3NBKA

Phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4'-phosphopantetheine
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
158
Chain Sequence
HMTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Kinetic, thermodynamic, and structural insight into the mechanism of phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 54
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3nbkA00
4ZCTA 5AHWA 2PZBA 4P2BA 1K4MA 3TS1A 5LM3A 1EFVB 3OTWA 3AKZA 1N78A 4EFKA 1ZH6A 3A4IA 1WXIA 1OBHA 3F3MA 3NBAA 1B6TA 3CLSC 3IODA 4DE5A 5TGTA 4ARCA 2ZUEA 1XJQA 1V47A 3MUEA 3AL0C 1IQ0A 1RQGA 2CYAA 1T9GR 4JYZA 1NSYA 3RHSA 1BS2A 4ZCQA 5KHAA 1NP7A 1VLHA 2I1LA 4PBTA 1WJGA 3N9IA 5TEWA 1TEZA 1I6MA 5LLTA 2PIDA 4MUFA 1EFPA 1KH3A 2EJCA 4YMIA 1IQRA 3ISJA 4U7JA 2J5BA 1T6XA 1WY5A 2D13A 3FG9A 4R0NA 3ND5A 5DEOA 1O0CA 3AFHA 3CVVA 1LI5A 1O5TA 1OWNA 5DASA 1O0BA 1NUQA 3RK0A 1T9GS 5F23A 2CV1A 1MBZA 1OWPA 3MLBA 4ZT5A 1EFVA 4R2LA 1KP3A 4MW0A 4A91A 2D54A 4MUIA 3COZA 3ZXSA 3CVXA 1COZA 3UMVA 4JFAA 4XFJA 2YY5A 3GLVA 3D6VA 3IMGA 2PZ8A 3HFJA 2VXOA 1KH2A 2QUKA 3SZ3A 1PG2A 1F7VA 5HUHA 1TYDE 3HZRA 3RFFA 4UZFA 2CT8A 3H97A 4MVWA 2OV4A 3COWA 3P52A 2J4DA 4AS1A 4MLPA 1N2EA 4MVYA 1KR2A 4H3SA 3QE4A 2G36A 2PFSA 2AKEA 1GN8A 3IOBA 1O97C 2CYCA 3KT3A 4MUEA 2X0KA 1X6VA 1YULA 4PBRA 3ZXIA 1X8XA 1JECA 4HK4A 1O95C 1U7DA 1YIAA 2E21A 3ZJTA 3PNVA 3FI0A 4R2MA 2DERA 5J58A 5FO0A 5HG0A 1MB9A 4ZCSA 1R6TA 1TQ8A 1N3LA 4KKVA 1JZSA 3AG5A 3X1JA 3COYA 4HJRA 3UOWA 1NUPA 2TS1A 1I2DA 1TYCA 4MWCA 4X0EA 1J21A 2HZ7A 1HYBA 1T6YA 3Q4GA 3FDXA 4MUJA 3MXTA 3CLSD 4PBSA 2RE8A 3ZGZA 1OD6A 3CLRD 2NZ2A 3CVUA 2QTMA 1VL2A 5FO1A 4EG7A 5HUJA 3NBKA 4Q93A 3FY4A 3M5WA 1G8FA 2Z08A 2A84A 2XRZA 2H29A 2RD2A 3PNYA 3VGJA 1R6UA 2PG3A 4MW5A 1J09A 3SEQA 1ULHA 4ZCPA 2BYTA 1KKUA 1Q77A 4EGAA 4CDNA 4MUHA 1F7UA 4WNYA 3FWKA 2OQ2A 2DR2A 2EL7A 4MUGA 4EG6A 3PRHA 3C8ZA 3IDFA 1H3FA 3SZGA 4G5FA 1JIJA 4GRIA 1NYLA 4F4HA 1ILEA 1YIDA 2CSXA 4DDKA 1MOPA 3HGMA 3CLRC 3A2KA 1EUYA 3IUEA 1N77A 4I6EA 3KT8A 5H16A 3FH0A 2CV0A 1IVSA 1JZQA 4ZT4A 4MAFA 1PFWA 3FHJA 1O94C 1TFUA 1T6ZA 2XRYA 3IOCA 3Q10A 1GZUA 1O97D 1O96B 1QNFA 2HMAA 5BNZA 1IHOA 1IQUA 2A88A 3ELBA 2E89A 1O95D 4NAUA 4S1OA 3JXEA 2QTNA 3U1VA 3X1KA 2A7XA 1EUQA 2O5RA 2X1LA 1VBKA 1ZUNA 1U7XA 4XSVA 3LCJA 4NATA 4ZT6A 2QJFA 1QJCA 3DO8A 1OWOA 4JZYA 2WB2A 4J76A 4KR7A 3COVA 2A1TR 1I6LA 4I6JA 2R5WA 4UZEA 1OBCA 1M8PA 3OP1A 4MUKA 4MW2A 2WQ7A 2WQ6A 1PG0A 5DK4A 1KQPA 2QUIA 4PY2A 5FNZA 4ND6A 4DNXA 3IVGA 4QREA 1M1ZA 1FFYA 4G6ZA 3Q12A 3LE8A 1O96A 3AIIA 3GUZA 3H99A 5EKDA 3X1MA 2BTEA 1I6KA 2DPLA 1YUNA 4YBRA 1LW7A 2A1TS 3IH5A 1MAWA 4RUKA 4DJAA 4BWVA 3TQIA 2DXIA 1GTSA 1JGTA 1XNJA 4U63A 1NZJA 3ILVA 1S4MA 2A1UA 4EF6A 1QU2A 5K0TA 3A04A 4MWDA 1WQ4A 5H7XA 1EJ2A 4NDAA 1JILA 1KORA 1Y42X 2O8VA 3SP1A 1K97A 4ND7A 3ZUGA 3PXUA 1G59A 3ND7A 4HPWA 3SEZA 1WOYA 3P0JA 1NUTA 2YWBA 1EXDA 1QRUA 5IJXA 1PFVA 1ZH0A 4JXZA 2ZP1A 2IP1A 3FETA 2WSIA 1MRZA 1M83A 1QQTA 2H2AA 4JXXA 4ZT7A 1JIIA 1WZ2A 2AG6A 1J20A 1O94D 3UY4A 1WQ3A 1KP2A 2DUMA 2QJTA 3CLUC 4ARIA 1EE1A 3TQOA 2Z09A 4MW9A 3E27A 3CLTC 1WXHA 4KR9A 1CT9A 4G5YA 2DEUA 3P0IA 2GOYA 4ZT3A 2CFOA 3H9BA 1J1UA 1OWMA 1LI7A 3PNBA 4ZT2A 1K4KA 1MB2A 4WSOA 4YP5A 3ND6A 4DLPA 4OJMX 3H9CA 3KFLA 1N2IA 3MLAA 1PFUA 3BL5A 1Q15A 4MVCA 3RJZA 3IOEA 1YI8A 4MWEA 2IELA 1WXGA 3TZEA 1UFVA 4MW1A 3S3TA 5IHXA 4K0RA 3INNA 2V0GA 1TYAE 1GLNA 1F4LA 2QTRA 2YXNA 4XFDA 1KQOA 3GMIA 3L93A 3N2YA 1V8FA 1P7PA 5JBNA 1N1DA 4FZJA 3P0HA 1Q19A 3UK2A 1IH8A 1M8KA 1WXFA 4QBTA 3UC5A 1M8FA 4NX2A 1MJHA 4DDHA 1QRTA 2DLCX 3CA8A 4EG4A 4QRDA 5TEVA 3CR8A 1GAXA 5J5AA 2CUZA 2CYBA 2A86A 1JIKA 5K0SA 2Z3VA 2A1UB 3G5AA 1N2HA 1Q11A 4KPUB 1WKBA 1PFYA 1XNGA 4MVXA 3IVXA 2YWCA 1OWLA 4YP6A 1NUUA 1JHDA 2C5SA 2E0IA 2VTBB 3G59A 1M8JA 3D6UA 4NAHA 4CQNA 1U3DA 4L2IB 5LFAA 3LOQA 4DDMA 2QUJA 2CV2A 4KR6A 1GPMA 2X3FA 1J70A 1SURA 4MULA 3KT6A 4Q16A 3IMEA 1D2RA 1M8GA 1QTQA 2PZAA 1G8HA 4MWBA 1MC1A 2A4MA 1TYBE 4NZPA 3QTTA 4MW7A 1U0BB 3FOCA 3CLUD 4MW4A 1F9AA 4HJXA 1KAQA 4MQ6A 3CLTD 1JMVA 1MAUA 4MW6A 3IUBA 3QTBA 4KPUA 1G8GA 1A8HA 3DPIA 3N05A 1DNPA 3IVCA 4YP7A 2E18A 3K9WA 5TS2A 5DB4A 1FYDA 1J1ZA 3VU8A 2J08A 1N2GA 2ZUFA 3DLAA 3TNJA 4E1AA 1KH1A 2VTBA 2GM3A 2JANA 3TZLA 4EG3A 1IRXA 4EG1A 4OUDB 3FIUA 4L2IA 1N2JA 4J75A 4CT0A 2GKSA 2X1MA 1R6XA 4EG5A 1N2OA 3I05A 1N2BA 1YUMA 3L92A 3FNRA 1QRSA 3RBAA 3NV7A 4MUNA 1K92A 1VBNA 2J09A 4ZCRA 1QU3A 1NUSA 3HL4A 3CVYA 1JEDA 1WXEA 2V0CA 3RK1A 5J59A 4U8HA 5KCMA 3K32A 1NURA 4EG8A 1ZJWA 4AQ7A 2B7LA 1U3CA 2QUHA 3ZIUA 5KWVA 3CVWA 4K03A 4I6GA 3SYTA 4CDMA 3MMXA 2NSYA 1GTRA 3G6KA 4GU5A 3DV2A 2IJGX 2PXHA 1H1TA 4RPIA 2JAXA 2DETA 2HGZA 1N75A 1NI5A 3ZJUA 1O6BA 3H05A 3AG6A 1KQNA 3A05A 4OUDA 2QJOA 3VRHA 2J07A 3N8HA 1H3EA 1KAMA 1IFXA 3HV0A 2AZXA 1JEEA 1EFPB 3IMCA 4F3RA 2D5BA 2JA2A 3SDBA 3HMQA 3ZJVA 1H3NA 4TS1A 3KT0A 1VBMA 1XNHA
chains in the Genus database with same CATH superfamily
4IIJB 3IALA 4L78A 3N3AC 3VHQA 2BMVA 4II2A 1P1IA 3BJRA 5LM3A 3BHIA 4DLUA 1CQWA 1VPEA 3AKZA 2AN3A 1TVKB 3NBAA 3A4IA 2Z8XA 3RCBA 1A97A 1KI2A 1TO2E 1T1GA 3KHKA 1JE1A 1CZLA 1B8UA 5FJIA 3JD4A 2ZUEA 5AJYA 1Y9AA 5J2TB 3AM1A 4C6TB 1NN0A 3PEVA 1QQ7A 4CKBA 5JPCA 3N8GA 1UXHA 4L0DA 4Q3OA 3AILA 3FR8A 4JKYA 5ALXA 5FPPA 4C6HA 1ODIA 2J41A 2ZQZA 3G0BA 4JJZA 3NORA 3VH3A 1B6RA 3IA7A 5DCWA 3QFRA 4KOEC 5E6RA 4LOHA 4ESHA 1X2BA 5K3FB 4KVGA 5CRIA 1R6BX 3RARA 4OI4A 1AB6A 2A5JA 2EF1A 2YZGA 3IEXA 2ZRPA 4GXRA 3WDKA 1SWWA 4EI7A 2WIBA 5ALFA 5CCEA 1P3Y1 2FN8A 4G8BA 2FXIA 5IZCA 2RH8A 1JTVA 3SBDA 4KK4A 1GYPA 2HTFA 1D0VA 3FB4A 3GB9A 3FJYA 4JJIA 3AB8A 3F7NA 1RXUA 4JOQA 5K3CA 5DE3A 4AY3A 3LT4A 2W2KA 5BSEA 4P98A 1GILA 3TE6A 4UM5A 3A1FA 3KEMA 3PUYA 5IC6A 4D98A 3ZV5A 4UM9B 1C8BA 4MIEA 5A03A 4YAUA 4IDQA 4CF6A 3PG5A 3FYSA 3UA4A 1D3AA 4MW0A 5EZ5A 1YDGA 1ZD5A 2WILA 3PPIA 4G1UC 3T3PB 2BGNA 3A27A 2IZ0A 5HIAA 3ZNNA 1C29B 2KS6A 3MK31 1XRPA 1IBKB 2JRLA 1T1JA 2I6XA 1KNXA 4L9AA 4RCVA 2Q0SA 1TJNA 2BIFA 3GLTA 4QOGA 4MKXA 3IPLA 1VLZA 2AK3A 3BQ9A 1H05A 4C5AA 1XEXB 4PHCA 5H83A 1GQFA 5JXIA 2ZR0A 3HZRA 1J7KA 1K27A 2QTCA 1I3LA 2I34A 3H97A 3ONNA 1XTZA 1SG0A 2GK7A 3EZ2A 5ISMA 3QF7A 4N5NA 3GUHA 2L69A 4U5QA 3WGQA 3IEVA 1TAUA 5KS2A 4J1TC 3F9CA 1Z4PX 4RMHA 5T6BA 2PH1A 2CYCA 3R23A 2DPXA 4NFHA 2QX9A 3CEHA 3GW8A 1T3TA 4BNXA 3R44A 4TSRA 4KAFA 3H6HA 4LRWA 2Y67A 1GRCA 4JUAA 2YQ4A 4YDSA 4I2NA 4MVJE 4MZXA 5FAXA 3IXQA 3T38A 3WMXA 5AM4A 5KMGB 4FDLA 1Z5ZA 2JATA 1I4DD 2R47A 1UOQA 3V80A 2Q46A 3IBCA 4RH3A 3H2KA 2F59A 4FMPA 1VHLA 3EF3A 2X4DA 2XUGA 1DEAA 4GW3A 2VSFA 4MSUA 1B23P 2H51A 2GM9A 3QKWA 4I8DA 1JU4A 1TMYA 1Z5OA 2WHPB 4PINA 4Z6KA 1ABBA 2GPNA 2LCFA 2Q3DA 1RAGA 1QZTA 3NT2A 4JA0A 4Q6BA 1V8OA 3DE4X 4GKVA 4GNKA 3OM8A 1JB9A 4R1UA 3V4ZA 2HZ7A 1JEJA 1T6YA 2VTKA 2NZJA 4CTNA 3BMNB 3KUCA 2EWMA 3UXMA 4MUJA 4A6DA 5JWHA 4DMUB 1P6QA 1P2SA 5I7OA 1YE3A 3MXTA 4MVJG 3VJLA 4MLDA 3QEJA 5KNCD 2QW8A 3ROQA 3D3WA 4TX1A 3JQ9C 2JD0A 3AHFA 2WWGA 2HF2A 3BIJA 3K6KA 2WG0A 2C9ZA 1Q7GA 2VYND 3E9DA 4UVEA 4CM1A 1KFKB 1OPXA 1XN4A 1C4KA 1EWYA 1Z62A 3KE8A 1CJKC 4JP2A 3UMSA 3D0RA 2FK7A 4PF1A 1WSWA 3DO5A 2HZBA 2P3LA 1KDVA 3KQSA 1GCIA 1HXHA 2OXTA 4C2AA 1XVAA 2R3SA 2Z57A 2FWNA 4CLDA 4WLNA 1TGVA 3KYJB 4RHFA 4X90A 2GAJA 3O3MB 3TYXA 2QLJA 5H68A 5H3LA 3DOJA 2GARA 3DFKA 1OBVA 3IXLA 3U5ZB 3NWJA 1EP9A 1JZTA 2R2GA 2RK6A 3NC1C 3DDSA 4L8LA 1O54A 4AX4A 3SVZA 3V1TC 1AMOA 1PX0A 3QW4B 5B12A 4V1CA 1PV1A 3V4SA 1PGPA 4DR5B 3PUKA 1JTFA 5IKOA 3ZIAA 1KJIA 2XT0A 5JDIA 5DM0A 1LW6E 4LXUA 4JASB 1F7UA 4EITA 3LQKA 3GA0A 3MJSA 4JVSB 4P83A 4Q4HB 3ADCA 4RF4A 1JQAA 2PGLA 4W9NA 3TQHA 3D2BA 4M83A 3U3JA 3SMQA 2XQKA 4ZOLB 1FRZA 2H1SA 2OQ2A 2JL1A 3KDSE 4JBLA 1D2CA 4B7ZA 4IQ8A 4B7AA 1CFZA 4KQ2A 1HEIA 1I0ZA 2KPOA 3R5XA 1MGPA 3PHBE 3G7UA 3P4YA 4B6QA 3G1TA 5L3QB 2QN3A 4HGPA 2AVDA 1W59A 4N6GA 2H2WA 2H0QA 3GJ8A 1RPNA 3DOHA 1UM8A 2JS7A 5AKXA 3FCSB 3EXEA 2LIVA 4BVGA 1UPTA 1UBUS 2JHGA 1E5VA 3BKXA 4AP5A 4HWKA 1FTQA 3VR0A 5B1HA 2OD9A 4NJEB 1XK7A 1MEOA 3K0AB 1GG9A 3LCCA 4K5QA 4PAWA 3F5FA 2QTTA 2XX3A 3L1JA 2ODTX 2WW8A 4OJTA 3ETJA 4KO8A 2OGZA 4P3XA 4BO0A 3EZ7A 4ZREA 3UB4A 4JY7A 3PPXA 4R2XA 5F7OA 1O95D 4YXWD 2X6RA 5A9TA 3FWHA 4LOJA 4M9SA 5IVIA 2VSNA 4AMBA 2CJYA 2PHZA 1OAAA 4AJNA 1RJWA 2B5WA 2JHAA 4B83A 4WZAA 1VBKA 2OWEA 1JQDA 4ZJPA 5CLFA 1GG8A 3AVQA 4YUWA 1R0ZA 4JZYA 8LDHA 2FPGB 5IH7A 1EWKA 1GFWA 1GTJ1 3ICOA 3COVA 2ORYA 2SCUA 4FW8A 3BGWA 1HORA 1QV7A 2R5WA 3M82A 3MZ0A 3E05A 4IH9A 2VQEB 3NYIA 1GLGA 3RIEA 4QJIA 3KBBA 1R0BA 3TQTA 2HV8A 2OCKA 5C8XA 2FEKA 1YL6A 3EARA 1D2EA 3MMPA 4GRDA 2D06A 2YQ5A 1SU8A 2LE0A 4KUEA 3NHPA 4XVUA 4PYLA 3KQKA 4ROTA 1WKVA 2RGBA 1CUHA 2Y77A 3LP5A 2FCAA 2FCRA 4YLYA 5H80A 1FNCA 4A73A 4LKRA 1FFXA 3AT1A 3L7IA 1I5RA 3B6IA 2ECKA 1JH8A 2JKVA 3AIOA 5DTQA 3Q7TA 2XMDA 1IBLB 2PAFA 6NULA 1E6LA 4IG9A 3GGSA 3CKLA 4HHEA 3ICQB 1XHFA 5IBRA 3ASYA 4XYBA 4G0NA 1N0HA 1D04A 3TQIA 3IV9A 4Q6WA 3VXKA 5A1JA 4C78A 4DSOA 1Z5GA 1E1DA 3GFGA 3I9FA 4HAUA 4JC0A 4YQEA 4D0SA 5FV4A 3K94A 2NTJA 2IF0A 2NTNA 4YLEA 3UF0A 1S89A 1TQ6A 1XEWY 4P7FA 4B40A 1PNRA 5BOSA 1U9CA 1SRRA 2OYSA 2BEKA 4JGGA 3KR2A 4FOPA 1K7SN 4AJJA 3W5AA 3NC0C 2R8ZA 3ORQA 1KEPA 2BHSA 3I12A 1M2NA 1DU4A 2O0HA 1Y9EA 3PNQA 4Q4AA 1SVSA 4AXBA 5KPDA 1QK4A 1AV6A 5DI3B 5KNBD 1R10A 4I66A 1FRVA 2C2HA 4HL6A 4OQFA 5JHGB 1PVOA 3Q5EA 1Y0BA 3RNOA 4BFSA 3AF0A 3PLAE 3C16C 3TEFA 1XDGA 3I53A 2FWAA 1SUIA 2IT1A 5CW2A 3ETGA 2BISA 3M1LA 4LZLA 4I14A 1R4NB 4MYTA 2O19A 4DCVA 2LCIA 2IDJA 4JLOA 1SB9A 2YHIA 4RIHA 4ENVA 4UBKA 1CEQA 3UQYS 1YVDA 5FBQB 1W35A 2NN3C 3CF6R 1DAEA 2PS3A 3G68A 4XM1A 5TC4A 3EDOA 5B30A 2GPWA 2J7PD 3GT7A 4GZMA 5EXTA 4JUIA 4X63A 4DF3A 1FYFA 4OQ4A 3A10A 2VPZA 4RV5A 1DE0A 1H0RA 2G5GX 2IE8A 3D81A 4L72A 1WZIA 3P9CA 1ELOA 5DM4A 1KK0A 3K31A 5C4MA 4BFYA 5KVAA 1GZVA 2P67A 4Z3KA 3WRYA 2EVWX 4TZKA 5KKAA 3Q8MA 2BR3A 2I7XA 2E1PA 3S2SA 1TE2A 1O2DA 3ON5A 3HN7A 3BWMA 4ZU3A 2OGSA 1T9AA 2PDAA 2ZYAA 5K5EA 1W0KD 1EB9A 2GAIA 1DBIA 5BVHA 2OSVA 3WRWA 1CEXA 2PJUA 5DNEA 3FTEA 1TGYA 2Q4DA 4QD3A 4YIKA 3VNSA 4A2CA 2BE9A 3RC3A 2WAYA 2PH3A 2IEZA 2OVFA 1Q15A 3JALA 5I47A 4MK4A 5J1SB 1FDSA 4M36A 3MTJA 4OB6A 1QVZA 4YAKA 2EF0A 1M2VB 1T35A 1WXGA 2Z95A 5DFAA 4DBLE 5LN1A 3LRXA 3UXHA 3HDGA 2O7VA 1QDUA 2MJLA 5A3JA 4N3BA 4U6NA 1H4VB 1W0JA 2AEMA 2FQQA 1OQAA 2X15A 4LMRA 1SRQA 1BD4A 1TYAE 2MSKA 5DM60 2ZZKA 4N03A 4US1R 5E8JA 4HDCA 5JEEA 1JYEA 2PU7A 4MHTA 1FZQA 2XA1A 1FQJA 4G1EB 1R88A 1US8B 1JT9A 4DEXA 4LY9A 1JFVA 4AF6A 3IX7A 3S2YA 5FPTA 2VBGA 1ACJA 2DOKA 5SICE 5CXXA 3RF7A 1G1AA 4RABA 1N2XA 3M70A 3CW2A 3PK0A 4ZICA 5B4TA 2OO7A 1TAHA 3NVMB 3QUBA 2PKQP 4PEVA 2ODWA 1DBRA 5GM1A 2DLCX 1NASA 4B2YA 2R2AA 4CF7A 1CUGA 3ZR4B 1YMUA 2GUWA 2P41A 3IJRA 1KJWA 1TMGE 1Z0DA 2YYSA 1DAGA 1NR1A 3SU8A 3WQHA 4E46A 1JHUA 2PO5A 2ZCVA 3QFSA 4OBBA 4B33A 3DBRB 2J1LA 3C39A 4G4JA 2HR1A 3RIMA 3II6X 5BWLA 1J06A 4TKZA 3QKRB 1BOOA 2EEPA 2WQZA 4JC5A 2JK0A 4ZVNA 3EVBA 3JX9A 2G09A 2NXCA 4WY8A 3N2LA 3QXJA 1X8JA 1TECE 3QWBA 3VOBA 3L7LA 5E3IA 3H5OA 2R68A 1NE2A 2QUZA 4L2IB 5DHRA 1GUZA 4EUKA 1VHJA 5BWCA 2GBCA 4E15A 1WZUA 4A4DA 1UDCA 2V59A 2X3FA 4TQGA 4WFIA 2F3UA 4XXHA 3NYWA 5IXSA 4CL0A 4UD6A 4E51A 1SC6A 2HSZA 1R6AA 2C7QA 1M8GA 3C98A 3ITKA 1G8HA 1PL6A 2P1ZA 2QAIA 2WFLB 1N8TA 2HBQA 3K7EA 3DMTA 1EINA 1OB2A 2AFHE 1I3NA 4GGMX 4M0CA 4HEQA 2HSGA 1Z34A 4CIWA 3L6UA 1YOBA 3PNMA 1R15A 4HY3A 3T8YA 1P5JA 4QWWA 4RTSA 1BXGB 1CUZA 1R18A 3BILA 5KJ6A 4N5HX 1XFAA 2GHTA 3KSMA 2PMCA 4GEGA 3V6LA 4CTMA 2I3BA 4TTJA 3E5RA 5F5NA 1XCBA 4TRMA 3UMMA 2DHEA 4TQUS 1CY8A 3FNIA 3Q11A 4RTJA 1OMOA 5LBIA 3RAGA 4PLGA 3EZLA 1PQPA 3UKJA 2GD2A 3B3FA 1J8VA 4HDNB 5HRCA 3DLAA 1AX9A 1KOFA 4XVCA 1SXGA 2P11A 5AIBA 5ALVA 1P9WA 3TW4A 4I1OA 3M3DA 3FWZA 4Q4CA 3QI7A 3SC2B 4E22A 1IOVA 4RKQA 2NLOA 4ISCA 4BOYA 1A5ZA 3HJNA 3W5HA 2W83A 1HMPA 2HCFA 4FYVA 5E1DA 3T1TA 4ATNA 1R6XA 2FWMX 4JR2A 3L02A 1N2BA 3PT9A 3KOZA 5B55A 5GZ3A 4ALMA 4NDNE 3KP1A 2ZITA 4TTPA 4D96A 3KAJA 4HC4A 2VOJA 2ATVA 3RYFA 1QU3A 2DU8A 2BH9A 2VEDA 1NXQA 4QUEA 3V1KA 1LNQA 1Q0SA 1NHGA 1UWKA 3OZVA 4YY3B 1U3CA 4K03A 5T8KA 3QE0A 1U0LA 4R5MA 1P60A 1FTYA 1ZA2A 2W6JA 3QI2A 4JP3A 3W04A 3W77A 4NNPA 3G6KA 4IEIA 2WJJA 3NTOA 1D0IA 1BFUA 4RD1A 1SQ0A 2C8VA 3TWOA 4DLVA 1KYWA 1JWLA 3M33A 2ID9A 2VQDA 1XTVA 2ZVJA 4E2XA 3LA8A 2O3RA 2PUWA 2ODPA 1JVSA 2PXHA 3H5TA 3NR2A 4HMOA 5EPUA 5A5VA 2JDIA 2VSQA 4XX0B 4ZVKA 5HCUA 5JNTA 4CM8A 2JLCA 3HJUA 1OE0A 1UKCA 4YRLA 4F9EA 1EDOA 5A1TA 3WV4A 3PUJA 2YTZA 5EGNA 5LDHA 1EDBA 4WUVA 3ZE7A 1NVEA 1B41A 2IYRA 3PGA1 3WGJA 1RBYA 2QA5A 4X94A 1NI4A 3G5TA 4UASA 3VC2A 4JXJA 1KI7A 5LZ5A 3VRHA 3HTXA 4I1PA 2FWBA 1OXUA 3H9JA 5K4AA 1PZHA 2QM0A 3I5AA 3VSDA 1JDPA 1N7GA 1P91A 221PA 2Q5HA 3JWEA 4ZZIA 2MT9A 4BEJA 5JJBA 4EUFA 3HI6A 2ZBUA 4V0NA 4ABYA 1XZDA 1MIOB 1XGKA 1JAHA 2H2IA 3CY6A 1JLMA 1MAAA 4K86A 1FS4A 3WWYA 4IZHA 5JNUA 1ZRHA 1KE2A 4NPAA 1MP0A 1YB1A 2OV3A 5AHWA 4ZANA 3F96A 1K4MA 4M0FA 3TIVA 1A7JA 1SGWA 2A5FA 1PKXA 2D4HA 1II8A 2YHUA 3LKZA 3ZDRA 4HVCA 3OFVA 5EHZA 3EZGA 1B6TA 1NDUA 1G291 3V8RA 1TJYA 3OOHA 5CYPA 1XJQA 2REXB 2HLPA 3KSUA 3PE3A 5EIOA 4DVGA 2O5EA 2ONZA 5FD8A 5GM2A 3CXUA 2VP3A 2QY9A 2XB6A 1D2HA 3ROMA 4G1MB 3OVMA 1UZNA 1S8OA 4N3AA 1X1AA 1OXBB 2HLHA 2CFSA 3EW7A 4F2WA 4YRPA 1ZGJA 3IGFA 1NP7A 1E61A 1S2GA 2COUA 3FA2A 3NGMA 3NTRA 2BKVA 2REQA 3WA7A 2HX1A 1BJTA 4XWKA 1J0AA 2H07A 2YJ5A 4XFKA 3PFIA 2YYZA 1Q7BA 1B7GO 4QULA 3HE3A 2HDNB 1NF9A 2VDQB 4CODB 4Z1OA 5MFPA 4D8VA 3EUEA 3LFHA 4HRAA 4E88A 2J8ZA 3VDRA 1L4UA 2Q5QA 3QFCA 1L9KA 4RSRA 1JA0A 4TRRA 1P9OA 1ST3A 5KSYA 4HGRA 3WHIA 1VRVA 3MWLA 1VSVA 1NUQA 2QPAA 2ZE6A 5DASA 1PTKA 4BO8A 1AO0A 2Z5GA 3ECSA 3R24A 3H4IA 2ANCA 4NJOA 4Y2GA 1GR1A 3FGZA 3NHBA 1MQSA 3R0QA 2OMKA 2RGGA 3I92A 3BD7A 2ZIXB 3VHXA 1CCWA 4LCBA 3QLVA 4HEHA 3KOOA 1JR3E 4CM9D 1M73E 3ZGYA 5IC5A 1L7AA 1T1IA 5TVGA 4D9BA 1EVLA 3MTQA 3I73A 2W8ZA 5AW8A 4O4JF 2NG1A 1FP7A 1PG2A 2DFKB 3E7DA 3DF7A 2N9UA 5FHRA 3ZXUB 2Q5EA 1A2QA 1UQUA 4J0CA 3ZZ1A 5IAAA 4QUJA 3TRKA 1J22A 2R4TA 3HS3A 3P52A 1Q21A 4MLPA 2XQIA 1RYMA 3R77A 5F35A 1AIPA 2GXAA 1GARA 2F3RA 5U4QA 1G64A 1JBKA 2ZU0C 2AWNA 4PG4A 5EESA 3GBSA 1BQ4A 1LXCA 2OBFA 3HACA 1UPBA 4V3CA 3KXDA 2QVGA 5EIBC 2BCGY 4FFLA 2WAMA 4MGKR 2I2DA 1WCIA 3NBMA 3KR0A 4N0PA 1E1QD 4ZHQF 2CD7A 1D5WA 1QAOA 2G8LA 1RKUA 2VRCA 1TADA 3NP9A 4GI2A 1JEQB 2WT8A 3GIDA 5DGXA 1MB9A 1Q0HA 4M37A 1LNSA 1MOQA 3ORRA 5IVKA 4O3MA 1G19A 3GLFA 1EFKA 1ODLA 5EAIA 3K1ZA 3W9YA 5LNK6 3GRCA 1PLKA 2QRPA 1KPHA 3ASUA 1PNQA 2ZYGA 4JJ4A 2BHNA 3EMBA 3ZW9A 3TLMA 1FX0A 3PC3A 4J07A 3J7AC 3ZLJA 4X0EA 1J21A 4X92A 3E35A 3UUFA 4RENA 2ZPTX 1QANA 5BN5B 3SS9X 3AJRA 5JYDA 1RQXA 3GJ6A 4LF7B 4JODA 1QIDA 2QPLA 1WU8A 2IVFA 3CLSD 3EEFA 4TYMA 4Q48A 2WI8A 4PWYA 3ZXYA 4F84A 2NZ2A 1LDNA 3ZH2A 3PZBA 4DHEA 3KQUA 3VGPA 2FW0A 1I30A 3OCUA 1H22A 5FO1A 3TCNA 2PGDA 4G2NA 4J0HA 3UHJA 5K99A 3I6IA 3Q2KA 4O4JA 5CM8B 4BAGA 1FB5A 2UUAB 2AJLI 3HCNA 5DTEA 1XHEA 4RH1A 4BJ5A 2PG3A 1I9CA 4RSMA 1VE3A 4EVRA 1ULHA 2VUSA 1OU0A 3CN9A 3ETEA 1FS5A 1P9NA 3B82A 4N01A 3NHSA 3BIXA 3NI2A 2FHPA 3HU3A 4TS4A 4D56A 4KZPA 3KD3A 4V2UA 2WBLC 1EQUA 2YRWA 1XVLA 3RHZA 3WLKX 2O1EA 2HJHA 4J94A 4FGSA 4ZHQA 1JIQA 3G8YA 2EOAA 3LG2A 2V9PA 4NNJA 1NDHA 3IVAA 3JD3A 2Z3ZA 4BV2A 4UNNA 1V5WA 3AR6A 3IDFA 1SBTA 1FVOA 1P77A 1UDRA 2JIDA 2OHJA 2CSXA 4B3CA 4F4HA 1W9MA 3Q6NA 4UU1A 2GZ2A 4Y1EA 2OQIA 5G53C 3WQBA 4PGGA 4G0OA 4BJ3A 3U7GA 3L43A 2OXEA 4I36A 5AI6A 2EKLA 4TXJA 3WNDA 3VPBA 3EMKA 1W2GA 1AKWA 5CNIA 4DR7B 3U49A 1HQDA 3R6WA 2II6A 4YRKA 2VJOA 3HWRA 2VZ0A 2NP6A 2O8FA 1ZMOA 2F3SA 1T6ZA 3A2LA 5HK8A 3ZK8A 5IZ4A 2K2WA 2J9GA 4CMKA 1QB7A 1ZIOA 5BWOA 3IEKA 3MWKA 3FUXA 1GZUA 4NPHA 4YB8A 1NRIA 4XQGA 1Z18A 5ALMA 5HF8A 1FDRA 3KSRA 1T2VA 1QGED 1AUVA 3LT5A 1L8OA 1SVUA 2I2FA 2GBFA 3TN7A 2GK3A 1U5AA 1RBZA 3PVZA 4OK3A 3AUYA 4RCZA 2C7RA 2QKYA 1OIVA 5CT6A 4AKIA 1E9BA 4HGZA 1LBTA 5KYNA 1J0BA 2WF8A 4HDMA 2I67A 1DOAA 1FE8A 2ARKA 1PWYE 1XDWA 1FNSA 2O5RA 4RXMA 1ZUNA 2ZLBA 4NXNB 2YH2A 4IJVA 2GYUA 2B94A 4OATA 4F5YA 4Z7QB 1H2RS 2FRDA 3VI3B 1CUSA 3L4BC 4EJSC 4ON9A 3ZQUA 1GM5A 1E8NA 2A1TR 2PCJA 5ES4B 2OKCA 3KZMA 4NCAA 5FLXA 1M8PA 1P2GA 1G18A 1RACA 4YXFA 3WHPA 2JGIA 1UPFA 4ZZ3A 3QRWA 1MC5A 5AM3A 1MJGA 1OYVA 2WVAA 1ZEJA 3BFPA 4IZ6A 1QS0A 5EIWA 4A1OA 4K26A 4BQOA 1XRRA 2A33A 2H5IA 4V0RA 4UHEA 4ND6A 5F78A 4BP1A 4HTAA 4D9HA 1M2WA 2Q6LA 1LX7A 3BFXA 4JU8A 4GSLA 3GFSA 4M3NA 2X5KO 4L51A 1E3TA 3ZK7A 4WXHA 5LZ9A 3I9OA 2W43A 2FHSA 4KW7A 2XJ4A 1I6KA 2YN0A 3A1SA 3TBKA 1P5RA 2G9ZA 2O2SA 3U13A 3DFUA 1YL7A 2WF9A 4MQFB 3P19A 4Q02A 1VJ5A 4D4MA 4RS4A 4LFBB 2Y99A 1B74A 2IEYA 1LFDB 1B2LA 5EKXA 2JEZA 1Z73A 2OT3B 2HB6A 1PJ8A 2DFLA 2X2FA 1XNJA 3K0EA 4IOMA 3KLOA 4K9PA 5DKFA 7ABPA 1LCIA 1LTHR 2IOYA 1VE1A 1TM2A 4B0OA 2FLKA 2P40A 4KO3S 2IY7A 4FHGA 1KHTA 4LK3A 3SFVA 3ZY4A 4GBMA 4ETNA 4CTJA 1KZYC 2OY0A 1ZK2A 1PR3A 2NQ2C 3KQWA 3O8NA 4C4ZA 2ZUSA 2ZBGA 4GE0A 5I9MA 3DVAA 4V0KA 4CKYA 3TOCA 1LPNA 2ZAGA 4WAUA 1OXMA 1R1DA 1QRUA 2QBYA 1DAPA 3D5TA 4J1QA 2XOXA 4D4GA 1I6WA 1KKMA 1S1CA 3DNMA 5F2NA 1NA5A 2XTZA 4PC2A 1PYOA 2HLDA 2IIQA 3E5NA 3WRVA 3HG7A 4JC8A 4DCJA 4DIKA 3PQEA 2EW8A 1POXA 3IILA 3O38A 1QQTA 2C2XA 2NZWA 4IDCA 4O4IB 4OVKA 1YHNA 4CDRA 2WFMA 4KL8S 4KODA 1W4ZA 2OXRA 2X77A 3ZX4A 4YS6A 1J20A 3C45A 4JYAB 3EGEA 1PZNA 1QHHA 3FTFA 1E2BA 4MRMB 4H3HB 4KWTA 1KP2A 2IHBA 2ZJAA 4MP3A 2H2DA 1VCOA 3BWXA 5JD3A 3PZRA 4MR8B 4BTVA 1N32B 3GMDA 3EG5A 3JPYA 3U3DA 2C4KA 1YJBA 4QOSA 1CZKA 3W2FA 2DEUA 1Z6XA 1GG5A 2HHJA 2WJ3A 1DT3A 3KOYA 4I5IA 2PLRA 5CP8A 4EQ6B 3SJCA 3HLKA 3MWDB 4TN1A 1GQSA 1XRQA 1EX1A 1L4KA 2VK1A 4HNAA 5JC1A 3HCOA 1KRWA 2Q2VA 5KOIA 2FQWA 4ABTA 3QY9A 1XVUA 3AETB 4P34A 2B6HA 4IV0A 3RABA 2ISSD 4Y0AA 1M6YA 4O2BB 4AM8A 2QN2A 4DLPA 5BVGA 4IZOA 2YZ2A 5AOAA 5AI4A 4CV1A 1PR2A 1GSOA 1E2QA 3LFUA 3WK7A 3R0XA 2MOKA 3QU9A 2YXPX 3A4TA 1TIPA 1GCAA 2D0DA 3T3EA 3IAXA 3IOEA 1WCWA 4Y2VA 3FMFA 4NXMB 2VL7A 1E94E 2GZSA 3G8AA 5C4IA 1YVRA 1HLFA 3DONA 5E6SB 2WZBA 1QKJA 2GSWA 3IUJA 4DV4B 1X14A 4BN4A 4LYEA 4R9SA 1MX3A 2F8MA 3FPSA 2GTPA 4DQXA 1QAQA 5BMVB 3H7AA 1E5XA 4M8NE 2AFIB 3U62A 7MHTA 3AXTA 3DOCA 1YFLA 1J5XA 1DTWB 1SUWA 3A3OA 4Y30A 3OAAA 3ZY2A 3ORSA 4AKHA 1KIAA 1SPXA 1HR0B 4NYJR 3ICWA 5CNJA 1P62B 3HUUA 4L75A 1Z36A 1DLJA 3AEQA 2O5VA 3DPUA 4NBRA 2FVYA 2PUHA 2HWWA 2QZPA 1XU4A 2V96A 1UBJS 5J5AA 3WLLA 3CVOA 4A8TA 4KPUB 4DUPA 4TROA 1YRWA 4KLNA 5DLEA 2KQUA 4QOHA 1PFYA 2GVZC 3PFCA 3TZQA 1I51A 4EZEA 1DMRA 2D1YA 1AQIA 5K8VA 2GS9A 4KMSA 4TTQA 1PYDA 1XKQA 3DXXA 3IVXA 4DCUA 4NLLA 3B51X 4G65A 1DBSA 4K87A 5FTWA 5HKLA 2XA9A 3OX3A 4TUYB 5EKTA 4K9RA 4RXTA 4UUQA 3FUUA 3ET4A 1XK6A 4FEEA 4AMGA 1IXYA 4LDJA 1ZA1A 2RGNA 4JT4A 4JK3A 2FJ0A 2BT4A 2BEVB 1BCRA 3M4XA 1QH0A 4RMJA 2F1OA 3FFBA 4MI1A 4RSHA 4DJEC 4ZK6A 3WK9A 2HK7A 2XUAA 1NP3A 3JATB 1BIFA 1C0KA 2EZTA 1P5FA 1YV9A 2UYOA 2YVUA 4HX5A 5K3SA 5B2EA 4Z7NB 2AZTA 1K7XB 4M7OA 1OZHA 2ZAMA 1JKMA 3AZOA 3QUCA 2BWJA 4AJ2A 4H7JA 4HSGA 3AUFA 5CA1F 1NJ2A 4KE7A 4BXOA 1LUAA 1UXKA 2K7ZA 5EHQA 2IYEA 5D00A 2DSNA 2UZ3A 4HDKB 1EFDN 3SVTA 1G2PA 2C2ZA 3BRWA 4OM7A 4WJZA 3AUSA 3BRSA 2GLUA 5CFMA 1JT2A 1GPAA 2H0AA 1JPJA 4OHFA 4PIVA 4X1IA 5K0NA 3H16A 4M22A 2ZRDA 1UDBA 2VT3A 2JG3A 2INGX 2NVOA 4H08A 4B4UA 2Q1TA 4MV0A 3ICCA 5AOCA 4DJ5X 2GCOB 2JFYA 4F71A 5I8WA 2MINA 4MUMA 1P4AA 1WWKA 3I76A 3WXMA 5TS2A 621PA 2GERA 1G0NA 3M5PA 3EG9A 3NIBA 3SS8A 3UJ6A 4HDRB 4GMDA 4HMPA 2NO7A 4LXXA 4YAGA 4X1KA 2GM3A 2OCAA 1VLVA 4PTYA 3IDSA 3O2SB 4KOAA 3TIXB 2N1BA 1E3JA 4PRKA 5AW0A 3MTDA 2OZPA 1Y4ZA 4FNGA 2NYVA 2AJCA 3IQFA 1CHDA 3H5RA 4KPGA 3UK7A 1I2CA 1KEUA 2GKSA 4C21A 3AUJB 1GPBA 1E2UA 1U0SY 4UTOA 4S04A 2D2VA 1DWQA 2W2LA 3FFXA 2VJPA 3RB8A 5ITVA 1WABA 1TQDA 2ZJZA 1Z0IA 3W6ZA 1QE0A 1ZXBA 2EX1A 2CNNA 1Q95A 2GBLA 5K6AC 3V00A 3OF3A 1NUSA 3I5MA 3FAKA 4NE7A 4D3XA 2XVZA 5JD6A 1Z08A 3M3HA 5AWFC 1RCTE 1RCFA 2XWSA 4M46A 3ZOZA 3ZQ4A 3ZIUA 4FSHA 3MMXA 2O8CB 5AM5A 1XT6A 4YCDA 5IPFA 5K2MA 2VNSA 3STWA 4EBFA 3MTEA 5CA1A 1VLJA 1L7VC 4F6RB 4F5EA 4FT2A 4FTWA 1T10A 1C3LA 2N75A 4RPIA 4PVDA 1QGYA 1MO4A 4TMWA 4R1LA 3VJRA 4NOLA 3C3MA 4JWKA 1YFKA 1YQ9A 1DUVG 3ROEA 3T06B 2CUNA 3T61A 3IA2A 2PRJA 2FW7A 2WABA 3MB5A 4AX8A 4B6RA 2JJ2D 1DAMA 1GUDA 2P2YA 4KQHA 4AZSA 1D7AA 4NQZA 1M10A 3LPDA 4QFCA 2V7EA 1ZM7A 1C1YA 2OCPA 3L8MA 5LUAA 3AR8A 4LY6A 4BE9A 4ZOAA 3BM5A 3VBCA 1NT4A 1T4GA 2IFTA 4P0QB 1CUFA 1ZSNA 4JBHA 3ZY6A 2XOKD 4CFZA 4F45A 1QE5A 3BWDD 4J0KA 4XGKA 3I8XA 1JJVA 3D6AA 2JLZA 3CF4A 3KT0A 5B6JA 2ZAYA 1PZXA 3E53A 4LQLA 1H1DA 1A7UA 4PANA 1QCZA 2XTMA 3ZWKA 3T7IA 3T9BA 5AJUA 5EWLB 3B12A 1YJ5A 4PLYA 4L9RA 3OZIA 4G0XA 5A4IS 4GXTA 4BFWA 3QF4A 3RSZA 3NT5A 3KK0A 4Y6QA 2JFOA 4X6LA 4FDAA 1OBHA 5I7SA 1DKQA 1U28C 3IODA 5ITZB 3FZQA 3R7DA 5JCXA 4E08A 1CXZA 1L4EA 1OV6A 3U5TA 2AG1A 4OY3A 5DM2A 3JSAA 1EM6A 3OEWA 4L74A 2HXGA 4MYSA 2PZKA 2IYOA 1XLTC 5FYDA 1LPSA 5NULA 3SQWA 1FPMA 1UOOA 1RHRA 4C2TA 4IIXA 1N7HA 2ANBA 3ROFA 4PBTA 2MMCA 5TEWA 4FEGA 3MINB 1SD2A 2J0QA 5GTDA 5LLTA 3DO6A 4E4TA 1EFPA 5CLLA 1JDVA 3SX0A 4X62B 4NBTA 3U4GA 4LV6A 4B48A 1E99A 3T5MA 3U3MA 3WKDA 2I2WA 2V7QD 2XCOA 2BM8A 2ODAA 3MYRA 2V6JA 4MGIR 4YEDA 1O7JA 4EGQA 3QQPA 4E4YA 1Q84A 3SI7A 3GJSA 4DV6B 2O2XA 3K4PA 5LQUA 4L27A 1ZAKA 3KJNA 4DMHA 1R12A 2XODA 2XKBA 3WLNA 1J8QA 4Y1RB 1JAXA 1MBZA 4FFSA 3MLBA 2DH6A 5AI5A 3TSCA 4F4DA 1EFVA 3KSZO 5A5FA 3DFIA 2BVNA 3QJ5A 2NXJA 5DBHX 1BXRB 4AG3A 4P6VF 3KTDA 5F3DA 1JEYA 1NG1A 4ZEWA 2XW6A 3GL9A 1DX4A 4U2EA 2XCUA 5CW1A 1XZCA 2ADFA 1F0NA 2AZ4A 3D6VA 4H6WA 5FH9A 5JNWA 1SCNE 2Q4EA 4MIKA 3P9IA 1W4BA 5EXSA 4J4HA 1JHYA 1NKSA 2V8OA 3S28A 4B82A 5BV7A 4B3FX 1SUDA 1TYDE 2X8WA 1EK2A 2NAPA 2WVHA 2XVYA 2IZOA 1P17A 1Z5PA 1T36B 1U9JA 4BNDB 1KFCB 2AGVA 3VYRB 4F3KA 4ETMA 4CLEA 4WN9B 1WXQA 4GQAA 3IPCA 1FDOA 5KNCH 4J1SA 1VG8A 3ENWA 4M7WA 2PRIA 3IJ5A 4DILA 3PFNA 1W6RA 2C00A 4DJTA 4FOLA 4PQEA 4NU5A 1L5RA 1RPTA 1U7DA 1E2MA 1YIAA 1Z83A 2WV9A 1JQEA 3PNLA 1ORHA 1OGIA 2VNHA 2JLXA 5EJIA 1VHQA 3LT2A 5DNWA 1V25A 3IQZA 1R6TA 3EQ2A 4BL5A 1LBEA 1JQLB 3CPSA 5DF1A 1C1DB 1ZGAA 3BRQA 3GEHA 4FB5A 1J39A 1PW5A 2JIQA 2WF6A 2YFHA 3OJWA 2ZUDA 4II7A 1BWQA 1LQUA 1THZA 2V3VA 5F5LA 4CDGA 4MQ5A 1QRRA 2EZ9A 1QP7A 1XF9A 1IC6A 4TM7A 2WHQA 2R0QC 2W6QA 3K6RA 4C7OB 1B6SA 1FFAA 3AV3A 4R5HA 3H1FA 1XYYA 1Y8QA 3O21A 1IAVA 2D7DA 4NYIQ 1ZESA 3EWIA 3QHQA 1ECJA 2X8BA 1X39A 5LVAA 4FE4A 1J4AA 4HWTA 4AZWA 3C3XA 3O94A 3C3WA 1ESZA 4EW2A 3CVUA 4OYYA 2I3AA 2ZTLA 1FMTA 3H0EA 3NT4A 3VAZA 3LQ4A 4AQDA 1Y6ZA 1IY9A 3EEOA 2HOQA 3JZIA 4IGIA 1ZMTA 1J23A 1OLUB 3OE7D 4F04A 4XPIB 3UK0A 3OO0A 1MX1A 2A3NA 4NZ9A 4PAOA 4CF5A 2CVFA 2A5GA 3H13A 3KJGA 1QPZA 2H4ZA 2RD2A 2J9FB 3ANSA 3PNYA 4NYMR 1JL3A 1WOMA 4MW5A 4N3NA 3U9TA 1EXWA 1U4SA 2WJZB 1HZZA 3L40A 4ZCPA 3PQ3A 4G0ZA 1KKUA 2V7BA 3UAZA 4WADA 1YRAA 1OFUX 5AVZA 2XUKA 4EW3A 5H3HA 3EIUA 4DUZB 3L6OO 2LPMA 1IWBB 4X1OA 4WNYA 4BMPB 1UFOA 5D86A 4DLXA 3CG0A 4IYJA 5KTSA 2R6AA 2A0FA 4LHVA 3WYNA 1DAOA 5LQMA 4QJ5A 2PUCA 4CIAA 4R05A 4RACA 2JFZA 3EYAA 3JYLA 3G8CA 2OB1A 1A8UA 1NMEA 3EGIA 1THMA 3SPXA 4WEQA 2HHCA 1EVYA 4HN2A 5JXWA 3NYQA 1LRKA 1QIGA 3PSHA 1QZXA 1W34A 1ZUIA 3IP1A 1TU4A 2YR0A 4O0MA 3EIHA 4W6QA 3S40A 2ZKIA 4MDHA 1CE8B 2OZLA 4M8KA 4JX9A 3COPA 3FYUC 3UZUA 1HSZA 4CM6A 4G63A 1KYYA 2WEKA 3AW9A 1JWBB 1U04A 2I91A 1WUIS 4YBZA 2UXBB 1YRBA 4K2AA 3WB0A 1Q74A 4ENPA 4AKTA 3HPRA 4G09A 2E4AA 3SE0A 5KSZA 1P1JA 4U2BA 1ILWA 4Q3CA 2XITA 2YWJA 1GLVA 3IAHA 5AM2A 2OFPA 5BN4B 3T95A 2WYWA 5B2ZA 3KR1A 5GQSA 2HBYA 3DZIA 4OHPA 4CT4B 2YWDA 3PC4A 4IDPA 5IX8A 1FLVA 5IXJA 2ID8A 3Q98A 3WP0A 2A7XA 3T9AA 2P68A 3AFGA 4ZAFA 2GZ1A 1DIHA 1P2FA 1W4CA 1MJGM 2V7WA 3E22B 4GIBA 4LBWA 2UXCB 3JQ6A 3LCJA 3H65A 1DQPA 2CF6A 3O1HB 4I4CA 4TTIA 3GLFE 1M6EX 1U0HC 1UK6A 1JR6A 3TTWA 3RFCA 3THXB 4X65B 1RHJA 1V1RB 3BD8A 3DMNA 5F64A 5JCPA 1XNQB 1TLFA 2R8PA 3BYZA 4FR2A 4KFRA 3U60B 3DXZA 1U2GC 1OYYA 3GFOA 2AHRA 1P7ZA 2R8EA 3OZSA 3GFBA 3H8SA 5IJ0B 2QTVB 3V97A 2R11A 3HO1A 2H8GA 4LGMA 1JHVA 1AB5A 3NHUA 1UDWA 1X3LA 3TOVA 1HX7A 3UW1A 3IIKA 1KJJA 3SHFA 4L4SA 1NKTA 4E3ZA 1IDOA 5B3KA 4JI4B 2OVBA 2RJNA 5KNBH 1E9FA 3OFKA 3C6YA 4F91B 4J0JA 2UV8A 2V5UA 1JR3D 4L85A 2TMDA 1MOSA 5BQ3A 1HK7A 2YXLA 2QI9F 1PNTA 1FTSA 2IHZA 2IOFK 4I4TF 3C5VA 1X7HA 4XLLA 2PR7A 1LW7A 2AG8A 4RK1A 2P3OA 4OKNA 3WV5A 3JCZA 2OCDA 5CD9A 5FWYA 4OI2A 3PDIA 3QLEA 4FW9A 1FVFA 2FWIA 1OX5A 3ANTA 4GYKA 1RWOA 1M7HA 2ZVQX 3R5FA 4IMPA 4KBYA 1WNTA 3U17A 1VSTA 3CUVA 1S4MA 3LY7A 3P9NA 4UBLA 4EF6A 1WHSB 2PZMA 1QPGA 1CIJA 3A04A 5BY2A 3VA7A 2BI8A 3MF4A 5AUPB 2TECE 4OXKA 4PAQA 1E4EA 1NN1A 2P35A 2XBMA 3BCHA 1GCGA 2PT9A 4UMVA 2H1VA 4BO9A 4XPZA 3ZUGA 1XAJA 2RGCA 3ROXA 4B79A 3ZVMA 1CRPA 3HRIA 4GNRA 3JTEA 1UPXA 5AJVB 2BZSA 3GIWA 3H2IA 3SIWA 5D5QA 1XAIA 3SZLA 3WGYA 2QIPA 3V6MA 4D9NA 2PKRA 4KAXA 1P8JA 1EUCA 3AERB 3L4SO 2W2VA 3JZDA 4IY1A 1HGXA 5GV7A 5KYWA 5REQA 1T2FA 4EA8A 3IKLA 3TBHA 1H8HD 4CTOA 3I5UA 3KOWA 2HJGA 3SKVA 4C43A 3CSSA 3IP8A 3RG8A 1B8VA 4FNMA 3UAWA 1TA4A 1KO4A 2FG5A 3OJXA 4NK4A 4Q9LA 5TDHA 4EFLA 4JXXA 4IDOA 4ZT7A 4DZTA 1RZVA 2XD4A 4I1SA 2G0NA 3GELA 1U3FA 4XW2A 3SK0A 4UUAA 3BIFA 1N57A 1OTYA 1O94D 2FLVA 4UMDA 2Y1WA 3WL6A 4RLSA 1NSFA 5CNKA 3IT2A 4BKMA 1Z2PX 1KQGA 2OOSA 2YV5A 3CUWA 4GDMA 5YASA 1L5QA 2V03A 2QVCA 1L5FA 3D3KA 3MM4A 4X7PA 3ZY5A 4ARIA 1SZPA 4GM0A 4CUKA 4EPRA 1SC1A 2E87A 4DFDA 3NJ4A 4DM4A 3DR5A 1VHDA 1M7BA 1JX6A 3ZHRA 1XWIA 3P9KA 4IXMA 1PS8A 2YDXA 3SE7A 3TXXA 5KJFA 4LJ7A 2PV7A 3F8TA 5CTJA 1G66A 4I4TA 1KMHA 4RDHA 4YALA 1SUSA 1C9DB 5ARDA 3AX6A 1OLSB 3SSMA 1TA9A 4MZDA 4L0MA 1J1UA 1MC8A 5JPDA 4KQEA 5JW6A 4KQKA 4MQEB 4AT1A 4Y0VA 4EABA 2AOVA 3R2JA 2J9ZB 2VRWA 3NIDB 5H9VA 1N2IA 3VH2A 2O0LA 2DVMA 2H2HA 3BL5A 4NZNA 1SD5A 1QIEA 3TNLA 4X64B 3PLNA 4JJEA 2PVPA 5TQVA 4AN1A 1WEHA 2VRNA 1P39A 3WOVA 2DJ5A 2WOOA 4MW1A 5DWDA 2PFKA 4QDKA 1L8XA 4N41A 1XIVA 3GHHA 1KNQA 1W19A 3KC2A 5C1DA 2LTAA 1S6YA 2A2ZA 4WT7A 1QHIA 1GWNA 1NR5A 3DZKA 2E48A 1ENYA 2HQOA 4FZVA 3HJAA 4J3JA 3PR2B 3SDZA 1YKSA 3UK2A 1IH8A 2IEDA 2FZCA 2WD8A 1M8KA 1FVHA 3HKDB 1U2SA 2C7BA 4YRAA 2V6IA 3DP7A 2O3TA 2ODBA 3PRYA 4X66B 1RJEA 1Y1SA 1Y3FE 2GN2A 3KYDA 2SKEA 5AK5A 1DVRA 1T34A 3PWKA 4M8LA 5EJ5A 3EIWA 5ETJA 2JJ1A 4U02A 1UFQA 4G5GA 4PLZA 3WL7A 1F4VA 1P5ZB 2IYUA 4HQRA 3EPJA 3KPJA 1II9A 2AI3A 3ZZTA 1N34B 3MAAC 2C7OA 5AXCA 1VA4A 2GPTA 1N2HA 3Q8KA 3VH4A 2V45A 2JGRA 2WUVA 3I4LA 4JB8A 3L18A 3WL3A 3VYWA 4J6FA 3NFRA 3N39C 3KEOA 3IAM6 1T8SA 3C6XA 3VM6A 1PZFA 4IXDA 4DWJA 1OREA 3GOQA 3HXTA 3O4HA 4J7CA 2YZKA 1N0IA 2XF8A 4E13A 5KVCA 4XYMA 3PX7A 3LZCA 4EY8A 4F9FA 2RBGA 2ZIFA 4IDFA 3TCKA 3G0GA 2ECPA 4CTKA 2NSDA 1D1TA 1KU6A 1RKQA 1QTRA 5KYXA 3AM4A 4RL6A 1BMFA 4RKEA 1X70A 3DCYA 4CN8A 4P32A 5B58T 4G5HA 2V55B 5K0GA 5LFAA 5AKGA 5I48A 1XZFA 2QUJA 1L4GA 2QLTA 4R81A 5J40A 1QF6A 1E9CA 1ORTA 3SWWA 3RANA 3PDJA 3SMVA 3P71T 3RWBA 3IMKA 2AXQA 5TR9A 5CEFA 2XZOA 3F71A 1NFFA 1Z38A 4F11A 2X23A 4Q9NA 2CF5A 4RVSA 1EHYA 1MENA 2P2CA 2BP7B 1BHSA 1Y7TA 4JB3A 4KSBA 2R8BA 1YA4A 1MXHA 3ZU5A 4BNNA 2BBWA 3GPDG 4MLCA 2FUEA 3PRKE 4MJ7A 1KJ8A 1ZNZA 4QG3A 3RIYA 4ZGBA 4PZCA 5KAMA 1E2JA 5HF6A 1DNPA 2I78A 2B4QA 4KIJA 3SHOA 3AYZB 3UJCA 2Q27A 2R5NA 1BMTA 2GJKA 1KZ6A 3DV0A 4IWYA 3JARB 1UC5B 4JQCA 1E32A 1UINA 4MAAA 3ZNQA 2OZVA 4EUHA 4HQKA 3UV6A 2FSIA 4H7KA 3BWCA 2IV3A 1XVVA 2C61A 1ID1A 2QAGA 3RVKA 3FDJA 3IT1A 3MJTA 1BYUA 3HXMA 4Z1MA 1CRWG 4REQB 1M34E 1TX4B 2WYUA 3T3DA 1TVCA 4R6XA 2XVMA 1W85B 4HNVA 3HB5X 3LUGA 3MFQA 3OUUA 3QVWA 4FONA 1MW8X 1MU0A 2VZ9A 3VHRA 4EENA 4LK2A 4NG4A 1BN7A 3QELB 3TX6A 3PQ4A 3ZIAD 1N2OA 1YRHA 3AEKA 4EB6B 3AOEA 1I7QB 1ES9A 3B13B 3N86A 5DW3A 3IJPA 3O83A 1Y3AA 1Q20A 3CRVA 4L16A 5G1PA 1N9KA 1VA5A 3S5UA 2A0UA 5JMTA 1E1NA 4C5BA 1NNUA 1XALA 1UXGA 3BWBA 1WLYA 3A6HA 3ISVA 4UQPA 3TLYA 3H75A 3PHHA 1OW3B 5JJLA 4F93B 1ZJWA 4D92A 1G8AA 1QVAA 3S2FA 5JHHB 1PR0A 5D3MB 4HUQA 2I5PO 3SHQA 1CQIA 2OBLA 3N3BC 4S3MA 1DKPA 4X44A 5B4VA 3WQRA 3A7DA 1ZD8A 2NSYA 3I23A 3KL4A 2JGDA 2WTUA 4QG7A 3IT0A 3U4IA 2EYUA 2WPNA 3P8ZA 2WT9A 4XQCA 4DOMA 1XVIA 2AOUB 2X5XA 2ATIA 3QVSA 1GZDA 2VCHA 1I5OA 3R3SA 4UREA 3WB1A 2V9ZA 1YTLA 1YACA 4IIJF 4MUYA 2JLAA 3EEYA 4YR9A 4Z7OB 3LK7A 3HY4A 4ZCMA 5C7LO 1VMEA 1NBWB 3IE0A 3SXPA 4TWBA 5JDCC 3OU6A 3RUHA 3Q1LA 4INJA 1P44A 5COAA 5MN4A 3CEPB 1P18A 2G1UA 2IL1A 2Y1KA 2OV1A 4RJIA 5LWHA 4KYVA 2PVSA 2DRIA 4P82A 4PX5A 5J2TF 4YMIA 4DMCA 2MYNA 3FMIA 1KXZA 1Y48E 5GJCA 4ZO7A 2RHWA 4M53A 4EKDA 5EJAA 5KX5B 2HFJA 3ZG6A 3PUZA 4LE1A 4WVLA 1X1RA 1YDWA 2MSLA 4LI0A 4Y8VA 1E4VA 4BX8A 2PWBA 3CKYA 4QVGA 1U6KA 5BV8A 3GLIE 1PWHA 4MPPA 1Z16A 5BW5A 4O2AB 4EFKA 5ELLA 3DFZA 2AHOA 2ZTMA 1OI7A 3K6JA 1YONA 2QD4A 1U3GA 1TUGA 5IF3A 3TLBA 5FWXB 3RYCA 2FFHA 3LGXA 1WHTA 4S2UA 1P4JA 2L18A 5A3VA 3ED5A 2ZM5A 4EVIA 3V8NA 1MB4A 4J3FA 4D81A 4N6OA 1KI9A 1EFUA 4U7TB 1ZWLA 3ZGOA 3A1VA 5D84A 3A37A 3KAPA 5DTMA 2OYCA 2P4SA 1AQUA 3QLUC 2WUFA 2JCGA 1TUEA 2O0MA 1KDRA 3PGMA 2IK8A 2PIDA 2QLMA 3WGIA 2DKFA 4MTLA 3Q40A 4JOBA 4ODIA 4XD2A 3RJMA 5K0LA 2J5BA 3FOZA 4L4UA 1MO2A 4IXWA 2C4VA 1HOXA 1CBUA 4YJHB 4L50A 4XE5A 4BZQA 1R74A 1XZJA 2QVBA 1VE5A 2XB4A 1K06A 4JJ6A 3CVVA 3O9ZA 3WB2A 4KPEC 3BT7A 4IHAA 4IIJA 3OSUA 4NOMA 3QNWA 2CV1A 5F3WB 3EZNA 3G7SA 1L1RA 2FTKE 2YIJA 4EP1A 4MMYB 3OY7A 4IV8A 4DY4A 3U3ZA 2O1WA 3ONWA 1QDLB 5B7NA 2VS1A 1E8DA 3ONEA 3IHLA 4KFUA 4RHEA 1ZCZA 3HBAA 3SC6A 3QW2A 2OGUA 5CFRA 1A77A 1TVKA 2C5HA 2Q6OA 2I03A 2GPBA 3IAS1 1NZDA 1FNBA 4KKXB 4M9ZA 2HTEA 5I9NA 4ILEA 3MCUA 5KYGA 5J2TA 3UN1A 4C6TA 4LBVA 1KAOA 2QZSA 2B78A 3EXHC 2NSJA 4ARSA 3R6GA 1T5OA 1TQ4A 5DBGA 2FSHA 4I1IA 5A2GA 2OFXA 1R4ZA 2F7SA 3GFPA 1YQTA 4DB4A 1KPIA 3BL8A 3QYFA 1JXQA 4IUCS 4C4RA 3CE9A 1C7FA 5K3FA 2OCYC 4L07A 3R9IA 1QYDA 5FUYA 4B3DA 4B7CA 1XTUA 2PFSA 3QG1A 1CERA 1O97C 2CXUA 3WLHA 2M32A 1FDUA 3B1XA 3I52A 3ZNPA 4MKFA 4PZ9A 3LQRA 4PBRA 4A5OA 2FFBA 4ZAYA 1FMJA 4AVYA 4B31A 4GHWA 3N2EA 3I0ZA 4RDXA 3DEIA 3PVCA 4TMFA 4BLWA 4ARVA 3D6FA 4ZXFA 4ARZB 4MYCA 3FGNA 3VKFA 2YVQA 2AH5A 1NMZA 3IUYA 3O90A 3X1YA 4QPPA 3IEMA 3CGWA 1ZSVA 2PJZA 3V8PA 4MDFA 3H2JA 2JKZA 4M7RA 2D7CA 3M6VA 3CX8A 1W36D 1GNSA 3H2HA 1J0EA 2CJWB 5LWQA 1LLCA 5LYJB 3PCRB 4FVTA 2A7QA 3TLKA 3S1LA 3FZNA 4BLSA 3NU1A 3D1LA 1NUPA 1OJLA 1W2HA 2G9NA 1SIOA 4DLLA 1K66A 2D1QA 1C8VB 1BU5A 4OHVA 2KX7A 4LF6B 2A9FA 2WWYA 1XEXA 3LQQA 1YK0A 3B8HA 4NG5A 1W0JD 2O2HA 4IJWA 4TLLB 2BTQB 5EP4A 2C84A 4R54A 2Z04A 1HNNA 4RZXA 5FWDA 1YL5A 2PL3A 3HNPA 1Q7EA 1WZCA 2IHJA 4W6ZA 2AUTA 1HFEL 5J47A 1P1HA 1V11B 4WZBB 5ALUA 2FFRA 2P30A 4LFCB 3RU2A 1YBMA 4B43A 1XP5A 5BYAA 3K8YA 2BFOA 3A6LA 4FD3A 1B15A 3Q7IA 4O2RA 4JI5B 4BV3A 3LAWA 3B70A 4EI9A 4U4AA 2EV9A 4AQYB 3HVUA 2CNOA 2G6BA 4G9BA 4PIMA 3V8QA 4KXMA 5KTKA 5L53A 4B3MB 3MWEB 3OCWA 1BS1A 4ZOLF 1LJLA 4RMNA 1EFRA 5E3HA 5JZOA 2GWRA 3RRZA 2VAMA 4NCXA 4C03A 4IJUA 1QVRA 1W47A 2G70A 2V5AA 1NXWA 2EATA 2WHPA 3HCCA 4QATA 4QGFA 1RQ2A 2D1TA 1KBOA 3R76A 1GA4A 1Y4UA 2OL4A 4CCWA 4WY2A 1BX0A 1ZI8A 4G0MA 3L7OA 2FDXA 4KNYA 1TF5A 1KY2A 2NXEA 1AGRA 1J97A 3BMNA 4GI3A 4LWPA 3G82C 3QVMA 4KCGA 4QUGA 1Z6AA 4BNFA 1BU8A 1UODA 4Z0HO 5CDYA 1U2RA 4YFVA 4F9TA 1N2CE 2QYSA 4G5FA 4D44A 1A4XA 1AZWA 1BXKA 3RYTC 2AN1A 4NMMA 1JSXA 4MO2A 4ROSA 2RI1A 5DXJA 4PG8A 2J3QA 4LZZA 1WXDA 2VHWA 2SNIE 2XNJA 1QSGA 3HU2A 4AKSA 5C8ZA 1VL5A 4KDCA 4FHCA 4TS3A 4TWZA 3SDSA 4AO6A 4PHHA 4MAFA 3BDAA 3GLQA 3FHJA 3IHTA 2XBUA 3BKWA 3EASA 3MELA 5B7PA 1JDTA 2ZB3A 3P7MA 1F6BA 2FETA 2GM4A 1LF0A 4BO1A 4IGFA 1BA2A 3CZAA 3D4PA 3DHVA 3GP5A 4DJJA 3KU1A 4JYBA 3A4YA 4YJFB 3BE5A 1YA6A 4V3BA 2VZ8A 3UWPA 3V2GA 421PA 5INTA 3WADA 5IYZB 1L4FA 1EI9A 4UE2A 1Y8CA 4AJ1A 2RC6A 1AUQA 1CUDA 4I5DA 1KY3A 4TT8A 1NXTA 2C78A 4KYTA 1SC9A 2I1WA 5F3RA 2I4TA 5F77A 4AO7A 5HP4A 1EGMB 1R6DA 4FZ5A 3SM9A 4Y2XA 2BMAA 3F4LA 3SEFA 1WBBA 3BSYA 2GF2A 4IHKA 4C2UA 4M4SA 4AECA 2WHRA 4PZ0A 4ZOLA 3V7UA 1Z0FA 3AFMA 1L4YA 2GXUA 2WJHA 3BTSA 4E1VA 3ZHBA 3LX4A 3MOSA 1UJ6A 7REQB 3A1NA 1YR2A 3FVVA 2QMOA 1PJ2A 1G3MA 1PVDA 1R5JA 3AHDA 3DW1X 1F48A 4N54A 3T5PA 3D59A 1EFAA 5JJCA 5AVUA 2F9LA 3V8BA 1VCIA 3VDXA 3AP2A 5AH0A 1GFIA 2V7TA 2ZPUA 1PAUA 2QD1A 2HW8A 3DE3X 2E4YA 4AN0A 1ZIPA 1M2JA 5AQ1A 2PJDA 1MX9A 3EIFA 3W90A 1Q16A 3I9JA 4N7RA 1GD1O 2X2OA 3WBBA 3PHGA 4R8VA 3V4OA 4AYWA 4NJEA 5BSWA 3GGJA 3K0AA 3DE7X 4MKRA 1MKYA 2C42A 2JZNA 4V0MA 5ERGB 3ZHZA 5KDDA 2AMJA 2W6ID 3H99A 3PI7A 4MRRA 5D5HA 2BW0A 3A6FA 4XYLA 4YBRA 3JVDA 4DEVA 3OJCA 4DDWA 2IHVA 1H2BA 4JSYA 3GJ4A 1O6CA 3E1GA 3PEFA 2EJVA 2R79A 3ZTYA 3UNXA 1I1HA 2XQFA 2W6JD 3E7WA 3P2IA 1JGTA 3G8DA 5IJ9B 2I4MA 3ILVA 5EJMA 3P2KA 3I9NA 2PUVA 2P6PA 2ZTUA 1CUYA 2WMNB 2IXGA 1ZHOA 2N47A 2HRCA 2YV1A 4YT5A 3TAXA 2FPGA 1TM4E 2FKAA 3NJRA 4Z8YA 5CCXA 2SBTA 1KORA 1H6DA 2JDID 2VC2B 3HXOA 1UJNA 4HGYA 1PUJA 1SA0B 3DE1X 3HZHA 1B93A 3TSOA 2ZK7A 1YQUA 1SU4A 4MX8A 5CXQA 1X9HA 4DV3B 1S0UA 4JXZA 1T4BA 1UJ5A 3T34A 1QV6A 1IUPA 2DE0X 1JXAA 2OBYA 4UCFA 5F7JA 2GVNA 5B7GA 3NDJA 2WSIA 5C8YB 2VN8A 2P0AA 1RRFA 2A4KA 3QWFA 2CXNA 5AM0A 3KJEA 4OYLA 2AVNA 4WKOA 2KWIA 3I1FA 3GWZA 5T3UA 1KHHA 1SXJC 1ZMXA 5B3JA 2Q9CA 2EJTA 4QUBA 1Q0PA 2QY6A 1M5TA 3TLCA 4F3NA 1RQNA 2ZT7A 4RFSB 1I2MA 3E84A 2COEA 1SUEA 1EVKA 4IIBA 3EGWA 2NPFA 5K8JB 5KREA 1R0CA 2NV6A 2CHVA 1CUCA 3UUWA 2DBVO 2DQKA 5ILQA 3BJEA 4M99A 4CBVA 4DMMA 3TSZA 4EK9A 2HWYA 3VR4H 1T8TA 1B1CA 4OFXA 5L9AA 1J5PA 1GITA 4JA2A 5GIOE 3DKKA 2GJAA 4M0EA 1Z12A 4QBFA 3V32A 8GPBA 3KZXA 4X1YB 2IP4A 5FTKA 2JI8A 3R41A 1DKMA 4FINA 4MYHA 2YN2A 5C9ZA 3ZD7A 4F8JA 2CXHA 4J43A 4RK5A 4B1FA 10MHA 4CM7A 4YP5A 2B8EA 2WICA 4Y0NA 5AW9A 2I4IA 3OD5A 3SXUA 3H1BA 5JTUA 5LQCA 4E0BA 3TW8B 3DCIA 5IC4A 4TL7A 1HH4A 3RH0A 2I3ZA 2WUDA 1QIFA 4FJ2A 4YROA 2QDXA 3WICA 1ZOIA 1R4NA 3L46A 4C04A 5A4JA 2HPHA 4QLBA 1KEEB 4ZOEA 3S3TA 4ASUA 1WA5A 5LPNA 3UGJA 3IPAA 3VZSA 4TSKA 3FJ1A 1ESMA 3T6KA 5CG2A 4D79A 3ZVKA 4MVJP 2CDBA 2VFAA 3NXKA 4FXPA 4OFZA 5CD1A 4KSCA 1LBHA 1EJBA 4KH1A 2MSDB 2O7RA 1NX6A 4O8CA 4E31A 5C31A 1JEYB 1QQAA 1G5RA 1A50B 2WJPA 2QR2A 4HLNA 4OQLA 2VJBA 2WJYA 8OHMA 1E4OA 3FHCB 4BZWA 1HSOA 4AP6A 4JBYA 2FPWA 2XYRA 2APJA 4BFTA 4P5DA 3P2MA 1CFJA 4CU5A 4Y6GB 2GCNA 2VF4X 2PEZA 3CR8A 3ELDA 4ADSG 1GAXA 1KEWA 4KXXA 5J43A 1HE2A 4BMDA 2Z3VA 2OLEA 2PQ6A 4DHWA 1SY7A 1SKUA 3QMWA 4ZAGA 3SKYA 3H19A 5T7BA 2QG9A 4GI5A 1ZNQO 3O95A 2YHAA 3K9GA 3KEGA 1NY5A 1Z13A 1W49A 2IX9A 4OG2A 5FCDA 1FYVA 1IZ7A 4UAJA 1SXJE 2B4AA 4MVXA 2X7XA 1QFXA 3OZCA 1GL7A 3WL8A 4CLRA 2H1CA 4OBEA 2QW0X 1D8TA 4AY4A 2O2CA 4LISA 3VO1A 1E9RA 5IZCC 2PZLA 1ONNA 2L82A 3S8YA 3ZDCA 4V0LA 1PL8A 2XXAB 5HIIA 1PT9A 3A32A 4UULA 3KHTA 4KO4S 3WLQA 2VRCD 3LBAA 2I1VB 2FQXA 3Q1KA 2PM8A 3T99A 3HDQA 1OIXA 4JYPA 4KXLA 5A3QA 1URPA 3KQPA 3W8DA 3EXG2 1JQBA 2CV2A 5F1PA 4CFSA 1S9HA 2O2IA 4JS0A 3LXXA 4P3OA 4Z9XA 4AUNA 1ONPA 1R0RE 2GF9A 1O9GA 5LQJA 1NM5C 2RKWA 4N5IX 5ABPA 1TYBE 1XCGB 4TLDA 3OTGA 2P2DA 1L6RA 1FNMA 5KIAA 1U0BB 1EKXA 4UUMA 4HUTA 2BEUB 3C4QA 2QR5A 2J87A 3HZZA 4QPZA 1SG6A 3WGVA 1Z5NA 4ENUA 2P0EA 2DPYA 3GRVA 4RZ3A 1ISMA 2FEOA 5KDLA 1G2OA 1RBMA 3ABQB 2VYFA 4XQEA 2R25B 1OHHA 3KR9A 5HBGA 5DN6A 4E6PA 1MG5A 3KYIB 1UMCB 3QKRA 3DW3X 4KLZA 2WSBA 2X9GA 3E9CA 5JCJA 4HYTA 3UWDA 1P5HA 1F8UA 3O74A 1P2VA 4E1AA 4BLVA 1ZM3A 5ALIA 3MMSA 1G5FA 3PNPA 3D64A 4JBWA 3FUVA 3UWSA 1LRJA 4AFNA 2BGWA 4CGZA 1KEZA 1PJAA 3K30A 4G24A 4G36A 4L2IA 5FFNA 2XUDA 3CTPA 3T35A 4C4TA 1T4CB 4DBVO 1Q0TA 2WZCA 1G55A 2ZRJA 5J63A 3DJFA 4TTTS 2IUEA 3FZEA 3R7AA 4EG5A 2IDKA 4JVMA 2BKUA 2QU8A 1NJ8A 1ENPA 2WFLA 3DQPA 2DTEA 4E5MA 2PMDA 1HTBA 3V3TA 1M67A 2W6ZA 4C89A 4DY6A 2WTNA 2IYPA 5KU7A 1DXOA 3RVQA 1Q92A 4Z9FA 2W4QA 4Q0MA 3ICPA 5BN1A 2C57A 5H4HA 3WS7A 2P65A 1B1AA 1BXGA 1DC3A 4N9QA 3ZE0B 3OEEA 3U48A 3N8IA 4RZHA 2ZANA 3ESBA 3L8GA 1S8NA 3W2IA 2Q8QA 5JANA 4OMDA 3A0RB 3TNFA 1Z8NA 3H7IA 3D3JA 2YWHA 5IEJA 3ADKA 3DD1A 3OQBA 4AG5A 2UYHA 1Z7EA 2WT4A 4HDNA 3DG9A 2G8NA 5HIKA 3SLGA 2VQ6A 1WMSA 3UT0A 2Z58A 4D9JA 2PCLA 2FN7A 1T5SA 2J3EA 4O33A 5BYJA 3SC2A 2ZB7A 4HTFB 2FWRA 3IAUA 3R9XA 2PBLA 5AHRA 4U2CA 3N8HA 3PWTA 2WK1A 3GJZA 4EJSB 4P4SA 3KUKA 2YIVX 1CDZA 2GD6A 3MJHA 4OF4A 4BCCA 5LMCA 4YAJA 4RQTA 3TTXA 2WDPA 3REQB 1WZNA 4K05A 3FVWA 4AYTA 4XSHA 2XYQA 3E2MA 4B6OA 2CHGA 1L3CA 3OZFA 4P7GA 4YPVA 2V1UA 5BSFA 1E6CA 2YXEA 4W9NC 4ZT5A 1PP4A 1QOQB 1P1BA 2OOKA 3RHFA 3ZV7A 3O8CA 1QBGA 4JJ7A 1G1MA 1QCYA 2FE4A 2IZ7A 4LFAB 3IUNA 4FCCA 3DZDA 4BNUA 1GNRA 3L07A 4TMTA 4XIYA 4N12A 3EWSA 1G98A 1JPUA 2XUZA 3EAQA 4IJQA 3A6ZA 1N78A 3CR7A 2PYZA 3F3MA 4LAFA 3B53X 2XGMA 4AW9A 3F73A 2W48A 4EGJA 3HMKA 1OYOA 5JFTA 5AFSA 5IU6A 1USWA 4N18A 3GFFA 1ZIDA 4MINA 3RGWS 3J7TA 2CYAA 2Q9BA 1PBTA 5AI9A 4JYZA 1ULAA 3A6JA 4G1FA 1JHXA 2WC1A 1MTZA 2EKQA 2CLOB 4ZCIA 1EWVA 3KOUA 1UKEA 4YRZA 1AZSC 3H4MA 1Z2EA 3P0FA 4LN1A 4MP6A 2WVJA 1QQ5A 1SAYA 2CK3D 3FLAA 4MUFA 4NS1A 3VDMA 2J5XA 3WLIA 2JLYA 1SVIA 4GGPA 4LW8A 4B6FA 3B3AA 5B53A 4D4JA 3PA6A 1I80A 4RD2A 4HAWA 2J0VA 1MIOA 3QU7A 1VSBA 6ABPA 1SOMA 2I1QA 1LI5A 2XNCA 2AE2A 3V4FA 1X1BA 1G20E 4OH7A 2C5FA 3V5NA 1UOEA 5FBZA 3C1AA 1P33A 1V5IA 1YHZA 2ENUA 2HRBA 3OMXA 2JAHA 4M1ZA 3ZXSA 2QSYA 3UMVA 3OUZA 5JZBA 4TMZA 1RRVA 2VHUA 5K8LA 2FZLA 4Q9DA 1XZGA 2HLDD 3L7CA 1Q2XA 2YQZA 3T3OA 1GCOA 2E4VA 2ZRCA 3FDZB 3WGMA 1A9SA 3GT4A 5IKEA 1USKA 2HCTA 5C52B 5ADHA 3G8BA 3ZLUA 2OV4A 1GNPA 1MV5A 3ZQJA 1NQWA 4AJ4A 1KR2A 1H42A 2XYPA 3E61A 1GN8A 5DV9A 3IOBA 4PXAA 3RD5A 3BHNA 2AKEA 5IXYA 4ER0A 3GK3A 3ZU4A 1DRKA 1HTWA 3TX2A 3FRIA 2ESRA 3GRAA 1YZUA 3Q7PA 5HMMA 4NY1A 3N7UA 4TN5A 5LB2A 3T7SA 2P2NA 4RMGA 4YQYA 4UCXA 1LGYA 2OZEA 4L4ZA 1NN3A 1V16B 5J58A 1WO8A 1LB1B 5K9ZA 4PYMA 3JWPA 1JVNA 4M6WB 1JR2A 4D3YA 1N3LA 2BEJA 4D9GA 4EYSA 1KEKA 2GM5A 5FWNA 3CZPA 4JNCA 5ELMA 2FE1A 3NH6A 4N40A 5EEGA 3WQSB 1VYUA 5DIFA 4R68A 1W36B 3MXOA 5KQLA 2PK3A 4D4HA 1V71A 1EWRA 1FYWA 2HH9A 4Q3AA 3U9LA 5CYGA 4GL2A 2YY6A 3LV8A 1Z4NA 4NCBA 2WD9A 4WNAB 2IE0A 2IH5A 5HQJA 1ZVVA 1JA9A 1ZCFA 2J3KA 1EK5A 2QN7A 5HPYB 2C1XA 4P54A 3CQ9A 1S01A 1WBJB 2VJYA 4L8FA 5HIJA 1G3IA 3V2IA 1AQNA 4ZJZA 4KUGA 5HM6A 4KBGA 4RY0A 4RA6B 3ZGZA 2YMQA 1CC1S 1NVAA 4P5EA 5GGXA 2IU6A 1CV2A 1D0SA 3Q7RA 1NKVA 1VL2A 3RSGA 1IK6A 3KB6A 1O4WA 3C3BA 1NW9B 4O4HB 5LD2C 1U1CA 2YW9A 3M5WA 3QKIA 1CUBA 3JD0A 3TNYA 1L2TA 2Y2VA 1DEKA 3OF5A 2B8WA 1Z06A 2A67A 3DEKA 2PMFA 1YVUA 1XZNA 2X5NA 3ZX5A 4OGWA 4N0MA 3WRYC 3GAFA 2G88A 4GL4A 1QTNA 4BVFA 1JEQA 3Q3CA 1GPKA 1S2OA 3O8LA 2V7GA 1OI2A 3LDAA 3QJYA 2C88A 1O57A 2FX2A 4PU0A 4WBXC 1WPRA 4RVDA 4EEKA 1KYTA 2ZSUA 1BH2A 4KE6A 1UC8A 5AI8A 3T5CA 3ZDYB 2GRJA 3BMOB 3MWJA 1HE8B 1X7XB 3V1NA 4TVKA 4BVJA 1ZWKA 5I6DA 2G5TA 1NNSA 3EIXA 4JVLA 4CV2A 1GN9A 4KV7A 4CLOB 1RYYA 5CVUA 2V7UA 1MA0A 4HAIA 3QVLA 4GLFA 2ZB4A 2Z8YA 3B2EA 4B9AA 3UTDA 1TZ2A 2EL7A 1I7PA 3DXFA 5BN5A 4CM4B 3SSAA 2QT1A 2G08A 3IQEA 3OHMA 3OFNA 4S1WA 3KEFA 4EW6A 1ZIYA 1MT3A 1D8AA 1CKEA 1ZOOA 2G76A 2GPJA 3C5EA 3C8UA 3RUCA 5BUSA 1DWOA 4MKGA 5KNCA 1PWEA 3DE0X 3IDQA 3ZDBA 1EUYA 3SIXA 1ZKDA 2C1EA 2F4NA 2I55A 1QMGA 2VYNA 4QFMA 4D6XA 3KSAC 4F2HA 4QA9A 3A9CA 3TEJA 4DSTA 4KAJA 3MGKA 5EHNA 4ZKEA 1TC1A 5JBQA 2H63A 3BG5A 4P3NA 2FOXA 4GOKA 5C0OE 1AMUA 1OH7A 4LYHA 4GS5A 1L8LA 2IYYA 1BGVA 3GBPA 3OWXA 2Y71A 4M9XA 4W5QA 5JSUA 1O96B 4I5FA 5BNZA 3H2GA 3QUTA 1NVWQ 1VJCA 4JP8A 1FSGA 4ZI7B 1R0LA 5KTPA 2Q9AA 1H2AS 4R69A 1HM5A 3BE8A 2QTNA 3FDIA 1OH8A 4K8RB 4ZGWA 1XAHA 1B3BA 2H5LA 1IONA 4KX3A 3KDPA 1IEXA 2HV9A 3ENKA 3AQIA 1J42A 1CY4A 2QTZA 5DHQA 3MGGA 4FGJA 3G88A 3F3SA 3GXOA 2IHTA 3LOPA 1B3RA 1XEWX 4JENA 4KHZA 1MRSA 5DZSA 3RLFA 3UHPA 4LE0A 5A5DA 1JAIA 3OA2A 1WB9A 3GJ7A 1IL0A 1WNFA 4DG8A 4PLCA 1J2YA 1F8GA 1OF1A 2Y6VA 3SBOA 5A06A 4IS3A 4KR7A 3L77A 2YJTD 5EMNA 5BRAA 5JROA 4MW2A 2FMFA 1QG0A 2P2ZA 2XZTA 3LBNA 2VHJA 2RCNA 4FBGA 1B43A 2WHXA 3TMKA 2JK1A 1R50A 3RIGA 4EA9A 3R3ZA 2QUIA 1EXNA 4JT9A 3U4MA 3TI9A 4IMIB 2A3RA 1M1ZA 3HCFA 4I3GA 4KPFC 3VVMA 4ANFA 2IU4A 4Y2RA 5D3KA 3IAEA 5IT5A 2ZRFA 4II3A 4DIDA 3VH1A 2NM0A 1LQTA 4PYJA 4RZIA 4EZIA 4MCAA 1XMIA 4IIHA 4D74A 4HYEA 2B8JA 4B8YA 2OFWA 1I2BA 2I0FA 2E9SA 3QBEA 4YAIA 1OJ7A 2CC2A 4KXQA 4OCZA 3UMCA 1V41E 2BFAA 2RHHA 1MJ5A 2B7CA 3IB6A 3RFUA 5EQDA 1O95A 1O8CA 3P96A 1B0ZA 4DXAA 2C29D 1FDTA 3ER9A 1N5IA 2ZE7A 4XASA 2F1RA 2VF7A 4EECA 3LIIA 3QV2A 5HHTA 2RGWA 4NTZA 5LNK1 4EI2A 4XJTA 3BEDA 3TFWA 1UKVY 1R27A 1JILA 2DP4E 3VNRA 4EKIA 4O4IF 1IPFA 2D62A 1SKYB 1Z0SA 2QTAA 2ZSBA 1YBHA 2A78A 4H31A 4PNHA 1VB5A 4OHYA 2ZYDA 1VBFA 5DCYA 3ZZUA 4UUOA 4ZTBA 1T9HA 1P9LA 5LUBA 4DMFA 3WWCA 4BATA 4L8VA 2F43B 4F8EA 2W9XA 3T4EA 1RADA 4D6PA 4OAQA 1P1KA 4ZVRA 1SHTX 2PWYA 2H65A 3G3EA 3ASZA 5CJJA 3IDZA 3O2JA 1NP6A 4F1WA 3VBEA 5JNSA 3WGHA 5HS6A 2RGXA 3BOSA 1Y1RA 3L84A 1HDZA 4UPVA 1Q3TA 4MQFA 3Q8LA 4GYYA 2OQVA 4E5SA 3LBYA 5M2QA 4M0DA 3MJRA 3QXHA 5GAJA 3I72A 2H08A 1WG8A 2E4XA 3Q6IA 4L4RA 4TYPA 2RH4A 4ZI5A 5JH7B 5KOJB 4PLVA 4O2BF 4TM8A 3KKEA 1N7IA 4RV9A 4D6YA 3MWYW 1M6HA 1TXGA 3HA5A 3KEQA 4TLEA 2E82A 4D9CA 1EBFA 1ECFA 3H5LA 3PSAA 3T9DA 4B9EA 4ZYZA 2WA2A 2B4TO 4ZT3A 1KZGB 2CXPA 3PRJA 1UMDB 5WRFA 3ACCA 3JQ8B 5DM70 2PEYA 3L8YA 5JUWA 1OFHA 3M1YA 3UW3A 1ENZA 1L3IA 1RNLA 3GYGA 4GM1A 4HB3A 5DP2A 5ILGA 5FPKA 2C0PA 1Y33E 3VR5D 1QF9A 4G5SA 5CA0B 4M1TA 4UUPA 2QQGA 5BMVF 2H1IA 2ZI6A 5TGZA 4CMHA 2DLNA 1PX2A 3MLAA 1PFUA 4D9IA 3L82B 5KNBA 4XUGB 3BIOA 4YRGA 3E7PA 3PR3A 4TMXA 5F4BA 5AO9A 3R7SA 3QVGB 1JKFA 3W9UA 4QOIA 2QYTA 4O4IA 1K4YA 4RELA 3FMVA