3NBNB

Crystal structure of a dimer of notch transcription complex trimers on hes1 dna
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
196
structure length
196
Chain Sequence
QTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNNVDAAVVLLKNGANKDMQNNREETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Recombining binding protein suppressor of hairless
publication title Structural and mechanistic insights into cooperative assembly of dimeric Notch transcription complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 56
structure length 196
sequence length 196
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00023 Ank Ankyrin repeat
B PF12796 Ank_2 Ankyrin repeats (3 copies)
B PF13637 Ank_4 Ankyrin repeats (many copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3nbnB00
1SVXA 2DZOA 3EHQA 4NIKA 2XZTG 4HBDA 1TR4A 3NOCD 4LNUD 2NYJA 3V30A 1MYOA 3W9GA 5CBNA 5BXUA 3NBNB 3UXGA 4U8YD 4HI8A 5CBOA 2AJAA 5ITZF 1BD8A 3AJIA 2F37A 4J8YA 4DX1A 5AQAA 2ZGGA 1MJ0A 3J5QB 1MX2A 4CZ2D 5CECB 3F6QA 3LJNA 1DC2A 3KEAA 4HQDA 5HS0A 3V2XA 1IXVA 2RFAA 2PNNA 2L6BA 1MX4A 2BKKB 1SW6A 4HRLA 1D9SA 1N11A 4G8LA 1BI8B 5ENPD 2J8SD 2BKGA 2XZDG 4TUMA 5ENTD 4HB5A 3DEPA 2KXPC 3C5RA 3EHRA 3J5PA 5EYPF 3TWXA 2V5QC 2ZGDA 2VGEA 4C48B 4DX5D 5ENSD 3AAAC 3V2OA 5EILA 5JMND 4K5AB 5AQ9A 4HI9A 4JB8P 4LG6A 4YDWA 3V79K 1MX6A 2V4HC 5KNGA 2XEEA 4K5CA 5AQ7A 4HLLA 4HRMB 4A63B 2F8XK 1YMPA 1G3NB 3Q9UC 5KWDA 1IKND 5ENQD 1IHBA 4GPMA 4BSZB 1AWCB 3D9HA 2Y0BG 4U8VD 4HRNA 4G8KA 4RLYA 5AARA 3ZKJA 3JXIA 4DX2A 4LSZE 3T8KA 1N0QA 1NFIE 5EIDA 4F6RD 4U96D 5AN8A 4QQIA 3EU9A 4YDYA 2ETCA 2DVWA 4ZFHA 3ZU7B 3ZNGA 2MYOA 2A5EA 3T9KA 1OT8A 1WG0A 1K1BA 2F8YA 1UOHA 5AAOA 3NOGD 5AQBA 4UUCA 2RFMA 3TWSA 4O60A 3HG0D 5EN5D 4K5BA 2QC9A 1DCQA 1S70B 1YYHA 2DZNA 3DEOA 4O1PA 3TWWA 3B7BA 5HRYA 4DUIA 5EIBE 2KBXA 3Q9NC 1OY3D 5BXOA 2FO1E 4OAUC 2QYJA 5ENRD 3W9FA 5D66A 4O1OA 4F1PA 5HKPA 3UI2A 4CYMD 5CEAA 4ATZD 5KBAA 3TWVA 1YCSB 3TWTA 4OAVB 1N0RA 4BERA 4DRXE 3ZUVB 3UTMA 1WDYA 3B95A 1QYMA 5KNHD 3V31A 4J7WA 2JABA 5FIOA 5JA4D 4HNAD 3SO8A 4DX7D 4B93B 4BETA 5ENOD 2ETBA 2DWZA 5CEDB 3IXEA 4Z68A 3JXJA 1K3ZD 4GMRA 2Y1LE 2B0OE 3HRAA 4ZHBA 4N5QA 1A5EA 5CERB 2XEHA 2ETAA 4QFVA 4DX6D 3TWUA 1BLXB 3TWQA 1AP7A 4BEPA 2HE0A 3JUEA 2XENA 4BESA 5EYLA 4U95D 5FINA 1BI7B 3TWRA 1K1AA 2P2CP 1BU9A
chains in the Genus database with same CATH superfamily
3Q5MA 3SZ7A 3EHQA 2KM4A 1IQRA 4F53A 3ASNE 4I17A 4YDOA 2DYSE 4APFA 3SQVA 2VGYA 1A17A 3TJPA 3HDXA 1ELRA 2BKKB 4PS8A 5FQ6A 3DWLG 4LEUA 4FLBA 1RW2A 3PE4A 4O6FA 3APCA 3X2QE 1Q2ZA 4EZLA 2C2LA 4CDMA 4TXRA 5KJMA 2H6IA 3ABKE 4GTTA 4U8VD 3ASHA 4RLYA 4DX2A 4I9EA 3JCKC 3ASFA 1NFIE 4KVMA 4N5CA 1LF8A 1U3DA 2WXNA 3EIJA 1UOHA 3DPDA 3HXDA 2EIME 2LSUA 1E7VA 5EN5D 3CV0A 2QC9A 1YYHA 4J8FA 5HRYA 5AIJA 2CG2A 4XZ4A 3W9FA 1TNZA 2AVPA 2H6GA 4JL0A 3CVUA 2WPVA 4HOSA 4L7TA 2BEDA 2PL2A 3ASDA 4FADA 4GA1A 2JLBA 5FIOA 1N4RA 1TNOA 3EHMA 4EBAA 4B93B 3P2BA 4BETA 3U9WA 2VQ2A 3ZYLA 3G2SA 3TWQA 1N95A 5FINA 4LUNU 1BI7B 3K9IA 5G2NA 4J8SA 4GZDA 4RSYA 1SVXA 2XZTG 3Q47B 4GCNA 3V30A 2XGOA 1OWLA 1TJCA 4AVXA 3MKQB 5AQAA 4GTMA 3Q73A 4HS2A 3ASOE 2L6BA 2L6JA 1D9SA 4LNBA 4P29A 5ENTD 2IOLA 4FHJA 1OWPA 3GW4A 4GU5A 4DJAA 1DCEA 3PZDA 4YDWA 2F8XK 2RD0A 1YMPA 3UMVA 2OV8A 3D9PA 3PUKA 1E8ZA 2Y0BG 1QNFA 4UWGA 3G2WA 3CQCB 3B7SA 4ME2A 2R5SA 5LCWJ 5AN8A 2VJ8A 3CHPA 5AAOA 3LY9A 1P5QA 4UUCA 5AENA 3PZ3A 3BG0B 2UWJG 2XRYA 3Q9NC 2EINE 2AWIA 4KXKB 3L22A 3SFYA 3MA5A 4EBAG 3MGBA 3OXFA 2DWZA 4FU3A 2PZIA 2H6FA 1AP7A 1ELWA 3G2TA 1K1AA 1BU9A 4N39A 5LOZA 1V55E 2AJAA 4DX1A 5CHEE 4I2WA 2V8SE 1X81A 3KEAA 5HS0A 2GRQB 2WXIA 2XGMA 3D9MA 4BWRA 2XZDG 3QWVA 3G2UA 5CRVA 3C5RA 3TWXA 1QBQA 4WWOA 4A3VA 1DVPA 3V2OA 3I4GA 3ZYMA 5EILA 5JMND 4DI3A 3SI5A 2MOWA 1MX6A 3JQ1A 1KZOA 3UT8A 3ZKJA 4WNGA 3UKUG 2PM6A 2MRIA 1ZB1A 3ASGA 3MX3A 4LERA 5AQBA 1NZNA 3FTUA 2VSXE 3E33A 3MJWA 1TJFA 2J4BA 3NQPA 3S2AA 1S70B 4K0RA 4DUIA 1WAO1 4J8EA 1E96B 2FO1E 3ZRHA 3KSLA 3UPVA 3PUJA 1YCSB 1FCHA 4TUUA 3U66A 3C3RA 3VLEA 1QZ2A 3GZ1A 1HZ4A 2PQNA 3QAQA 5CEDB 4NACA 2IJGX 3DXKG 2BUGA 1TNBA 3ULEG 4CT0A 3CEQA 2LUHA 2FEZA 1WM5A 3FEXA 3EUVA 3W9GA 2IFUA 3FUMA 3UIPC 3AJIA 2ZGGA 2FO7A 4AY5A 1Y6IA 3V2XA 4KVOA 4H7YA 2WXPA 2J4DA 4DLOA 1EYHA 2P9LG 3LJ3A 1U3CA 1TNUA 4JHJA 2FF4A 3ZFWA 2CG3A 2QYUA 4JPSA 2X6FA 4CEMA 4F1SA 2WXLA 4BSZB 3D9IA 4L2YA 5JJ7A 1PC2A 2DBAA 3CHQA 4F6RD 4NURA 2ETCA 4GZ3A 3SGHA 2RFMA 3MZLB 3Q79A 1FVFA 3RO3A 1B89A 4ANVA 2X38A 4GMLA 1OWMA 1JCRA 3TWTA 2GRMA 2L0TB 3RO2A 4BERA 1HG5A 4AIFA 3C72A 3I4RB 1QYMA 2X6IA 2JABA 2WM9A 2VTBA 1UN8A 4OYSA 3FFLA 4AJWA 4CGVA 3HRAA 4N5QA 5CERB 2XEHA 3FUEA 5KJLA 4G25A 1N4SA 3CVXA 2P2CP 1FT2A 5ARGA 5BV1A 4ANXA 2YHCA 3DSSA 4B0ZA 4XIFA 1EF1C 3HHMA 1H19A 5ITZF 4J8YA 4BX8A 4JZYA 4HQDA 2RFAA 4AOFA 5M72A 4GTQA 2C0LA 3J5PA 3EJNA 1SZ9A 1OCRE 3GZ2A 4JA9A 3T5XA 3V79K 3UQ3A 4HRMB 2XCBA 2Q7FA 2Y3AA 1N54A 1NL4A 4GPMA 2IF4A 3FULA 4GYWA 5J08A 3ONKA 3FTSA 4I6EA 3JXIA 4LSZE 3PH0C 4N2SA 2AXZA 4BY6A 3EU9A 1MZCA 4H7XA 3FU0A 2DVWA 1IHGA 5FZSA 2X6HA 1EPUA 1KPSB 2RG8A 4IN3B 5H7PA 3PZ2A 1IQUA 5BXOA 1H6PA 4O1OA 3VTYA 4GA0A 3SNXA 2LAIA 5JJ6A 4OAVB 1LD8A 5IY5E 4HXIA 2F0YA 4Y6WA 4FLHA 4DPRA 3LVRE 4UI9C 1INZA 3ML8A 1E90A 2I1JA 2VGXB 2WXOA 2OCCE 3KD7A 4QFVA 3JUEA 4UQZA 2WXRA 3CQGB 3ZHEB 4JEHA 3ZN3A 4K03A 2NYJA 3VLDA 2LNIA 5C1DA 3DBSA 3ULYA 3FUDA 4TXQA 4A1SA 5D0OD 5CECB 3DPYA 2B6CA 4N2QA 2R03A 3SD5A 2NSZA 4CDNA 4EZKA 4GZ6A 4G8LA 2KCVA 1H2TC 3U3WA 5EYPF 3CK9A 2VGEA 5C2YA 4HVBA 4GA2A 4ABNA 3CHOA 4U7EB 3Q9UC 1AWCB 3ZYQA 4L1BA 2WXKA 4YDYA 4BT9A 2DYRE 2OVFA 3DSXA 4UWHA 3RSEG 4I6GA 4HOQA 3D9JA 5CCLA 1DCQA 3FUIA 1BPOA 2DZNA 3TWWA 4O1PA 3PDNA 4UQYA 3OXGA 1S0PA 1SA5A 3S7DA 3EHNA 3TL5A 4EHMA 4ANWA 4DX7D 2VSNA 2ETBA 3FTWA 2J49A 2UY1A 4ZHBA 2LAHA 4BFRA 1JWGA 2ETAA 3NAWA 2XGSA 2XENA 4JHRA 4CGWA 3R7QA 2AXVA 5E76A 3TWRA 2HM8A 4IRUA 1K8KG 1MYOA 4AXHA 2F37A 3AG2E 2I9CA 3LJNA 3ML9A 2EQXA 3PE3A 3MV3B 2GGFA 2E0IA 3LY7A 1N9AA 3L08A 3HVEA 2V5QC 3AAAC 3T8MA 1KLXA 1VDYA 3CHMA 2WXHA 2XEEA 4K5CA 3AU5A 1IHBA 4NRHB 4GZ5A 3D9HA 2R17C 4HOUA 3ULQA 5LCWC 5AJLA 3ZIMA 5FJYA 3UM3A 2MYOA 3TAXA 1HS6A 3RIBA 3PREA 4FP7A 2NC9A 3BEEA 5KJKA 4JEUA 4FULA 3B7BA 5EIBE 2DIWA 4J6IA 4ILGA 1LD7A 4ANUA 3I5PA 5CEAA 2R59A 3ZUVB 4EECA 4XKCA 4BSXA 2ZIRA 3ZEFA 5JA4D 3VTXA 2RKKA 4GMRA 1A5EA 2I1KA 1D8DA 2QZAA 2LO6A 3CVWA 4GTPA 4BT8A 4IYPA 4F3VA 5CBNA 5CRUA 4R7LA 3QJZA 5CBOA 1TNYA 1NP7A 2CFUA 5G04J 1H6OA 2XHEA 4AV7A 4N3BA 2WQ6A 3LYAA 4U0ZA 1MQSA 4B94A 3QC1A 4N3AA 4DK5A 2BKGA 4I43A 3Q78A 2H6HA 3NZUA 3UIOC 3L17A 2IONA 3FDHA 5KNGA 1TYQG 4WWPA 5AQ7A 4J8DA 1Z5SC 1HU3A 3DSTA 3BU8A 1O1RA 3QWWA 5BNWA 5BW8C 4JVSA 1N52A 2V0PA 4GCOA 1OT8A 3TXMA 4Y6CA 2FI7A 5D2MC 4O60A 5G05J 1HG2A 3OXLA 4ATGA 3CSTA 3FUKA 2ZU6B 3IHVA 3L54A 1JWFA 1TN8A 4MRUA 3ESLA 5KBAA 4WAFA 2KZTA 3FU6A 4GYYA 4XKBA 3PS6A 3SF4A 3UT4A 2OOEA 3PZ1A 1H6KA 2A4ZA 2WXGA 4E6HA 1H2UA 3QDNA 1DNPA 3FU3A 3L13A 4UI9K 5E75A 2PQRA 1TR4A 4LNUD 4B89A 3DSWA 3AG3E 1BD8A 4UWKA 5HQ8A 3L9TA 4J0UA 1MX2A 5JHBA 1TN6A 4UWFA 2J08A 3B7TA 1UW4B 2WQHA 3PVLA 2Y4UA 4GMJA 4ACLA 5B1AE 3SHFA 3PZ4A 3RJVA 1KT1A 2XPYA 1G3NB 2BTDA 2YNQA 4AP2A 3E30A 2Y69E 2ONDA 4ZFHA 4CDRA 2GRPB 1K1BA 5T3RA 2XCCA 3L16A 2R2LA 3HVEB 3B7UX 4YNDA 1JCQA 3IV0A 1Z6TA 2IOSA 3NB2A 4F1PA 4JA7A 5AYWD 3ISMC 3P1UA 4RQIA 3E4BA 3B95A 2MHKA 4PS3A 1HE8A 2P9SG 1HF8A 4BTAA 4Z68A 1N4PA 4U04A 3QARA 4EZJA 5DBKA 3Q7AA 3TXNA 4NIKA 2KATA 3D3MA 1OCZE 4XI9A 4M3OA 4I6JA 3CGHA 2CFZA 3J5QB 4KZCA 4TV3A 4CZ2D 3LS8A 2PNNA 1MX4A 3FWVA 3FTXA 3BQOA 3UM0A 4GTOA 2J8SD 2WB2A 5ANRA 4A55A 2LXMA 4KZ0A 4ILHB 3ESKA 1OWNA 5FT9A 3Q15A 2R02A 3T8KA 2HR2A 5EIDA 3ONLA 3MKQA 2P9PG 2CHZA 1GW6A 2A5EA 5EKQD 2P9UG 2X6KA 2WXFA 2WMNA 4XX5A 5FQ7A 3FP3A 3QNKA 5ENRD 4GTSA 4ATZD 2L9BA 3FTZA 1HH8A 3JQ0A 3DXMG 2J09A 5EX3A 3SO8A 3OAWA 2EIKE 3D9NA 3QB2A 4BTBA 1Y8MA 3S7BA 3JXJA 4JXTA 2DCPA 4A3TA 3CK8A 4IULA 3Q7FA 2X3MA 4XE0A 2QY7A 5LFAA 3CR3A 5BXUA 4D10C 4HI8A 1JPLA 3LPZA 3JUIA 5FZQA 4XEIG 1S64A 1TN7A 1O1TA 3AS8A 3E37A 4N3CA 2VSYA 1SW6A 2IO3C 3Q75A 4WNFA 3D9OA 4DI4A 3DEPA 2ZGDA 3ZXPA 5ENSD 2WQ7A 4JB8P 2M63A 2P9IG 4I9CA 4WWNA 4GTRA 2YINA 3FUHA 4ILIA 2V5FA 1E8YA 2PM7A 3PEUB 5A23A 4PH4B 1WG0A 3BUAA 2GRRB 1OUVA 4PDXA 5JJTA 1OCOE 5KCMA 3KEZA 3CLJA 4GAAA 3MCXA 1V54E 2GW1A 2J07A 4X8QA 3MKRA 4KMOA 2JEKA 2OEWA 5KNHD 2QFCA 2BF0X 1QQEA 1MHQA 3QKYA 3RRNB 4MLPA 3PRZA 2A5UA 5CMWA 3IBEA 5FQ8A 3ENEA 3APFA 2IY0C 4HOTA 3HXCA 3NOCD 4WUYA 5DIZA 4FHKA 4MKTA 3FH5A 3I3NA 1MJ0A 3F6QA 3L82A 1DC2A 3L6AA 2V4LA 2XPZA 1IXVA 1X5BA 1O1SA 3GYZA 1KZPA 3SBTB 4URKA 3LY8A 4DX5D 2FBNA 4B8AA 3TGOA 1HFAA 4JHKA 3C3OA 2P9NG 3RRMB 2NXPA 2XS8A 3RAUA 1IYGA 3CIAA 4Q94A 5T4YA 4CCAA 4L23A 2VTBB 1E8WA 4I2ZA 4KT6B 5AARA 4G2VA 3KAEA 2J9QA 5ENNA 3BG1B 3ZU7B 3ZNGA 3LEWA 3G2VA 3KSQA 5FWQA 3UM2A 2ZXWE 3U4TA 3JYSA 3GZSA 2EIJE 1OY3D 4GTVA 3ZPJA 3SBSA 1NI1A 3FU5A 4UWLA 1Z3YA 1YA0A 4DRXE 4G11A 4GB9A 3V31A 3MEKA 2IQCA 5FTPA 4LCTA 5ENOD 3AS4A 3UX4A 5BUZA 1K3ZD 3MYVA 4EQFA 4I1AA 1BLXB 2HE0A 3SFZA 1WY6A 2XPIA 3B7RL 4FC8A 4RVBA 3TG5A 3CVQA 4JD2G 4GYOA 3ZW3A 3UUXA 5G04C 3UINC 3LDZA 3CKCA 5LP0A 3AS5A 4U8HA 3DRAA 4OVUA 5J90A 3FTVA 3CVVA 2GRLA 4HB5A 4U63A 4V3IA 1XGWA 3EDTB 4G23A 3ABME 4UQXA 4K5AB 3AG1E 1U2VG 5BPPA 4A63B 2AXUA 1S63A 1SQMA 2E2EA 3E32A 4HRNA 3TG4A 1OWOA 3RRUA 2OEVA 4KYOB 2F8YA 2LXLA 5G05C 4FA6A 2P58C 3HG0D 3R9MA 1JCSA 2XS1A 3QOUA 4FJZA 3HXFA 2KBXA 2GROB 1PAQA 1OCCE 1D8EA 3OTNA 5HKPA 4CYMD 5A6CA 4TRQA 3UTMA 5EDSA 1SZAA 3CK7A 4YVQC 4U07A 3SFXA 1UN9A 1OXJA 3RU0A 1ZU2A 3C98A 3HXEA 4U95D 1O5MA 1Z3XA 1L5JA 3ABLE 2DZOA 3LCAA 5JHAA 3UT7A 1UJKA 5CCMA 5FZRA 4AEZC 3T5VA 4I1OB 4JW1A 4MS6A 4PUCA 3VLFA 4EPZA 1XNFA 1ZBPA 4YDEA 5ARFA 2VGXA 4G24A 1W3BA 4HI9A 2P9KG 3CKBA 5D0QD 5LX8A 4U0SA 3D9LA 4HLLA 4LRZA 2KC7A 4TXPA 5KWDA 3PEVB 3B13A 3ZHEA 5A7DB 3CVLA 2FULA 2UY1B 3FUJA 1FT1A 1H0AA 4Q96A 2KCLA 2OVBA 4BX9A 3T9KA 3RK6A 1JUQA 3TWSA 4A1GA 4DLQA 3PNLB 3SY2A 3HIZA 4CT4A 3DEOA 4PS7A 3ZXSA 2WXQA 1N94A 2QYJA 3R9AB 4OAUC 4I1MA 3ZYKA 3UI2A 4C9BB 1E8XA 3FHEA 2YHEA 4KBQA 5G55A 3HYMB 3UKRG 3O4ZA 4WNDA 4RG6A 5T8IA 1FVHA 3IXEA 2HYZA 2LSVA 4ACKA 3FH7A 4HFGA 3FUNA 3WXXA 3QWPA 4CRWA 4BESA 5EYLA 2I2OA 3Q4AB 2XRZA 4G1TA 1NA0A 3KS2A 5ANLA 3NBNB 3IHYA 4HLEA 2KCKA 5FQ4A 2IO2C 3LXUX 4YVOA 5B3SE 1N11A 1BI8B 5ENPD 4WNEA 1ELKA 3EHRA 4OVVA 4C48B 3IKOB 4U0UA 1SA4A 1TEZA 2V4HC 3QK0A 3ZGQA 4HORA 3FY4A 2XEVA 2WXMA 3WG7E 1E7UA 4AY6A 2WVIA 3NOGD 3E34A 5B1BE 4E85A 4K5BA 3PNTB 3DSUA 1PY1A 2AW6A 2WMOA 4G26A 5D66A 3O48A 2ZISA 1WDYA 4NQ0A 5HI7A 3FH8A 4J7WA 3RKVA 2Y4TA 2X6JA 4HNAD 2IU1A 5BT1A 4Q69A 4C0MA 3Q49B 4RG9A 2HO1A 2Y1LE 4BEPA 1HXIA 4MBGA 3C3QA 2GRNB 5EX0A 3AG4E 2C0MA 3CHSA 4HBDA 4AM9A 2XQ0A 3R7RA 3U64A 3UXGA 4U8YD 1HO8A 3FEYA 3MV2B 3URZA 3CVYA 3LKUA 3S7JA 3FUFA 5CMYA 3APDA 1HX8A 3DSVA 4HRLA 3LVQE 1KT0A 3EIQC 1H2VC 4TUMA 1UJJA 2KXPC 1EDUA 3N71A 3NF1A 5AQ9A 1NA3A 4LG6A 4FJYA 1FPPA 2KZTB 3ZVVA 1UG3A 4W9RA 1IKND 5ENQD 2EILE 4GZCA 4G8KA 2I6HA 3CSFA 1N4QA 3UM1A 1N0QA 1RZ4A 4U96D 4QQIA 2CHXA 5BV0A 2VYIA 2VSOE 4M7CA 4LNGA 3CVPA 4JC8A 3NZSA 2YQ8A 1LTXA 4L9PA 4C0EA 3CHRA 3EU5A 3AU4A 3CVNA 4L2LA 3TWVA 3S7FA 1N0RA 2CHWA 2L0IA 5KJNA 3D9KA 4GPKA 2ILRA 4XI0A 4B8CB 3FTYA 4UI9J 2IEJA 4APOA 3IEGA 4F7AA 5AJDA 3HXBA 2B0OE 4DX6D 3TWUA 2R05A 2WXJA
chains in the Genus database with same CATH topology
1SVXA 2DZOA 3EHQA 4NIKA 2XZTG 4HBDA 1TR4A 3NOCD 4LNUD 2NYJA 3V30A 1MYOA 3W9GA 5CBNA 5BXUA 3NBNB 3UXGA 4U8YD 4HI8A 5CBOA 2AJAA 5ITZF 1BD8A 3AJIA 2F37A 4J8YA 4DX1A 5AQAA 2ZGGA 1MJ0A 3J5QB 1MX2A 4CZ2D 5CECB 3F6QA 3LJNA 1DC2A 3KEAA 4HQDA 5HS0A 3V2XA 1IXVA 2RFAA 2PNNA 2L6BA 1MX4A 2BKKB 1SW6A 4HRLA 1D9SA 1N11A 4G8LA 1BI8B 5ENPD 2J8SD 2BKGA 2XZDG 4TUMA 5ENTD 4HB5A 3DEPA 2KXPC 3C5RA 3EHRA 3J5PA 5EYPF 3TWXA 2V5QC 2ZGDA 2VGEA 4C48B 4DX5D 5ENSD 3AAAC 3V2OA 5EILA 5JMND 4K5AB 5AQ9A 4HI9A 4JB8P 4LG6A 4YDWA 3V79K 1MX6A 2V4HC 5KNGA 2XEEA 4K5CA 5AQ7A 4HLLA 4HRMB 4A63B 2F8XK 1YMPA 1G3NB 3Q9UC 5KWDA 1IKND 5ENQD 1IHBA 4GPMA 4BSZB 1AWCB 3D9HA 2Y0BG 4U8VD 4HRNA 4G8KA 4RLYA 5AARA 3ZKJA 3JXIA 4DX2A 4LSZE 3T8KA 1N0QA 1NFIE 5EIDA 4F6RD 4U96D 5AN8A 4QQIA 3EU9A 4YDYA 2ETCA 2DVWA 4ZFHA 3ZU7B 3ZNGA 2MYOA 2A5EA 3T9KA 1OT8A 1WG0A 1K1BA 2F8YA 1UOHA 5AAOA 3NOGD 5AQBA 4UUCA 2RFMA 3TWSA 4O60A 3HG0D 5EN5D 4K5BA 2QC9A 1DCQA 1S70B 1YYHA 2DZNA 3DEOA 4O1PA 3TWWA 3B7BA 5HRYA 4DUIA 5EIBE 2KBXA 3Q9NC 1OY3D 5BXOA 2FO1E 4OAUC 2QYJA 5ENRD 3W9FA 5D66A 4O1OA 4F1PA 5HKPA 3UI2A 4CYMD 5CEAA 4ATZD 5KBAA 3TWVA 1YCSB 3TWTA 4OAVB 1N0RA 4BERA 4DRXE 3ZUVB 3UTMA 1WDYA 3B95A 1QYMA 5KNHD 3V31A 4J7WA 2JABA 5FIOA 5JA4D 4HNAD 3SO8A 4DX7D 4B93B 4BETA 5ENOD 2ETBA 2DWZA 5CEDB 3IXEA 4Z68A 3JXJA 1K3ZD 4GMRA 2Y1LE 2B0OE 3HRAA 4ZHBA 4N5QA 1A5EA 5CERB 2XEHA 2ETAA 4QFVA 4DX6D 3TWUA 1BLXB 3TWQA 1AP7A 4BEPA 2HE0A 3JUEA 2XENA 4BESA 5EYLA 4U95D 5FINA 1BI7B 3TWRA 1K1AA 2P2CP 1BU9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SVX A;  2DZO A;  3EHQ A;  4NIK A;  2XZT G;  4HBD A;  1TR4 A;  3NOC D;  4LNU D;  2NYJ A;  3V30 A;  1MYO A;  3W9G A;  5CBN A;  5BXU A;  3NBN B;  3UXG A;  4U8Y D;  4HI8 A;  5CBO A;  2AJA A;  5ITZ F;  1BD8 A;  3AJI A;  2F37 A;  4J8Y A;  4DX1 A;  5AQA A;  2ZGG A;  1MJ0 A;  3J5Q B;  1MX2 A;  4CZ2 D;  5CEC B;  3F6Q A;  3LJN A;  1DC2 A;  3KEA A;  4HQD A;  5HS0 A;  3V2X A;  1IXV A;  2RFA A;  2PNN A;  2L6B A;  1MX4 A;  2BKK B;  1SW6 A;  4HRL A;  1D9S A;  1N11 A;  4G8L A;  1BI8 B;  5ENP D;  2J8S D;  2BKG A;  2XZD G;  4TUM A;  5ENT D;  4HB5 A;  3DEP A;  2KXP C;  3C5R A;  3EHR A;  3J5P A;  5EYP F;  3TWX A;  2V5Q C;  2ZGD A;  2VGE A;  4C48 B;  4DX5 D;  5ENS D;  3AAA C;  3V2O A;  5EIL A;  5JMN D;  4K5A B;  5AQ9 A;  4HI9 A;  4JB8 P;  4LG6 A;  4YDW A;  3V79 K;  1MX6 A;  2V4H C;  5KNG A;  2XEE A;  4K5C A;  5AQ7 A;  4HLL A;  4HRM B;  4A63 B;  2F8X K;  1YMP A;  1G3N B;  3Q9U C;  5KWD A;  1IKN D;  5ENQ D;  1IHB A;  4GPM A;  4BSZ B;  1AWC B;  3D9H A;  2Y0B G;  4U8V D;  4HRN A;  4G8K A;  4RLY A;  5AAR A;  3ZKJ A;  3JXI A;  4DX2 A;  4LSZ E;  3T8K A;  1N0Q A;  1NFI E;  5EID A;  4F6R D;  4U96 D;  5AN8 A;  4QQI A;  3EU9 A;  4YDY A;  2ETC A;  2DVW A;  4ZFH A;  3ZU7 B;  3ZNG A;  2MYO A;  2A5E A;  3T9K A;  1OT8 A;  1WG0 A;  1K1B A;  2F8Y A;  1UOH A;  5AAO A;  3NOG D;  5AQB A;  4UUC A;  2RFM A;  3TWS A;  4O60 A;  3HG0 D;  5EN5 D;  4K5B A;  2QC9 A;  1DCQ A;  1S70 B;  1YYH A;  2DZN A;  3DEO A;  4O1P A;  3TWW A;  3B7B A;  5HRY A;  4DUI A;  5EIB E;  2KBX A;  3Q9N C;  1OY3 D;  5BXO A;  2FO1 E;  4OAU C;  2QYJ A;  5ENR D;  3W9F A;  5D66 A;  4O1O A;  4F1P A;  5HKP A;  3UI2 A;  4CYM D;  5CEA A;  4ATZ D;  5KBA A;  3TWV A;  1YCS B;  3TWT A;  4OAV B;  1N0R A;  4BER A;  4DRX E;  3ZUV B;  3UTM A;  1WDY A;  3B95 A;  1QYM A;  5KNH D;  3V31 A;  4J7W A;  2JAB A;  5FIO A;  5JA4 D;  4HNA D;  3SO8 A;  4DX7 D;  4B93 B;  4BET A;  5ENO D;  2ETB A;  2DWZ A;  5CED B;  3IXE A;  4Z68 A;  3JXJ A;  1K3Z D;  4GMR A;  2Y1L E;  2B0O E;  3HRA A;  4ZHB A;  4N5Q A;  1A5E A;  5CER B;  2XEH A;  2ETA A;  4QFV A;  4DX6 D;  3TWU A;  1BLX B;  3TWQ A;  1AP7 A;  4BEP A;  2HE0 A;  3JUE A;  2XEN A;  4BES A;  5EYL A;  4U95 D;  5FIN A;  1BI7 B;  3TWR A;  1K1A A;  2P2C P;  1BU9 A; 
#chains in the Genus database with same CATH topology
 3Q5M A;  3SZ7 A;  3EHQ A;  2KM4 A;  1IQR A;  4F53 A;  3ASN E;  4I17 A;  4YDO A;  2DYS E;  4APF A;  3SQV A;  2VGY A;  1A17 A;  3TJP A;  3HDX A;  1ELR A;  2BKK B;  4PS8 A;  5FQ6 A;  3DWL G;  4LEU A;  4FLB A;  1RW2 A;  3PE4 A;  4O6F A;  3APC A;  3X2Q E;  1Q2Z A;  4EZL A;  2C2L A;  4CDM A;  4TXR A;  5KJM A;  2H6I A;  3ABK E;  4GTT A;  4U8V D;  3ASH A;  4RLY A;  4DX2 A;  4I9E A;  3JCK C;  3ASF A;  1NFI E;  4KVM A;  4N5C A;  1LF8 A;  1U3D A;  2WXN A;  3EIJ A;  1UOH A;  3DPD A;  3HXD A;  2EIM E;  2LSU A;  1E7V A;  5EN5 D;  3CV0 A;  2QC9 A;  1YYH A;  4J8F A;  5HRY A;  5AIJ A;  2CG2 A;  4XZ4 A;  3W9F A;  1TNZ A;  2AVP A;  2H6G A;  4JL0 A;  3CVU A;  2WPV A;  4HOS A;  4L7T A;  2BED A;  2PL2 A;  3ASD A;  4FAD A;  4GA1 A;  2JLB A;  5FIO A;  1N4R A;  1TNO A;  3EHM A;  4EBA A;  4B93 B;  3P2B A;  4BET A;  3U9W A;  2VQ2 A;  3ZYL A;  3G2S A;  3TWQ A;  1N95 A;  5FIN A;  4LUN U;  1BI7 B;  3K9I A;  5G2N A;  4J8S A;  4GZD A;  4RSY A;  1SVX A;  2XZT G;  3Q47 B;  4GCN A;  3V30 A;  2XGO A;  1OWL A;  1TJC A;  4AVX A;  3MKQ B;  5AQA A;  4GTM A;  3Q73 A;  4HS2 A;  3ASO E;  2L6B A;  2L6J A;  1D9S A;  4LNB A;  4P29 A;  5ENT D;  2IOL A;  4FHJ A;  1OWP A;  3GW4 A;  4GU5 A;  4DJA A;  1DCE A;  3PZD A;  4YDW A;  2F8X K;  2RD0 A;  1YMP A;  3UMV A;  2OV8 A;  3D9P A;  3PUK A;  1E8Z A;  2Y0B G;  1QNF A;  4UWG A;  3G2W A;  3CQC B;  3B7S A;  4ME2 A;  2R5S A;  5LCW J;  5AN8 A;  2VJ8 A;  3CHP A;  5AAO A;  3LY9 A;  1P5Q A;  4UUC A;  5AEN A;  3PZ3 A;  3BG0 B;  2UWJ G;  2XRY A;  3Q9N C;  2EIN E;  2AWI A;  4KXK B;  3L22 A;  3SFY A;  3MA5 A;  4EBA G;  3MGB A;  3OXF A;  2DWZ A;  4FU3 A;  2PZI A;  2H6F A;  1AP7 A;  1ELW A;  3G2T A;  1K1A A;  1BU9 A;  4N39 A;  5LOZ A;  1V55 E;  2AJA A;  4DX1 A;  5CHE E;  4I2W A;  2V8S E;  1X81 A;  3KEA A;  5HS0 A;  2GRQ B;  2WXI A;  2XGM A;  3D9M A;  4BWR A;  2XZD G;  3QWV A;  3G2U A;  5CRV A;  3C5R A;  3TWX A;  1QBQ A;  4WWO A;  4A3V A;  1DVP A;  3V2O A;  3I4G A;  3ZYM A;  5EIL A;  5JMN D;  4DI3 A;  3SI5 A;  2MOW A;  1MX6 A;  3JQ1 A;  1KZO A;  3UT8 A;  3ZKJ A;  4WNG A;  3UKU G;  2PM6 A;  2MRI A;  1ZB1 A;  3ASG A;  3MX3 A;  4LER A;  5AQB A;  1NZN A;  3FTU A;  2VSX E;  3E33 A;  3MJW A;  1TJF A;  2J4B A;  3NQP A;  3S2A A;  1S70 B;  4K0R A;  4DUI A;  1WAO 1;  4J8E A;  1E96 B;  2FO1 E;  3ZRH A;  3KSL A;  3UPV A;  3PUJ A;  1YCS B;  1FCH A;  4TUU A;  3U66 A;  3C3R A;  3VLE A;  1QZ2 A;  3GZ1 A;  1HZ4 A;  2PQN A;  3QAQ A;  5CED B;  4NAC A;  2IJG X;  3DXK G;  2BUG A;  1TNB A;  3ULE G;  4CT0 A;  3CEQ A;  2LUH A;  2FEZ A;  1WM5 A;  3FEX A;  3EUV A;  3W9G A;  2IFU A;  3FUM A;  3UIP C;  3AJI A;  2ZGG A;  2FO7 A;  4AY5 A;  1Y6I A;  3V2X A;  4KVO A;  4H7Y A;  2WXP A;  2J4D A;  4DLO A;  1EYH A;  2P9L G;  3LJ3 A;  1U3C A;  1TNU A;  4JHJ A;  2FF4 A;  3ZFW A;  2CG3 A;  2QYU A;  4JPS A;  2X6F A;  4CEM A;  4F1S A;  2WXL A;  4BSZ B;  3D9I A;  4L2Y A;  5JJ7 A;  1PC2 A;  2DBA A;  3CHQ A;  4F6R D;  4NUR A;  2ETC A;  4GZ3 A;  3SGH A;  2RFM A;  3MZL B;  3Q79 A;  1FVF A;  3RO3 A;  1B89 A;  4ANV A;  2X38 A;  4GML A;  1OWM A;  1JCR A;  3TWT A;  2GRM A;  2L0T B;  3RO2 A;  4BER A;  1HG5 A;  4AIF A;  3C72 A;  3I4R B;  1QYM A;  2X6I A;  2JAB A;  2WM9 A;  2VTB A;  1UN8 A;  4OYS A;  3FFL A;  4AJW A;  4CGV A;  3HRA A;  4N5Q A;  5CER B;  2XEH A;  3FUE A;  5KJL A;  4G25 A;  1N4S A;  3CVX A;  2P2C P;  1FT2 A;  5ARG A;  5BV1 A;  4ANX A;  2YHC A;  3DSS A;  4B0Z A;  4XIF A;  1EF1 C;  3HHM A;  1H19 A;  5ITZ F;  4J8Y A;  4BX8 A;  4JZY A;  4HQD A;  2RFA A;  4AOF A;  5M72 A;  4GTQ A;  2C0L A;  3J5P A;  3EJN A;  1SZ9 A;  1OCR E;  3GZ2 A;  4JA9 A;  3T5X A;  3V79 K;  3UQ3 A;  4HRM B;  2XCB A;  2Q7F A;  2Y3A A;  1N54 A;  1NL4 A;  4GPM A;  2IF4 A;  3FUL A;  4GYW A;  5J08 A;  3ONK A;  3FTS A;  4I6E A;  3JXI A;  4LSZ E;  3PH0 C;  4N2S A;  2AXZ A;  4BY6 A;  3EU9 A;  1MZC A;  4H7X A;  3FU0 A;  2DVW A;  1IHG A;  5FZS A;  2X6H A;  1EPU A;  1KPS B;  2RG8 A;  4IN3 B;  5H7P A;  3PZ2 A;  1IQU A;  5BXO A;  1H6P A;  4O1O A;  3VTY A;  4GA0 A;  3SNX A;  2LAI A;  5JJ6 A;  4OAV B;  1LD8 A;  5IY5 E;  4HXI A;  2F0Y A;  4Y6W A;  4FLH A;  4DPR A;  3LVR E;  4UI9 C;  1INZ A;  3ML8 A;  1E90 A;  2I1J A;  2VGX B;  2WXO A;  2OCC E;  3KD7 A;  4QFV A;  3JUE A;  4UQZ A;  2WXR A;  3CQG B;  3ZHE B;  4JEH A;  3ZN3 A;  4K03 A;  2NYJ A;  3VLD A;  2LNI A;  5C1D A;  3DBS A;  3ULY A;  3FUD A;  4TXQ A;  4A1S A;  5D0O D;  5CEC B;  3DPY A;  2B6C A;  4N2Q A;  2R03 A;  3SD5 A;  2NSZ A;  4CDN A;  4EZK A;  4GZ6 A;  4G8L A;  2KCV A;  1H2T C;  3U3W A;  5EYP F;  3CK9 A;  2VGE A;  5C2Y A;  4HVB A;  4GA2 A;  4ABN A;  3CHO A;  4U7E B;  3Q9U C;  1AWC B;  3ZYQ A;  4L1B A;  2WXK A;  4YDY A;  4BT9 A;  2DYR E;  2OVF A;  3DSX A;  4UWH A;  3RSE G;  4I6G A;  4HOQ A;  3D9J A;  5CCL A;  1DCQ A;  3FUI A;  1BPO A;  2DZN A;  3TWW A;  4O1P A;  3PDN A;  4UQY A;  3OXG A;  1S0P A;  1SA5 A;  3S7D A;  3EHN A;  3TL5 A;  4EHM A;  4ANW A;  4DX7 D;  2VSN A;  2ETB A;  3FTW A;  2J49 A;  2UY1 A;  4ZHB A;  2LAH A;  4BFR A;  1JWG A;  2ETA A;  3NAW A;  2XGS A;  2XEN A;  4JHR A;  4CGW A;  3R7Q A;  2AXV A;  5E76 A;  3TWR A;  2HM8 A;  4IRU A;  1K8K G;  1MYO A;  4AXH A;  2F37 A;  3AG2 E;  2I9C A;  3LJN A;  3ML9 A;  2EQX A;  3PE3 A;  3MV3 B;  2GGF A;  2E0I A;  3LY7 A;  1N9A A;  3L08 A;  3HVE A;  2V5Q C;  3AAA C;  3T8M A;  1KLX A;  1VDY A;  3CHM A;  2WXH A;  2XEE A;  4K5C A;  3AU5 A;  1IHB A;  4NRH B;  4GZ5 A;  3D9H A;  2R17 C;  4HOU A;  3ULQ A;  5LCW C;  5AJL A;  3ZIM A;  5FJY A;  3UM3 A;  2MYO A;  3TAX A;  1HS6 A;  3RIB A;  3PRE A;  4FP7 A;  2NC9 A;  3BEE A;  5KJK A;  4JEU A;  4FUL A;  3B7B A;  5EIB E;  2DIW A;  4J6I A;  4ILG A;  1LD7 A;  4ANU A;  3I5P A;  5CEA A;  2R59 A;  3ZUV B;  4EEC A;  4XKC A;  4BSX A;  2ZIR A;  3ZEF A;  5JA4 D;  3VTX A;  2RKK A;  4GMR A;  1A5E A;  2I1K A;  1D8D A;  2QZA A;  2LO6 A;  3CVW A;  4GTP A;  4BT8 A;  4IYP A;  4F3V A;  5CBN A;  5CRU A;  4R7L A;  3QJZ A;  5CBO A;  1TNY A;  1NP7 A;  2CFU A;  5G04 J;  1H6O A;  2XHE A;  4AV7 A;  4N3B A;  2WQ6 A;  3LYA A;  4U0Z A;  1MQS A;  4B94 A;  3QC1 A;  4N3A A;  4DK5 A;  2BKG A;  4I43 A;  3Q78 A;  2H6H A;  3NZU A;  3UIO C;  3L17 A;  2ION A;  3FDH A;  5KNG A;  1TYQ G;  4WWP A;  5AQ7 A;  4J8D A;  1Z5S C;  1HU3 A;  3DST A;  3BU8 A;  1O1R A;  3QWW A;  5BNW A;  5BW8 C;  4JVS A;  1N52 A;  2V0P A;  4GCO A;  1OT8 A;  3TXM A;  4Y6C A;  2FI7 A;  5D2M C;  4O60 A;  5G05 J;  1HG2 A;  3OXL A;  4ATG A;  3CST A;  3FUK A;  2ZU6 B;  3IHV A;  3L54 A;  1JWF A;  1TN8 A;  4MRU A;  3ESL A;  5KBA A;  4WAF A;  2KZT A;  3FU6 A;  4GYY A;  4XKB A;  3PS6 A;  3SF4 A;  3UT4 A;  2OOE A;  3PZ1 A;  1H6K A;  2A4Z A;  2WXG A;  4E6H A;  1H2U A;  3QDN A;  1DNP A;  3FU3 A;  3L13 A;  4UI9 K;  5E75 A;  2PQR A;  1TR4 A;  4LNU D;  4B89 A;  3DSW A;  3AG3 E;  1BD8 A;  4UWK A;  5HQ8 A;  3L9T A;  4J0U A;  1MX2 A;  5JHB A;  1TN6 A;  4UWF A;  2J08 A;  3B7T A;  1UW4 B;  2WQH A;  3PVL A;  2Y4U A;  4GMJ A;  4ACL A;  5B1A E;  3SHF A;  3PZ4 A;  3RJV A;  1KT1 A;  2XPY A;  1G3N B;  2BTD A;  2YNQ A;  4AP2 A;  3E30 A;  2Y69 E;  2OND A;  4ZFH A;  4CDR A;  2GRP B;  1K1B A;  5T3R A;  2XCC A;  3L16 A;  2R2L A;  3HVE B;  3B7U X;  4YND A;  1JCQ A;  3IV0 A;  1Z6T A;  2IOS A;  3NB2 A;  4F1P A;  4JA7 A;  5AYW D;  3ISM C;  3P1U A;  4RQI A;  3E4B A;  3B95 A;  2MHK A;  4PS3 A;  1HE8 A;  2P9S G;  1HF8 A;  4BTA A;  4Z68 A;  1N4P A;  4U04 A;  3QAR A;  4EZJ A;  5DBK A;  3Q7A A;  3TXN A;  4NIK A;  2KAT A;  3D3M A;  1OCZ E;  4XI9 A;  4M3O A;  4I6J A;  3CGH A;  2CFZ A;  3J5Q B;  4KZC A;  4TV3 A;  4CZ2 D;  3LS8 A;  2PNN A;  1MX4 A;  3FWV A;  3FTX A;  3BQO A;  3UM0 A;  4GTO A;  2J8S D;  2WB2 A;  5ANR A;  4A55 A;  2LXM A;  4KZ0 A;  4ILH B;  3ESK A;  1OWN A;  5FT9 A;  3Q15 A;  2R02 A;  3T8K A;  2HR2 A;  5EID A;  3ONL A;  3MKQ A;  2P9P G;  2CHZ A;  1GW6 A;  2A5E A;  5EKQ D;  2P9U G;  2X6K A;  2WXF A;  2WMN A;  4XX5 A;  5FQ7 A;  3FP3 A;  3QNK A;  5ENR D;  4GTS A;  4ATZ D;  2L9B A;  3FTZ A;  1HH8 A;  3JQ0 A;  3DXM G;  2J09 A;  5EX3 A;  3SO8 A;  3OAW A;  2EIK E;  3D9N A;  3QB2 A;  4BTB A;  1Y8M A;  3S7B A;  3JXJ A;  4JXT A;  2DCP A;  4A3T A;  3CK8 A;  4IUL A;  3Q7F A;  2X3M A;  4XE0 A;  2QY7 A;  5LFA A;  3CR3 A;  5BXU A;  4D10 C;  4HI8 A;  1JPL A;  3LPZ A;  3JUI A;  5FZQ A;  4XEI G;  1S64 A;  1TN7 A;  1O1T A;  3AS8 A;  3E37 A;  4N3C A;  2VSY A;  1SW6 A;  2IO3 C;  3Q75 A;  4WNF A;  3D9O A;  4DI4 A;  3DEP A;  2ZGD A;  3ZXP A;  5ENS D;  2WQ7 A;  4JB8 P;  2M63 A;  2P9I G;  4I9C A;  4WWN A;  4GTR A;  2YIN A;  3FUH A;  4ILI A;  2V5F A;  1E8Y A;  2PM7 A;  3PEU B;  5A23 A;  4PH4 B;  1WG0 A;  3BUA A;  2GRR B;  1OUV A;  4PDX A;  5JJT A;  1OCO E;  5KCM A;  3KEZ A;  3CLJ A;  4GAA A;  3MCX A;  1V54 E;  2GW1 A;  2J07 A;  4X8Q A;  3MKR A;  4KMO A;  2JEK A;  2OEW A;  5KNH D;  2QFC A;  2BF0 X;  1QQE A;  1MHQ A;  3QKY A;  3RRN B;  4MLP A;  3PRZ A;  2A5U A;  5CMW A;  3IBE A;  5FQ8 A;  3ENE A;  3APF A;  2IY0 C;  4HOT A;  3HXC A;  3NOC D;  4WUY A;  5DIZ A;  4FHK A;  4MKT A;  3FH5 A;  3I3N A;  1MJ0 A;  3F6Q A;  3L82 A;  1DC2 A;  3L6A A;  2V4L A;  2XPZ A;  1IXV A;  1X5B A;  1O1S A;  3GYZ A;  1KZP A;  3SBT B;  4URK A;  3LY8 A;  4DX5 D;  2FBN A;  4B8A A;  3TGO A;  1HFA A;  4JHK A;  3C3O A;  2P9N G;  3RRM B;  2NXP A;  2XS8 A;  3RAU A;  1IYG A;  3CIA A;  4Q94 A;  5T4Y A;  4CCA A;  4L23 A;  2VTB B;  1E8W A;  4I2Z A;  4KT6 B;  5AAR A;  4G2V A;  3KAE A;  2J9Q A;  5ENN A;  3BG1 B;  3ZU7 B;  3ZNG A;  3LEW A;  3G2V A;  3KSQ A;  5FWQ A;  3UM2 A;  2ZXW E;  3U4T A;  3JYS A;  3GZS A;  2EIJ E;  1OY3 D;  4GTV A;  3ZPJ A;  3SBS A;  1NI1 A;  3FU5 A;  4UWL A;  1Z3Y A;  1YA0 A;  4DRX E;  4G11 A;  4GB9 A;  3V31 A;  3MEK A;  2IQC A;  5FTP A;  4LCT A;  5ENO D;  3AS4 A;  3UX4 A;  5BUZ A;  1K3Z D;  3MYV A;  4EQF A;  4I1A A;  1BLX B;  2HE0 A;  3SFZ A;  1WY6 A;  2XPI A;  3B7R L;  4FC8 A;  4RVB A;  3TG5 A;  3CVQ A;  4JD2 G;  4GYO A;  3ZW3 A;  3UUX A;  5G04 C;  3UIN C;  3LDZ A;  3CKC A;  5LP0 A;  3AS5 A;  4U8H A;  3DRA A;  4OVU A;  5J90 A;  3FTV A;  3CVV A;  2GRL A;  4HB5 A;  4U63 A;  4V3I A;  1XGW A;  3EDT B;  4G23 A;  3ABM E;  4UQX A;  4K5A B;  3AG1 E;  1U2V G;  5BPP A;  4A63 B;  2AXU A;  1S63 A;  1SQM A;  2E2E A;  3E32 A;  4HRN A;  3TG4 A;  1OWO A;  3RRU A;  2OEV A;  4KYO B;  2F8Y A;  2LXL A;  5G05 C;  4FA6 A;  2P58 C;  3HG0 D;  3R9M A;  1JCS A;  2XS1 A;  3QOU A;  4FJZ A;  3HXF A;  2KBX A;  2GRO B;  1PAQ A;  1OCC E;  1D8E A;  3OTN A;  5HKP A;  4CYM D;  5A6C A;  4TRQ A;  3UTM A;  5EDS A;  1SZA A;  3CK7 A;  4YVQ C;  4U07 A;  3SFX A;  1UN9 A;  1OXJ A;  3RU0 A;  1ZU2 A;  3C98 A;  3HXE A;  4U95 D;  1O5M A;  1Z3X A;  1L5J A;  3ABL E;  2DZO A;  3LCA A;  5JHA A;  3UT7 A;  1UJK A;  5CCM A;  5FZR A;  4AEZ C;  3T5V A;  4I1O B;  4JW1 A;  4MS6 A;  4PUC A;  3VLF A;  4EPZ A;  1XNF A;  1ZBP A;  4YDE A;  5ARF A;  2VGX A;  4G24 A;  1W3B A;  4HI9 A;  2P9K G;  3CKB A;  5D0Q D;  5LX8 A;  4U0S A;  3D9L A;  4HLL A;  4LRZ A;  2KC7 A;  4TXP A;  5KWD A;  3PEV B;  3B13 A;  3ZHE A;  5A7D B;  3CVL A;  2FUL A;  2UY1 B;  3FUJ A;  1FT1 A;  1H0A A;  4Q96 A;  2KCL A;  2OVB A;  4BX9 A;  3T9K A;  3RK6 A;  1JUQ A;  3TWS A;  4A1G A;  4DLQ A;  3PNL B;  3SY2 A;  3HIZ A;  4CT4 A;  3DEO A;  4PS7 A;  3ZXS A;  2WXQ A;  1N94 A;  2QYJ A;  3R9A B;  4OAU C;  4I1M A;  3ZYK A;  3UI2 A;  4C9B B;  1E8X A;  3FHE A;  2YHE A;  4KBQ A;  5G55 A;  3HYM B;  3UKR G;  3O4Z A;  4WND A;  4RG6 A;  5T8I A;  1FVH A;  3IXE A;  2HYZ A;  2LSV A;  4ACK A;  3FH7 A;  4HFG A;  3FUN A;  3WXX A;  3QWP A;  4CRW A;  4BES A;  5EYL A;  2I2O A;  3Q4A B;  2XRZ A;  4G1T A;  1NA0 A;  3KS2 A;  5ANL A;  3NBN B;  3IHY A;  4HLE A;  2KCK A;  5FQ4 A;  2IO2 C;  3LXU X;  4YVO A;  5B3S E;  1N11 A;  1BI8 B;  5ENP D;  4WNE A;  1ELK A;  3EHR A;  4OVV A;  4C48 B;  3IKO B;  4U0U A;  1SA4 A;  1TEZ A;  2V4H C;  3QK0 A;  3ZGQ A;  4HOR A;  3FY4 A;  2XEV A;  2WXM A;  3WG7 E;  1E7U A;  4AY6 A;  2WVI A;  3NOG D;  3E34 A;  5B1B E;  4E85 A;  4K5B A;  3PNT B;  3DSU A;  1PY1 A;  2AW6 A;  2WMO A;  4G26 A;  5D66 A;  3O48 A;  2ZIS A;  1WDY A;  4NQ0 A;  5HI7 A;  3FH8 A;  4J7W A;  3RKV A;  2Y4T A;  2X6J A;  4HNA D;  2IU1 A;  5BT1 A;  4Q69 A;  4C0M A;  3Q49 B;  4RG9 A;  2HO1 A;  2Y1L E;  4BEP A;  1HXI A;  4MBG A;  3C3Q A;  2GRN B;  5EX0 A;  3AG4 E;  2C0M A;  3CHS A;  4HBD A;  4AM9 A;  2XQ0 A;  3R7R A;  3U64 A;  3UXG A;  4U8Y D;  1HO8 A;  3FEY A;  3MV2 B;  3URZ A;  3CVY A;  3LKU A;  3S7J A;  3FUF A;  5CMY A;  3APD A;  1HX8 A;  3DSV A;  4HRL A;  3LVQ E;  1KT0 A;  3EIQ C;  1H2V C;  4TUM A;  1UJJ A;  2KXP C;  1EDU A;  3N71 A;  3NF1 A;  5AQ9 A;  1NA3 A;  4LG6 A;  4FJY A;  1FPP A;  2KZT B;  3ZVV A;  1UG3 A;  4W9R A;  1IKN D;  5ENQ D;  2EIL E;  4GZC A;  4G8K A;  2I6H A;  3CSF A;  1N4Q A;  3UM1 A;  1N0Q A;  1RZ4 A;  4U96 D;  4QQI A;  2CHX A;  5BV0 A;  2VYI A;  2VSO E;  4M7C A;  4LNG A;  3CVP A;  4JC8 A;  3NZS A;  2YQ8 A;  1LTX A;  4L9P A;  4C0E A;  3CHR A;  3EU5 A;  3AU4 A;  3CVN A;  4L2L A;  3TWV A;  3S7F A;  1N0R A;  2CHW A;  2L0I A;  5KJN A;  3D9K A;  4GPK A;  2ILR A;  4XI0 A;  4B8C B;  3FTY A;  4UI9 J;  2IEJ A;  4APO A;  3IEG A;  4F7A A;  5AJD A;  3HXB A;  2B0O E;  4DX6 D;  3TWU A;  2R05 A;  2WXJ A; 
#chains in the Genus database with same CATH homology
 1SVX A;  2DZO A;  3EHQ A;  4NIK A;  2XZT G;  4HBD A;  1TR4 A;  3NOC D;  4LNU D;  2NYJ A;  3V30 A;  1MYO A;  3W9G A;  5CBN A;  5BXU A;  3NBN B;  3UXG A;  4U8Y D;  4HI8 A;  5CBO A;  2AJA A;  5ITZ F;  1BD8 A;  3AJI A;  2F37 A;  4J8Y A;  4DX1 A;  5AQA A;  2ZGG A;  1MJ0 A;  3J5Q B;  1MX2 A;  4CZ2 D;  5CEC B;  3F6Q A;  3LJN A;  1DC2 A;  3KEA A;  4HQD A;  5HS0 A;  3V2X A;  1IXV A;  2RFA A;  2PNN A;  2L6B A;  1MX4 A;  2BKK B;  1SW6 A;  4HRL A;  1D9S A;  1N11 A;  4G8L A;  1BI8 B;  5ENP D;  2J8S D;  2BKG A;  2XZD G;  4TUM A;  5ENT D;  4HB5 A;  3DEP A;  2KXP C;  3C5R A;  3EHR A;  3J5P A;  5EYP F;  3TWX A;  2V5Q C;  2ZGD A;  2VGE A;  4C48 B;  4DX5 D;  5ENS D;  3AAA C;  3V2O A;  5EIL A;  5JMN D;  4K5A B;  5AQ9 A;  4HI9 A;  4JB8 P;  4LG6 A;  4YDW A;  3V79 K;  1MX6 A;  2V4H C;  5KNG A;  2XEE A;  4K5C A;  5AQ7 A;  4HLL A;  4HRM B;  4A63 B;  2F8X K;  1YMP A;  1G3N B;  3Q9U C;  5KWD A;  1IKN D;  5ENQ D;  1IHB A;  4GPM A;  4BSZ B;  1AWC B;  3D9H A;  2Y0B G;  4U8V D;  4HRN A;  4G8K A;  4RLY A;  5AAR A;  3ZKJ A;  3JXI A;  4DX2 A;  4LSZ E;  3T8K A;  1N0Q A;  1NFI E;  5EID A;  4F6R D;  4U96 D;  5AN8 A;  4QQI A;  3EU9 A;  4YDY A;  2ETC A;  2DVW A;  4ZFH A;  3ZU7 B;  3ZNG A;  2MYO A;  2A5E A;  3T9K A;  1OT8 A;  1WG0 A;  1K1B A;  2F8Y A;  1UOH A;  5AAO A;  3NOG D;  5AQB A;  4UUC A;  2RFM A;  3TWS A;  4O60 A;  3HG0 D;  5EN5 D;  4K5B A;  2QC9 A;  1DCQ A;  1S70 B;  1YYH A;  2DZN A;  3DEO A;  4O1P A;  3TWW A;  3B7B A;  5HRY A;  4DUI A;  5EIB E;  2KBX A;  3Q9N C;  1OY3 D;  5BXO A;  2FO1 E;  4OAU C;  2QYJ A;  5ENR D;  3W9F A;  5D66 A;  4O1O A;  4F1P A;  5HKP A;  3UI2 A;  4CYM D;  5CEA A;  4ATZ D;  5KBA A;  3TWV A;  1YCS B;  3TWT A;  4OAV B;  1N0R A;  4BER A;  4DRX E;  3ZUV B;  3UTM A;  1WDY A;  3B95 A;  1QYM A;  5KNH D;  3V31 A;  4J7W A;  2JAB A;  5FIO A;  5JA4 D;  4HNA D;  3SO8 A;  4DX7 D;  4B93 B;  4BET A;  5ENO D;  2ETB A;  2DWZ A;  5CED B;  3IXE A;  4Z68 A;  3JXJ A;  1K3Z D;  4GMR A;  2Y1L E;  2B0O E;  3HRA A;  4ZHB A;  4N5Q A;  1A5E A;  5CER B;  2XEH A;  2ETA A;  4QFV A;  4DX6 D;  3TWU A;  1BLX B;  3TWQ A;  1AP7 A;  4BEP A;  2HE0 A;  3JUE A;  2XEN A;  4BES A;  5EYL A;  4U95 D;  5FIN A;  1BI7 B;  3TWR A;  1K1A A;  2P2C P;  1BU9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...