3NBKA

Phosphopantetheine adenylyltransferase from mycobacterium tuberculosis in complex with 4'-phosphopantetheine
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
158
structure length
158
Chain Sequence
HMTGAVCPGSFDPVTLGHVDIFERAAAQFDEVVVAILVNPAKTGMFDLDERIAMVKESTTHLPNLRVQVGHGLVVDFVRSCGMTAIVKGLRTGTDFEYELQMAQMNKHIAGVDTFFVATAPRYSFVSSSLAKEVAMLGGDVSELLPEPVNRRLRDRLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphopantetheine adenylyltransferase
publication title Kinetic, thermodynamic, and structural insight into the mechanism of phosphopantetheine adenylyltransferase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 54
structure length 158
sequence length 158
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.3: Pantetheine-phosphate adenylyltransferase.
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3nbkA00
1O96B 1O94D 3RK1A 2WSIA 1EFVA 3ND6A 4PBSA 4OJMX 3ZUGA 4ARCA 3DLAA 3X1MA 2HZ7A 1N2IA 1F9AA 4G5FA 1IRXA 4J75A 4MWEA 1EFPB 4MQ6A 1G8FA 1U7DA 3CVWA 3G6KA 1O97C 4DJAA 1JMVA 1N2GA 1MB9A 1MAWA 3CLSC 4OUDB 1GPMA 1WZ2A 1JIIA 1KKUA 1I6MA 2J4DA 2RE8A 2CV0A 1O97D 1JZSA 1COZA 3ELBA 2CYCA 4NAUA 3D6VA 4ND6A 1WXEA 3CLSD 4DDMA 2CUZA 1TYAE 2B7LA 1SURA 3N9IA 1EJ2A 4DNXA 2I1LA 4Q93A 5KHAA 1QQTA 1JECA 1X6VA 3CA8A 1JILA 2DEUA 3M5WA 3K32A 1PG2A 1M83A 2PZAA 4MVXA 2J09A 5J5AA 1NUPA 2Z09A 1MBZA 1YUMA 4EGAA 1VBMA 4A91A 1Q15A 3IDFA 2OV4A 3RHSA 2QUHA 4NX2A 3A4IA 4MAFA 1KH2A 2CYBA 4X0EA 5FO0A 1TYCA 3ZJVA 2VTBA 1Q11A 3QTTA 5IJXA 1NI5A 1VBKA 2A1UB 1NUSA 3FHJA 1J21A 1T9GS 3X1JA 4EFKA 1ZUNA 5LM3A 3AG6A 2O5RA 4P2BA 5BNZA 3K9WA 3IMCA 3ZJUA 4MUKA 3ZXSA 2AG6A 4YP6A 3NV7A 4KR9A 3CVXA 4EG4A 4MW7A 3DPIA 3A05A 1IQRA 1M8KA 2A84A 4MLPA 4R2LA 3CLTC 5LFAA 3RJZA 1QJCA 1KAQA 2NZ2A 2A7XA 1KP3A 4CT0A 2QUKA 3FOCA 4MUJA 2V0GA 5IHXA 5TEVA 4MUFA 2H29A 1KQOA 3CLTD 2CFOA 1JHDA 4EG3A 2HMAA 1OBHA 4KR6A 4MWBA 4YBRA 3SZ3A 1PFWA 1U3CA 1WKBA 3UK2A 3UOWA 3KT0A 4L2IB 2G36A 5HUHA 1N2JA 5TEWA 3TQIA 4EG8A 4MW1A 1O96A 1K92A 2X3FA 3CVVA 1QU3A 2WQ7A 4ZCRA 2A1TR 3H9BA 4WNYA 4EG1A 3LE8A 4MW0A 3FETA 3H05A 3HMQA 3ZGZA 1GLNA 2YY5A 3AL0C 1IQ0A 1EFPA 4Q16A 2QJTA 4UZFA 1OBCA 4F4HA 5J59A 3IVCA 4XFJA 4MW2A 2CSXA 3PNBA 3Q10A 4GRIA 4CDNA 1TYBE 1WXHA 5DEOA 2E0IA 4OUDA 1IVSA 1MAUA 1S4MA 3VGJA 3RFFA 4MUIA 2PFSA 3FI0A 3L92A 4I6GA 4HJRA 1LI7A 1YIDA 4QBTA 4EG6A 3GLVA 2BTEA 1I6LA 1JIKA 5FO1A 4EG7A 3H97A 1DNPA 3LOQA 1OWOA 4ZT3A 2D54A 3TZLA 1F7VA 3IMEA 1T6ZA 3HGMA 1XNJA 3FWKA 1JEEA 2JA2A 1QU2A 4S1OA 3AIIA 3AFHA 1J70A 4JXXA 1NSYA 5HG0A 1KH3A 1WJGA 3CLRC 2Z08A 1K4KA 4MUEA 4HJXA 1K4MA 1NYLA 1G8HA 4XFDA 1I2DA 2O8VA 1EE1A 3COWA 2J08A 3G5AA 1N1DA 1OWLA 5HUJA 1MB2A 2A1UA 1P7PA 3CLRD 3IUBA 3H9CA 1J1ZA 1K97A 1U3DA 4KPUA 4JYZA 2J07A 4R0NA 2EL7A 3IVGA 4J76A 1LI5A 1WXGA 1OD6A 3Q4GA 1J09A 1TYDE 1TQ8A 4I6EA 2CV1A 1O6BA 1NUQA 3HFJA 2CV2A 2PZ8A 4QREA 4F3RA 4RPIA 2BYTA 3SZGA 4PY2A 3HV0A 1JZQA 1JEDA 3FDXA 1N2EA 3GUZA 4KPUB 2A4MA 1QRTA 1J1UA 1M1ZA 1RQGA 3IODA 3SEQA 3P52A 1MRZA 2PZBA 1VL2A 3VU8A 1IQUA 1Q19A 4K0RA 3VRHA 3MXTA 4HK4A 4ZCTA 5JBNA 3AKZA 2X0KA 4L2IA 1JIJA 3DO8A 1GAXA 4MWDA 4ZT7A 3ND5A 3X1KA 1N2HA 3TS1A 1N78A 2QJFA 2Z3VA 4MUGA 3OP1A 2GM3A 3IUEA 3A04A 2IJGX 1H1TA 2DUMA 4E1AA 4G6ZA 2OQ2A 1N2BA 2J5BA 3QTBA 4YP7A 4AQ7A 1YI8A 1ZJWA 3KT3A 1U7XA 3IH5A 1N77A 3KT8A 3ISJA 4MW5A 2XRZA 4HPWA 1O0CA 3IOEA 1XNGA 2WQ6A 1NZJA 1IFXA 3FNRA 4MW4A 3PNVA 3COVA 2D5BA 4ZT2A 3IOCA 3DV2A 2AZXA 4I6JA 4MW9A 3RBAA 1PG0A 3FIUA 3JXEA 4H3SA 3RK0A 1MC1A 4BWVA 4K03A 2A88A 3TZEA 2DPLA 4MWCA 1KP2A 5DASA 4PBTA 3QE4A 1FFYA 4ZCQA 3UY4A 1GTRA 4ND7A 1WXIA 5DB4A 1I6KA 3D6UA 3ZXIA 4QRDA 5K0TA 4MW6A 1V8FA 4NATA 4NZPA 4R2MA 1LW7A 1N3LA 3MLAA 1QNFA 3C8ZA 1MOPA 3KT6A 3N05A 1KORA 4GU5A 4AS1A 1T9GR 2R5WA 3P0IA 4YMIA 2WB2A 1X8XA 3TQOA 1H3EA 1MJHA 5TS2A 1GTSA 3ZJTA 3NBKA 1FYDA 4NDAA 4JZYA 3E27A 4TS1A 1IHOA 2GKSA 1H3NA 2QTMA 3CVUA 2DLCX 2PIDA 3P0HA 3G59A 3SEZA 3N8HA 1O0BA 3BL5A 1N75A 2DETA 4DDHA 4MUNA 1JGTA 3I05A 4YP5A 1PFVA 4JXZA 2YWBA 2PG3A 4DLPA 3PXUA 1WOYA 3HL4A 1M8JA 3CLUC 2ZUFA 2DXIA 4ZT6A 4MUHA 4MVYA 5KCMA 3COZA 2QJOA 3PRHA 4ZCSA 1EFVB 1WQ3A 3CLUD 3IVXA 1EUQA 2QUIA 1VLHA 2VXOA 3FG9A 3ZIUA 2QTNA 1WXFA 1EUYA 1F7UA 1WY5A 1CT9A 2X1LA 3UMVA 1IH8A 1PFUA 2IELA 3TNJA 1NUUA 4ZT4A 1ULHA 1OWNA 2A1TS 3N2YA 4U8HA 1ILEA 4CQNA 4EG5A 1G8GA 3P0JA 4PBRA 4MVWA 2HGZA 1XJQA 5DK4A 5H16A 1NURA 4JFAA 1KR2A 3AG5A 5K0SA 5KWVA 1WQ4A 2ZP1A 1O5TA 1OWMA 2JANA 1T6YA 2DR2A 2CYAA 1NUTA 2YWCA 2QTRA 3IOBA 4G5YA 3HZRA 3FH0A 2AKEA 2A86A 1YIAA 4KKVA 3COYA 2TS1A 3ILVA 4ZCPA 3INNA 1TFUA 4EF6A 3KFLA 1HYBA 2IP1A 3SYTA 2GOYA 3MUEA 4U7JA 1V47A 3MMXA 4XSVA 1UFVA 1R6XA 1M8GA 1YULA 3SP1A 5F23A 1Y42X 1R6TA 3Q12A 3CR8A 1D2RA 1BS2A 1M8FA 2PXHA 1KQNA 2ZUEA 2H2AA 5EKDA 1O95C 1QRUA 2VTBB 1GZUA 3CVYA 2V0CA 2DERA 4ARIA 1KQPA 2C5SA 1OWPA 1VBNA 1YUNA 2NSYA 1A8HA 1R6UA 1QTQA 2JAXA 1O95D 1ZH6A 2RD2A 3FY4A 1ZH0A 1QRSA 2D13A 1G59A 1T6XA 1KAMA 2X1MA 2XRYA 5J58A 3GMIA 1KH1A 2CT8A 1J20A 3A2KA 4MULA 4RUKA 5FNZA 1EXDA 3U1VA 5H7XA 3MLBA 4NAHA 3S3TA 2YXNA 3L93A 3ND7A 3IMGA 1GN8A 1PFYA 2E21A 1M8PA 4U63A 1F4LA 1TEZA 4WSOA 3PNYA 4DE5A 1Q77A 5AHWA 5LLTA 1NP7A 4MVCA 3F3MA 3UC5A 5TGTA 1B6TA 2EJCA 4ZT5A 3LCJA 1O94C 4FZJA 3SDBA 1H3FA 2E18A 2E89A 3OTWA 3H99A 3NBAA 4KR7A 1XNHA 4UZEA 1U0BB 1N2OA 2QUJA 4CDMA 4DDKA
chains in the Genus database with same CATH superfamily
1AT1A 1GUZA 1WCYA 1IB0A 3L6DA 1TJPB 3RK1A 2WSIA 3DO6A 3V00A 4IDQA 2J3KA 5LOVB 1Z28A 3EAFA 4N9WA 1LNSA 2ZCUA 3VKWA 5JAHA 4KI0A 3WWDA 1Y33E 3C8UA 3DEKA 1C7QA 1ZINA 2GZ2A 4J75A 1KY4A 2MR6A 5CD9A 4H77A 1EFPB 3OPYB 3SM3A 4FFDA 1USIA 4X1YA 1J07A 3NHUA 5EJ2A 4PM4A 3RHZA 1TVKB 2MTBA 4U7GA 4MZDA 4G81A 3OOSA 3KAKA 1MC4A 2LZ0A 4GF5A 1CUHA 3ORQA 3ZWOA 1E63A 5JV5A 3H9UA 4PNPA 4TTIA 3CEAA 2ZANA 5DZSA 1JRLA 3NO4A 3PQ8A 1GCIA 3C7KA 4OQDA 4QXQA 5DM4A 4BLWA 3DOEA 5JS6A 3B5IA 3GELA 1SK9A 1PJ3A 1VJDA 2N0SA 2OYSA 2Q5QA 1E2FA 3Q3CA 2C4NA 3GFSA 4KAAA 3RRFA 3GP8A 2ODTX 3D6VA 1A9PA 3OZTA 4OYRA 5A04A 1DHRA 2QRGA 3FKJA 1W0KD 2WPDA 3KPUA 2ZB4A 1CUVA 4EENA 5C81A 1DAMA 1EJ2A 2OA0A 1IXYA 2JBWA 2QT0A 2VP2A 4UNIA 4BBZA 1Z16A 1QHFA 2H4XA 3C7AA 4P5DA 1K8YB 4DSNA 1PK7A 3HP7A 4W1RA 1SUWA 1JIVA 4LXHA 4NG4A 2QQFA 1NAHA 4ENWA 1NF8A 3AZQA 1HUQA 4ITVA 4WFQA 4TVKA 3DTNA 1OH7A 3EPJA 4JELA 4EYEA 1I5EA 1JEYA 1E32A 2B34A 3IUJA 4OXYA 5C4GB 5BMVB 1YASA 4E5UA 2AR0A 5J5AA 3SGLA 2EKPA 1E1RD 2Z09A 2IYQA 2AMVA 4C2BA 4LGVA 4EQ6B 3IDFA 2XDYA 3JQ6A 2G3YA 4CN9A 5FTWA 4BLRA 3C3EA 4IPTA 4MEJA 4UU1A 1ZNQO 4CR6A 4NMLA 2AK3A 3BJRA 5AHOA 1AMNA 3UF0A 1Q11A 4C6HA 2ZRBA 4LECA 4NBRA 4QQFA 4XQEA 4YRGA 1CFZA 4QXOA 3DL2A 1DKLA 2HF8A 4E7PA 3MCVA 2R7AA 3A6PC 3IMFA 6ADHA 3G2OA 3RSFA 1N3IA 1LPMA 5UKDA 1KVSA 3KCNA 1P2BA 4PINA 2XCQA 4QFBA 5JRDS 1BEUB 4AVYA 4O2AB 2IOFA 4NH4A 3T3DA 2AG0A 1HE3A 2FEOA 3N2KB 4OYHA 5DYWA 2PMEA 3K0HA 3BFJA 4HQ6A 4IRMA 5AUQA 5LP6C 5EXPA 5NLLA 3LK7A 1VGVA 4UM9B 3QEKA 4HTAA 5IVPA 1NRJB 2COEA 2IZ1A 1BJKA 3AY3A 3WLRA 4MKFA 1FP7A 1GOTA 1BE8A 4JR1A 5KYVA 2QSJA 2R1TB 3CF4A 4G07A 3O4JA 2J9FB 3I23A 4J91A 5DTIA 4OHUA 5IHXA 4CMKA 2OCXA 1ODTC 4K0KB 3QELA 4RLHA 5KTOA 2ZTHA 3VBEA 2NSDA 2YKGA 2QZZA 3MOSA 4LA4A 2I34A 1DX9A 1PQUA 1UIMA 1WUHS 5ERXA 1E5TA 5KEIA 3IE1A 1H2ZA 2GAJA 3B1KA 4MP3A 3U9TA 4EFMA 1PFWA 2PLNA 3ASVA 1S5PA 3QE3A 3QKRB 1IVNA 2C9BA 2H54A 2BHTA 2YYZA 3OE1A 2IBMA 1PS0A 2I3DA 4N39A 1E0DA 2MDTA 1KJQA 1F8YA 4YAJA 1V5GA 3H5WA 4G3XA 5DHTA 1JDBC 1IEVA 1KDPA 4DR5B 3LQKA 3N0XA 2YIDA 4REQB 3H9BA 1AZWA 4A2QA 2N47A 3E22A 1J7KA 3ZGZA 4J1NA 1OXMA 1E2QA 1T29A 2AN5A 3K8OE 1DMRA 1QKKA 4LYEA 4QRHA 2CHVA 3FSGA 4EY3A 1G2OA 1L5WA 2YVKA 2YW2A 1TIPA 1QIEA 2WDPA 2ZUUA 4GRIA 3KUKA 4HQFA 2ZWIA 3BXOA 4UPEA 4YUYA 2O2DA 3A6EA 2VT6A 3T7AA 2FPUA 2XOKA 2NTVA 3R0QA 2ZUTA 2OKGA 2Q46A 1AKNA 2Q29A 5REQB 2NNWB 2MCFA 2WSLA 3EWIA 4E21A 4E2ZA 1QZXA 3KWLA 4S35A 3Q2OA 3W5AA 2O8EA 1JR6A 1Z68A 1S2MA 2I6QA 3GFGA 4XTCS 5AM2A 2C29D 4HNVA 2Z9DA 4OXXA 1K3TA 1NSFA 2I99A 3BBLA 5G02A 3O3CA 3U13A 1M76A 4P3KA 1VKZA 3BMOB 2E4XA 1KZ6A 3HGTA 2DF8A 2H1LA 2NUTA 4FT4A 4A0FA 5GZ3A 1YB4A 2HA3A 2FWIA 2JGMA 1EQ2A 3KR2A 3I01A 3ZHRA 1V25A 3NONA 2UUAB 3H65A 3SNKA 3JQAA 4B3CA 2VXYA 1E2JA 2W6JD 3FSRA 1QWSA 5DULA 2EFCB 3JATB 2XCRB 4PYJA 2WTUA 3QA9A 3E7DA 3A0UA 1KPIA 3U62A 2JLBA 4M0DA 1KAEA 2CCKA 3BMCA 4UTZA 3DAOA 2WJYA 2WV9A 4HJXA 1T6BY 4R3WA 1Y4AE 2OV8A 3OJFA 3PHLA 3DZFA 4TMYA 5DYTA 2PIAA 2IW3A 3UHOA 5AHXA 1U3TA 4QQRA 5H59A 1DG3A 3VJMA 2ID7A 3RSZA 3WBBA 5LSAA 3HCFA 4LGYA 1OHHD 3DT6A 4XFKA 1DDIA 4NQZA 1QKJA 1NJ1A 4OU4A 4DC0A 1Z35A 4MVJM 3TECE 2DVMA 7MDHA 1ZMOA 4Q4AB 2KM1A 2XEDA 4TV8A 1XE3A 2RC5A 4P54A 4CKBA 2WWTA 3ZU6A 1HNWB 2H1VA 3AL2A 2GEBA 3UGKA 3B3QA 1O6BA 1JHXA 1ZICA 2DR0A 3T4XA 3L7OA 3HFJA 4ZZ1A 1YRYE 2YN4A 4DT1A 4RJTA 4QXMA 1XVIA 2AVDA 2PKXA 5GGYA 5L6LB 5K6AA 3LHDA 2VXBA 4MQFA 1YE5A 3E7FA 4ZU6X 4B2YA 5HKBA 5L9AA 3VR5D 2X4DA 3ETNA 4I1PA 4P6VF 2HRRA 2H57A 2GD6A 2V4UA 3GOQA 4OBBA 1E6CA 5DN9A 4EJ6A 1ZEJA 5TPZA 4J8PA 1LTKA 1RRKA 4BWYA 3S1LA 2HEIA 4TVBA 4MVJH 4JC0A 5HTKA 3EG9B 2HRQA 3EXG2 2WAXA 4J0EA 2E9SA 3SHWA 3JY6A 5HZGA 1IQUA 2I2AA 1AF7A 2I4OA 4EHBA 7REQB 3WAJA 2IZ5A 1HM5A 2XCIA 1FQKA 3LPDA 5B55A 1X92A 4D43A 5AVXA 1CUAA 3A6LA 4GLBA 4JLOA 1OVGA 3BXFA 1D2HA 1B7GO 1GAXA 2Q6IA 3BEDA 2I29A 5DIFA 3WL8A 3FN4A 3AETB 4KYIB 2HBRA 5F1OA 3SC2B 1N78A 1W85B 3IXQA 4MQ4A 1ISRA 2C83A 3F5DA 3NT2A 4FX2A 1XRQA 4DNPA 3NT5A 5F1YA 3STVA 3HJAA 1ZJWA 3A2LA 3KT3A 2ZCJA 3IH5A 4FR5A 1XTRA 4XRRA 5K5EA 5L6MB 2P40A 2GBLC 2I6SA 1EWVA 4HPWA 2WPNA 3KNZA 4XDHA 4QPZA 2NVUB 3RODA 4A2CA 1GL9B 1GT6A 2ONZA 3EIWA 4XARA 3DT8A 4JR0A 4D4HA 3CMMA 1YZVA 1C30A 3NW9A 4JS0A 1YQQA 4K28A 1N7IA 4PZCA 2O20A 1RIIA 3G1UA 2AZXA 5AVRA 3ENWA 1NTRA 4UM8B 3D8BA 4ZOLF 5D1HA 1JBKA 2XLBA 5DTRA 2PRKA 4UXIA 4A7PA 3OHSX 5LU9A 2KQUA 3GBVA 3H3XA 5MFZA 4HMQA 2UZ0A 1A50B 3EQ2A 2P3OA 1K7YA 4CM9A 1QGYA 2BV3A 2VSOA 3NBUA 1XD8A 3GRUA 4QPPA 4UAUA 2J3MA 2XMBA 3PC7A 4GHWA 2AC4A 3TCNA 4K6HA 1ECGA 4ARAA 3RC8A 2O57A 1ZD2P 3CUTA 1YGPA 1RD4A 3G6WA 5L3VA 2KWIA 3MUOA 4QRDA 2PSHA 4GGPA 4L9AA 5FOSA 2Q28A 4DS3A 4ATNA 4YRBA 1KYZA 1Y6ZA 1W5AA 2GZSA 1B3RA 1CVRA 3QGMA 5CHEA 3OTGA 3QVLA 1DC3A 4O4HA 2FJPA 4MUAA 3UW3A 4AG6A 3GB9A 2AOUB 1UQRA 4IDEA 5F7ZA 3KT6A 3VH1A 4TYMA 1CQJB 1JHYA 1SUPA 4YREA 2HJRA 4ER3A 1YQ9A 1BH2A 1LB1B 1P5FA 1X2EA 1ZBQA 2AN9A 2X0NA 3MD0A 1IOVA 4PRZA 3OIGA 1MJHA 2XTZA 2ZVPX 5AW1A 1Y0BA 3I2YX 1JPUA 2A92A 2R79A 3BGWA 3QYAA 4CR7A 2CEAA 2AZ4A 3M70A 4BDTA 4H1VA 1KXZA 2VBGA 2WSBA 2EFYA 4H08A 3WNVA 4UAGA 1SEVA 1EK6A 2BFPA 4NMMA 4L76A 4OKSA 2FVXA 4B9EA 2H2DA 2Z5GA 1J5EB 2GRJA 3H0CA 5KNCA 1ZRHA 4H18A 5J2TF 4BMSA 2Z1NA 3NNSA 4XQ0A 1JE0A 1JE1A 2AUTA 4KXWA 2VDJA 4LYJA 5ECWA 3TSAA 5IT9A 1YS4A 4TS9A 2A67A 2VLBA 3A31A 4OQ4A 4LF5B 3CLUC 5IARA 4EBFA 3RUCA 1K8RA 4CL0A 3P0RA 2BL4A 3AEKA 2MT9A 3T3OA 1DC6A 5A05A 3X3HA 1P29A 2W7TA 1AG9A 4LY9A 3ZHTA 5T6BA 4ZHQB 3CR3C 2WVJA 4M1EA 3G23A 1ORVA 1KVTA 3OE5A 4LS3A 4QBGB 3U4HA 4BVEA 4J4BA 3L40A 2QUIA 4NTZA 4URUR 3C74A 5IAKA 3FG9A 4X60A 1INLA 1DJLA 2JKYA 2ZBPA 5EWLA 1Y8RB 5GADl 4G0YA 3PJRA 5ADHA 3N8DA 1ZJ4A 2Z0MA 5FNVB 3S2YA 4BASA 3P45A 2FWJA 3L0OA 5IFLA 4U1RA 1XRMA 3QPAA 5D3MB 2ZXUA 5AKEA 5EQFA 4Z4FA 2HWYA 3ZDBA 3BZWA 2P5UA 2QZ4A 4K40A 3I92A 4Z3OA 3WMWA 1GSAA 5LP6F 2J33A 5IDQA 1PUJA 2O5VA 1JLLB 1YAHA 3ESAA 3FXAA 4B35A 1R66A 3OAAD 1T1RA 3AIMA 4BFWA 4JWKA 5FTKA 2UZ1B 2FUEA 3OMWA 2VP9A 3DH0A 1TMOA 3MGGA 1PR0A 3PNKA 4UDYX 3WGOA 1ABEA 3EAGA 3WGGA 2WU3A 1SXHA 2K7ZA 2ZE5A 5LA6F 2X0DA 3DBRA 3QWFA 1Z47A 1HOXA 1U2PA 1NV8A 1DBPA 2GZ1A 1U02A 4ZRNA 4AMVA 3A06A 2Y67A 1NLYA 3L18A 4ROSA 3KTAB 1X9HA 2OSBA 1PR5A 3HJBA 4FHEA 3TEMA 2OLEA 5K3FB 3ECSA 1E7YA 5EXXA 4W5TA 4P81A 3M1AA 1I3CA 2IXGA 1YU9A 2XRMA 5GZ6A 3OM0A 4BQEA 2ZB8A 3AHDA 4F72A 5DYYA 1T8WA 3Q5DA 5J4HA 3KYJB 4RVDA 3CTPA 3FPLA 1Q92A 2BTQB 4KGZA 3ZI4A 3OU2A 4HX5A 1NBME 2OESA 3RHTA 1FB5A 4HPJB 1C4OA 2JFFA 4FYJA 1VGRA 5B5SA 3FWZA 4X64B 4RVSA 2F3SA 1CDOA 1QAQA 3WL3A 2HX1A 2V0CA 2PANA 1H2YA 4NMHA 3CVYA 4TWZA 2SHKA 2WYWA 1IZ7A 1A76A 5K99A 1N6HA 5ITWA 1FTNA 2ZWAA 1ZUNB 3M3DA 1BSVA 2PAAA 2E55A 2ZJ3A 3NHBA 2Y6UA 3DO5A 3E1KA 1QRSA 1DWPA 2Q6KA 4HLUC 1HE8B 2IC5A 4UREA 4I19A 5F33A 4ADSG 2ODQA 3TMYA 4LKOA 3PQ7A 2XMCA 4GPTA 1IEWA 4FOTA 3D2BA 3TCKA 5C4IA 3HO1A 3MZ0A 4CEJA 1POWA 3BL6A 3LQRA 2P9FA 5EGNA 2DFTA 3V8RA 3OPXA 4C0JA 3KZ1E 2FMUA 2IW1A 4U63A 5JROA 4XWWA 1F4LA 1IBMB 4ENQA 4Q7EA 2PLFA 1EWTA 4Y9RA 2IHTA 2EX1A 2GILA 5D51S 1M2OA 1NP6A 3FVRA 4X41A 2XF2A 4Y67A 3VYWA 3VI3B 1ZK0A 3TNFA 1VYVA 1EP1B 1DQPA 1WTAA 2Q4EA 3WIBA 1JEQB 2ZQZA 1IN1A 3T1HB 1Z25A 4MMYB 5AOAA 4PNZA 5MFPA 2DQ4A 4ZKDA 3K2BA 5EEHA 1CEQA 4GX5A 1DBQA 2VDLB 3LBNA 3VYUB 5F2OA 1U65A 4IUDS 3GEPA 3V80A 2PUVA 2FQXA 2BMVA 1O94D 3CG0A 3JQBA 3SR3A 4DDKA 5DT9A 3QU9A 2CVOA 3B82A 1IPHA 4OJMX 1AQIA 2J41A 1PGPA 1A98A 3U17A 4OG2A 5KU1A 4BB9A 3X1MA 1E2GA 3PUKA 1XWIA 3O90A 4M0LA 4QUBA 4C4XA 3TUZC 4QIHA 1R5NA 1EUCB 1ZSVA 4J1TA 1MO3A 2NZYA 3BGOS 2ORYA 1ZA1A 1SB8A 3U40A 5CHYA 4DLXA 1UCFA 4RK6A 3AKCA 1Y1QA 2W43A 2ZIGA 3CVWA 2X2OA 4P4GA 1CZOA 1MB3A 4ZMBA 1SXJA 1J2YA 1TM4E 3MYYA 4JUAA 4C01A 2CJWB 1Z8DA 2O0LA 1UPTA 1NLUA 3H2ZA 3I42A 3JWJA 4G2NA 4ZAFA 8LDHA 4C2UA 3FKSD 4H35A 3U3DA 1RXYA 4LHSA 5IVIA 4MR7A 3VNQA 3TW8A 4CPDA 4ZQCB 4EI7A 3E9DA 1TYEB 2HPHA 1SNYA 4NAUA 5K4GA 3H7AA 4LNUB 4PGAA 1XOIA 4HAIA 4W6ZA 3S4YA 1GNSA 4DNXA 4W6QA 1QQTA 2QHXA 3CX8A 4UBNA 5JAUA 5DT2A 4P32A 4ZIRB 2B7BA 4FHGA 3NFRA 4YP9A 2Z8ZA 3WGQA 3WDMA 5FQNA 2IS6A 1UPUA 2N42A 5FTNA 1PJTA 4R9VA 2WICA 2DHQA 3GL9A 3LBAA 1N3YA 5EESA 5DGCA 3RTBA 2JBHA 2ZDQA 3HZHA 4EI9A 5K8CA 4M0PA 4R41A 2BEJA 1Z36A 1GL6A 3GRZA 1GKLA 3HG7A 3K1JA 3PJGA 4L5AA 2NVBA 3KQKA 1REQA 4CKCB 4FEAA 2J3HA 3B9QA 4AO8A 3LO5A 1B8UA 4K87A 5GONA 4I9UA 3LPAA 1D4FA 4BNMA 3OSUA 2EBFX 1K08A 3NEYA 3C16C 3CV3A 4LXGA 4KRXA 1T13A 4Y0AA 4IGIA 4ARVA 2O8BA 3WICA 2F3UA 3GRPA 3ROFA 4ARZB 4BQRA 4FWTA 5LM3A 3AF3A 2FX2A 3SLGA 3K9WA 3C6BA 1M1NA 2V7VA 4BRSA 3F6EX 2C42A 4GBMA 2CL7X 1EJ6A 3VISA 3V1LA 1OIWA 1Z0JA 3MQ4A 2C5GA 2WVHA 1ZGBA 4D3YA 1E3DA 2Y4NA 2Z95A 2P2LA 3NV7A 4KR9A 5JIBA 3UPUA 3KOMA 3CVXA 4MW7A 4IGFA 5DW3A 4RA6A 3VAYA 1Y5NA 1UADA 3JD2A 1ETUA 2DKFA 2OFOA 3B12A 4RK5A 4RK1A 1PTJA 2AYZA 2BFOA 2H1IA 2PVPA 2HSZA 2QMUA 2ZRGA 4FJ0A 3JQFC 1YQTA 2ATXA 3PCRB 3QW2A 4CCYB 3L0SA 2EBUA 4Q7LA 1QC5A 4I4LA 4NDZA 5AVQA 4Z5XA 4ZMRA 3GCZA 3VKHA 2P9ZA 3A6ZA 1XC7A 1D0SA 3I53A 4HAUA 4R2IA 1KQOA 3KE8A 2W2VA 1YVUA 3U3OA 1DQRA 1J2UA 2BJVA 4MWBA 2IUFA 1B8PA 2WILA 2DGDA 2X9NA 2LBPA 1M6NA 5DSTA 4ZA2A 5JC8A 3SHFA 1RVDA 3ZHOA 1W59A 4HLDA 2ZLBA 2OWEA 1U1GA 3Q7IA 3EBOA 3R7WB 1Z3IX 3NORA 3N6RA 4F46A 1Y6GA 5JCJA 1X19A 3ZBUA 3UWMA 2JFWA 4NF2A 1O57A 2EDCA 2GK4A 2C3PA 4MRPA 2CWDA 5DXAA 4Z51A 5A3VA 4PRLA 1MUUA 3GYBA 3KYCA 5EJGA 2AI3A 2YY5A 1QRRA 4RHTA 3L43A 5AKKA 5FJJA 3F97A 3NG1A 2EYQA 3ZV5A 4NG5A 1H9AA 2H6EA 1HZJA 1ZI6A 2IUTA 3REOA 1YB5A 4Z1MD 5YASA 1ZGCA 3NHRA 2IYEA 2VDMB 5E1OA 2GSWA 1OFGA 2L18A 4MX8A 1QYDA 3F9IA 1H0KA 2FA9A 4WLOA 2PUBA 4BLQA 1RW4A 3ORFA 2LD4A 1X0VA 3PJFA 4RM2A 4MUIA 1T2CA 3GPDG 4TUYB 1G5FA 5TGZA 1Y1PA 3QM1A 4CKYA 1U3FA 4AJ4A 2XVXA 4ZYLA 1PQPA 3DS8A 4I6GA 2HJSA 4IJMA 4R1PA 3UKOA 3QMMA 1J22A 2Q3EA 4YCBA 1NVXQ 3Q8LA 2AS0A 4QWWA 1RM5A 2WJVA 4RFVA 4B82A 4BZPA 4ZARA 1JXQA 2XMZA 2QTBA 1P0FA 1PR9A 1YHZA 3HB7A 5IKXA 1Y1LA 2J4FA 3QFHA 3RSLA 3I30X 4M8KA 2VSXA 2VPTA 1UMDA 1GCOA 1XZLA 4IMPA 4G85A 3CW8X 3SKXA 3PCTA 1U1DA 1L5HA 1P6XA 3JQ8B 3UFXA 4JX8A 4CKEA 3U44A 3WIEA 1WBJB 4BV9A 2WIGA 2XQIA 3TRJA 1T2DA 1WD5A 5L3QB 3P9IA 1NQOA 4QL3A 4QXAA 2RGNC 2QSZA 3IMKA 1QM5A 3CLRC 1FLNA 3WWOA 3PX7A 4DMFA 4YFYA 3VC2A 3PGVA 3HVRA 1V37A 5CXSA 3ZN2A 2DFDA 1EVKA 4L6CA 2O9JA 3K96A 1Y63A 4GOLD 3AU9A 1TXGA 4H4EA 4L51A 1ZN2A 1WCXA 2XW6A 3FJYA 3IUBA 2QL7A 2XDQB 1EP3B 3VPFA 2ECKA 2ZIAA 3R7SA 2AN4A 3O83A 5ALSA 3T9FA 3TQCA 2J07A 3LC7O 4CDGA 1G21A 3TSZA 2P1ZA 4EL0A 4WGGA 1VIVA 1T3HA 4J76A 2EZUA 1OD6A 1LS6A 1Z83A 2ECFA 1A4IA 2F43A 3C3JA 5D5PA 4PS0A 4TT3D 2O8FB 4QUEA 5CFPA 1NVGA 2DYKA 2P9QA 4LZNA 4OJKA 2B92A 3WWPA 4FYYA 1NRIA 4G1BA 1OXTA 2HBQA 3E82A 4M4SA 5FUBA 3WWCA 2FRXA 1PWEA 3PTLA 3T3MB 3OKPA 2JJ1A 4RPIA 4WZAB 5IJ9A 4I50B 1K6MA 2M1XA 2NO6A 2O2IA 2WF5A 3CKYA 3E9QA 3QLVC 4IRUB 5BNIA 5A5DA 3SC3A 2YOGA 4PY2A 4RIIA 4S1VA 3NMUF 1Z4KA 4YAGA 2HLDD 2IHBA 5DOZA 3WK4A 5IT5A 2BDTA 5C52B 5BYAA 4AY2A 5AK0A 2P6OA 4R1OA 5L4NA 4HRVA 2FXVA 4BQPA 3TKLA 4KGDA 1W76A 3EEIA 4FZRA 3SEQA 1KJNA 3KYDA 4OQZA 1B0PA 5LMCA 1YB1A 4UPDA 1SCJA 4ZJZA 1Q19A 3BRCA 1N6OA 2I6GA 3JR7A 2HKIA 3OCZA 3KPVA 1O08A 3TIXB 5DI9A 4ZVOA 3DHEA 2F3PA 1NNEA 2JK0A 2ZUSA 1B8OA 4BFCA 2IEBA 2F4VB 1H0HA 2O7VA 3TS1A 5SYAA 2G7MC 4Q3DA 5IC5A 2ORVA 3HRKA 3I73A 3O8OB 4X91A 5AVKA 4MARA 3SSOA 5AUNB 2ZM5A 2J5BA 5J9FA 4AYTA 1K66A 3R24A 3WADA 3MINA 3X2FA 4IXMA 2IYLD 1NN0A 1N77A 1B0UA 2FMIA 4ZK2A 5HFJA 4FWIB 1SHUX 1SQ6A 1Z6ZA 2FEPA 3HWX1 1C4XA 4GI3A 1L5YA 4OFXA 1WCIB 2YIJA 1FQWA 2XUZA 13PKA 4YR7A 2ORIA 2PMFA 4TKZA 1CD5A 2SKDA 4OMDA 4LZJA 4HWPA 1FW6A 3ANXA 3MTQA 3HEMA 5AHRA 3GLGB 1Z6YA 3BMQA 2R6DA 3AY6A 3PX2A 1OLXA 3RO7A 3VOAA 1KQGA 3FNFA 1C4WA 4J0DA 4LMPA 1B23P 4QDOA 4LJLA 3QBVA 5BOSB 4OQMA 5FIUA 4JU9A 2R87A 1DC8A 1XLTC 4MWCA 2NNLD 3FRIA 3PQFA 4G0MA 1IYZA 4X20B 5KCZA 3Q3HA 2Y9MB 4HGRA 4RTOA 1QU2A 1P5RA 3C1OA 2GK3A 5E6SA 1DZ3A 1YQWA 3CO5A 2J67A 2HBYA 5KIAA 1YACA 3ADOA 1BX3A 2H5EA 5I4KA 1RKVA 5DB4A 3BD7A 4V3BA 2HIHA 5FV7A 3LK6A 1A5TA 3EXIB 2WYOA 2ZSKA 2XVYA 4QEKA 5FLEX 1WSAA 2CVPA 2ZIVB 4X84A 3ZDYB 4RENA 3W4JA 2OM2A 3JYHA 4F4JA 4LJAA 5E7IA 5E2AA 5HZKA 4XUCA 2UXDB 1O5IA 4EUKA 1FYFA 1XFAA 3L3BA 3TW4A 3VMFA 3L77A 1GPAA 1QZ3A 4A8JC 4UASA 1KK2A 4PX5A 3NBXX 1IWPB 4YMTA 3ZXXA 1SKYB 3FZGA 5EXDA 1CS0B 5K3SA 1O2DA 2FCAA 5SYMA 3CVUA 4F38A 5F98A 2GERA 3H2GA 3NWEA 4NOKA 4Q9AA 2HT6A 3QMVA 4DXHA 4RDXA 2X19A 1I3KA 2XR1A 4LW8A 4RXMA 2IDKA 3OFSA 3K94A 4CTKA 4V02A 4AY5A 1NNI1 1V1RB 3G1WA 4ESVA 3ZE1B 2H5LA 1PYDA 4UUBA 5B4UA 3MT8A 4RDIA 4YONB 2JJQA 2XMRA 2C96A 2PLRA 3HL4A 1BU8A 3JAWA 5ALNA 5JH7F 4DLVA 1IHDA 3YASA 4KFRA 4W1PA 5I9BA 2A9KA 1AS3A 1JFFB 1IXRC 2EKQA 2XD9A 1UKYA 4MVYA 5JDCC 3CSUA 3GZNB 3HN7A 4HXEB 5CYPA 3MOGA 4ZANA 1BGWA 3T1QA 3M9XA 1AU9A 4TTTS 1D2CA 1DCFA 1S01A 3F4LA 3L1JA 3QLJA 4NFYA 4YJHB 2WKWA 1N25A 2ZJ8A 3TM5A 4TTAA 2WF8A 1FNSA 1F38A 4PIPA 2C1XA 3MPUA 3EFHA 1I8TA 4PQFA 5CNIA 4GFDA 1BEEA 3QKSB 3AONB 4XIJA 2VN8A 2YJ5A 4IDDA 4QGSA 4CQMB 1OYOA 2CE2X 4NYIR 2VQDA 1KRHA 2ISCA 1MNAA 4G23A 4UEKA 2JCVA 2DHEA 4XXHA 2A1TS 2JIPA 4CQNA 5LMZA 2EJTA 1XKQA 3I2HA 2GCOB 3VR6H 4LUCA 3P0JA 4FCCA 1VLMA 4U9HS 4H7IA 2FMHA 1BXRB 2YV5A 1I9CA 3WISA 1D6JA 2IHYA 3VNUA 2IDMA 5CG2A 3EX7C 1APBA 3CUUA 3N2GB 2DG2A 4LJ6A 4Z0TA 2QE7A 3KJHA 4ZI7A 3JQ7B 4E88A 1HT2E 2QRVB 1UXJA 2FUKA 3IELA 3SQDA 5JI2E 4FGJA 5KU7A 1OREA 4QC2A 2FZWA 3QYPA 2J0SA 1ZXBA 4HWRA 2ZIWB 5J4KA 2AKEA 1WX1A 2UZAA 3G8YA 4KKVA 3AVWA 3CX4A 4G9GA 5EP2A 5EJMA 1RAIA 4P33A 1O9HA 4C89A 4INPA 1PJLA 4ND4A 3W2FA 4TZTA 1VG0B 5A9TA 2AOXA 3GT7A 1U6JA 2DUJA 3IP9A 4IDNA 2WU8A 3QU2A 4HX9A 4ZQIA 2VP6A 1HXHA 4UBOA 4ZYUA 1M8GA 2H5IA 1NXXA 2XZPA 1EFKA 3NV9A 2PM8A 5DBOA 2JHGA 2GR9A 4ZD6A 2PSDA 3LXUX 1WMAA 1E4OA 2FSHA 1BS2A 2GO7A 1B1AA 3E05A 3IB3A 3HI4A 3NBFA 5C7YA 2C4KA 1SO8A 2GFQA 2QA5A 3HA2A 4Z9YA 4CI9A 3DBHB 4OQEA 5BN1A 3F3SA 4NZOA 1OI7A 3K0BA 2PPVA 3LUPA 1G5QA 3MJCA 2QX8A 4ZJYA 1JFLA 4MS4B 1G9XA 3HBJA 4GKVA 4Q34A 4D74A 5T4HA 5HF9A 1PS8A 1JLMA 4DAEA 2EWMA 4Y6QA 3C2QA 1KQPA 4K86A 1XJ0A 5LDGA 4CLXA 3ZX5A 1GITA 3B1XA 3ZC3A 1V1JA 1NW5A 4XM0A 2GK7A 3FSEA 4FC7A 1ZH6A 2C2KA 4GOMD 4NONA 1HTTA 2D13A 3OY7A 1CXZA 2C3MA 3PEFA 3UB3A 2RHGB 3BWVA 4D42A 1XTUA 2F1KA 3EZLA 1E1MA 1D1TA 2B69A 4EPWA 3R7BA 5B3JC 4FMDB 1K68A 2YN0A 4TOIA 4V2UA 1EFRD 2CT8A 1J20A 2G1JA 3A2KA 2NPOA 3E9CA 4MYRA 1L7NA 3QUTA 4MRNA 1KRXA 1S8AA 1OX4A 2XI4A 3SE0A 1EA7A 3CH6A 4WA8A 3WFZA 1ADCA 5C53B 1MW8X 3CLHA 3AKYA 4OA5A 2P3QA 3T1OA 5KYYB 1J6UA 3VR5H 2CXOA 2ES4A 2OO5C 4NR0A 2GKOA 5DBEX 4LOJA 3ZDAA 4F92B 4MVCA 3UC5A 4ZOCA 1CDZA 4MYSA 1TTPB 2R8ZA 1GL3A 2Y93A 4CM3A 2W8BA 4DSUA 2GXSA 1P45A 1A2QA 2D8MA 2XY4A 3UJ9A 4MDHA 3QLUA 2QZPA 4FZJA 4C0XA 3UJPA 4PPFA 3BWYA 1CC1S 3MTAA 3R41A 1PQYA 3OTWA 2FSVA 3HCEA 4UXJA 4CR8A 4F86A 4W4TA 3O9VA 3UK0A 2FR1A 5BSVA 4MGIR 1NKTA 4LYGA 4WKPA 2YHSA 4EYKA 1C3XA 1EHYA 1NOJA 2FMXA 3I3OA 3PT5A 4OXNA 1A9QA 1IEQA 3DVQX 4HDNB 2MSNA 1GPDG 4OPMA 4AJHA 2QTVA 3S5UA 2RKOA 3GH3A 4G0PA 1N2XA 1JH8A 1X7GA 2Q1YA 1RP1A 1GG9A 2QAGA 3QNMA 4EJ0A 3HBAA 5KOHB 1TC1A 4RKYA 2G0TA 5LXTB 3L7JA 4QQNA 1S2DA 2D7JA 3PLNA 4MJ7A 1OT3A 3MA0A 5I7OA 1XZJA 3PDCA 4X8OA 1P33A 3TEFA 3EPLA 2HD4A 2AFVA 1HH4A 2IYYA 3RTEA 2DT8A 2J9RA 3C3WA 1Q14A 1W6UA 1YR6A 3FPSA 1G3UA 2A9FA 5CDFA 5HE9A 4DUZB 1DT3A 4R2JA 4U6SA 3IBYA 2ERXA 1VP9A 3O6VA 4M1YA 4MAMA 4FGUA 1X86B 4K3VA 5EMNA 2JFBA 5K0EA 2BUBA 1R16A 2WSSD 4C4YA 4TLDA 3I2GA 3W90A 5ECGC 4G1CA 1Q6YA 3FLEA 3RSCA 2ZBEA 2PX8A 4BV8A 4HZUB 5JSHA 1T25A 5AICA 3LQFA 4MIKA 3UK7A 3V1TC 2R6JA 4DDMA 3TI7A 4KYUA 1TYAE 4HGQA 4RKFA 4Y2QA 1SUBA 3AILA 4A3SA 3GP5A 1UWKA 5EKUA 1ADGA 1Q44A 3TRDA 3GAZA 4JUDX 4KMMA 3HDVA 4ZOBA 2OHXA 2QJRA 4BKUA 2JJYA 1U0TA 3QMWA 1M10A 3OQJA 2DEUA 1XTKA 2HQRA 4PYOA 4H0FA 2RH8A 1ULZA 4Z3KA 2G4LA 5AHKA 5ILQA 2VF8A 3RFTA 1E3TA 2OGTA 4XX1A 3IAAA 1PG2A 1DIOB 3ME5A 1XZMA 2J09A 3TIGA 5I8WA 1K27A 1LV8A 3GFPA 1LWOA 1YUMA 5LQJA 1NPDA 2FUG6 3HV2A 1VBMA 3NU1A 2GN8A 3MCWA 4LRSB 5I9TA 2XT9A 4ZK6A 1S9DA 5CITA 1G8AA 1U31A 2O4UX 1U7HA 3U7RA 4D4JA 3EY9A 2FOLA 4D25A 1ORRA 2WNSA 3UMRA 1JFSA 4DM7A 1NUSA 3EOZA 3RJ5A 1WZCA 4IHJF 4X8MA 2XIJA 3ICCA 4F5WA 1SKAA 5BQOA 3WGIA 4P98A 5IUJC 2PO7A 4WD3A 3V9AA 1E0AA 1NY6A 2B4RO 3HB9A 1XELA 2OORA 5FUMA 3OFNA 3DMYA 4O2AF 3KQYA 4MUKA 3P9CA 4X61A 1QTNA 5HMLA 3RREA 1P9NA 1DADA 2YZMA 3DLIA 3KAJA 5E0KB 4F21A 4O3MA 3W2GA 1MIOB 5EINA 4YP6A 3E81A 1BVHA 3QK7A 1S8NA 2HK9A 4HDMA 3D3WA 4B09A 4XPIB 2HRZA 3AK4A 1NYQA 1TJNA 1L5OA 1JR4A 2J0EA 4V39A 3SK0A 2ZJFA 3O94A 4TZ6A 5LFAA 3RJZA 1L6RA 2BFFA 2VP0A 2HQBA 2BN4A 4ZVLA 1FFHA 4Q7QA 4AMYA 5JNSA 3DUFA 2NTJA 1ULTA 4PYIA 3I0ZA 4W63A 5EYPB 1DIHA 2A9PA 5ALLA 2H29A 3IIJA 3IV7A 3MTJA 2JI9A 3DKPA 3KAPA 3ETLA 3K5WA 4L8GA 2VJQA 8ADHA 2D0IA 3L41A 5LZ4A 1RJFA 4A03A 2HMUA 1K1EA 3HYLA 1X1BA 5F5NA 2PFKA 3TQIA 4FM9A 5B2FA 3AEQB 1KI4A 1XHEA 4OXQA 1ZVVA 2RK3A 2RH9B 2SBTA 4BTVA 1SQSA 3QVGA 4CM8B 1IOLA 2RGAA 4HUQA 3WHKA 3C6MA 3COPA 3VHXA 2EQAA 3DOIA 5FT9A 5DX1A 1MC8A 3C14C 1YR7A 3ZOZA 2NZWA 3RTCA 3TMKA 1I0IA 5FYQA 1JHOA 3KCQA 2ZYTX 2NZXA 4UZFA 3N6VA 1LLUA 2XB2A 5CX1A 4O4JB 2G28A 4IV5A 2A9RA 5HCIA 1RWPA 1XDUA 2XE6A 3PNBA 4FYXA 1HQYE 1JSCA 1YB6A 3O8QA 4LISA 4UVGA 2VTVA 4BRZA 4FDAA 2GHTA 1UKBA 1T2UA 2DPXA 5ALJA 1BHJA 1AUQA 5JG7A 3NASA 4OUDA 4NK5A 5ALYA 2OQIA 5H3CA 1QPBA 1H4TA 4JB3A 5HKLA 3WL7A 4BE4A 3ZLJA 1MAUA 5DGXA 2Z2ZA 3BH7A 1P2FA 4NCXA 2YJ3A 4R8RA 2QB5A 3LL7A 4FSHA 4WKBA 1ZVMA 3B78A 1KI2A 3LIPA 4O33A 4GM0A 3VC1A 1R0SA 1XXHA 3AP1A 4II7A 5HPYB 3MCTA 1D1QA 1FFSA 3HFGA 5CFMA 2WIDA 3GLVA 2BEUB 3L6EA 3OLWA 1VE7A 5EXTA 3UT5B 3VZCA 1LF5A 5F4BA 3LBIA 1B16A 2ZETA 1LKZA 2YXBA 5EG5A 4LBZA 1BH6A 4O4LA 1OAOA 3WL6A 1F2TB 1K8QA 3LQYA 4P9NA 2PUFA 4AJ9A 4PPNA 3ICOA 1YRHA 2VJKA 3TQHA 3V3KA 2NVOA 3ID6C 4IIJB 3BWBA 1ZVQA 3G02A 1S3FA 1SKQA 2EG9A 1G9SA 1U2DA 5TQVA 4MV5A 4XB6B 3SFZA 5BSGA 3I72A 2BGLA 1LFAA 3Q1KA 2ZYSA 3BCRA 3TGWA 3ZWQA 4IEEA 5JQGB 3EXEA 1B42A 2F8MA 3NTXA 1ODSA 2Y1DA 4YPFA 4ERNA 1VIYA 4MGYR 2Z08A 3E9EA 2I1VB 2GLTA 3X1WA 1DEXA 2AUMA 1MVOA 3BTSA 4MHTA 1YBHA 3P9PA 4Q4HB 1RSZA 3I09A 4RTKA 3SVZA 4XVUA 2JB9A 3LBFA 2XMSA 2XOEA 2Q45A 1PJQA 4WN3A 3PKJA 5AD1A 2A1UA 1A9ZA 1BKYA 4MCJA 1O3YA 1QHHA 4GMDA 4H60A 4N3NA 4B75A 5JSZB 2DP4E 2NO7A 1QRAA 3CCFA 4R0NA 1D8AA 1GPKA 3WO0A 3MBOA 1Z29A 3T94A 4G0WA 5BORA 5EMHA 3GFFA 2CV1A 4D8YA 5G4KA 1C8KA 2XT0A 3QWIA 2Y1OA 3TXYA 1ZIOA 3EUFA 3PDJA 4GVPA 2PL3A 2FUG1 4IJWA 4NCKA 5CT6A 2DJ5A 2Y76A 3A1TA 4FNGA 3NKFA 1NVTA 2CEKA 3OMXA 4W5HA 3B6IA 3OESA 2B1RA 3ELWA 4TQ9A 4IUYA 5DN6D 2J9XB 1H93A 4PO3X 3CZAA 3HKDA 4U8GA 1M1ZA 3SIPA 3G3EA 2ACEA 4JL8A 4F4UA 1W2WB 3OPVA 2O3SA 2QXTA 2ZBDA 3L1HA 1U8UA 4ETMA 5LZ8A 4YRKA 3P52A 2XAAA 4DLZA 5CIYA 1E1KA 3NM5A 1H65A 1AKEA 4GSKA 4NEGA 4Q3EA 3NYIA 3BB3A 1CZRA 5CFRA 1EZ1A 1ZI8A 3PDHA 4L2IA 4KQ9A 1LJLA 4H6PA 3WIOA 4F91B 4YJKA 4ZT7A 1E6KA 1XXLA 4ENVA 3UHFA 2Q1UA 2RONA 3AM3A 4K2AA 5LL6P 3HNOA 4QUGA 4XM2A 4CIVA 3VYRB 4MS3B 3W3AD 2WWWA 1I2ZA 2OZLB 4DIFA 5JO0A 4YASA 4Q3AA 1QH1A 1LLQA 4RVOA 3CIOA 3D7KA 4FFLA 5E2BA 2OBBA 2PY6A 2VFAA 5L51A 4ENSA 1T9DA 1SCUA 1Z5NA 4JEMA 3GLSA 2Q5JA 1C1XB 4FSDA 2VHWA 3MQ2A 4CMIA 4V0KA 1UJ5A 3THRA 5B64A 2XCUA 4D0LB 1XVAA 3RJTA 4M8LA 3FBTA 1DDOA 4IS2A 2EBHX 2D5BA 1DAHA 4JUBA 3LT2A 3JX9A 2GYWA 1MOZA 5LYJB 4WBNB 1YKGA 2C7PA 3PPIA 4ZV4A 5KQRA 3UATA 2H08A 4EVSA 3JXEA 4OLJA 3WLPA 2BH9A 1T0UA 1EGMB 1HMPA 2Q0QA 2GSDA 4KXFB 3RW9A 3CZQA 1A7UA 2OCGA 5COBA 2G77B 1THMA 1TF2A 3ABIA 5JFGA 3KUXA 4L4ZA 5E7MA 4C7OA 1R8YA 2CD7A 3UA4A 4MJ3A 4Q3LA 1P61B 3Q7QA 3OT5A 3J7AC 5DNYB 1L5ZA 1XTBA 3UW1A 1T34A 4EK9A 2D2EA 2ZR8A 3M6XA 5K0FA 2FX5A 4JNCA 3L0IB 2YJ6A 3T5TA 3DJYA 3S2UA 3CMCO 1RXIA 3P0EA 3D8RA 3RH0A 5G0TA 1SXIA 2VF5X 3ZCVA 4Q4LA 3OIVA 5J2TA 2XGOA 2P5YA 1PT6A 2OP0A 2ZVQX 3R5XA 3TPCA 2G63A 3PVZA 4WNIA 4COKA 4ASUA 3KKKA 1BMTA 4ENUA 2JLAA 9GPBA 5FWXB 5EHGA 3W4IA 3W78A 4DNFA 1QF6A 3IAS6 4ZVRA 4CEHB 3OEEA 4PO8A 4ITUA 1CZNA 4RDHA 2VBIA 3BMNB 3KU1A 2C88A 4FYKA 4MLCA 2QTMA 5B36A 3GN2A 4QEZA 5J23A 5DBIA 3P0HA 3FDZA 3FNHA 5LLSA 2VUUA 2NSLA 1JFRA 4IFTA 2NQ8A 3KIPA 5FCDA 2GA9A 3I05A 3O82A 4FZ3A 4BMZA 3EEOA 5HIJA 3TZHA 2PD4A 4CMJA 2WDZA 3KUUA 3FVWA 3OHPA 3OU7A 1YO6A 1TVCA 3CUSA 1LC0A 3L84A 2DXIA 1FTSA 4ZHQF 2D3WA 2A78A 3WC4A 2F4NA 2F64A 4UVHA 5GIPE 4OHVA 4TLEA 3LRXA 1NVDA 2QPTA 3HDGA 3NJ4A 3NT4A 4FK8A 2PXAA 4IINA 4F4CA 2EGUA 2NVWA 1RC8A 2CXHA 4HGZA 2IXTA 1F12A 3DDZX 2RGRA 5EJFA 1O03A 1YR8A 3VR4D 2C7OA 4XWYA 3MJDA 2Y0CA 1IPEA 3MRTA 4GT1A 4TLCA 1CQZA 5EFZA 1VSTA 2DHCA 2AMFA 5FNVF 4JUCA 1E0JA 1U4NA 3P2EA 1HFKA 1IH8A 1Y3HA 1MG5A 4GPAA 3BB1A 2ZRFA 4X1YB 4J3FA 1L1EA 1Z07A 2EJWA 2Q0SA 3OE4A 1O9BA 2FNAA 1SN7A 2QD1A 3A4NA 2BFBA 2R9VA 3QZUA 2FP3A 1KARA 1A72A 1NQUA 2AR9A 3RIMA 4F8JA 3ZKWA 1USUA 1YK1A 3AUJB 4B6SA 4EGFA 3R7DA 3MJRA 2AQ8A 5FUXA 5C7IO 1UDWA 1WKVA 5K0SA 3IBCA 1N36B 5FH9A 4DNQA 4IJVA 2O1SA 3OICA 621PA 5B58T 3HDHA 4FQ7A 1AY0A 3DL4A 3O93A 1NKVA 1FQJA 4N7BA 2G25A 3I4FA 1WP4A 4NLLA 2BDEA 5IMSA 1EJBA 4BMOB 2PCJA 1YR9A 3I8SA 5H80A 1YAJA 3FWYA 3L7YA 1TIKA 1ECBA 4EHIA 1Y6JA 4YYEA 3KFLA 2ZAGA 1YVRA 2FHSA 2PL9A 5HIIA 1C7JA 4DREA 2HREA 1SEPA 5DNUA 3OCXA 4X94A 5K3CA 2CXXA 3PNQA 2A3NA 3RVJA 1PT8A 2H1SA 2Q1XA 2JAWA 2RARA 2ZPTX 4HH0A 3KZOA 1YULA 1AZSC 5DU2A 4BPRA 4E94A 5ALDA 1Y42X 3Q9LA 2CNBA 5ALXA 1R6TA 2FW0A 4MVJA 4YC7A 1JEYB 5JEDA 4MVJE 3OQHA 5JBIA 1LWNA 2YHIA 3D4LA 2GBIA 2X9LA 1QSGA 1BTOA 4QBIA 1PDWA 1Y3CE 3HADA 4MS1A 2G5CA 2Y2UA 2A0XA 1JHZA 2NTYC 1PT7A 3IDZA 3L06A 1GARA 2CKDA 4Y6SA 1P2SA 3SS8A 4H7JA 1WL8A 2NUPA 1D4AA 2DFNA 2ILTA 1TRKA 4LMAA 3AW9A 4Q1AA 2QWXA 4QUAA 3GC6A 4RMIA 3V42A 2VT3A 2CLHB 3IOYA 3KV3O 2M6LA 5JATA 5J4VA 1UPAA 2IH4A 1K98A 1XGKA 2NSYA 3ZU5A 3T3GA 1V3QE 2LCQA 1H2XA 2R8PA 3X1DA 5CG1A 1FFEA 1LGYA 1IHYA 4C7XA 3H5RA 1GKIA 2LNDA 1ETHA 4N5DA 3R5JA 4X85A 5BRJA 3KB1A 4ZWNA 2SNIE 2W4MA 1FUUA 4HLCA 4TRMA 4Q9JA 2CZCA 1VJ5A 4P1ZA 3ROEA 1Y9ZA 2ZRCA 5A7GA 5AW5A 1WB9A 2V7QD 4B3HA 3ETJA 4NESA 4V0NA 1PFQA 4R8KA 3M2TA 5GGXA 2PTGA 3JWGA 3I83A 3NKLA 4INOA 5IM5A 1SCDA 4DRYA 5K0GA 3IQGX 3NGMA 2Q3MA 3C4JA 1GN8A 4UUQA 1STOA 3VI4B 3VHQA 2I9PA 5A4JA 3ZJ4A 3MWDB 4UM9D 2FGJA 3Q8KA 3ZVNA 2ZWVA 2P9JA 2H9YA 4YX9A 5GINE 4JI3B 4FHDA 2YWEA 1HLDA 2QVGA 3D8HA 1QCCA 1VI6A 3PHCA 5FBLB 3QELB 2DSNA 4YRLA 4HAVA 4E07A 3TG8A 3SIWA 2Q5CA 1BCRA 1MAAA 1FF9A 1MRSA 5JVDB 1R6BX 3KQMA 4RJLA 5EE1A 3CO0S 2GCGA 4CFZA 3T3HA 2XCSB 2XUOA 2Y0BA 4I5GA 5JNUA 2JIQA 1W88A 4IZIA 4JSTA 3FOZA 3ETGA 2Q5HA 3L4KA 3M81A 1LBSA 1UC9A 4HFRA 4PG5A 1N0WA 4Q02A 2GLUA 5LP1A 2R6FA 4C6RA 4BEBA 3R0JA 1EFVA 5I8ZA 2X23A 4PC7A 1Y7LA 1KPHA 4JA0A 3IAS1 4RO0A 2AA3A 4TSKA 1A95A 3LF1A 3NKVA 4R05A 5TF4A 1JKJA 2EP8A 3E22B 5CEEA 2IF2A 3G8BA 4G5FA 4LOLA 4PHCA 1N5KA 1EM6A 3LO8A 1SKMA 1XMSA 5ALOA 3SXUA 4XKJA 4HLQB 4BEVA 1YRBA 4ZVQA 4RABA 4YRIA 3CONA 1O97C 1WSWA 4XWGA 3KSDO 3WK6A 1T8SA 2B4QA 2CMGA 3DA8A 721PA 1MAWA 5DKFA 4J7XA 1P4JA 3OJCA 4OHPA 4QWMA 5BNWA 2EL9A 4P4UA 4NXMB 3ORHA 2O8EB 1FE8A 1N5IA 4H7EA 3HLYA 4G0XA 4CV1A 3GLIA 3V4ZA 3X2SA 1NMQA 1IN4A 2VVTA 3D7LA 3KB2A 1WXEA 3AF6A 3DC2A 3HXKA 2B7LA 3IVMA 5K0NA 3AJAA 1YMQA 3E3OA 4PGMA 1CP2A 2FQWA 3BC1A 4GRAA 2K6GA 3BERA 2NUTB 2E37A 4R98A 2PS1A 3QEMB 3CLVA 1L1RA 1RJ9A 3EIOA 3NDPA 5EP1A 3FI9A 4QU8A 3OT4A 5T6MA 4E11A 5U4QA 3JQAB 1XAIA 1KO5A 1PL6A 5DHQA 1BXGA 4D79A 1V6AA 4OJNA 2M9MA 4H1WA 2A14A 1U7OA 2DPMA 4L74A 5LB4A 4BQFA 5I4CA 2C8KA 1D2AA 2ODPA 1K2WA 1SCKA 3H16A 4JVOA 2R6R1 2VZ0A 3BMCB 1GKYA 4C06A 1J24A 4HKTA 3U6BA 3OPQA 4C3ZA 3VJRA 4XZ3A 4ZQGA 1SH7A 1MZPA 5DX8A 1U0NA 5GVRA 4Y2YA 5TS3A 3V7FA 3IIKA 4DFDA 1E18A 4IIDA 3GG9A 1TYCA 4QBFA 3HN6A 1U7ZA 3CW2A 3ZVRA 2HLNA 4QEDA 3HR8A 3UCFA 4ARZA 1UMCA 4JXKA 1M2KA 1RQ2A 4O63O 2BLLA 3CT6A 3B1FA 3ROGA 1T2FA 1M2NA 3F7OA 3H8WA 1GSHA 4HQ0A 5DI3A 5AM0A 3WZMA 4B3DA 5KKCA 2UUOA 4MV1A 4TV8B 3IMCA 1PEDA 1UBHS 1RR6A 3PFFA 4IFIA 1O1YA 4WXEA 3UXEA 1KY3A 4CCWA 4CKBB 4DVJA 3N2EA 4ARBA 5KVSA 1KAOA 3FYTA 4WKOA 3OJWA 5K4HA 1PO7A 1N7JA 3FUUA 4GO1A 2FZVA 1SU8A 3IALA 1DC4A 1U1CA 3GNQA 3LUAA 2QX7A 4DT1B 4NU6A 3R09A 1MX9A 3MSXA 2ZJ7A 3GQBB 1JYFA 3Q5EA 1P7CA 4KPFC 4NCBA 4C43A 4MQFB 4M9RA 4R2LA 2V58A 4IDOA 5T5QA 3SY8A 3GWGA 3U3JA 5J1TB 2JCXA 1ENOA 2J7PA 3N7AA 1YT5A 2B8NA 1ZD3A 2OCLA 2QNBA 4RADA 1KDYA 3RUEA 5I3ZA 2QN9A 5KYWA 4BLTA 4GBED 4EO4A 3VVCA 2BVNA 1EH5A 2XGSA 1MQ8B 3FPEA 5AVJA 3Q85A 1H2AS 4RD0A 1YKFA 1Z7BA 2JD2A 2P41A 3STXA 1DZIA 1G64A 2NIPA 4EGSA 5CBKA 4YPOA 2P7IA 4D5EA 2HMAA 3NBZC 1FS4A 4UJ5A 3WG9A 4PNEA 4RX1A 1RZRD 3UOWA 2PEYA 1A8SA 2I3BA 3SBEA 1JJ7A 3RFXA 4IDGA 4OLHA 3INTA 3EQZA 1JB9A 1I1OA 1PLKA 2ZR7A 3MMPA 2AF3C 4DA6A 3B8EA 2C8JA 1SCNE 4G4SO 4R0VA 4BNDA 1L8OA 4QVKA 2F1JA 3PR3A 2WTEA 1K8ZB 3B2EA 1U9ZA 5F7OA 3JARA 3IT2A 3TF5A 3M4JA 1H6AA 5C0OE 1ZSNA 4V0RA 2QJTA 1SQ5A 1CUBA 3ZV6A 1NONA 2BM9A 3KE9A 5CJPA 3RFVA 4RYDA 2ZJ0A 3TO5A 3JQEA 4JBYA 3R74A 2FR8C 1C30B 1K75A 4Y6RA 3DDWA 4FEYA 4CNQA 1TJ3A 4TUYF 2V9PA 3WV4A 3D0KA 1ZAYA 4AU1A 4X00A 3ZD7A 4MYCA 5BR7A 5KVQA 3L92A 4DR1B 1I3OA 4CUKA 1TCBA 1M66A 3FE2A 3QXXA 4MYUA 1OH6A 2G9RA 4M53A 3I0MA 4JC5A 4O4IA 3ZVKA 4W1SA 3TZLA 4JLJA 4FWBA 2Q7OE 4ALMA 1L4KA 4CCSA 3TDNA 1P1FA 3DZDA 4N01A 4BVFA 1A8UA 3T0GA 2CCJA 3DJFA 4D6YA 2RH4A 2OBYA 3WZ2A 5LZ2A 1X3LA 2K2WA 1X42A 4TTQA 2AC2A 3IGFA 1FRFS 5FA5A 4D44A 3OQ1A 1CUYA 2W11A 1WJGA 5KX5A 1GLVA 2I4TA 4D98A 3T1YB 4Z2AA 2GWRA 3H6KA 3TZKA 2O2CA 2TRSB 4AJKA 3WWZA 1T1EA 1PV1A 4Q1DA 3K6JA 5SZKB 5CVVA 2J8ZA 3I5AA 5BVHA 1E89A 1EE1A 1T4GA 2H07A 3DEYX 4YA6A 2CFTA 5HUJA 2W2NA 3K8QA 2C0CA 4IYJA 3VSEA 2F48A 3ZHQA 4RGBA 4RVUA 5HJ7A 5ITZA 2H5JA 1RRMA 5CNKA 1LBTA 4L0CA 5BWMA 1L3BA 4DMGA 4YRRA 2ZYWX 1D4ZA 1DIGA 2QRUA 1YWGO 1K97A 1WF6A 2DUUA 3GI1A 3I9LA 3KR9A 3QNUA 4KPUA 3BBPA 4KNVA 3DC7A 3KQTA 1QYIA 3TZCA 1GP2A 3EVCA 3GVHA 3BDIA 3QIVA 1ORHA 3GVPA 2G1PA 1IJFA 2FOXA 1P5ZB 3GN1A 4BL5A 2NUAA 3AEKB 1XDBA 4WCVA 5BV0A 2QR3A 4K6MA 4MLZA 1QTRA 4HFNA 2R00A 4QREA 4O8ZA 1Q0LA 2QX6A 3DL7A 1Z4QA 1XCMA 5AK4A 4NYJQ 5DHRA 4ZQHA 3LCVB 1C9JA 1L7QA 3UUFA 3BT7A 1KEPA 1RYZA 1UZUA 3A28A 3WMRA 4E09A 4WEOA 4MK4A 3RYFA 3SZGA 1CRLA 3FFXA 4LHYA 4ZAGA 4ZTBA 4F2DA 4OV6B 2J0QA 2HU7A 4M1SA 2RJNA 1DWQA 5EWLB 3U4GA 4FU0A 4R8MA 2E5LB 5JPCA 1VRVA 4O08A 3E5HA 2C54A 3L05A 1C2YA 5AWFC 1T3GA 4WY8A 5DK6A 4AROA 3ICEA 3JZFA 2PZBA 1RMYA 4QTXA 1UL1X 4RELA 5H81A 3SC4A 3AY0A 4AZWA 4CMCA 2M2IA 4BZQA 2XLCA 2XPCA 4LRQA 4YALA 2I6FA 3RANA 3NTRA 3P5SA 1JN0A 3TSCA 4ENPA 4UU7A 2YVAA 1C3EA 4NCNA 4U2BA 3DO8A 3CN7A 1M54A 1EBUA 4M1QA 3KTDA 3SZLA 4KP7A 5HJ2A 4R3NA 5B7QA 1SXQA 3CKLA 1EDOA 3KPJA 3PDIA 3HDTA 5DYIA 4EATA 2HV8A 2Q49A 4GI2A 2FSUA 4RY9A 4CCAA 3HSKA 3G2NA 5EE5B 4DBLE 4V24A 2CB0A 4MHOA 5EJAA 3S55A 1SB9A 2JFPA 3DBRB 3NPMA 1RYNA 4KK3A 1FP6A 2FJUA 4ID3A 2I78A 4LE1A 3HHEA 2GVDC 1WHSA 3RAPR 5LUAA 1WBDA 2IXBA 2K87A 3IOEA 1EVIA 3GJSA 3PKIA 4RPCA 4XOUA 4BKMA 5H4GA 4X65B 4H2DA 1AKQA 1R8XA 1NVVQ 4M83A 4XGKA 5BWBA 3EMBA 4KK4A 4IF6A 1AK2A 5EXSA 2ZRMA 2GD0A 2V1UA 5A03A 4IEIA 4EUHA 1G3RA 2ZXFA 3BFPA 4PGGA 1MA0A 2GFHA 3G2LA 5BV7A 3H11A 2DQZA 1P9LA 1UBTS 2FFAA 3ENNA 3HB5X 3S44A 1DJMA 4MKGA 3VJKA 2WU4A 1ODCA 1Q95A 3WTCA 4H0NA 3VOBA 1T0JB 1LSJA 3HFSA 1KKLA 3PVSA 5IDYA 4X45A 3PDWA 4KXUA 2WT9A 3FR7A 1J8FA 2YZ7A 5DTJA 3UJ3X 3ZXIA 1B8NA 5DOVA 3H5VA 2R6GA 2UDPA 1MO5A 4QU5A 3K4QA 1KSHA 4Y2SA 1AX9A 4B48A 2CJPA 3RQIA 1MCZA 3K6KA 4NICA 1N3LA 3AFIA 5L4LA 3EUAA 4H7KA 4XVRA 1J33A 3E7PA 3O73A 5FL3A 4A73A 3MIIA 4UE2A 4B2PA 1RKQA 1E9BA 1TFRA 2VPZA 1QQ5A 1SFRA 2R5WA 1NPYA 3EFOA 4GGOA 1EYZA 1X8XA 1KEEA 5A71A 4CEJB 3D02A 3SQWA 1OOEA 1QDUA 5G40A 2WNIA 2ZYAA 2AJLI 4JP8A 3DF7A 4TS1A 3NM6B 4WL0A 3JVUA 1FK8A 3A9WA 1SUFA 4PWYA 2J3LA 2AFIA 4LV5B 5ER6A 3TZBA 5C8DA 1F0YA 2AFIE 1V3UA 3ELDA 2L42A 4BUJA 3DFKA 3GRVA 4YJ3F 1M2OB 1V16A 4UBKA 4UE3S 1V9LA 3I9V6 1Q21A 4YP5A 4GG1A 5CLLA 3WO1A 4L8FA 4LC0A 3ZWNA 3N28A 1P60A 2GHRA 3OLZA 4CQJA 2GAFA 2WWYA 2PCLA 3IP1A 2HO5A 5H70A 1QGDA 3SI7A 1T2VA 1ZIDA 4H0CA 1S89A 3W6PA 4M55A 4AKSA 3UIEA 4CM6A 1J8VA 4J9VA 2SCUB 4UFPA 4Q4CA 5HKKA 1XD9A 1Z2DA 3JV7A 4ZQBA 5JZ9A 4EBBA 5KC9A 3UK6A 2WJ3A 1IHXA 4HCJA 4N9QA 2ZM6B 3Q3VA 4G97A 5GQSA 2ZSUA 3ROTA 1QO9A 1G98A 2CL6X 3TGPA 1EQAA 1CEEA 2MMCA 3C3MA 3IE0A 1F1BA 3FHCB 1R27A 3TR0A 4ZVMA 3Q9NA 1F7UA 5HE8A 5U9CA 5I7RA 1RRFA 4EJMA 1AS2A 1QH9A 3JQFA 4YXWD 1HETA 1PFUA 3I04M 5AW8A 5A62A 3EW9A 2ONJA 1P74A 1X1AA 3RB8A 5B7GA 4O2RA 4PFSA 3QPDA 5C31A 2JI6A 1FNNA 4FNAA 3F5SA 4Q66C 4GE3A 3WIUA 3ESZA 3QVWA 3Q41A 1SXJB 4YDQA 2XH8A 4MWGA 1DKMA 2PUGA 1O8BA 4IS3A 3D7MA 3E6AA 4KIWA 4NS1A 5AK6A 4U5XA 3S1AA 1XRSB 3R8FA 3FGNA 1WKCA 1X14A 2YHAA 3WLHA 3U19A 1AM4D 1IY1A 2QW1A 3O8LA 4MR7B 3TW8B 4XUGB 4IVPA 2C95A 3NX4A 1FDUA 4YHBA 3ZE2B 2VQFB 4NV3A 3UMYA 2CYAA 4HL6A 4QD3A 1UEIA 1JU9A 2Y66A 3ACDA 4X6XA 4F3NA 2DR3A 2VPXA 4BBAA 2QUAA 1IRIA 1YONA 2AMLA 4JI4B 2JFGA 4PG6A 2W6IA 1JW9B 1IBSA 2P77A 2UYYA 5I5EA 2FSIA 2ALJA 3SYTA 5E7JA 2D1SA 3IEVA 1P75A 4JIMA 1RVV1 4F6RA 2X13A 3T3PB 1GZ3A 3T1NA 3TFQA 3ZHCA 4UM7A 4XB2A 5GMOA 1TOAA 3N0RA 2YBEA 4OFWA 1DEKA 2DBRA 3CR8A 3EVDA 5CA1F 4NENA 5A4FS 4MA5A 4BU0A 4E08A 4AP6A 5HJEA 2VBFA 4GWLA 1HA3A 2QW8A 3DEFA 4U0JA 4ND1A 1FUIA 1U7WA 1MEEA 4D8TA 4D8WA 2IA5A 3DWEX 3ZCRA 5HWSA 1REQB 5F64A 4C0AC 5LJIA 2A58A 3VYSB 1MV5A 4XH9B 5GONB 5IXYA 1KIFA 4MV0A 3G9UA 3BGDA 1AGYA 2HDOA 2PZKA 4A2WA 2O8BB 1ADJA 1R3UA 7ABPA 3TTVA 2BR5A 2EAUA 4EQZA 1QTQA 3KZCA 5SY4A 5LU8A 5H0IA 2J9YB 1XFDA 3I6YA 3UKDA 1FX0A 2H59A 4LHVA 1W34A 1M1NB 4GMXA 2ZE8A 1Y4UA 3DE2X 2J59A 4M49A 3P4UA 4LJKA 1Z75A 1J23A 3SKVA 3N53A 3MJEA 2XMPA 2PV7A 5THKA 1WZNA 1NLMA 2HF7A 3FAKA 5BN4A 1KPGA 1QO0D 4RA6B 4U2KA 3D4BA 2ZYHA 3JVVA 3IHTA 1XG5A 2CLCX 1PFYA 3LLVA 3TGLA 3EEYA 4LF6B 1GTMA 1UBJS 1YSCA 4B6RA 1NTOA 2F3QA 4KO4S 3RYHA 4ZZIA 1KI1A 1E1RA 2PSFA 4RF2A 4AYXA 1RHRA 3RC3A 2AWOA 1QC5B 3GNSA 1JJBA 4ENTA 3FPGA 1WB4A 3MD9A 5HDQA 4ALNA 2BGGA 1J0DA 3DWFA 4KVZA 4B7ZA 1XYVA 1N8SA 1XCJA 3I1YA 4AJEA 3AVYA 1YS1X 2IIVA 2L0XA 4BLPA 4TS4A 1L4LA 2ISSD 4W9NA 1K7CA 2FFHA 4UZEA 2YBDA 4D96A 1KKMA 4I2NA 1NMXA 5E8RA 1BXZA 1PN3A 1ZYUA 5EY5B 1UJ6A 2HU8A 5IASA 3KKQA 4L9SA 4KVFA 4TSRA 3SJ7A 4TL9A 3BCHA 3S8MA 3I5UA 4FYIA 4M37A 4WOJA 3G9ZA 3T12A 3ZUGA 4YXFA 4LOHA 4WAUA 2Z83A 4MQLA 2H2HA 3WE7A 4PZZA 4BB5A 3KYCB 3QLVA 1F9AA 2L2QA 4RGQA 2CMHA 1DKOA 2FDRA 3W3AH 3RIYA 1WO8A 3GZTB 2GZRA 3ND9A 3PUXA 4RNCA 1LBEA 2I6UA 5I7FA 1U0LA 3BIOA 2F1RA 1KOJA 2HCTA 2JAHA 4KWTA 3RF7A 1PWHA 3M4NA 2YVQA 2E85A 4XGNA 2R8BA 1PNVA 2EGGA 2TMGA 2YYYA 2HA4A 2IOFK 3HP1A 3IR7A 5AVUA 3BK2A 2HMWA 4HXGA 1KF0A 2GAAA 3M4ZA 3UGTA 2B1QA 3QX7A 4QYSA 3LNCA 3PTAA 2Y3IA 3HTXA 1OI3A 1NT4A 1RI2A 1SM4A 3HKEA 4N6NA 4POAA 5AM1A 5C5EA 2PH3A 3GR6A 2XMGA 3LX6A 3OMLA 4HF7A 4NV0A 4QJBA 1IWBB 1YRQA 5ITSA 3RR2A 4JB2A 4ZPJA 4ZZ2A 4NU0A 1S3IA 4BE7B 4TLAA 5T67A 2ZJ5A 4L57A 2YNMD 3RG2A 1J42A 3I8OA 5JYCA 1UZMA 3LCMA 3NC4A 1NF9A 4C7BA 1PX0A 2ZUBA 4UNNA 1UMDB 2A5FA 2IITA 4Z6KA 1DLJA 3DD5A 1RYFA 4F8YA 1NBEA 1L5HB 1VKHA 3AI3A 3UFXB 4CKEB 2REXB 3U44B 4IHJA 2MSKA 3QJYA 4L5CA 3X0DA 4AJLA 4L1KA 4MVXA 2XIQA 2ZKLA 2YS7A 4QKQA 4R2HA 3CKKA 1DO0A 1Z2EA 1Z38A 4B40A 3VNSA 2IWRA 5AO9A 4D3FA 5KVCA 3W34A 5K2OA 3PE3A 1NVKA 1KI7A 3RC2A 3ANSA 2VUTA 2YHBA 3OWXA 2WHEA 4LWOA 5A1TA 4FCTA 1XLTA 3BXGA 1C1DA 2ZSIA 1BFDA 3EMVA 4M1MA 4ILEA 3IO3A 1T1IA 2GEJA 1TAGA 4M36A 4OY3A 3AXSA 3C98A 3HL0A 1J21A 2JIMA 3GDFA 1K0FA 1T5BA 4F11A 4KX5A 3AF2A 2RHLA 2PA0A 2VP5A 5CDUA 4WVFA 1G21B 2JNWA 4P84A 4KU4A 2LIPA 3EZ6A 1KMNA 2F43B 4QYIA 3B3JA 3KWJA 1AUVA 2GEUA 2ID9A 2ZSAA 4FS8A 4H59A 4D9GA 5A4KA 1MP0A 3C5VA 5D85A 4JL5A 2XA1A 2VAXA 3RRNA 2RBEA 1UBMS 3FVVA 2B4YA 2IQIA 1FVOA 3HYNA 3O74A 4A27A 1MX1A 4DPKA 1UDXA 5IJ9B 1GTVA 3EARA 3N5CA 2ZRLA 2FN9A 4MLPA 5EAIA 3RVDA 3UFBA 1IN8A 1M1YA 1G20E 4FXOA 3UEOA 3IAXA 2EEZA 5BUCA 1JYSA 1ZAKA 2J3QA 4MKXA 2AOTA 5BYBA 3FUWA 2BHLA 1J2JA 1Z5ZA 1P3JA 4FFVA 4PX2A 4AB1A 4E5DA 4MUFA 5HOEA 3KYDB 1TUEA 4DRXA 3UAYA 1GTG1 3V4SA 4FHCA 1NXOA 2BI4A 3FUTA 4OGWA 3RSOA 4KL8S 1WTCA 1FFGA 4JODA 1TA4A 1XL0A 1GA1A 3N8IA 1F6BA 4P82A 3MMZA 2CMKA 3LVFO 5EMMA 3WSVA 4U7PB 4ME6A 2QR5A 2Y92A 1PR2A 1RE0A 3GMTA 4K9DA 3LHFA 4RZIA 3E5RA 4E2XA 5BURA 1Y5LA 2FPGA 3K5PA 1TKAA 1X87A 3QVVA 4MYTA 4E4RA 5CDHA 1JG2A 1G19A 4FINA 3L01A 4B47A 3KD3A 1ZMTA 4F7WA 4TL8A 3WGNA 5ADUS 3MINB 2B83A 1NQ5A 1RAFA 1XEWY 2H7CA 4E5PA 1VPVA 4KXNA 1Z37A 3B6ZA 3NOVA 1ZK2A 3GDHA 3H7IA 4O4JF 3HUUA 4R68A 3IRUA 5F5LA 1T3SA 2QYHA 1T9ZA 2Z98A 1EZZA 4IDBA 4XGIA 2VEDA 3G9TA 4KXLA 2GBFA 4XWOA 4XYGA 3I1JA 5G0WA 1QLWA 1NGSA 4IGKA 3VUFA 4Q0MA 1NDQA 2HHJA 5B57C 3QX8A 2RC6A 5IP5A 2OCKA 4QHYA 1S4MA 4I5EA 2GF2A 5FOWA 1A4XA 4KYVA 2O52A 1OLXB 1PJ2A 5CJ2A 1RI1A 2H51A 1CUGA 2YIVX 3H8VA 4FPXA 4MMZB 2D4HA 3FI0A 4RLSA 2QGFA 3DMPA 4EI2A 4ZAVA 3RYTC 1MQAA 5K8VA 3BREA 3GK3A 3IERA 3OF3A 1G5PA 3EZ9A 2JFQA 1I6LA 1UJ4A 1N5DA 5E6SB 4U2EA 3KLOA 1IM8A 3R2JA 2PL5A 2D1FA 4WQMA 2CC2A 1CNEA 1OJ7A 2W2OA 5ALEA 2I4MA 2V3CC 3M82A 2JGRA 2OLKA 4G1VA 4MGEA 5E3JA 4EY7A 2AG8A 4L75A 3G0CA 5IEBA 3CXRA 3KTOA 2CDCA 4QATA 5JQGF 1NW4A 4GPZA 1ZQ1A 1HEYA 2TYSB 3AFHA 4OSEA 3U0VA 5IPFA 4PPQA 2HR1A 2FW9A 3O3OB 4RDCA 5SV2A 4JXXA 1HZZA 1KH3A 1AF4A 2C3YA 2MOKA 4QGHA 5D1NA 2RHWA 2PNFA 4FEGA 3VAZA 1J9GA 4U7DA 2G5GX 4WXHA 2VPQA 5I4BA 3I61A 1HE4A 4HQKA 1NYLA 2VEOA 1E1CA 5NULA 6GPBA 3KQSA 3THXA 5C1PA 2FWAA 1BKSB 1HSZA 2B6HA 3KQWA 3UOAB 2J08A 3DHYA 3OU6A 4QOSA 5AESA 5AQEA 1JJFA 4FI3C 4HPXB 3P2OA 4P7FA 2HHCA 4AO6A 2H2WA 3E70C 4EFDA 5HXAA 4YGYA 3GFRA 4MUBA 1T2NA 2WY2D 1XA0A 4DR3B 1E6UA 1C7RA 1U3DA 2X0JA 5IT0A 2ASEA 4Q9DA 4EKYA 3ENKA 3LWZA 3SSNA 4O02B 1WXGA 3PL1A 1Y9EA 5C1OA 3JAWB 1XROA 1T1SA 2ZAYA 1CJVC 3DCNA 3ED5A 5KJ6A 2NT4A 4PE5B 2QY9A 1KZ4A 3PWSA 5B3JA 4XRGA 2EWVA 4YAWA 1LC3A 3B1JA 4EMBA 5BYJA 5BSUA 3RS4A 4V0ME 4F2GA 1I0ZA 2BYTA 4IIHA 1N7GA 3BGSA 3HV0A 1Z6AA 4JEUA 4OBXA 4NP6A 1DBSA 4BGIA 5A7HA 3ZBPA 1YA6A 3KUCA 4NE9A 2YOFA 2ZYGA 1L9KA 1E0KA 3C8MA 3UT6A 2DY1A 4CV2A 4NBNA 1EA5A 1ZJYA 1KMCA 2C7BA 2O3RA 2ZU6A 3GOHA 4H31A 1CUFA 4NH0A 1VE6A 1VL2A 1FDOA 3BCUA 1OB2A 2FP4B 3QXCA 4JP2A 1QBKC 4CQMD 1XN4A 1VL6A 2B2NA 5CNJA 3Q72A 1Q0HA 1GV1A 2PKEA 4WJKB 1FSZA 1Y8AA 2X0KA 4Q01A 5B1HA 3NDJA 4L02A 3VH3A 2XVMA 5HMMA 3WGKA 4YS6A 4B44A 4Z7QB 4F6LA 1WMBA 5JZVA 3ND5A 3SYLA 1XA3A 1MV8A 1OAAA 4ZI7B 2ZAOA 4AZ0A 4XR4A 1MFPA 1CU1A 2O48X 1P19A 3ZDZB 4E2YA 2O05A 1JWBB 1N4AA 1L2TA 2VWQA 4QYTA 3STHA 3OUZA 4YP1A 1GUAA 2GA8A 5DNAA 2O5EA 4LWPA 2FKNA 2WM9B 4JN6B 4JSYA 2AQIA 1SOWA 2E4AA 2WHYA 2R2AA 4I46A 3QUSA 4BDSA 5LIPA 4R6XA 3KRTA 3IP5A 2VZLA 4O8CA 4BO5A 2VPIA 1U3WA 4FYHA 3HRIA 5JWHA 3COSA 3MILA 1ITZA 3FNRA 1AS0A 1G2PA 3C15C 4TKLA 4WECA 1P8JA 2B94A 1G3IA 5FYDA 2YWJA 1JH9A 2FN8A 4V0LA 3HJRA 4D4IA 4WBNF 5LYJF 1NVWQ 1FBTA 2JLSA 2PFGA 3GX1A 1Z06A 4JSRA 1OI4A 3QF7A 4UTXA 3U9SA 4B4VA 5KDDA 3AOGA 3E5NA 2PMKA 2O8CA 3VU1A 5ECYA 3RABA 5JS2A 3EVFA 2H11A 4Q3BA 1MEOA 3AKEA 5EIBC 5K6AC 3PHJA 1CBUA 4PFKA 5EUMA 4PZDA 2H85A 5JC1A 4D56A 1AD2A 4EG0A 5ICSA 3AOEA 5LQMA 5FFNA 1QCYA 4MRMA 3OAAA 4GRDA 3CKMA 3KC2A 3CZRA 3LY9A 3OZGA 3KSMA 3OZCA 5CLGA 1CDEA 5K0TA 2V6MA 2LKDA 1OFTA 1NMZA 3L6BA 3BJIC 4NATA 3NBQA 5SY6A 3WTBA 4FDLA 1GADO 4RV9A 2QP3A 1DEHA 1TIBA 2W93A 4PCLA 5BV2P 1IULA 4YP0A 5KTKA 5EHNA 1WPXA 1M2FA 2D06A 2NLOA 5KOJA 3W1WA 2WB2A 3LWNA 1QQBA 1XQ9A 1XRNA 1OX4B 3CLKA 3FKQA 5ARDA 1PKXA 3EAQA 2DY0A 2V9ZA 2V7XA 3QLTA 4CTNA 1TMGE 1LVUA 2VYCA 1ZESA 2ZAIA 3PFIA 5CM9C 5JPIA 1CG6A 1KMIY 2WKQA 1OYVA 5DLEA 3U7FB 2OV3A 4AZVA 1CULC 2QMZA 4YWHA 2I9KA 1LSUA 2B61A 3VO9A 4U5QA 2W8BB 2YOHA 3B85A 4PIVA 4J3JA 5FNVA 4DDVA 4PR3A 3ZWVA 1PZFA 3WLAA 4O0LA 1G2QA 1Q84A 4NZNA 4CKWA 1BIFA 2QENA 4G86A 5KCMA 1VECA 3IUQA 4KMRA 5LWQA 4NSNA 5J5CA 2BHRA 2P75A 2DFVA 4D7AA 4ZCSA 4G0UA 5AIBA 3I9KA 2GJ9A 2ATEA 2QTVB 2JCGA 4EPVA 2CW5A 2GLXA 3EDCA 1II0A 2QAGB 4EX6A 4YCAA 5K1ZA 2VDNB 2FF7A 2PZJA 3MRXA 2QTNA 4AUEA 1BVUA 1D5WA 3OJLA 1L4BA 4TZKA 1Y4SA 4FE7A 2JHAA 4LRWA 2MSCB 3WKAA 2OAEA 4LF9B 3G2QA 4EW6A 5IX8A 1JWLA 2AG1A 4NBUA 4F1JA 3GFQA 5C1DA 3IP3A 4QOHA 3IV6A 4Y2RA 1G5IA 2IGTA 1KVRA 4EG5A 3PYMA 2IWHA 1IIBA 3KOUA 4RD6A 1A7JA 4AICA 2JH3A 2CNLA 1MMFB 2B8JA 2BISA 3W7BA 2DFKB 4BO9A 1GPBA 1WZEA 4A6DA 3BL8A 3M33A 4I1OA 1ZC4A 5IDVA