0D A;  1STN A;  4I65 A;  2VUM H;  4LF9 Q;  2YU9 H;  4QQB X;  4X66 Q;  2AMC B;  2D62 A;  4IQZ A;  2JY5 A;  4A3L H;  2K03 A;  1SE3 A;  2JA7 H;  1JMC A;  3RGS A;  5L8R F;  3AQQ A;  4P17 A;  1CKM A;  3Q22 A;  1WHC A;  3LMM A;  3ITP A;  2Y0S B;  1VEK A;  4AKG A;  4X3U A;  2G8L A;  5CR3 A;  2Q8T A;  3L25 A;  1OIP A;  2VNU D;  1HT1 E;  4IJH A;  5CV4 A;  3HOU B;  1FNW A;  3OIP A;  3GRU A;  3WHL A;  3KJP A;  1VQ7 A;  1YNN D;  2LH0 A;  5C0X J;  2QCU A;  4N9P A;  5BN4 A;  1Q12 A;  2Y0S G;  2EY2 A;  1GKH A;  2DWL A;  3CF0 A;  1SYB A;  4GKJ Q;  2K28 A;  2VW9 A;  5ELC A;  1GD7 A;  1EY6 A;  3I8Z A;  2Q8I B;  3TS2 A;  3HOU G;  4M1U B;  4JYA Q;  5ITX E;  1IL8 A;  3PUV A;  1U4P A;  2L7I A;  4B7H A;  2Y0S E;  1CTM A;  1Z9F A;  3HKP A;  1WTQ A;  4DF7 A;  2XEP A;  1FGU A;  2XFT A;  5FK9 C;  2RHS B;  3RN2 A;  1F9P A;  2LHC A;  1CKN B;  2KZU A;  1QIL A;  2I5L X;  5TSS A;  2ZTC A;  2N78 A;  2VUM B;  1MI2 A;  2YU9 B;  2KVM A;  2AWO A;  5LMU M;  4YWM A;  1K3X A;  1IY0 A;  2JA7 B;  5FJ8 H;  2G3Q A;  3GRR A;  1STB A;  4DV7 M;  3F2B A;  4LF9 L;  1GUN A;  4X66 L;  1LT6 D;  3GPX A;  4O2D A;  2NTS A;  1I94 L;  3E9I A;  4IBJ A;  5D3D A;  2V6Z M;  5NUC A;  2VUM G;  3MEH A;  5ELD A;  1UE1 A;  3GLH E;  4X64 Q;  1FYC A;  2JA7 G;  1JQJ C;  3SR1 A;  3VDP A;  2WAC A;  3RZD H;  2JWS A;  4LF8 M;  2JQO A;  3OW2 A;  2O25 A;  1G8Z D;  4OX9 M;  3CPF A;  1YIJ A;  3ZCB B;  1WFQ A;  3SK6 A;  5ELN A;  3TWK A;  4RKU F;  3KF8 B;  4IZ8 A;  4MNO A;  4BA1 I;  1UE6 A;  1M4V A;  3KP0 E;  1DGG A;  4IBD A;  3HHY A;  4WP2 A;  2K14 A;  4P73 A;  4ALP A;  4HED A;  2UXD M;  1QYR A;  5LMN M;  4UAI A;  1Q81 C;  1PH1 A;  2EXZ A;  4HR7 B;  4JYA L;  1NE3 A;  1B3Q A;  4GLX A;  2ZXR A;  3D6C A;  2DGY A;  1CKO A;  3KLR A;  4GKK Q;  1VQM A;  2MO1 A;  1EIY B;  4LF5 M;  1YJN A;  2ZM6 Q;  5F2D A;  1IBK Q;  5CBA E;  2KNA A;  2WSF F;  1G2T A;  2Q2I A;  1L1O C;  4KY6 A;  3CP0 A;  1R2Z A;  4R4C A;  2B8G A;  2DAM A;  2VQE Q;  3Q8X A;  1R4P B;  5I6Y A;  1HQM C;  1DOK A;  3J81 E;  1Z5C A;  4ZK9 B;  2QNJ A;  3GD7 A;  2FOI C;  5KPT A;  2RCN A;  1G4A E;  4RG1 A;  2MNA A;  1Q90 A;  3KDF A;  5FJ8 G;  2K04 A;  3CKI B;  3GDE A;  4HJ5 A;  2EJM A;  2R7F A;  4K2K A;  3D0F A;  1N9W A;  3RZD B;  1KFV A;  2UXB Q;  5CBE E;  4RWS C;  2PQA A;  1VG5 A;  3CC7 A;  3VA7 A;  2MGW A;  4X64 L;  4LCB A;  1SXJ B;  3GQ3 A;  4JI4 M;  3BU2 A;  4RAU C;  2D7G A;  2DAE A;  2WV6 D;  5JJI A;  3GTP H;  4PCZ A;  1DGB A;  1UNS A;  3NPP A;  3P20 A;  4R8I A;  2EKK A;  1JR3 D;  2MJ5 B;  2GN5 A;  3GP7 A;  1STA A;  4RMF A;  5LMN W;  1PH4 A;  4FVM A;  4KHP Q;  3U4V A;  2CP8 A;  4K5W A;  2A5Y B;  2VQF M;  1IQP A;  4L6V 6;  1NBW A;  2RBM A;  1F77 A;  5KND A;  1RCV D;  1WIV A;  4CDD C;  4OHJ A;  4JI2 Q;  8CAT A;  1Y1V H;  3H09 A;  1Z5B A;  3TP8 A;  5DNF A;  1N77 A;  1QCB D;  5JAV A;  1SBB B;  5C4Z A;  1SXJ E;  5IIF A;  4GKK L;  1VQ5 A;  1GHJ A;  4LJ6 A;  1Z6H A;  3KLS X;  4YIJ A;  3SAU A;  2ZM6 L;  3M7N A;  1BCP C;  4HJ9 A;  5ITR A;  1IYV A;  1ZXT A;  2WFW A;  2EO2 A;  2KNV A;  4M0D A;  2G9H D;  4AKH A;  1L2D A;  3M4Q A;  2F03 A;  1FNN A;  1SSO A;  4TRD A;  2VQE L;  3H6M A;  3NEN A;  1V1P A;  4QNM A;  3QYB A;  4J15 A;  1IYU A;  3I51 A;  2RVL A;  1E2Z A;  3RR5 A;  1SNO A;  3MHV C;  2I5H A;  3LGJ A;  3M7G A;  2G9D A;  2Z1C A;  2G5D A;  1N36 Q;  2DNE A;  1G8P A;  2C96 A;  4AG5 A;  1CQV A;  1XJV A;  1EY7 A;  4NXN L;  2RGO A;  3GTP B;  3F92 A;  3U60 A;  4ZUJ A;  3GLG B;  4GOP B;  1XTD A;  2NBF A;  2KJX A;  1BKB A;  2F0U A;  3T1H L;  3GRV A;  3N52 A;  1XPO A;  1FNV A;  3KSJ A;  1JWM D;  1EWH A;  2F52 A;  3K5O A;  5ELO A;  3NHH A;  1DCZ A;  1Y1V B;  5HY6 A;  2DKL A;  1JB0 F;  2ICE C;  2YTX A;  2IWH A;  4NKL A;  4KTA A;  3L0O A;  5DYI A;  2QKI C;  1WTO A;  2EY6 A;  3I4L A;  3JAM i;  4FXG C;  1Q02 A;  4JI2 L;  4REZ A;  4ITQ A;  1C4Q A;  1A15 A;  3U6C A;  4DBG B;  3GLG E;  3TE6 A;  3DM1 A;  1Y1V G;  3LWE A;  3MZ5 A;  1HUM A;  1JJG A;  1VQN A;  1WJJ A;  1LT5 D;  3J7B A;  1DO0 A;  3KW6 A;  2L4N A;  3T56 B;  3CC4 A;  4G4O A;  4DV5 Q;  2UUB Q;  1O7Y A;  2N88 A;  2QIL A;  2QZ4 A;  1GVN A;  2R93 H;  1V9P A;  1PYW D;  3BXW A;  1EQV A;  4KI0 A;  5JJZ A;  1TS5 A;  1JB3 A;  2K5D A;  1K83 H;  4CDF C;  1QNK A;  3U61 B;  3NQI A;  1YI2 A;  4DA2 A;  5FLX S;  4OO1 H;  4LRT A;  3KFU A;  2KCT A;  1AIP C;  2KCN A;  1N36 L;  5C44 H;  4C3J B;  1GHK A;  1EFU B;  1C7Y A;  1SAP A;  2F0T A;  1ILQ A;  3QOJ A;  1ZAE A;  1UUP A;  5CC4 A;  4K0K M;  3IG5 A;  4ZQ3 A;  3TRZ A;  4R4I A;  3HKZ B;  2EA0 A;  5EPL A;  3CU7 A;  2XSZ A;  1S5F D;  4C3J G;  2D0O A;  5C18 A;  4MGI E;  2DEN A;  3RE8 A;  1STE A;  4NXM L;  5FSW A;  3PO2 H;  4OO1 I;  4KY7 A;  4X62 M;  3E0J A;  4AKI A;  4B3S M;  2KEC A;  4QL5 A;  1K0R A;  1DV0 A;  2F4I A;  1PZK D;  3A7A B;  4ME3 A;  3HKZ G;  2PNH A;  5IP9 H;  1SFO B;  2Q8R E;  4AYB E;  5LL6 S;  1U4R A;  4L5T A;  2R6G A;  5C3X A;  1E1T A;  2XF3 A;  1MU5 A;  4D82 A;  2MH8 A;  1MN3 A;  4NRW A;  4DUY L;  2CRU A;  2J5Y A;  4RFB A;  1Q46 A;  4LNQ A;  5FO9 B;  1IXR C;  4Q5V A;  2B2T C;  2Z4I A;  3HKZ E;  1PRT D;  1GVP A;  2R93 B;  1SXT A;  3C3D A;  2RQX A;  2HWJ A;  4XT3 B;  4LZZ A;  1K83 B;  2NB0 A;  3LWU A;  2UUB L;  3VKH A;  4TVA B;  3U6E A;  2Z4S A;  1PJJ A;  1VEG A;  2QEX A;  5C44 B;  2Q2T A;  4BY1 H;  2DUD A;  3H3V H;  4I7A A;  2QQ8 A;  3D8B A;  1N32 M;  1TS2 A;  2R93 G;  2NUC A;  3GLF A;  1RL2 A;  3BVM A;  3QB3 A;  4FWH A;  2MRO B;  3DOA A;  2H5X A;  4LJA A;  3SAS A;  1BCP F;  1Q3L A;  3HHW A;  4IUN A;  1HXY D;  3J7Y W;  2HD3 A;  2L4E A;  4OO1 G;  1SYE A;  2JYO A;  3FTE A;  1LTM A;  3B6Y A;  3NSW A;  3J80 E;  5KPR A;  4PDI A;  1WYD A;  2FIN B;  3P7J A;  5ELF A;  4C56 C;  5L37 A;  4QIW B;  5C44 G;  4DV3 M;  1TY0 A;  1XXG A;  2B29 A;  3PO2 B;  3PNV A;  5I2Y A;  1Y14 B;  1KDA A;  2F5O A;  1EYG A;  4BXX H;  2A68 C;  5ITT A;  2A6H C;  3L2A A;  1FJG M;  3PFI A;  2XZU A;  1FR3 A;  1VQF A;  3D6W A;  1TH2 A;  3G6J B;  1STH A;  4UHV A;  1GM5 A;  3A5U A;  3H3V I;  4PZ6 A;  2X8A A;  3SK4 A;  3UDG A;  1R7R A;  1HH2 P;  1OKS A;  5EPJ A;  1K0S A;  3JAM S;  4MIU A;  2F0L A;  1D5M C;  4N9T A;  3PO2 G;  4EQO A;  3PIP 3;  4CJ1 B;  4LRS A;  3AL0 C;  2ZXO A;  4JI0 M;  4EQN A;  1U4L A;  2X49 A;  4QOS A;  2A5H A;  2QBY A;  2JY7 A;  3TDQ A;  5IP9 G;  1OXS C;  3W1G A;  1IN6 A;  4QIW E;  1QZM A;  4IUQ A;  5KYL A;  1QVC A;  4KHV A;  4PMB A;  3EFX D;  3PSI A;  3MMP A;  5FTN A;  4D81 A;  2EYO A;  2CW0 D;  5KQ8 A;  4CHT B;  4JI1 M;  3NUC A;  2C9O A;  1B70 B;  4DV2 Q;  2EXD A;  4FWD A;  3A46 A;  1YNN C;  2LVA A;  4UPA A;  1YJW A;  2A73 B;  5I4D A;  1HNW M;  2UU9 Q;  1EIH A;  2KZS A;  1AZP A;  3LVW A;  2LBC A;  3TQY A;  1ZQ9 A;  4PDG A;  2HDM A;  1T3T A;  1CQF A;  1Z59 A;  1IW7 D;  2D9U A;  3ULP A;  2YR0 A;  1YNX A;  3OIQ A;  3U6M A;  1QB5 D;  2FNA A;  1IBL M;  4QHS A;  2ZAO A;  3FUT A;  2XN9 C;  3BG3 A;  2QSF X;  4JI3 Q;  3PVS A;  4GNX B;  1BBX C;  3H0G H;  3K0X A;  2R45 A;  1YEZ A;  1GO5 A;  1CSQ A;  4P72 A;  2XLJ A;  4LUV A;  3AOE A;  3DWQ A;  5J22 A;  1WCM H;  2JZ1 A;  2H4O A;  2KOL A;  1QOH A;  3U9O A;  4Y7N H;  4QY7 A;  4L5R C;  1W2B A;  3NTH A;  4NSO B;  1PV4 A;  4DR4 Q;  4DR7 M;  2F0V A;  1U9R A;  3NBH A;  4S12 A;  1PH6 A;  2F0F A;  4BXX G;  1GO3 E;  4HCE A;  2QDL A;  5D3I B;  4OW0 A;  1YBY A;  3G4S A;  4IPD A;  4DGZ A;  4YHH M;  2BOS A;  3V05 A;  2DY8 A;  3C3L A;  1B8A A;  4EQP A;  2RF4 A;  4LF4 Q;  1QE6 A;  4GN5 A;  2DI0 A;  3SMS A;  5KPZ A;  3FUW A;  1YJ9 A;  2QCP X;  2CKZ B;  3CQZ B;  5JVH 3;  1CT1 D;  2NZO A;  2HHH M;  1YZ6 A;  2Z8L A;  4GEW A;  3UI2 A;  1D5Z C;  2GQF A;  4DV2 L;  3WHK A;  1AUA A;  4IPC A;  2UU9 L;  4KN7 C;  4HJ8 A;  1LM0 A;  3HRZ C;  2CHV A;  5GAG C;  1G91 A;  2XFS A;  1JIC A;  3S17 H;  2E74 C;  2MO0 A;  4FF2 A;  4R9W A;  1Q7Y C;  3LQR A;  4FXK C;  1PJQ A;  3H0G B;  4RGO S;  4WJ4 A;  1Z7T A;  2CH4 A;  1KQS A;  4OIK A;  3N6R A;  4ZAI A;  5IOC A;  3RUZ A;  2IX0 A;  4G3O A;  3GTJ H;  1EQQ A;  3W5O A;  1WCM B;  3GTG H;  4JI3 L;  2JN4 A;  4Y7N B;  2EY1 A;  4RGT A;  4OWT B;  4Q0F A;  4OU7 A;  1AW7 A;  1Y8P B;  4FO2 A;  4A3B H;  4MTK A;  2ZAM A;  2DHY A;  1OXU A;  5C4H A;  2X69 A;  3T6P A;  1DGH A;  3H0G G;  4LFC M;  2L11 A;  3Q6S A;  1QZE A;  2QA4 A;  2JK8 A;  3ICE A;  4DR4 L;  2D7E A;  1WCM G;  3HWS A;  3DZD A;  1YSY A;  5D14 A;  1ET9 A;  5EBC A;  5BR8 Q;  4KY5 A;  2RSN A;  3CCQ A;  2XH9 A;  4K6L A;  1KRS A;  1FNU A;  5F3W A;  1Y69 U;  1N34 L;  1MJE A;  1XHB A;  4LF4 L;  2Y0T A;  1VMC A;  5BN3 A;  2ZTD A;  2PYK A;  4IBG A;  1RJT A;  1DGS A;  4G4R A;  3AFQ A;  2RHQ B;  3FPP A;  3TZD A;  4DK1 A;  3I4M H;  2D7H A;  4EQ5 A;  1H9M A;  4LFA Q;  1PFN A;  2XRS D;  2KHI A;  1BDO A;  4G57 A;  1X3E A;  4C1N K;  5FOB B;  2IJ0 A;  3LCV B;  1NSF A;  4LGY A;  5KQD A;  2VF7 A;  3S17 B;  1G41 A;  5FTK A;  2DZO B;  4V0B A;  3QYE A;  1NCV A;  3JR5 A;  1J8I A;  1LTR D;  3R2I A;  2CWP A;  1PLF A;  3U5Z A;  5EPK A;  3GTJ B;  3GTG B;  4JV5 L;  2Q2E B;  3U6L A;  5D65 A;  3G48 A;  4KKS A;  1JWU D;  2GVA A;  4JBM A;  3ER0 A;  2NVY H;  3B7Z A;  4A3B B;  2IHE A;  2LMC B;  3W67 A;  1UWV A;  1T9H A;  3TP5 A;  1IKL A;  1PJI A;  3MEF A;  4DK0 A;  1EWC A;  3MFG A;  3UDI A;  2NVT H;  2DAI A;  1QUQ A;  2BDO A;  4UY8 C;  4Q7J A;  3SGI A;  2OWO A;  1HJP A;  3FVQ A;  1QVR A;  1L1O A;  5IRE B;  1SMY D;  4B3T Q;  4OVZ A;  1TWA H;  2HDL A;  3J81 c;  1C1K A;  4A3B G;  3PO3 H;  1NNU C;  2HL7 A;  1A2T A;  3JAM L;  1CSP A;  2AKW B;  1XTC D;  3HOZ H;  4M9Z A;  5BR8 L;  2A69 D;  1OIZ A;  2Y20 A;  4LW1 A;  1L1Z A;  4HIO A;  1SDF A;  3VLF B;  3ERQ A;  3I4M B;  5IWA M;  4BLC A;  4JI8 M;  1PM5 A;  4LF7 M;  3DWA A;  2MJ8 A;  3PCO B;  1ASZ A;  3ND8 A;  2EQS A;  1EYD A;  4FWG A;  3GTQ H;  1RF2 D;  1X32 A;  4DV1 M;  4GMQ A;  4IAL A;  4LFA L;  5EXS A;  2PZW A;  4L78 A;  3UE1 A;  4G4K A;  4R8N A;  3HOY H;  1V92 A;  3SYK A;  2N8N A;  3M4O H;  3FEW X;  3I4M G;  3G6E A;  2L1B A;  3DXJ C;  1Q39 A;  1STY A;  2K6B A;  1MIU A;  3FKE A;  5G3L F;  4ZKC B;  2KEE A;  1ONL A;  4AG6 A;  2OQ0 A;  3J7Z C;  2JA5 H;  4QOZ C;  1Y8N B;  3CC2 A;  4B3M L;  2NVY B;  1XMQ L;  4ID6 A;  4JI6 M;  5EKL A;  4DR3 M;  4IJE A;  1L0X B;  1PH2 A;  3S2H H;  2NVT B;  4MH0 E;  3KDF B;  1D7Q A;  1Q8K A;  2PQA B;  1TWA B;  2XTI A;  3GTK B;  1RKN A;  1PHJ A;  2K05 A;  4P2C B;  2F0I A;  3PO3 B;  3KOW E;  4DAP A;  1LT3 D;  2YTV A;  4B3T L;  3JR4 A;  1WGN A;  3J27 B;  4BB9 A;  3KDS E;  1ENF A;  3IL8 A;  3HOZ B;  2APL A;  1NNX A;  5EXT A;  3KF6 A;  1Y8G A;  2EYP A;  4DV0 M;  1HNZ M;  5M3M H;  3SAT A;  3LNN A;  3OPO A;  2KEB A;  1UE7 A;  5C3W A;  3CCE A;  1A3V A;  1IHZ A;  4A75 A;  2F0O A;  4UN2 B;  2A6H D;  3PO3 G;  3OWE B;  5LMU Q;  2JZ0 A;  1ZEQ X;  4DAM A;  3KS4 A;  1EIF A;  1WTX A;  2NVX B;  3HKS A;  5J1Z A;  2ES2 A;  3K92 A;  4DV7 Q;  3HOZ G;  4HLQ A;  1TWF H;  4DFA A;  2DWM A;  4FCW A;  3HOY B;  3M4O B;  3I70 A;  1NAP A;  1U5K A;  1Z6T A;  2GVB A;  1ESR A;  4K2L A;  1I94 Q;  2CQO A;  1GUT A;  3A8J E;  4TUW A;  4II7 A;  4YY3 M;  4G4Q A;  1ICF B;  1GOZ A;  1JJ2 A;  2JA5 B;  1EOT A;  1PRB A;  5JVG 3;  1KNA A;  4IBF A;  4TQU S;  1X3P A;  3T13 A;  5FLM H;  5FO7 B;  5IGB A;  2B2W C;  4LF8 Q;  1S72 A;  3HOY G;  4OX9 Q;  1OAO C;  4B08 A;  1V1P B;  2A74 C;  2LXJ A;  1EY4 A;  4XDX A;  3S2H B;  5M5Y H;  1X3G A;  3AFH A;  4LAA A;  1AZQ A;  1J9O A;  1I5F A;  2WIN B;  2JA5 G;  1GJT A;  3NXW A;  1ENA A;  4KLN A;  2HCI A;  2UXD Q;  5LMN Q;  1A63 A;  1XWE A;  1X6O A;  4IFD J;  3U60 B;  2QGQ A;  1PTO F;  3PGZ A;  3A55 A;  2D0P A;  1PRT C;  5FLX E;  3EIV A;  1YVC A;  1P8L A;  1DOL A;  1X54 A;  4J6H A;  5K5P A;  1WTR A;  4LF5 Q;  5M3M B;  2CV1 A;  2QEN A;  1KAB A;  1STG A;  3T16 A;  3F2D A;  3EVQ A;  3S1R H;  2R6F A;  1NR2 A;  4WJ3 M;  2HIV A;  4OIJ A;  4L4U A;  1D8L A;  4KO8 A;  1VQC A;  4CIZ A;  3VK7 A;  3TS0 A;  2F0W A;  1SYD A;  4L8R C;  3V96 A;  2KUM A;  4H02 A;  4DV6 M;  2WP8 J;  5LMU L;  1PH3 A;  1D0M A;  5M3M G;  3TWM A;  1CHQ D;  3HG9 A;  3I7F A;  4DV7 L;  3M0E A;  4XGI A;  1VQ6 A;  2ZT9 C;  1ZMV A;  2B2U C;  3K58 A;  2R4J A;  1QVG A;  4OEM B;  5C1B A;  2ZJP A;  4POG A;  1HZA A;  1VS0 A;  3R93 A;  2CHB D;  2IY5 B;  4XTC S;  2BJV A;  4JI5 M;  4WRD A;  1PTO H;  1F9S A;  4A3L G;  5M5Y B;  1RTN A;  4NP5 A;  2B63 H;  4LF8 L;  3QR8 A;  1KAA A;  4OX9 L;  2QEJ C;  2L7H A;  4MZ9 A;  3CCV A;  3AB9 A;  3KS8 A;  1X9N A;  4GHL A;  5FLM G;  4MGH A;  2C35 B;  1C8C A;  2ZBK B;  3BZD B;  1X56 A;  1PA6 A;  1VQJ A;  2VQF Q;  2DY7 A;  1SE2 A;  2UXD L;  5LMN L;  4AW4 A;  4LF9 M;  1IXR A;  1VQO A;  1MJG M;  1JE5 A;  2B2T A;  1E2V A;  2CW0 C;  4G6Z A;  3OSO A;  2CWA A;  2F5N A;  3KFU G;  4HJ7 A;  4LGM A;  4NSR A;  3MA2 B;  4LF5 L;  4R1J A;  1GUG A;  1PH5 A;  1PXU A;  3VDY A;  4XK8 F;  2L5T A;  1VF7 A;  4DN4 M;  1MGS A;  1DON A;  3K5L A;  2F4V M;  2R18 A;  4DPG A;  3L26 A;  4F2L A;  3Q24 A;  4JVZ A;  4IOA A;  1IW7 C;  5JJK A;  4C3I H;  3FKI H;  1RTO A;  4NDX A;  4O0A A;  4CKC A;  3VYU A;  1LT4 D;  2BWE A;  4IUV A;  1B7Y B;  4GKJ M;  4UP7 A;  4PZ7 A;  3RN5 A;  1PZJ D;  3FPU B;  2C5C A;  1O78 A;  1UAP A;  2JP1 A;  3GV3 A;  3LX0 A;  3CPW A;  3GQ5 A;  2C5R A;  5EP2 A;  1PTO B;  3CW2 C;  1HA5 A;  4G7H C;  1L1T A;  3F1Z A;  5JPN C;  4NXN Q;  2ERC A;  2F3I A;  3I55 A;  1E94 E;  3B74 A;  1B44 D;  5EKI A;  4E6I A;  4JI4 L;  1HNX M;  1JR0 D;  3W68 A;  1F2M A;  2OCE A;  4ABN A;  2EYH A;  3OTO M;  4A3M H;  3K2L A;  2Y0Q A;  4J1M A;  3EIH A;  3ZJY C;  3T1H Q;  2HQL A;  1L0W A;  1Y8O B;  5T1I A;  2BA1 A;  3GLF B;  1IBM M;  5KO3 A;  3UDF A;  2VQF L;  2QW7 A;  4A3C H;  3QAU A;  2ID0 A;  4ILW A;  5CV9 A;  2B39 A;  1JOQ A;  4G7Z C;  2JXM B;  4JN6 A;  3B7Q A;  1GL7 A;  3BVZ A;  1JE4 A;  3SYL A;  1XPR A;  2LFN A;  4OGQ C;  1B2T A;  5ELB A;  4RHS A;  4P74 A;  3URY A;  4OEL B;  3FKI B;  2AUK A;  1C48 A;  2P5Z X;  4GNX C;  1GXD C;  3B9P A;  3KXE C;  5CV7 A;  2R0I A;  4LF6 Q;  4BWG B;  2L6O A;  1QAQ A;  3GLF E;  2F0K A;  1J09 A;  1D0K A;  2YNM D;  1WTV A;  2RSO A;  1Q86 C;  1XWI A;  3A8K E;  3M9B A;  3ND9 A;  3IG8 A;  4RA8 A;  2QBY B;  2H1E A;  3PUW A;  1SXJ D;  3FKI G;  5IYB H;  4RHR A;  1F9Q A;  5FTL A;  3HY5 A;  4AQY M;  1EYC A;  3BZC A;  5J3B A;  2CV2 A;  5EBD A;  1GLN A;  5ITY A;  5IT9 c;  4D80 A;  2C99 A;  1QQW A;  4A3M B;  4KJN A;  3GRY A;  2PCF B;  1QVF A;  4K0K Q;  1SN8 A;  1AP0 A;  5EP1 A;  1IBK M;  2H1R A;  3S15 H;  2WAQ B;  2M2L A;  1NO1 A;  2EE1 A;  3UDX A;  3A45 A;  2QPA A;  1DD2 A;  2K33 A;  1JT8 A;  1BVS A;  4A3M G;  1KLG D;  4NXM Q;  3SFZ A;  1T5E A;  2CFM A;  3E4R A;  3PNY A;  1TII D;  2CEA A;  2Z8Y M;  5A2Q L;  5GRO A;  1TTE A;  5IT9 L;  2WAQ G;  3A8I E;  2WB1 B;  2O5J C;  4A3C G;  4KOD A;  4FW9 A;  1O7Z A;  1Q3B A;  5AFW A;  2UXB M;  3R2T A;  3VYS A;  1EWI A;  4KD4 A;  3A98 B;  3THG A;  4DUY Q;  4I8O A;  3K5M A;  3C3E A;  1K73 C;  2MP1 A;  1JQY D;  3PXG A;  4R4O A;  4CJ2 C;  2MUY A;  4AI6 A;  2WB1 G;  4YCU A;  2M60 A;  3GLH A;  4OL7 A;  3SMP A;  1EY8 A;  1SJH D;  2SNM A;  3A74 A;  4FCV A;  2V4D A;  4LF6 L;  3J81 i;  3PIP A;  4KHP M;  1WD1 A;  1VDL A;  2L09 A;  1VQ4 A;  4IUT A;  4P71 A;  3AFP A;  1WTW A;  4F1I A;  5BN5 A;  4Z8X A;  2WB1 E;  1HTP A;  2CHQ A;  1N32 Q;  3TQS A;  1SE8 A;  1XNR M;  3CRL C;  4P16 A;  5E4X A;  3A42 A;  3FYC A;  1A3U A;  1X55 A;  3CHB D;  2KA6 B;  1EEI D;  2F0Q A;  5DM6 3;  3S1Q H;  4DAY A;  5I6W A;  2XNA C;  4MB7 A;  3S15 B;  4NC6 A;  1I50 H;  1VQD A;  5EQT A;  5IYB G;  1SMY C;  1Q82 C;  3HU2 A;  3C58 A;  4MN3 A;  4K0K L;  1CM9 A;  1N78 A;  1TT2 A;  3D31 A;  4RH6 A;  2AHM A;  4DV3 Q;  1QAN A;  4PV1 C;  3QO2 A;  4A76 A;  3U9S A;  1LUZ A;  3HJQ A;  2X6L A;  1FJG Q;  2A69 C;  1EY0 A;  3PMF A;  4X62 L;  1BBW A;  2TMP A;  1VEJ A;  2IX3 A;  2JXN A;  5M5X H;  4B3S L;  4A3J H;  1T43 A;  3NBI A;  1B4O A;  3DM3 A;  3K80 C;  3VR2 A;  1NJF A;  1SE4 A;  1TR8 A;  4BBS H;  1IKM A;  4JI0 Q;  4DR6 M;  1N75 A;  4DV4 M;  1DXM A;  2F1M A;  2AQ1 B;  1JR3 A;  2KW0 A;  1DM0 B;  3C9P A;  1NY5 A;  3FDT A;  5E3F A;  1G71 A;  2LXE A;  3QWN A;  2HKJ A;  2FJ2 A;  2DHR A;  4DR2 M;  2CE7 A;  1DGH B;  4GIT A;  3M3Y H;  1KIX A;  1EZ8 A;  4LJ7 A;  1YHA A;  1HNW Q;  2PZU A;  1H95 A;  4FXD A;  1LTS D;  2I46 A;  1AE2 A;  3S1Q B;  1N32 L;  4HMJ A;  1LAC A;  5E7N A;  2J4X A;  3BOS A;  1OFH A;  1I50 B;  3JC6 6;  1VQH A;  3CXC A;  5KYI A;  1SJE D;  4R7G A;  1FVI A;  2EUC A;  4OXP A;  1BUV T;  4MGZ E;  3K59 A;  1RIP A;  4C2M H;  3TRE A;  4K14 A;  4DV3 L;  3BJU A;  2LY7 A;  5IYD H;  3I04 M;  5GQO A;  4QUF A;  1OTC A;  1R6B X;  2KRU A;  3VR4 A;  3FMC A;  4ZRZ A;  5M5X B;  4DV5 M;  1FJG L;  3K8A A;  4PQX A;  4RCO A;  4A3J B;  4DR7 Q;  2DWZ B;  2Z0S A;  3U5Z B;  1D1I A;  4BBS B;  4MTN A;  2ENB A;  3DUZ A;  4Z6Y A;  1IYJ B;  2Z4R A;  4YHH Q;  4DUZ M;  1PZI D;  4IJL A;  5HGQ A;  2Z6B A;  4JI0 L;  1Q3C A;  1V1Q A;  4X3K A;  3M3Y B;  2UUA M;  2K0B X;  2MQH A;  1R2Y A;  1QUQ B;  4A3J G;  4IO9 A;  1ESF A;  5EXP A;  1S3S A;  3BDO A;  5M9O A;  4BBS G;  3K9P A;  1XMO M;  5IGE A;  3I90 A;  1L1O B;  4OVZ B;  3SEB A;  2HHH Q;  2R7D A;  2R92 H;  2AUJ D;  3J81 S;  4K8J A;  2J0T D;  3NTI A;  3DLL A;  1HZC A;  3CCS A;  1N33 Q;  4NPS A;  1HNW L;  5JI3 E;  2NN6 H;  1ET6 A;  4BY1 B;  4AH6 A;  2MPM A;  1JC7 A;  3AEV A;  4B7F A;  4X3T A;  4HIM A;  1XB2 B;  3S24 A;  3DWP A;  3MWY W;  4PG3 A;  2SDF A;  1SNC A;  1NMF A;  4C2M B;  1ZMU A;  1IBL L;  3GLI A;  5ITQ A;  1B3A A;  3ULJ A;  1PH8 A;  3J7A F;  4BY1 G;  1H6U A;  2XGT A;  2DJG C;  5DFL A;  4ZPX A;  1NY4 A;  1ORY B;  2LVO C;  2NN6 I;  3SHF A;  2E2J H;  3GLG A;  2LTU A;  1T6O A;  4AZF A;  2OO9 A;  3FRI A;  4LFC Q;  3GO8 A;  2L9H A;  1XX8 A;  1IFY A;  4IPG A;  5CYU A;  4XQJ A;  3A5Z B;  5IYD G;  4KHZ A;  4DR7 L;  1DGF A;  4WOR A;  4LJ8 A;  3PF5 A;  1NMG A;  1CA6 A;  4NB3 A;  4YHH L;  4GIP A;  3CCJ A;  1KSF X;  1NR4 A;  1G3I A;  2BA0 A;  1K8A C;  3L28 A;  4EIW A;  1Q1E A;  5EP4 A;  1BCP B;  2CHG A;  3GPU A;  3T1Y M;  2R92 B;  1L8Q A;  1N34 Q;  2F5S A;  1L2F A;  4CDC C;  1PFM A;  4A3I H;  2R44 A;  5EJC A;  3SHG B;  2HHH L;  2ZJR A;  1I4G A;  2B2W A;  2Z6K C;  2K5H A;  2DVW B;  3CTW B;  3C1F A;  2OQ4 A;  1E7Z A;  3H4M A;  1H9S A;  5COY A;  1N33 L;  2O5R A;  1DZ1 A;  1HUN A;  3E0E A;  4R3D A;  4FNF A;  3IFT A;  1S5E D;  1ENC A;  4LK1 C;  2R92 G;  1G2S A;  4XYQ A;  1XPU A;  1EE8 A;  1WXQ A;  1S5D D;  2AWN A;  2VS1 A;  2K01 A;  3FRP B;  3QWL A;  1MSH A;  2NN6 G;  1KAW A;  5KNC A;  1GUW A;  2FMC A;  2HIX A;  2PQE A;  4ZCK A;  5CV8 A;  4JV5 Q;  4A3V B;  3R8F A;  1RD9 D;  5CV6 A;  3OMG A;  2E2J B;  3VA5 A;  4RCN A;  1BO0 A;  1D5X C;  2MGS A;  3HOX H;  1IN7 A;  3MJ5 A;  2CCZ A;  2LVQ D;  4C3H H;  5LHY 1;  3KOZ E;  1L2B A;  3OHX C;  3U6O A;  1PMR A;  3FTD A;  4LJ9 A;  2OQK A;  1BXT A;  1KYI A;  4LFC L;  1QDT A;  1J5E M;  1I4W A;  4DNR B;  5E6J A;  3I72 A;  1I4P A;  2BE5 D;  3BDC A;  3GTM H;  3LW5 F;  3S1N H;  1OO9 B;  3HS0 C;  4JXJ A;  1HR0 M;  3L2P A;  2B2U A;  3HJS A;  1J6Q A;  3D8L A; 
#chains in the Genus database with same CATH homology
 4A3I B;  2PW7 A;  4IBK A;  3C46 A;  1Q1B A;  2EJF C;  3M85 A;  4B3R M;  3K5N A;  1D1K A;  1O80 A;  3NK9 A;  1TR5 A;  2ZXP A;  2KRK A;  1HHV A;  1I6V C;  1YE9 A;  2I7N A;  3K1J A;  2O4X A;  4HN7 A;  2CQA A;  4ZUI A;  2FMM A;  4H0L C;  5H37 D;  1HA6 A;  2F0P A;  2M9V A;  1VDD A;  4I5S A;  3RD4 A;  1GUO A;  4GH9 A;  4L6T B;  5FTM A;  3ERO A;  4L16 A;  3HOX B;  1DYQ A;  2VXW A;  3T4A C;  1TH3 A;  3AOG A;  1TKW B;  4C3H B;  3CF2 A;  3MXN A;  5BPV A;  1QG7 A;  4ZKB B;  1YNJ D;  4K6D A;  5T1G A;  4S3S A;  1TVX A;  3MVV A;  5IGD A;  3GTM B;  3S1N B;  4C3H G;  1L2C A;  2UXC M;  3QIA A;  4FYD A;  2RDF A;  3RLF A;  2EYM A;  1K8O A;  1SXJ C;  3VK8 A;  2B2V C;  1EU4 A;  3GP1 A;  3VKG A;  1OJL A;  3SBJ A;  1XXH A;  2RDG A;  3O13 A;  1K8M A;  1YUB A;  4V19 0;  4L15 A;  3J81 L;  4HTH A;  1HQC A;  4RF0 A;  4JI7 M;  3BS1 A;  5C3E B;  3M6A A;  5JI2 E;  3DMU A;  4M9S A;  2O2L D;  5EJW A;  2YFQ A;  3LQQ A;  4NW2 A;  2E5L M;  3ILK A;  3KVW A;  1IN8 A;  4K5V A;  2EDG A;  4DR1 M;  4CKE A;  3R3O A;  4IBB A;  4X65 M;  3SAV A;  4NOO B;  3F2U A;  4KV6 A;  3MAQ A;  2VB3 X;  3OOC A;  1MX0 A;  2EYJ A;  2E75 C;  3VR6 A;  4KKU A;  3G7L A;  3S16 B;  2OEO A;  2OPF A;  1CK1 A;  2XRQ D;  5DM7 3;  4IBE A;  3ZC7 B;  1II3 A;  3M4Y A;  3TZU A;  3I4V A;  1SNM A;  2UUC M;  1MSG A;  4HSP A;  5KRU A;  1CZW A;  1QAO A;  3PIO 3;  5EGT A;  4GHA A;  4NMZ A;  1SNQ A;  2R62 A;  1EL0 A;  5EQ0 A;  5C5M A;  1TS4 A;  2DZN B;  1X3Q A;  2B2Y C;  2QF7 A;  2JE6 I;  4DR5 M;  4BA2 I;  1SYF A;  3GTQ B;  1PFB A;  1I4H A;  2AQ3 B;  1K82 A;  1F2L A;  4LFB M;  3GQ4 A;  1LO5 D;  2DNC A;  3MFY A;  2EZV A;  2L12 A;  1X37 A;  4IIW A;  3GTL B;  2K32 A;  4B3T M;  1GJX A;  3L27 A;  1OXT A;  1EY9 A;  3E9S A;  4A3G B;  1XC8 A;  5CMD A;  2J7N A;  4IBI A;  1EQT A;  4MGY E;  3GQB A;  2C98 A;  1JCK B;  2K5W A;  1QWY A;  1OXX K;  1V8Q A;  2R65 A;  5A2Q S;  1WVL A;  1EZ6 A;  3SAR A;  5IT9 S;  2MHV A;  3U6D A;  3BYY B;  1TWG B;  2QDB A;  2EOT A;  5C4J B;  4K8I A;  5ISR A;  1NSN S;  3EIE A;  1E9S A;  4WJW A;  1IXZ A;  2JSO A;  1A3T A;  5C6A A;  2XGN A;  1H9K A;  3TPZ A;  2EVB A;  1E0B A;  4CJ0 B;  3C2P A;  3KBG A;  5DEH A;  1TWF B;  1ROD A;  1IY1 A;  2E2I B;  3VYT A;  1I4X A;  2PW5 A;  3D4R A;  2F0M A;  2X4A A;  4KMU C;  4WUR A;  2I07 B;  3I4N B;  4RGN A;  1VDZ A;  3GLH B;  5FO8 B;  2K47 A;  1CHP D;  4BS9 A;  4LJZ C;  5E1F A;  3HJ8 A;  4GZY C;  1TQO A;  2K1B A;  3NP8 A;  3BVG A;  3WOE A;  5JEA H;  4A93 B;  4KD3 A;  3W0F A;  5C4X B;  3NWL A;  2LKV A;  5DYG A;  1WTP A;  1KLU D;  1Z5A A;  1I6H B;  2D5D A;  1JOK A;  3R8B A;  4X66 M;  2EPB A;  1V43 A;  5G3L D;  1I94 M;  4RGM A;  3W2D A;  1DO2 A;  2IW3 A;  3S1R B;  3SK5 A;  2NQ8 C;  3PUZ A;  2RKO A;  1G6Z A;  3W0L B;  3MXU A;  3U6Q A;  3S2D B;  3H94 A;  3X3N A;  1SYC A;  4GC9 A;  1E32 A;  1E9R A;  3U6P A;  4QNR A;  5DNY A;  3J7A S;  4F87 A;  5IGF A;  7CAT A;  3X3M A;  3Q23 A;  1HQY E;  3FD9 A;  5E26 A;  2K7V A;  1EEF D;  3ZYY X;  4JYA M;  3JAM E;  1D2N A;  3KP1 E;  1FGB D;  1HPC A;  1BNZ A;  4JK1 C;  2JA6 B;  3GO5 A;  2B63 B;  2HQE A;  4MM3 B;  3V2T A;  2PPB C;  1KNE A;  4DNT B;  3J80 L;  2C9C A;  2NZ1 D;  5M3F B;  3I73 A;  3RZO B;  3FUX A;  4O1N A;  4XYO A;  5JEA G;  1RDP D;  3T15 A;  4FF1 A;  3H3V C;  2XSZ D;  3MXP A;  1IN4 A;  1KTK A;  4IUU A;  3TN2 A;  1NHG C;  1LTB D;  1G59 A;  4F7X A;  4CKB A;  4CGY B;  2CV0 A;  1OXV A;  4X64 M;  2FHT A;  2R3Z A;  4O42 A;  4C3I B;  1GKI A;  1AFP A;  3LVV A;  4DU9 A;  4LG2 A;  2IPK D;  4XIG S;  1PTO D;  5I9O A;  1S5B D;  1PRT F;  2PZT A;  4HMI A;  4PMC A;  3HP3 A;  2P5T A;  2JEB I;  4TKO B;  1JOR A;  4C3I G;  2D2C C;  2F0G A;  1D6E C;  4EVO A;  4BBA A;  4FF3 A;  2Y21 A;  1KDC A;  4GKK M;  1O7L A;  2A6E D;  3BYT B;  3K6O A;  2ZM6 M;  5ITX A;  5E4W C;  2BE5 C;  1LLR D;  3EA6 A;  4I7Z C;  2Z4H A;  3J2P B;  3GPP A;  2HCC A;  2VQE M;  1PDQ A;  1ILP A;  1IN5 A;  4F88 A;  3P75 A;  2XIW A;  1Z47 A;  3GLI B;  2JA2 A;  5COR A;  3DEO A;  1L0Y B;  3SDZ A;  4XBO A;  4B7G A;  2B8F A;  2IL8 A;  4NXN M;  4NRV A;  2M5Z A;  1Q8I A;  4QF4 A;  2IX1 A;  2XVS A;  3RGP A;  1AN8 A;  3T1H M;  3L3O C;  2L55 A;  3FTF A;  3I4Y A;  3D4W A;  3HU3 A;  1HQR D;  2PNR C;  3PUX A;  3KSX A;  3I3C A;  2OF1 A;  4I81 A;  4U68 A;  5A35 A;  1ZYR D;  1GUS A;  4FP5 D;  5IGC A;  3OWF A;  4B9W A;  3RFW A;  1CI3 M;  2F0N A;  1YNJ C;  4X3S A;  4JI2 M;  3AU7 A;  2CVR A;  3UZU A;  1LTT D;  4IUR A;  5J39 A;  2CFO A;  1VCI A;  1H9S B;  3S1M B;  3DA1 A;  1TWH B;  3NWT A;  1B50 A;  4DXF A;  2CUZ A;  4LF6 M;  2J7O A;  5I9P A;  2ICI A;  1Y1W B;  3AJI B;  2YYZ A;  3TSS A;  3VFD A;  4M9X A;  3MHB A;  4A3E B;  4HSV A;  1PRT B;  2E76 C;  4ULL A;  3NWS A;  2E2D C;  3KF8 A;  4AYB B;  2AQ2 B;  1VF5 C;  2KQ3 A;  4G7O C;  4W5W A;  2DN8 A;  4EGV A;  1IY2 A;  1N36 M;  1CZG A;  2YQZ A;  1LTG D;  2NYZ D;  5GKN A;  1HT2 E;  3Q0A A;  1BF4 A;  4LJ4 A;  5HGT A;  1B9M A;  1TH4 A;  1R4Q B;  4XQN A;  4KJO A;  4CBV A;  2XSC A;  3D4D A;  3TBI B;  3IAY A;  4NXM M;  1SNP A;  2XWJ B;  3PUY A;  1HFG A;  2BCO A;  2R4E A;  4L8J A;  3H91 A;  4IJF A;  2F5Q A;  4RNA A;  3K57 A;  2IT1 A;  3DEP A;  3GTO B;  5CV5 A;  4DXG A;  4A3F B;  2F0J A;  1R9T B;  5HUR A;  2F0E A;  4DUY M;  2LS0 1;  2KCC A;  5I2X A;  5K36 H;  4FCT A;  2SNS A;  3DFZ A;  1JOO A;  1SXJ A;  1H9J A;  2FE8 A;  2I7P A;  2GA4 B;  5IZ7 D;  2UUB M;  3PV0 A;  3T51 B;  4GRI A;  2B2V A;  3HU1 A;  2Z3X A;  4MHE A;  1D2B A;  4QHT A;  2KED A;  4IBC A;  1RHP A;  4G4N A;  2HUG A;  3E6Z X;  2SOB A;  3W3A A;  2Z7J A;  5EXX A;  4Z9C B;  3CF6 E;  3SHL A;  1NNJ A;  1F2Z A;  3TL4 X;  2JEA I;  2BDN A;  2NWG A;  1I4Q A;  2TSS A;  4UDU C;  4LMQ D;  4JBW A;  1I3Q B;  3A7L A;  1SEB D;  4M8A A;  4FF4 A;  3AV0 A;  1TGU A;  2KA7 A;  1UEA B;  1IM2 A;  4H13 C;  2OXP A;  3NTK A;  5JEA J;  1B9N A;  2WKC A;  3CRK C;  3TWL A;  3TP7 A;  2PMZ B;  3EJI A;  3I91 A;  3TP6 A;  3QJY A;  1V1O A;  1CA5 A;  3AKZ A;  3HOW B;  4GC5 A;  1XXH B;  3R9X B;  1HCZ A;  5C0X H;  3UGJ A;  3HZX A;  1NUC A;  4TSS A;  4KK7 A;  5KGU A;  3L29 A;  3ZH9 B;  1G29 1;  3MC0 B;  1K3W A;  3VR3 A;  4IFD H;  3P1H A;  5M5W B;  2W82 A;  3SAW A;  3OMC A;  4FD2 A;  3UJN A;  2R61 A;  1J7K A;  3S9W A;  3D8G A;  2KHS A;  4L63 B;  4IUP A;  2XZF A;  3QG1 A;  5K36 G;  2B2Y A;  4H7B A;  5C0X I;  1MD2 D;  2LWX A;  2WKD A;  5FKA C;  1KDB A;  1BQQ T;  4IFD I;  4RKB A;  3E5S A;  3GV6 A;  2VB2 X;  4KN4 C;  3K8Z A;  2ZAN A;  4LY6 A;  5LL6 X;  2O5I C;  2BJW A;  2RA4 A;  2HCB A;  5A2Q E;  2RDH A;  3KK7 A;  2NTT A;  1ICW A;  5IT9 E;  2OT2 A;  4XT1 B;  2EJG C;  4ZYS A;  1S5C D;  2E2H B;  2EYF A;  1EY5 A;  1LTA D;  1UM8 A;  5KNB A;  3HOV B;  1QJO A;  4I4L A;  3K7A B;  3QOL A;  3WDN A;  4KKT A;  2R7Z B;  3HHZ A;  2WII B;  2K5Q A;  4PNY A;  4B9X A;  1ML0 D;  3L7Z C;  4WFN 3;  1NY6 A;  1F2Y A;  2SEB D;  3U61 A;  3AMU A;  2V1C A;  3K0Y A;  4PMW A;  5C0X G;  3L9A X;  1TDH A;  5DAU A;  2F5P A;  3HGI A;  1N33 M;  4IFD G;  1LV9 A;  4DV2 M;  4ZLT F;  1LV7 A;  4HL4 A;  4J8Q A;  1BCP D;  2UU9 M;  3IFD A;  3FTC A;  3NQT A;  5FTJ A;  3RMH A;  3TME A;  2F3V A;  3SVM A;  5FLX L;  2G5G X;  3A56 A;  5EP3 A;  3NE5 B;  4C1N I;  1B53 A;  3A54 A;  1OFI A;  2DXI A;  1LTI D;  3D3R A;  1SND A;  2X6G A;  4JI3 M;  4LJ5 A;  3WOF A;  4DAV A;  1AEX A;  3J7A V;  4QUC A;  2M00 A;  1IXS B;  3T38 A;  2V1U A;  1NVM A;  1LAB A;  1W6K A;  3U6S A;  1M8A A;  4DR4 M;  1EIG A;  2BNK A;  2L0C A;  3UK6 A;  4RF1 A;  4IN3 A;  1QAM A;  4M0W A;  1NJG A;  1H9R A;  3IKJ A;  1B1Z A;  1S4Z A;  2R46 A;  4ODG A;  1N34 M;  3MK6 A;  4LF4 M;  5KIX A;  1HTL D;  5ITU A;  1EU3 A;  4QMG A;  4RKL A;  5IGG A;  1W5S A;  3HEJ A;  1BOS A;  2FFK B;  4ME5 A;  2F0S A;  1PTO C;  4PD2 A;  1BR9 A;  2K6A A;  1WD0 A;  5CGK A;  4MGK E;  2KXE A;  3SE0 A;  3VR5 A;  1MBY A;  1QNU A;  1W5T A;  4XXE A;  4K5X A;  5JPM C;  4JV5 M;  1EFI D;  2NVQ B;  3UMM A;  1XYI A;  4XQQ A;  3ONA B;  1TY2 A;  3FUU A;  4BBR B;  2J7Z A;  4HAE A;  2A6E C;  1F9R A;  1JWS D;  2N55 A;  5JOB A;  4F8M A;  3DHQ A;  1ZKO A;  3MTS A;  4QCL A;  4CIS A;  1DJR D;  1I4R A;  4LZJ A;  1U4M A;  3KOY E;  3FYD A;  2RGH A;  3HGB A;  2F0H A;  3S14 B;  5BR8 M;  4U67 3;  3J80 S;  2EY5 A;  2LNH C;  5KEE A;  4H44 C;  4A3D B;  2RKS A;  3KBX A;  2JA8 B;  5C5L A;  4LFA M;  1TWC B;  2EYL A;  1XNQ M;  1TU2 B;  1CFM A;  2F3W A;  1HRJ A;  3HHX A;  1T5X D;  1FD7 D;  4QB4 A;  4PT5 A;  1ZYR C;  5ELE A;  3KOX E;  4B3M M;  3T53 B;  1GL6 A;  1NHW C;  1XMQ M;  1VMP A;  4HCS A;  3KUP A;  4A3K B;  2VII A;  1HFN A;  3SXH A;  3SK8 A;  1SYG A;  3EQL C;  4BY7 B;  2FFJ A;  3GPY A;  3OW7 A;  3SC3 A;  2PO4 A;  3MXG A;  3BDL A;  2QP9 X;  3FUV A;  4WW0 A;  2XWB B;  1A6X A;  3AOE C;  3C1E A;  3KLS A;  4NL4 H;  5IOD A;  1DOM A;  2A68 D;  3VYR A;  1EYA A;  3VDU A;  1A2U A;  1TDZ A;  2DWN A;  1TS3 A;  5EKK A;  1E2W A;  1W6J A;  2F0D A;  1STN A;  4I65 A;  2D62 A;  4IQZ A;  2K03 A;  1SE3 A;  3RGS A;  3Q22 A;  3LMM A;  3ITP A;  2Y0S B;  4AKG A;  4X3U A;  2G8L A;  5CR3 A;  2Q8T A;  3L25 A;  2VNU D;  1HT1 E;  5CV4 A;  3HOU B;  1FNW A;  3OIP A;  3GRU A;  3WHL A;  1YNN D;  2LH0 A;  5C0X J;  2QCU A;  4N9P A;  5BN4 A;  1Q12 A;  2EY2 A;  2DWL A;  3CF0 A;  1SYB A;  2K28 A;  5ELC A;  1EY6 A;  3I8Z A;  2Q8I B;  4M1U B;  5ITX E;  1IL8 A;  3PUV A;  1U4P A;  2L7I A;  4B7H A;  1WTQ A;  1CTM A;  3HKP A;  4DF7 A;  2XEP A;  2XFT A;  5FK9 C;  1F9P A;  1QIL A;  2KZU A;  5TSS A;  2VUM B;  1MI2 A;  2YU9 B;  2KVM A;  2AWO A;  5LMU M;  1K3X A;  1IY0 A;  2JA7 B;  3GRR A;  1STB A;  4DV7 M;  1GUN A;  1LT6 D;  3GPX A;  2NTS A;  4IBJ A;  5D3D A;  2V6Z M;  5NUC A;  3MEH A;  5ELD A;  1FYC A;  1JQJ C;  3SR1 A;  3VDP A;  2WAC A;  4LF8 M;  1G8Z D;  4OX9 M;  3ZCB B;  3SK6 A;  3TWK A;  4IZ8 A;  4BA1 I;  1M4V A;  3KP0 E;  1DGG A;  4IBD A;  3HHY A;  4HED A;  2UXD M;  1QYR A;  5LMN M;  4UAI A;  2EXZ A;  4HR7 B;  2ZXR A;  3D6C A;  3KLR A;  4LF5 M;  5F2D A;  5CBA E;  1G2T A;  4KY6 A;  1R2Z A;  2B8G A;  3Q8X A;  1R4P B;  5I6Y A;  1HQM C;  1DOK A;  3J81 E;  1Z5C A;  4ZK9 B;  3GD7 A;  2FOI C;  5KPT A;  1G4A E;  1Q90 A;  2K04 A;  3CKI B;  2EJM A;  4K2K A;  3RZD B;  1KFV A;  5CBE E;  4RWS C;  3VA7 A;  4LCB A;  1SXJ B;  3GQ3 A;  4JI4 M;  4RAU C;  2D7G A;  2WV6 D;  4PCZ A;  1DGB A;  1UNS A;  3NPP A;  3P20 A;  4R8I A;  1JR3 D;  3GP7 A;  1STA A;  4FVM A;  4K5W A;  2A5Y B;  2VQF M;  1IQP A;  2RBM A;  1F77 A;  5KND A;  1RCV D;  4OHJ A;  8CAT A;  3H09 A;  1Z5B A;  3TP8 A;  5DNF A;  1N77 A;  1QCB D;  5JAV A;  1SBB B;  5C4Z A;  1SXJ E;  5IIF A;  1GHJ A;  4LJ6 A;  1Z6H A;  3KLS X;  4YIJ A;  3SAU A;  3M7N A;  1BCP C;  5ITR A;  1IYV A;  1ZXT A;  2EO2 A;  4M0D A;  2G9H D;  4AKH A;  1L2D A;  2F03 A;  1FNN A;  1SSO A;  4TRD A;  3H6M A;  1V1P A;  4QNM A;  1IYU A;  3I51 A;  2RVL A;  1E2Z A;  1SNO A;  3MHV C;  3M7G A;  2G9D A;  2Z1C A;  2DNE A;  1G8P A;  2C96 A;  4AG5 A;  1CQV A;  1EY7 A;  3GTP B;  2RGO A;  3U60 A;  4ZUJ A;  3GLG B;  2NBF A;  2KJX A;  2F0U A;  3GRV A;  3N52 A;  1FNV A;  3KSJ A;  1JWM D;  1EWH A;  3K5O A;  3NHH A;  1DCZ A;  1Y1V B;  2IWH A;  2ICE C;  4NKL A;  4KTA A;  5DYI A;  2QKI C;  1WTO A;  2EY6 A;  3I4L A;  4FXG C;  4REZ A;  4ITQ A;  1C4Q A;  1A15 A;  3U6C A;  3TE6 A;  3DM1 A;  3LWE A;  3MZ5 A;  1HUM A;  1LT5 D;  3J7B A;  1DO0 A;  3KW6 A;  2L4N A;  3T56 B;  4G4O A;  1O7Y A;  2N88 A;  2QIL A;  2QZ4 A;  1GVN A;  1PYW D;  4KI0 A;  1EQV A;  5JJZ A;  1TS5 A;  1JB3 A;  2K5D A;  1QNK A;  3U61 B;  3NQI A;  4DA2 A;  5FLX S;  4OO1 H;  4LRT A;  2KCN A;  4C3J B;  1GHK A;  1SAP A;  2F0T A;  1ILQ A;  3QOJ A;  1ZAE A;  1UUP A;  5CC4 A;  4K0K M;  3IG5 A;  4ZQ3 A;  3HKZ B;  2EA0 A;  5EPL A;  3CU7 A;  2XSZ A;  1S5F D;  4C3J G;  5C18 A;  4MGI E;  3RE8 A;  1STE A;  4OO1 I;  5FSW A;  4KY7 A;  4X62 M;  3E0J A;  4AKI A;  4B3S M;  2KEC A;  2F4I A;  3A7A B;  1PZK D;  1SFO B;  2Q8R E;  5LL6 S;  1U4R A;  5C3X A;  2R6G A;  2XF3 A;  1MU5 A;  4D82 A;  4NRW A;  4RFB A;  5FO9 B;  1IXR C;  4Q5V A;  2B2T C;  2Z4I A;  1PRT D;  2R93 B;  1SXT A;  2RQX A;  4XT3 B;  4LZZ A;  1K83 B;  2NB0 A;  3LWU A;  3VKH A;  3U6E A;  2Z4S A;  1PJJ A;  5C44 B;  3D8B A;  1N32 M;  1TS2 A;  2NUC A;  3GLF A;  3BVM A;  3QB3 A;  4FWH A;  4LJA A;  3DOA A;  3SAS A;  1BCP F;  1Q3L A;  3HHW A;  4IUN A;  1HXY D;  3J7Y W;  4OO1 G;  1SYE A;  2JYO A;  3FTE A;  3NSW A;  3J80 E;  5KPR A;  4PDI A;  2FIN B;  3P7J A;  5ELF A;  4C56 C;  4QIW B;  4DV3 M;  1TY0 A;  1XXG A;  3PO2 B;  3PNV A;  5I2Y A;  1KDA A;  2F5O A;  2A68 C;  5ITT A;  2A6H C;  3L2A A;  1FJG M;  3PFI A;  2XZU A;  1FR3 A;  3D6W A;  3G6J B;  1TH2 A;  1STH A;  2X8A A;  3SK4 A;  1R7R A;  5EPJ A;  3JAM S;  4MIU A;  2F0L A;  1D5M C;  4N9T A;  4EQO A;  3PIP 3;  4CJ1 B;  4LRS A;  3AL0 C;  2ZXO A;  4JI0 M;  4EQN A;  1U4L A;  2X49 A;  4QOS A;  2A5H A;  2QBY A;  3TDQ A;  1OXS C;  1IN6 A;  1QZM A;  4IUQ A;  5KYL A;  4KHV A;  4PMB A;  3EFX D;  5FTN A;  4D81 A;  2EYO A;  2CW0 D;  5KQ8 A;  4CHT B;  4JI1 M;  3NUC A;  2C9O A;  4FWD A;  3A46 A;  1YNN C;  2A73 B;  5I4D A;  1HNW M;  1EIH A;  2KZS A;  1AZP A;  3LVW A;  1ZQ9 A;  4PDG A;  2HDM A;  1T3T A;  1CQF A;  1Z59 A;  1IW7 D;  2D9U A;  2YR0 A;  3OIQ A;  3U6M A;  1QB5 D;  2FNA A;  1IBL M;  4QHS A;  2ZAO A;  3FUT A;  2XN9 C;  3BG3 A;  3PVS A;  1BBX C;  2R45 A;  2XLJ A;  3AOE A;  3DWQ A;  5J22 A;  2H4O A;  2KOL A;  1QOH A;  3U9O A;  3NTH A;  4NSO B;  4DR7 M;  2F0V A;  1U9R A;  3NBH A;  4S12 A;  2F0F A;  4HCE A;  5D3I B;  4OW0 A;  4DGZ A;  4YHH M;  2BOS A;  3V05 A;  2DY8 A;  3C3L A;  4EQP A;  1QE6 A;  3SMS A;  5KPZ A;  3FUW A;  2QCP X;  3CQZ B;  5JVH 3;  1CT1 D;  2HHH M;  2Z8L A;  3UI2 A;  1D5Z C;  3WHK A;  4KN7 C;  3HRZ C;  2CHV A;  1G91 A;  2XFS A;  1JIC A;  2E74 C;  4FF2 A;  4R9W A;  3LQR A;  4FXK C;  3H0G B;  4RGO S;  1Z7T A;  4OIK A;  3N6R A;  4ZAI A;  5IOC A;  3RUZ A;  2IX0 A;  1WCM B;  4Y7N B;  2EY1 A;  4RGT A;  4Q0F A;  4OU7 A;  1AW7 A;  1Y8P B;  4FO2 A;  2ZAM A;  1OXU A;  5C4H A;  2X69 A;  1DGH A;  4LFC M;  2L11 A;  3Q6S A;  2D7E A;  3HWS A;  3DZD A;  1YSY A;  5D14 A;  1ET9 A;  5EBC A;  4KY5 A;  2RSN A;  2XH9 A;  4K6L A;  1FNU A;  5F3W A;  1Y69 U;  1XHB A;  2Y0T A;  1VMC A;  5BN3 A;  2PYK A;  4IBG A;  1RJT A;  4G4R A;  3TZD A;  4DK1 A;  3FPP A;  2D7H A;  1H9M A;  1PFN A;  2XRS D;  4C1N K;  1BDO A;  4G57 A;  5FOB B;  2IJ0 A;  1NSF A;  4LGY A;  5KQD A;  3S17 B;  1G41 A;  5FTK A;  2DZO B;  4V0B A;  1NCV A;  3JR5 A;  1J8I A;  1LTR D;  3R2I A;  1PLF A;  3U5Z A;  5EPK A;  3GTJ B;  3GTG B;  2Q2E B;  3U6L A;  5D65 A;  4KKS A;  1JWU D;  4A3B B;  2LMC B;  3TP5 A;  1IKL A;  1PJI A;  4DK0 A;  1EWC A;  3MFG A;  2BDO A;  3FVQ A;  1QVR A;  5IRE B;  1SMY D;  4OVZ A;  2HDL A;  1C1K A;  1NNU C;  2HL7 A;  1A2T A;  3JAM L;  1XTC D;  4M9Z A;  2A69 D;  2Y20 A;  1L1Z A;  1SDF A;  3VLF B;  3ERQ A;  3I4M B;  5IWA M;  4BLC A;  4JI8 M;  1PM5 A;  4LF7 M;  3DWA A;  2MJ8 A;  3ND8 A;  1EYD A;  4FWG A;  1RF2 D;  1X32 A;  4DV1 M;  4GMQ A;  4IAL A;  5EXS A;  2PZW A;  4L78 A;  4G4K A;  4R8N A;  3SYK A;  3FEW X;  2L1B A;  3DXJ C;  1Q39 A;  1STY A;  3FKE A;  5G3L F;  4ZKC B;  2KEE A;  1ONL A;  4AG6 A;  4QOZ C;  1Y8N B;  2NVY B;  4ID6 A;  4JI6 M;  5EKL A;  4DR3 M;  4IJE A;  1L0X B;  2NVT B;  4MH0 E;  1TWA B;  3GTK B;  1RKN A;  2K05 A;  4P2C B;  2F0I A;  3PO3 B;  3KOW E;  4DAP A;  1LT3 D;  3JR4 A;  3J27 B;  4BB9 A;  3KDS E;  1ENF A;  3IL8 A;  3HOZ B;  5EXT A;  2EYP A;  4DV0 M;  1HNZ M;  3SAT A;  3LNN A;  3OPO A;  2KEB A;  5C3W A;  1A3V A;  1IHZ A;  2F0O A;  2A6H D;  3OWE B;  1ZEQ X;  3KS4 A;  1WTX A;  2NVX B;  5J1Z A;  3K92 A;  4HLQ A;  4DFA A;  2DWM A;  4FCW A;  3HOY B;  3M4O B;  3I70 A;  1NAP A;  1Z6T A;  1ESR A;  4K2L A;  1GUT A;  3A8J E;  4TUW A;  4II7 A;  4YY3 M;  4G4Q A;  1GOZ A;  2JA5 B;  1EOT A;  5JVG 3;  1KNA A;  4IBF A;  4TQU S;  1X3P A;  3T13 A;  5FO7 B;  5IGB A;  2B2W C;  2A74 C;  4B08 A;  1V1P B;  4XDX A;  3S2H B;  1EY4 A;  3AFH A;  4LAA A;  1AZQ A;  1J9O A;  2WIN B;  3NXW A;  1ENA A;  4KLN A;  2HCI A;  1XWE A;  4IFD J;  3U60 B;  1PTO F;  3A55 A;  1PRT C;  5FLX E;  1DOL A;  4J6H A;  5K5P A;  1WTR A;  5M3M B;  2CV1 A;  2QEN A;  1KAB A;  1STG A;  3T16 A;  3EVQ A;  1NR2 A;  4OIJ A;  4L4U A;  4KO8 A;  3VK7 A;  2F0W A;  1SYD A;  4L8R C;  3V96 A;  2KUM A;  4DV6 M;  2WP8 J;  3TWM A;  1CHQ D;  3HG9 A;  3M0E A;  4XGI A;  2ZT9 C;  2B2U C;  3K58 A;  2R4J A;  5C1B A;  3R93 A;  2CHB D;  4XTC S;  2BJV A;  4JI5 M;  4WRD A;  1PTO H;  1F9S A;  5M5Y B;  1RTN A;  4NP5 A;  1KAA A;  2QEJ C;  2L7H A;  3AB9 A;  3KS8 A;  4GHL A;  4MGH A;  1C8C A;  2ZBK B;  3BZD B;  2DY7 A;  1SE2 A;  4AW4 A;  4LF9 M;  2B2T A;  1E2V A;  2CW0 C;  4G6Z A;  3OSO A;  2F5N A;  3KFU G;  4LGM A;  4NSR A;  3MA2 B;  1GUG A;  1PXU A;  2L5T A;  1VF7 A;  4DN4 M;  1MGS A;  1DON A;  3K5L A;  2F4V M;  2R18 A;  3L26 A;  3Q24 A;  1IW7 C;  1RTO A;  4NDX A;  4CKC A;  3VYU A;  1LT4 D;  4IUV A;  4GKJ M;  1PZJ D;  3FPU B;  2C5C A;  1O78 A;  1UAP A;  2JP1 A;  3GV3 A;  3LX0 A;  3GQ5 A;  2C5R A;  5EP2 A;  1PTO B;  1HA5 A;  4G7H C;  1L1T A;  5JPN C;  2ERC A;  1E94 E;  1B44 D;  5EKI A;  4E6I A;  1HNX M;  1JR0 D;  1F2M A;  4ABN A;  2EYH A;  3OTO M;  3K2L A;  2Y0Q A;  4J1M A;  3EIH A;  1Y8O B;  5T1I A;  2BA1 A;  3GLF B;  1IBM M;  5KO3 A;  3QAU A;  2ID0 A;  4ILW A;  5CV9 A;  2B39 A;  1JOQ A;  4G7Z C;  2JXM B;  4JN6 A;  1GL7 A;  3BVZ A;  1JE4 A;  3SYL A;  2LFN A;  4OGQ C;  1B2T A;  5ELB A;  4RHS A;  3URY A;  3FKI B;  2AUK A;  1C48 A;  1GXD C;  3B9P A;  3KXE C;  5CV7 A;  4BWG B;  1QAQ A;  2L6O A;  2F0K A;  1J09 A;  1WTV A;  2YNM D;  2RSO A;  1XWI A;  3A8K E;  3ND9 A;  3IG8 A;  4RA8 A;  2QBY B;  2H1E A;  3PUW A;  1SXJ D;  4RHR A;  1F9Q A;  5FTL A;  4AQY M;  1EYC A;  2CV2 A;  5EBD A;  1GLN A;  5ITY A;  4D80 A;  2C99 A;  1QQW A;  4A3M B;  4KJN A;  3GRY A;  2PCF B;  1AP0 A;  5EP1 A;  1IBK M;  2H1R A;  2WAQ B;  2M2L A;  2EE1 A;  3A45 A;  2QPA A;  1DD2 A;  2K33 A;  1KLG D;  3SFZ A;  1T5E A;  3E4R A;  3PNY A;  1TII D;  2CEA A;  5A2Q L;  5IT9 L;  3A8I E;  2WB1 B;  2O5J C;  4KOD A;  4FW9 A;  1O7Z A;  1Q3B A;  5AFW A;  2UXB M;  3R2T A;  3VYS A;  4KD4 A;  3A98 B;  3THG A;  4I8O A;  3K5M A;  2MP1 A;  1JQY D;  3PXG A;  4CJ2 C;  2MUY A;  4AI6 A;  2M60 A;  3GLH A;  4OL7 A;  3SMP A;  1EY8 A;  1SJH D;  2SNM A;  4FCV A;  2V4D A;  4KHP M;  1WD1 A;  2L09 A;  4IUT A;  1WTW A;  5BN5 A;  4Z8X A;  1HTP A;  2CHQ A;  3TQS A;  1XNR M;  3CRL C;  4P16 A;  5E4X A;  3A42 A;  3FYC A;  1A3U A;  3CHB D;  5DM6 3;  2KA6 B;  1EEI D;  2F0Q A;  4DAY A;  5I6W A;  2XNA C;  4MB7 A;  3S15 B;  5EQT A;  1SMY C;  3HU2 A;  3C58 A;  4MN3 A;  1CM9 A;  1N78 A;  1TT2 A;  3D31 A;  4RH6 A;  2AHM A;  1QAN A;  4PV1 C;  3QO2 A;  3U9S A;  3HJQ A;  2X6L A;  2A69 C;  1EY0 A;  3PMF A;  2TMP A;  2IX3 A;  3NBI A;  1B4O A;  3VR2 A;  1NJF A;  1SE4 A;  1IKM A;  4DR6 M;  1N75 A;  4DV4 M;  1DXM A;  2F1M A;  2AQ1 B;  1JR3 A;  2KW0 A;  1DM0 B;  1NY5 A;  3FDT A;  5E3F A;  2LXE A;  3QWN A;  2HKJ A;  2FJ2 A;  2DHR A;  4DR2 M;  2CE7 A;  1DGH B;  4GIT A;  1EZ8 A;  4LJ7 A;  2PZU A;  4FXD A;  1LTS D;  2I46 A;  3S1Q B;  4HMJ A;  1LAC A;  2J4X A;  3BOS A;  1OFH A;  1I50 B;  5KYI A;  1SJE D;  4R7G A;  2EUC A;  1BUV T;  4MGZ E;  3K59 A;  4K14 A;  2LY7 A;  4QUF A;  1R6B X;  2KRU A;  3VR4 A;  3FMC A;  4ZRZ A;  5M5X B;  4DV5 M;  4PQX A;  4RCO A;  4A3J B;  2DWZ B;  3U5Z B;  1D1I A;  4BBS B;  2ENB A;  3DUZ A;  4Z6Y A;  2Z4R A;  4DUZ M;  1PZI D;  1Q3C A;  4X3K A;  3M3Y B;  2UUA M;  1R2Y A;  1ESF A;  5EXP A;  1S3S A;  3BDO A;  5M9O A;  1XMO M;  5IGE A;  3I90 A;  4OVZ B;  3SEB A;  2AUJ D;  3J81 S;  4K8J A;  2J0T D;  3NTI A;  5JI3 E;  2NN6 H;  1ET6 A;  4BY1 B;  2MPM A;  1JC7 A;  4B7F A;  4X3T A;  3DWP A;  3MWY W;  2SDF A;  1SNC A;  4C2M B;  3GLI A;  5ITQ A;  1B3A A;  3J7A F;  1H6U A;  4ZPX A;  1ORY B;  2NN6 I;  3SHF A;  4AZF A;  3GLG A;  3GO8 A;  2L9H A;  1XX8 A;  5CYU A;  4XQJ A;  4KHZ A;  1DGF A;  4WOR A;  4LJ8 A;  1CA6 A;  4GIP A;  1KSF X;  1NR4 A;  1G3I A;  2BA0 A;  3L28 A;  4EIW A;  1Q1E A;  5EP4 A;  3GPU A;  2CHG A;  3T1Y M;  1BCP B;  2R92 B;  1L8Q A;  2F5S A;  1PFM A;  5EJC A;  3SHG B;  1I4G A;  2B2W A;  2DVW B;  3CTW B;  3C1F A;  2OQ4 A;  5COY A;  3H4M A;  1H9S A;  1DZ1 A;  1HUN A;  2O5R A;  4R3D A;  4FNF A;  3IFT A;  1S5E D;  1ENC A;  4LK1 C;  1G2S A;  4XYQ A;  1EE8 A;  1WXQ A;  1S5D D;  2AWN A;  2K01 A;  3FRP B;  3QWL A;  1MSH A;  2NN6 G;  5KNC A;  1GUW A;  2FMC A;  2PQE A;  5CV8 A;  4A3V B;  3R8F A;  1RD9 D;  5CV6 A;  3OMG A;  2E2J B;  3VA5 A;  4RCN A;  1BO0 A;  1D5X C;  2MGS A;  1IN7 A;  3MJ5 A;  5LHY 1;  3KOZ E;  1L2B A;  3OHX C;  3U6O A;  1PMR A;  3FTD A;  4LJ9 A;  1BXT A;  1KYI A;  1J5E M;  1I4W A;  4DNR B;  5E6J A;  3I72 A;  1I4P A;  2BE5 D;  3BDC A;  1OO9 B;  3HS0 C;  4JXJ A;  1HR0 M;  2B2U A;  3HJS A;  3D8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...