3NBPA

Hiv-1 reverse transcriptase with aminopyrimidine inhibitor 2
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
557
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 155
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3nbpA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nbpA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nbpA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nbpA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nbpA05
4DQPA 4KTZA 3EYZA 3FDSA 2FLPA 1Q8IA 4TLRA 3NHGA 3V9XA 2R8KA 1IKYA 4Q0BA 4N5SA 4M95A 3PW2A 2HWIA 2KZZA 4FBUA 2XI3A 4C8NA 1TK0A 4C8OA 1J53A 3EZUA 1EP4A 1LWCA 3AVIA 1EETA 2OPQB 4C8KA 2XO7A 4LY7A 4DTUA 1T94A 4IR9A 4M3ZA 4QAGA 1U49A 3C6UB 2V4RA 5F8JA 2X78A 3THVA 1UA0A 3NAHA 4AHRA 4IDKA 2YV0X 2DFHA 2YNHA 3N6NA 1TKTB 1RT5A 5L1KA 4MK8A 4LQ9A 4RW8B 2I5JB 1ASUA 1ZBHA 4QCLA 4DQIA 1JLEA 4QWBA 1A5XA 2VWKA 3G6YA 3CFRA 5CY4A 3I8DA 3S3MA 2R8IA 1HQEA 2XCPA 5EWEA 2ZD1B 4OLBA 3OSNA 3RAXA 4EYIB 4KI6A 1EETB 2G8VA 3KLEA 4Q45A 2RDJA 4C8MA 3V9UA 3IGVA 4FJGA 2J6UA 3OL7A 2FVSA 2YNFA 2Z1JA 4HYKA 3HYFA 4NLWA 2AGQA 4W5QA 4KKOA 1N5YB 4ID5B 3AVFA 1HNVA 4NLPA 3SI8A 2O4IA 4O0IA 4CHNA 4OPKA 3H5YA 1C0UA 3OHBA 2QE5A 1CZBA 2OPRB 1S9EA 4ZMMA 4YMEA 1ASVA 1JKHB 3PVXA 4Y34A 3ZCMA 4EP4A 5DQHA 4GC6A 5F8MA 3CIZA 4E1NA 1KTQA 4Y3CA 2W7OA 4FJ5A 2ETJA 3NF6A 1RYRA 1HNIB 1RT4B 3A2FA 1UOCA 4Z4GA 4XPEA 2ATLA 3MEGA 1W25A 4DS5A 4NCBA 4MFBB 1DTQB 5KFWA 1RTIB 5HRRA 3MEDB 4KHWA 3PZPA 4QOZB 5KT6A 2D0BA 4J9PA 2FBXA 4RU9A 1F21A 3QO9B 3WNGA 2GUIA 1JLCA 1UAXA 3P5JA 1IO2A 4G1QA 2HNZB 1ZTTA 3RMAA 1N56A 4MFBA 4EP5A 5KFEA 4IH6A 4ELVA 4Q8EA 1S0NA 3M8PB 4EBEA 1MU2A 2B6AA 2C2EA 1REVA 4QPXA 3PW7A 1WSJA 1SL0A 2FJVA 1RT6B 4E89A 1K1QA 4ED3A 3BSOA 2JEJA 3OS1A 4N76A 1HQEB 3CYMA 3P83D 3KOAA 1D9DA 3KHRA 2V0NA 3VQEA 4BE0A 3NCIA 2X6SA 1TVRB 4R0EA 2W7PA 1I39A 5DG9A 4NLOA 3JYTB 1RCHA 2I1RA 3SQ4A 3QZ7A 3M9MB 3V9ZA 2HNDB 4EO6A 1Q9XA 4CIFA 3V1RA 2R8GA 1RT1A 3CJ4A 1U48A 2UUTA 4FJ8A 3L2QA 2KQ2A 3M8SA 1SUQA 3KLEB 3V6KA 1QQCA 3AVMA 2OPRA 3GQCA 5FRNA 5EWGA 2W8LA 4DL4A 3RB0A 1HQUB 2IBKA 2YNGA 1VSHA 1EXQA 1S9FA 2FVQA 4NLUA 3M9OB 5KFAA 1NK9A 1KSPA 4CK1A 3GIJA 5J2QA 3CJ0A 1D9FA 2IM1A 3G10A 1FK9A 1NJYA 4FCYA 1JLAB 3U3GA 3V9SA 4J2DA 3SPZA 2WTFA 4B9UA 4LSLB 3V6DB 4M3RA 4CEQA 3RAQA 4JV2A 3AVAA 1RBVA 2XC9A 1BIZA 2F96A 1RTJB 4RNFA 4ECRA 2P5OA 3ZSWA 2IJNA 2D7SA 1LWFA 3RMCA 1S1TA 5KFSA 3DOKB 1SKWA 4JRQA 1JLEB 4CE9A 3T5LA 3SV3A 3BGRA 1NJZA 3AO1A 3HPHA 2FVPA 3HPGA 4AHTA 5EWFA 5KFZA 4W5OA 3TAMA 5J2NB 4KB0A 1KVCA 2C2DA 3AO3A 3DLKB 3TAFA 1S9GB 3CM6A 4K4WA 1DTTA 4J9OA 2RF2B 4CEAA 4MK9A 5HP1A 4FM1A 2AQ4A 1GX6A 1U04A 4B8CA 1NK7A 5J2MB 3AVCA 3JSMA 1TL1B 1A5WA 1TV6B 5C25A 4I9LA 1UWBA 4DL6A 3UDLA 3TABA 4WE1B 5J2MA 4KV8B 3T5HA 4F4YA 3RB4A 4CJEA 2Z1IA 2RF2A 4K4UA 4Y2CA 4XO0A 2W9AA 3H5SA 1HJRA 4WFZA 4EBCA 4ECZA 3JSMB 2ASLA 3OYGA 2YKNA 4I7FA 3QNOA 1MU2B 2HNZA 3OYNA 2ATQA 1DLOA 2P51A 4O55A 2OPQA 4BWMA 4F3OA 4M94A 3C6UA 4RUCA 4O3SA 2C2RA 2B6AB 1HQUA 4CEZA 3OYKA 3PJWA 3BSNA 1C0TB 3QZ8A 4DL7A 2CJQA 3OLBA 2WONA 3MXJA 2O4GA 3BSCA 1NJWA 4QW9A 3CJ2A 1K6YA 4FZYA 4DTNA 2EHGA 3BSAA 3ITHB 4JRPA 2IJFA 3KK3B 1KVBA 3CM5A 5K14A 1FKPB 3NE6A 1TP7A 1S49A 4YNQA 1Y97A 5KFHA 5KFUA 3IS9B 4IRDA 2ZE2B 3NF8A 4MQ3A 3FFIA 4CESA 4BDYA 4CECA 4NLVA 1EKEA 3SFGA 3KMQA 4EYHB 3B6PA 2C28A 3OHAA 1VK0A 2W9CB 3QNNA 3KLGA 3QEWA 4YQWA 3PUFA 1HYSA 3C6TB 4IG3A 1IKWB 1RT1B 4Y1DA 1T7PA 2G8HA 4AH9A 1NHVA 3OS2A 4FM0A 2R2SA 3HT3A 4FK4A 4KV8A 4CEDA 5F8GA 2JLEA 4I2PA 1JLGA 4LSNB 3OYFA 5HROB 1BCOA 1Z26A 4PWDB 3KNAA 5JS2A 3VQAA 4E19A 1TK8A 3H40A 4DMNA 4DS4A 3HKWA 5HRSA 1Z25A 2B4JA 3GIKA 2KZMA 2BRKA 5KFNA 3DMJB 3OYHA 4F50A 3I0RB 4N47A 1GOBA 5T7BA 3V9WA 1S1UB 1N4LA 1R0AA 3ZSRA 4B9MA 4E7JA 1QTMA 2RKIA 2VG7B 1NK6A 4KHQA 3MXMA 3VQBA 3PHEA 3CDUA 4TQRA 4M3XA 2Y1JA 4ZHRB 4FK0A 1TKXA 1S1WB 4E3SA 1RT6A 4CF1A 2VG6A 1YVFA 3WNHA 4NZ0A 4HHTA 3NKYA 4Y2AA 1FKOA 3LPUA 4KKOB 1N5YA 3QLHA 4TY8B 4ZPAA 2R2UA 4ECUA 3O3FA 4DSEA 3SPYA 1C0TA 4C8LA 1S9GA 5F8IA 1ITGA 2PY5A 3H4BA 3OSPA 1L3TA 4URGA 5DQGA 2EX3A 4FLXA 4R5PA 2JC1A 2FJWA 3ZSVA 5KG2A 2YHBA 3AVBA 2AGPA 1RT7A 5KG5A 1KVAA 4ID5A 3OYIA 1UA1A 1VSJA 3DYAB 2QKKA 3MEEB 3V6JA 4CFDA 1TVRA 5HRNA 1RTJA 3VN5A 4NYNA 2V4QA 3ZSQA 3DI6A 4URSA 2AX1A 5KFLA 1RTDA 3LANA 3SUNA 3CDEA 5K14B 3CJ3A 4DSFA 4Z4CA 2V9WA 3OYDA 1SV5B 5KT3A 3OYJA 3CJ5A 3U6FA 5J2PA 4HVJA 5EUHA 3AVGA 5DG7A 4DQSA 2BQUA 4IKFA 4FJ7A 4RNNA 4CJTA 4CGIA 3LZIA 3C6TA 3QIPA 2D0AA 2LSNA 1S1XB 1XWLA 2EC0A 4JV1A 5I42B 1RDAA 4RW4B 3IRXA 3DRSA 1U09A 2WCXA 4O3PA 3O4QA 3ICLA 3DMJA 3OYCA 3DM2A 1S97A 4K50A 4E7HA 3CDWA 3TI0A 4FJNA 2KFZA 1OS5A 3KKSA 4ECQA 4H54A 2WB4A 4AILC 4JV0A 3I0SA 3OYAA 4CJVA 1RBTA 1VSEA 3ZT2A 1NK0A 1D0EA 2P1JA 2ASDA 2GIQA 3V6HA 3F73A 4M42A 1SH2A 3O3GA 1LWEA 2G8KA 1HYSB 4ZP9A 5KI6A 3DM2B 5KFIA 3OYMA 1RNHA 1QSYA 4IFVA 3EPGA 1LWFB 4NRUA 2YHAA 4KBIA 3VQ5A 4WFYA 3VQDA 5HBMB 3PR5B 2PZSA 4I2PB 3G0ZA 3OYEA 1WLJA 2HHWA 3KK2B 3HP6A 3IG1B 1WNEA 2QV6A 4CF8A 3MR3A 3LP2B 2VG5B 4FZZA 3MEGB 3SCXA 4ZPBA 4NLGA 5KG0A 1LW0B 1RILA 4FVMA 1SL2A 3QETA 1S9EB 5L9XA 3QIOA 4BDZA 1RA6A 1TAUA 1NK4A 3GV8B 4J9LA 2UUWA 1R0AB 2X74A 4YR3A 1S0OA 4Z4FA 3K5MA 5CZ2A 2C22A 1KHVA 3QGIA 3M8QB 3KK2A 3V4IB 1C2PA 1BISA 1S0MA 1C1BA 5CYQA 4DEZA 4J9QA 3JYTA 4BACA 4RZRA 4MK7A 4DTMA 3D5MA 5JXSA 1FXXA 1XI1A 1WAFA 4CHZA 3DRPA 4I7FB 2HHUA 4W5NA 2I5JA 4J9MA 4R8UB 3IN5A 2FVRA 3KK3A 4TY9A 3VQSA 3E01B 5KFQA 4TXSA 5C5JA 2UVWA 1ZBIA 4NCGB 4F4ZA 4AHSA 5I3UB 3NF9A 2D5RA 1CLQA 3V1QA 1NOZA 4MKAA 3BJYA 5KFCA 4OVLA 4DQRA 1W9HA 4F4XA 3ZSZA 1VRUB 2E6MA 4X2BA 3NL0A 4DSJA 5L1JA 3QEVA 3TAPA 3BGRB 3N6MA 2HMIB 4TYAA 3SYZA 2DFEA 1EP4B 3HHKA 3RWUA 3KJVB 5EDWA 4EEYA 4NCAA 4ZP8A 4JLHA 4WZMA 5I42A 1S1XA 1JXLA 5J2PB 4DTRA 1YTUA 2XY5A 3IS9A 2XI2A 4ED0A 4IG3B 3WNEA 5KFFA 3Q8QB 3HVWA 4DTJA 1XR7A 4FBTA 3OYLA 4O3QA 1SV5A 2KTQA 3IRXB 4E7LA 1QHTA 1C1AA 4DLEA 3MF5A 4KTQA 4ZTJA 3T5JA 4CIGA 2IMWP 3KK1A 5DG8A 4KAZA 3HVAA 3TAGA 1HMVB 3RTVA 2D41A 3F9KA 3NH2A 3RB3A 3MECB 5FROA 5HBMA 4J2BA 2JC0A 3LP0B 2XRIA 1S1TB 1JLBB 3NDKA 1FKOB 3DOLA 4RNOA 4EO8A 1FK9B 1JXBA 1JLCB 3VA3A 2E9TA 3H2LA 3L8BA 3RBDA 3M8QA 3V4IA 4KB7A 2OPSA 4Q44A 5D3GA 1D1UA 3CO9A 1QE1A 4O3OA 3DLRA 5HLFB 5DLFA 3LP1A 2QXFA 5KRTA 4B9TA 5L1IA 1RBRA 4DSLA 4FZXC 4KSEB 3ZSXA 4Z0UA 4J9NA 4U7CA 3RR8A 5DGAA 4K4TA 5SWMA 1B92A 1NJXA 5KFPA 4B08A 2O5DA 4NRTA 2JEGA 4FLVA 5F8NA 4E7KA 1BQMB 1L5UA 3KLFB 2VG7A 4CJPA 3VQ6A 2IOCA 3BREA 3IAYA 4FJKA 5E41A 5DLGA 1S4FA 3DRPB 1B9FA 4JS5A 3HM9A 1RT2A 3C94A 1YTAA 4WYLA 4OL8A 3NH1A 4DU4A 2E9ZA 3K5LA 2Z1GA 3MEEA 3L3VA 4JS4A 4EBDA 4ECXA 3OLAA 2IC3B 3T19A 1TQLA 2IAJB 2UVUA 2UVVA 4Q0BB 3VQPA 2QKBA 2J6TA 1KFDA 2X6NA 5C24B 3C95A 4EZ9A 5KTQA 4O44B 2OH2A 4G3IA 1REVB 3SJJA 3OL8A 4YR2A 3TVKA 4GVMA 3RB6A 1X9MA 2A1RA 1XHZA 1JLAA 3FQLA 3SI6A 3LDSA 4J9RA 3VA0A 5KFDA 1VSKA 3PV8A 5KT7A 1TK5A 3QIDA 4IG0B 1A5VA 2W9CA 4NYZA 2FJXA 5KG7A 3GV5B 4IFVB 3KIOA 2YKMA 4KFBB 2E6LA 3KKRA 4B8AB 5T14A 2YKMB 3G6VA 3SQ0A 3E51A 3KMSA 3M9NB 3BDPA 3ISND 3ZSOA 4CJLA 4E1MA 2AX0A 1HPZB 1T05B 1KCFA 5DQIA 1DLOB 1RT3A 1RDCA 1SKSA 1C1CB 1HMVA 4RNMA 1HPZA 4KFBA 4ED7A 1FKPA 3KLIA 4DSIA 1CXQA 1U45A 2HVHA 4ECYA 1T8EA 2XY7A 2BDPA 2ZE2A 4ED8A 4KAIA 5KG1A 4O5BA 2IM0A 1S6QB 3OL9A 5DK5A 4CF0A 4BWJA 3L2RA 4FXDA 3QEIA 2OPSB 1TL3A 3NAIA 4OJRA 3ASMA 4CGJA 4K4YA 3GYNA 2NUBA 3CVKA 1HNVB 1BQNB 4KB1A 1WN7A 2IGIA 4YR0A 3LWLA 4KPYA 1RTDB 4ID1A 4ZPDA 1ZBLA 5F8HA 4NLSA 1S1WA 4FJ9A 5KFGA 1JL1A 3GIMA 3L3UA 2P5GA 3V81B 1LW2A 2F8EX 1XHXA 3NH0A 1BCMA 4M45A 4DL5A 2HHQA 4KHNA 3LZJA 4DTPA 3QYYA 2OZMA 2B5JB 2A1SA 4LSNA 1LWEB 4RW6B 2HNYB 4IFYB 3LWMA 3T1AA 4WZQA 1JLFB 3QEXA 3VQ9A 3K5OA 3H5UA 4K4ZA 3V81A 1UWBB 5EU7A 5DGBA 4FW2A 4UQGA 1RTHB 4R8UA 1DTTB 1VRTA 1JLQB 4CJRA 3HVTB 3I5AA 3CFPA 1KRPA 1BIUA 3QLHB 1QAJA 5D3GB 1G15A 1YVUA 2ZKUA 3RRGA 4FS1A 4I2QA 5HROA 4K4XA 4HUGA 1JX4A 1LW0A 3NGIA 3K5NA 2YNHB 1X9SA 3AVNA 1RDRA 4CF9A 3SV4A 1IM4A 1NHUA 4ED1A 1ZETA 1IH7A 3MR5A 4CEOA 1TKXB 1RBUA 4QWAA 2F8TA 4KRFA 3HVRA 2DFFA 2HAIA 1KLNA 3AO5A 3KD1E 3G86A 4FJMA 4G1QB 3H4DA 4IG0A 4NLRA 2HW3A 4K8ZA 4OKEA 2HVIA 4CJKA 3LP0A 2AJQA 2WONB 4RW7B 1GX5A 4F4KA 3H5XA 2VA3A 3QGGA 2FC0A 4HCCA 4ELTA 1GOCA 4WYWA 4ZVHA 4QWDA 1BQNA 3LPTA 1N48A 5CYMB 4CK3A 2OZSA 3KLHB 2R8HA 3MAQA 5KFOA 1TKTA 1I6JA 3AA3A 4WXOA 4CJ3A 1Z4UA 4O4GA 1ZTWA 1VSIA 3H59A 2OA8A 1IKWA 2BR0A 2HMIA 5JS1A 5KFTA 4KTWA 4HCBA 3I0RA 4Y1CA 3KLVA 3KJVA 4PA1A 2GBZA 3NGDA 3DLGA 1QSLA 4FK2A 2HHSA 3MR2A 5KFYA 4DLGA 3QERA 5KG6A 3LALA 4FW1A 1ZYQA 3VQ7A 2OYQA 3HJFA 1TL3B 4QWCA 4IH7A 3ZSYA 4FJLA 1SL1A 3KLGB 2AGOA 1TKDA 1WNSA 1LW2B 1TKZB 2QK9A 3GILA 4HUEA 3BR9A 2YNIB 4DFKA 4RNHA 5FDLA 1QSSA 3D45A 2CKWA 4M41A 4GC7A 4DG1A 3IG1A 2IC3A 3HSTB 4KHUA 4LH4A 3V6DA 4WE1A 2DTUA 3M8PA 1DTQA 2FVCA 4PWDA 3NF7A 3NBPA 3UIQA 3LP1B 1N6QB 3BQ1A 4CGFA 5KFBA 3QO9A 4IH5A 1SKRA 3L2VA 4B9SA 3AO4A 3S3NA 4KO0A 2WHOA 2ITGA 3AVJA 4CJQA 1JLBA 1TGOA 3AO2A 3DRRA 2W8KA 4YFUA 4Z4HA 2DPIA 3O3HA 4DF8A 1XR6A 2XY6A 4KHMA 4TN2A 2BQ3A 4M3WA 3HXMA 1JL2A 1QE1B 2FLNA 4DU3A 4ED2A 2HHXA 1NKCA 3CWJA 4DQQA 2WK4A 4H4MB 5SZTA 1RT2B 4E0DA 4NLXA 3DLBA 3LP3A 2BANB 4F3TA 3PR4A 3VQ4A 1L3SA 4TY8A 5KT5A 4PQUB 1B9DA 3TR8A 2IAJA 2DY4A 4TSXA 4Q43A 4OKJA 3AA4A 1S6PB 1BI4A 1RT5B 4BE1A 1JXEA 4CERA 3KHHA 4HKQA 4R5PB 2UVRA 4ZVFA 1JIHA 4FM2A 4O44A 4DU1A 2RN2A 2J6SA 2RPIA 4DFMA 2OPPA 1ZBUA 1S1VA 2D3ZA 3PW5A 4WXWA 5FRMA 2E9RX 4CK2A 4H4OA 1X9WA 3TARA 1YT3A 1SH0A 2B43A 3QIPB 4HUFA 4ECSA 2XGQA 4TQSA 3VQCA 1HYVA 4KE5A 3K59A 4OGCA 5KFKA 3LAKA 1J5OA 4RW9A 3HK2A 3PX4A 3GV7B 2ZD1A 1BHLA 4OGEA 4KHRA 3L2UA 5CZ1A 1BQMA 1LAVA 4FJJA 3KK1B 1ZBFA 4ECTA 5HP1B 3PO5A 3TANA 2WOMB 1RAJA 3K57A 2BE2B 1O1WA 2HWHA 4XPCA 2R8JA 4CJFA 1RDBA 3N6LA 5L1LA 3CFOA 4I9QA 3SUQA 4IQXA 5KG4A 2KW4A 4CIEA 2Q3SA 4Z4IA 3DLKA 3TAQA 3H98A 5KGXA 1U4BA 2VG5A 2BRLA 3KLIB 3MEDA 4MIBA 3OY9A 3ALYA 2YNGB 3ZT4A 4CEEA 3Q8PB 3K2PA 3KHGA 2AU0A 2VG6B 1J9AA 2FBTA 2RDIA 3D28A 4CFCA 3MECA 2YNIA 4URQU 4CGHA 3DRRB 1I3AA 3Q8SB 4CJ4A 4FLYA 4QW8A 4CGGA 4LSLA 3CG7A 2RKIB 3ZT3A 2DPJA 4H8KA 4W5RA 2Z1HA 4CFBA 4N41A 2W9BB 1GOAA 4FLUA 1IG9A 4W5TA 3PW0A 3OJSA 2PYLA 4IRKA 4F2RA 3UR0A 3MR6A 3OS0A 5C24A 4RW8A 4YP3A 5KT4A 2Y1IA 1RTHA 3RRHA 2R2TA 1T03A 3MXIA 3UQSA 1S6QA 4NLQA 3SUOA 3ZT1A 3MTKA 2D0CA 1VSLA 3QEPA 1BI4B 1IKVA 2XCAA 4ZTFA 4CF2A 1HYZA 1ASWA 3KLFA 2YKNB 3AV9A 4TYBA 2YNFB 3SQ2A 1Q9YA 3RR7A 3H08A 1JLQA 1S6PA 1TL1A 2VA2A 3PY8A 2G8FA 2OPPB 1KLMA 2KFNA 1VRUA 3B6OA 3QINA 4KI4A 5I3UA 1L3UA 3AVHA 4DFJA 3TAEA 1NOYA 1KLMB 3E01A 3KLHA 1WSEA 5CYMA 3G6XA 4Z4EA 4NLYA 3NGYA 4BE2A 4NCGA 4ZPCA 1K1SA 1JKHA 2ILYA 1X1PA 3FFIB 2HB5A 5KFXA 1QAIA 3T5KA 4DFPA 4DTOA 4FS2A 2ASJA 4RW7A 4ECVA 1S5JA 4MIAA 3HPOA 2FBVA 3HO1A 3BQ2A 3DOLB 1J54A 4CFAA 2FBYA 2G8IA 3S3OA 3DLEB 5C42B 1C1CA 2E4LA 5JUMA 3ISNC 3OJUA 2D3UA 3TWHA 3EZ5A 4U6PA 1RTIA 3KHLA 4IRCA 4ELUA 4FJXA 5KFVA 3BQ0A 3AVKA 3HL8A 3FRZA 3SUPA 4AHUA 5J2QB 3I5CA 3ITHA 2AWZA 3S9HA 1W0HA 2JGUA 2XY8A 3AA2A 5F9LA 1QS4A 3VQ8A 3WNFA 3D0PA 1WSHA 2JEFA 4LD0A 4MH8A 3K58A 4RW6A 1C0UB 2WOMA 1RYSA 3OL6A 4M3YA 3LP2A 3PW4A 4B9NA 4CJWA 4CJUA 3LAMA 1EX4A 3NMAA 1VRTB 4N56A 4DTSA 3L2WA 1HRHA 1KFSA 4NYFA 4AHCA 2GC8A 2JEIA 2R7YA 2G8UA 4KHYA 1SUQB 4ZP6A 3AVLA 3ZT0A 1CZ9A 3EPIA 4FJHA 2B5JA 4DF4A 2XWYA 1VSFA 1S1UA 4IOBA 1NK8A 3EY1A 4FLTA 1KHWA 4B3OB 3GIIA 3ULDA 1D5AA 4AHVA 3DOKA 2ALZA 2W9BA 4B9VA 4ECWA 3PX6A 5FDLB 1TV6A 1S1VB 5C25B 5KGWA 4ZHRA 3QESA 5DMRA 1WAJA 4NLDA 4Q5VA 2F8SA 2IS3A 4OKKA 3TAMB 4H4OB 4PQUA 3CQ8A 1L3VA 2IDOA 3QGHA 3I5BA 4LQ3A 4L8RB 2ZQBA 4OPJA 1RBSA 3M8RA 3T3FA 2HNYA 4XIUA 4Q8FA 3MFIA 1CXUA 1JLFA 4IDKB 5J1EB 4FLZA 1QUVA 4CCHA 4HTUA 4H4MA 4B3OA 1VSMA 1IKYB 3UPFA 2GV9A 1WSIA 1BL3A 1IKXB 4J2AA 3P1GA 2IA6A 1RT7B 4BDPA 1RT3B 4PUOB 3NFAA 3NAEA 5F8LA 3NBPB 4CHQA 1D8YA 4F4WA 4O3NA 4EZ6A 4KO0B 4IKAA 5J1EA 1SH3A 4CHYA 4CJ5A 4OLAA 1C6VA 2XHBA 1J5OB 3VQQA 3DLHA 4DG1B 4E7IA 1LAWA 2XGPA 4GMJB 2HHVA 5KT2A 3U3YA 4LH5A 2PYJA 4PUOA 3Q8RB 3O4NA 2WRMA 1T05A 2ILZA 1U47A 2HNDA 3FQKA 3DDKA 3MFHA 4ZVEA 5F9NA 4JUZA 3NGZA 1TAQA 4M3UA 3IGNA 3TQ1A 2G8WA 4J9SA 3DLGB 3I0SB 3DRSB 4O0JA 3FSIA 3PJXA 1HARA 2BE2A 1N6QA 1T3NA 4DL3A 4B9LA 3RMBA 1VSDA 4K8XA 1TKZA 4WFXA 4CEBA 2R2RA 3SFUA 3OVNA 1RA7A 4FYDA 3AA5X 4RW9B 4DWIA 3RBEA 4NLTA 2FLLA 4CHPA 1RDDA 1NKBA 1JLGB 5KFJA 4F8RA 2IM3A 3KTQA 1IKVB 1BGXT 5J2NA 4RW4A 5KFRA 4IBNA 1LV5A 1S48A 4CJSA 5KRSA 4K4VA 2BQRA 2W42A 4DL2A 4O4GB 2HHTA 5HRPA 1NK5A 1T03B 3SZ2A 4PY5A 3OYBA 1C0MA 4QWEA 3SQ1A 2GIRA 1WSGA 5KFMA 5HLFA 1S10A 1HNIA 1RT4A 1C1BB 5CYQB 4FJIA 2IM2A 1XR5A 1CSJA 5KG3A 4KHSA 4ICLA 4O3RA 4K4SA 4CHOA 4GW6A 2VWJA 3PO4A 1WSFA 4F2SA 1MMLA 4ZVGA 4MKBA 3HP9A 4M3TA 3PX0A 4KREA 4DSKA 4CGDA 3DYAA 4RUAA 3HVTA 1IKXA 4IR1A 3SNNA 3V1OA 4RG8A 4O4RA 2BANA 3KD5E 1NKEA 3DLEA 5C42A 4DTXA 3RMDA 4ICLB 1NNDA 1LWCB 4FLWA 4I2QB 4J9KA 3DI6B 4CEFA 4J2EA 4ED6A 1XC9A 2BGGA 4ZP7A 4IFYA
chains in the Genus database with same CATH superfamily
1ZPVA 3EYZA 2CG8A 4XDCA 2ZOFA 3AT1B 4O8UA 3GFZA 2V8PA 4C8NA 2JHEA 4ETZA 4C8OA 1LWCA 1Q81O 3AVIA 1EETA 4ZLJA 2PFDA 3IR6B 4QAGA 3THVA 3O4WA 5C0YA 3NAHA 4AHRA 3FBBA 2YV0X 3D6FB 3A8KA 3N6NA 5D77A 1TKTB 1RT5A 4MK8A 5AE2A 2I5JB 1ASUA 1ZBHA 2HVEA 1N88A 4JI6K 1X60A 2VWKA 5CY4A 3K2YA 1HQEA 1CJTB 1NG9A 2ZD1B 5D0HA 2IIHA 3RAXA 4OX9K 2M9KA 5C10A 3R1LA 2E20A 2RDJA 3V9UA 2J6UA 3KWGA 3OL7A 2GGPA 2FVSA 2YNFA 2Z0GA 2MKSA 4ILGB 2OKQA 1N5YB 4ID5B 4IFEA 1RGIA 3H5YA 2V2VA 2CNKB 3OHBA 1VJWA 1UL3A 2K1RB 4DN9A 3HHEA 4YMEA 1HI8A 4IO9L 5DQHA 4GC6A 5F8MA 2W7OA 5AR0A 3NY0A 1DQ8A 4P6QA 2XMMA 2PMZD 1UFLA 1UOCA 2P9KA 4OI2A 2ATLA 1W25A 2PO4A 2KB2A 1PIEA 3KG0A 5HRRA 2GCFA 2VONA 3M2RA 1VQ9N 3TOQA 5ETKA 4RU9A 3VAHA 1RBLA 2GUIA 1JLCA 1Y11A 2VUGA 2HBRB 2KDOA 2G1HA 2PBDA 1E6YA 4ES1A 1N56A 3MM5B 4DR5F 4ELVA 4C7QA 3OTBA 2GMHA 1MU2A 4AF1A 3CCJS 1VHFA 4B17A 1E6VB 1XERA 4QPXA 1SL0A 1WSJA 4NXMF 1GMUA 2LDIA 1K1QA 1Q7LB 1TYQB 3BSOA 1HQEB 1CJTA 1RAEB 3P83D 1VQ7S 3BH7B 2KH9A 1D9DA 4ANDA 1WC6A 1CEZA 4OHZA 2CGLA 2LQ9A 3ZZUA 3NCIA 3VAIA 3PIPQ 3TTDA 4R0EA 4PEOA 2WZ1A 4GKJK 3TX8A 1NEEA 3JYTB 1VBKA 1T6DA 3EGVA 5IT9O 1T9UA 3V9ZA 4DR1K 2HNDB 1Q9XA 2EFNA 4CIFA 2DRAA 4DR6K 3OR1B 4BREA 2BUPA 4FJ8A 1T11A 3H25A 4CNZA 4LFBJ 2VYPA 4DB3A 2OPRA 1M5OC 2QTDA 5FRNA 2W8LA 1OH8A 5CA5A 2OTLS 2F9TA 2X1GA 1D4XA 1EXQA 2RSQA 3FR0A 4NLUA 4DUTA 3D6MB 3M9OB 2V4JB 1NK9A 2DTJA 2NRVA 4CK1A 5J2QA 1D9FA 2IM1A 1FK9A 2MZ1A 1NJYA 2R7QA 3U3GA 4J2DA 4JV5K 4B9UA 5D0EA 4LSLB 1OY6A 4JV2A 3M8YA 2XC9A 1BIZA 3WIUA 2OFGX 4RNFA 4W98A 4ECRA 4LFCF 2D7SA 2FYXA 5IOLA 3C14B 1UVMA 1QVGM 2QL7B 3Q23A 3VPZA 4FYWB 1NJZA 1FD2A 5LXYA 3AO1A 4AHTA 1KN6A 5EWFA 2MKKA 4WF9L 5KFZA 4RL1A 4KB0A 3M8ZA 4BRIA 2HIYA 3DLKB 2P9LB 1EHWA 3CM6A 4K4WA 2HEKA 5IZHA 4CEAA 3FUYA 2AQ4A 2ZOGA 3CJ1A 1SJQA 1VQ7N 4LFAJ 3ZFVA 3IXQA 1IBMF 5J2MB 3L95X 3FRYA 2XLKA 4IOCQ 1EWQA 2Z2MA 4WE1B 4NXNJ 4CJEA 5AXNA 2ZJRL 1J5EF 2RF2A 4K4UA 2AV5A 2LA4A 4Y2CA 2CNLB 4C23A 1HJRA 5GMKa 4WFZA 1NMNA 4EBCA 5L8RC 3KUGA 1XMQF 2YKNA 4I56A 1TFYA 2HNZA 2M2BA 3DHXA 3OYNA 1NPPA 4WFBL 3KXDA 4DXLA 2OPQA 3WQPA 4F7VA 4PWUA 1JCFA 2QG9B 1EX8A 4MO5A 3BSNA 3MM8A 3QZ8A 4XDDA 1NAQA 2WONA 3MXJA 2O4GA 1X4FA 1NO8A 4R0JA 1DRZA 2H5EA 1K6YA 2QA4N 4FWOA 4I1TA 3ITHB 4C6AA 4OZJA 2IJFA 2ZVSA 1W7AA 4QYZJ 2BH1A 2VJUA 2ADCA 4FF1A 1FKPB 3NE6A 1HKCA 4GV3A 3S7RA 4FYVB 5KFHA 3CCWA 4IRDA 2EFGA 3C8YA 4JI3F 3RSEB 1PAUB 5TKYA 2V50A 1LK7A 2HBYB 4UZBA 3H20A 2DXFA 1SC4B 3BGFA 1KS2A 4JI1F 1Q4RA 4BC5A 2BE7D 3DNCA 5D15A 3B6PA 1RHQB 2W9CB 3F2KA 4CD3A 1Q18A 3QNNA 3OVBA 3QEWA 1RADB 2RQMA 3PUFA 1HYSA 3JB9k 1YJNS 1IKWB 3P5BP 3L4IA 3OBYA 4ZS6A 4PRFA 3CJTA 1PBAA 3RVCA 5F8GA 2F9DA 3QMLA 1JLGA 4LSNB 3OYFA 3KNAA 2HBMA 1S72N 3PG9A 5JS2A 3GJRB 1WJ9A 1WOOA 2CG4A 2IVPA 4DMNA 5IS2A 3HKWA 5BYQA 4WWSA 3U27A 2B4JA 1OY8A 4DCOB 1DT9A 3J7YI 3H7HB 2KZMA 4KY3A 5HL7L 5KFNA 2VZ9A 3DMJB 2GS8A 4DV0K 3BB5A 4F50A 4X66F 4N47A 1GOBA 5T7BA 3V9WA 5DDQC 4JK9A 1N4LA 1R0AA 3ZSRA 4K5SA 5HQMA 4FVUA 2P6TA 1QTMA 2VG7B 2L9WA 2DNOA 3VQBA 3PHEA 2DR8A 2Y1JA 4FK0A 3G6ES 4ISFA 2FSJA 1P1LA 3ILJA 4E3SA 4NZ0A 2E2QA 3HHLC 3JS6A 2VODA 3DXKA 2CWKA 2EEYA 2I6WA 2R2UA 4L73A 5KQDA 4DSEA 2J0XA 3HFKA 1N36J 5F8IA 1CULA 3H4BA 1L3TA 5I9EB 1RBOB 2UXCK 4FLXA 4BCAA 2FJWA 2YHBA 3FCHA 3CXCM 4C8YA 2ASOA 4RWXA 1KVAA 3IUCA 1UA1A 3OYIA 3VENA 1W97L 3JSRA 4QYRA 1R89A 3M8WA 4CFDA 3TA1A 3VN5A 1VIXA 3ZSQA 4ZVPB 2BKPA 2AX1A 1RTDA 3SUNA 3CDEA 1NZ8A 4A47A 2J0SD 1IXKA 3ILIA 4CO2A 2V9WA 4OJGA 2YWFA 3O9UA 5J2PA 5HANA 2PFFB 4DQSA 4CLPA 4IKFA 4LFCK 3A5LC 4RNNA 2AD9A 5A76A 4P2FA 3LZIA 3C6TA 1F9HA 1QHAA 3Q83A 3OVAA 1VC6A 4JV1A 4RW4B 3E66A 2EFVA 3O4QA 4QS7A 2G2YA 3OYCA 3DM2A 1KC8T 4UF4A 4E7HA 2E5IA 4FJNA 3TI0A 4JKHA 4WQ4A 4MAKA 3KKSA 4CO4A 3J7AP 3OYAA 2DH9A 1RBTA 4CJVA 1NK0A 1VSEA 3U1MA 3ZT2A 3DLJA 2P1JA 2ASDA 3V6HA 1U0HA 4ZP9A 1YJNN 1TR0A 1QSYA 2UUAJ 3L9ZA 3EPGA 3ZETB 3VQDA 2UUCK 3PKMA 3PR5B 4L3KA 4CH1A 4ZDNA 3UNYA 1DQAA 3OYEA 1WLJA 2UXDK 3T1HF 3IG1B 1WNEA 1FDNA 3MR3A 3A3PB 3O3LA 1VC0A 1XC3A 3SCXA 5KG0A 1KWMA 2W6KA 4BBYA 1RILA 1U1RA 4PCQA 2FJBB 3GG4A 5CQGA 3FSXA 1X3NA 1RHUB 1DEJA 3VHQA 2G1DA 5L9XA 2MQPA 3DWLA 4BDZA 1RA6A 1RAHB 4HH0A 4I6MB 4YOUA 4J9LA 2UUWA 2X74A 1AFJA 3K5MA 4RUBA 2AYBA 1S0MA 1QZ5A 4DEZA 1YIJS 3UFCX 4J9QA 5AQIA 1GH8A 2H65B 5DDOC 2D1CA 1Z6RA 2QWRA 1FXXA 1XI1A 1WAFA 3KVGA 2D0PA 2QYGA 3GCXP 3THPA 4IOAQ 3J81j 2F4VK 2QWQA 4R8UB 3IN5A 5LY3A 2NRWA 2FGOA 1YBTA 2MKHA 1B70B 3E01B 3CJCA 1Y9OA 1NMDA 4AHSA 1IJFB 2HIQA 3ENVA 2D5RA 4BRMA 1CLQA 1KDNA 4O0NA 3IAS9 2YJEA 2ZGZA 3EVOA 4QR0A 5KFCA 4OVLA 4BG9A 2PI5A 5AE3A 5BPNA 4F4XA 4ZN1A 1GFWB 2FDNA 2E6MA 4DUYF 3BGRB 2CPJA 1U7LA 3Q8YA 4YHHJ 4JI5K 5LJ3Y 4B3SJ 2EKNA 3KJVB 5I42A 1HBOB 1JXLA 3ELHA 3ATUA 1U1NA 3H2VE 4PWWA 2NXNA 2XI2A 4IG3B 4OX6A 4Z37A 2UV8G 4OI0A 3HVWA 2JVRA 3OYLA 2IVFB 3CXCR 2KTQA 3IRXB 3BYRA 4DLEA 1C1AA 4IO9Q 2O8DB 3ZNJ1 4JI3K 3QWPA 4FPBA 3W7BA 2K7KA 2H51B 2IMWP 2QA1A 4KAZA 3DOMA 3J81O 1T02A 2ZBRA 2ASMA 2D41A 3I4HX 3NH2A 5HBMA 3BN7A 2IDLA 2EFQA 2JC0A 4BG8A 5BYRA 5LSLA 2H48B 3O2IA 1S1TB 4F25A 2AA4A 4H5RA 4M5HA 3NDKA 3QJJA 2XMUA 4X65J 4DR2K 3LW5C 2BUNA 4JI7F 3M2VA 1B0VA 3L8BA 3M6GA 1P90A 3RBXA 4NZ6A 1VQLS 4FF3A 3U1NA 1EQMA 3DLRA 5HLFB 3DGPA 5DLFA 5IV3A 2XG8A 4QIEA 2JDJA 3LO3A 3ZETA 2A42A 1VHIA 4FZXC 1HKBA 2V9KA 4M7XA 3BF4A 2DY9A 2RUSA 4Q7AA 4J9NA 1F1BB 5DM7L 5C2DA 1TL4A 4TLQA 4CYUB 1W2BR 3B78A 4OZ0A 3UI3A 4NRTA 3UVJB 4JI7J 3OUYB 4E7KA 3NEKA 3THXB 4DQ8A 3CMQA 4U7UK 3DRPB 4LT6A 2GO8A 1WC4A 3MOJB 4JS5A 3CEDA 2E5HA 4H0XB 1MN7A 4DR4K 5LT5A 4LFAK 1IBMK 1E4FT 1NBWA 3VEWA 1BE4A 1S6UA 2IC3B 3T19A 2IAJB 2DHSA 2EC2A 3ZZRA 3VQPA 3CT9A 4DR7F 2QKBA 2J6TA 1VOMA 1PYTA 2QT7A 2DD8S 5L9NA 4EZ9A 3ZZYA 2RRNA 2OH2A 3OL8A 1YRTA 3ETMA 3TVKA 2AF6A 1IJEB 3RB6A 1X9MA 3MMJA 1IBLJ 1XHZA 3FQLA 3SI6A 2P6SA 2W7AA 3QJLA 1VSKA 4LRBA 1RP5A 4NXNK 4C3LA 4NYZA 5KG7A 2PGCA 3LGNA 3KKRA 1NSKL 5AQWA 1Z2LA 1ZM4A 2UV8A 5T14A 2ZM6K 2HLTA 2PMHA 4QIGA 1Y5LB 2YKMB 3SQ0A 3BDPA 3ISND 5BRHA 3UR3C 2VQEK 3K17A 4Y00A 3P3DA 1HPZB 1T05B 2NXUA 5DQIA 3IKMA 2K1RA 4BC2A 1RDCA 2NLXA 3VQTA 5LM7E 4KFBA 2IMOA 3PNIA 2MLZA 2HRTA 1H98A 2CPYA 4DSIA 4JYAJ 3OW2M 3Q0AA 1U45A 2YWEA 2HVHA 4JI2K 3MX2A 1FTRA 5G0RB 4O5BA 2IM0A 2YKAA 1UMJA 3L2RA 2H54B 1S5ZA 3CIMA 4OJRA 2WBRA 5A8KA 3GYNA 2PA3A 2LVWA 2ZWPA 3B4DA 3CVKA 4IOCL 1FTCA 1BQNB 2FUG9 3GP9A 3WX8A 4K0KJ 3PHTA 2KKHA 1URNA 3I82A 4DZDA 2N82B 1N33J 2B7CB 2F8EX 1XHXA 3THYA 1BCMA 4DL5A 5CH7B 1N36K 4KHNA 3E3XA 1RQ0A 5BJRA 1RWUA 3D0IE 4IFYB 4WZQA 4BR7A 1JLFB 2QSFA 1ZZFA 3K5OA 3Q2TC 4K4ZA 4ZVSB 5DGBA 1RZMA 3D3CJ 1VRTA 2NQPA 3WZ0A 7AT1B 4BRAA 3GL1A 2FB0A 3HVTB 2AJ1A 2ZZMA 1KRPA 3D1QA 2ZFHA 4JAXA 4QS9A 3QLHB 2POKA 4P2XA 4JI2F 4DR5K 3RRGA 5CCLA 5GAEI 2F4VJ 1KD1O 2BKOA 4Y2MA 2KT3A 3SV4A 1NGBA 1IM4A 1NHUA 1ZETA 3BEGB 3MR5A 4Z7YA 3TQEA 3I33A 1ZBTA 5B0AA 4F67A 2HVZA 4NEZA 3HVRA 4ZOSA 1CJVB 1M5KC 2YH0A 3GU0A 2A1BA 4IG0A 4M1KA 4K8ZA 3NCPA 2V51B 3FEXB 3N5BA 4OKEA 3LP0A 2LLZA 4HVZA 1A7GE 4LF7J 1TZ0A 1WC5A 2VA3A 2FC0A 3JQMA 3R5CA 3TU5A 4HCCA 3GG0A 2B4UA 3O8MA 1KONA 4ZVHA 2CQ2A 4A61A 2CQPA 4QWDA 1BQNA 4B3RJ 3LPTA 3NMUA 1N48A 5CYMB 4DR7K 2A3JA 3MAQA 1FXRA 4JNEA 3DLLQ 1IBKK 1TL5A 4WXOA 2RQKA 1VQKS 1SJ3P 3GWCA 3BGLA 3IRWP 2MQQA 3CC7S 2JVOA 2HMIA 3QRPA 4P2MA 5DM6L 3I0RA 1K0TA 2MYFA 3NGDA 4FK2A 4DUYJ 3MR2A 4CLWA 1AROP 3LALA 4FW1A 1NH8A 1MMNA 1ZYQA 3VQ7A 5JVGL 2DGOA 4FJLA 4FF2A 5GAHP 1TKDA 1WHWA 3A13A 1WNSA 1TKZB 2AJFE 2OI2A 3BR9A 2YNIB 4JI4J 4MDBA 2H3GX 3W60A 1YITN 4NB4A 4IO1A 3W64A 2GVZB 2LU2A 2ZH4A 2JWLA 3CQYA 4WE1A 3JAMO 3CCRN 1CS4A 1DTQA 1NU0A 1XNQK 3NF7A 3J80Y 3LP1B 1U1LA 4EFAC 2P9NA 5KFBA 5HQ8A 4UY8T 1SKRA 3L2VA 3HCXA 1FE0A 3U9DA 5DO2A 2ZBCA 4CJQA 1JLBA 3AO2A 3LPEA 4P73A 3ULEB 5ADXA 3QICA 2A2CA 3L7OA 4LVOP 2J7WA 2G0CA 3HXMA 1QE1B 2CH5A 1HD0A 4U95A 4KGXB 1HBNA 4DV6J 5CE3A 4ZVTB 2E1AA 4DQQA 4ILJA 2W24A 4H4MB 2IFXA 4OYXA 3VEVA 3HKZD 3CO0P 4K7QA 2DT9A 2ASYA 1HBMA 1WSVA 2XLIA 2LQ5A 4PQUB 2IAJA 4TSXA 3UN2A 3EM1A 4CZHA 1UFKA 1BI4A 1HFEL 4BE1A 1JXEA 3LM9A 4CERA 3KHHA 4HKQA 3UE2A 3QT5A 4MMOA 1YGYA 4FM2A 4O44A 1UCNA 4FWRA 4JI3J 2RPIA 3SAFA 1S1VA 2E9RX 3GYGA 2GMLA 4JKEA 1Q82O 4H4OA 1X4GA 2MSSA 4CI6A 4YS2A 4BRHA 3UWTA 3DRYA 1JJ4A 2VQEF 2D3O1 3DFEA 4BQZA 2E1RA 4DR7J 3VQCA 4AYBD 4KE5A 1Y00A 4OGCA 5KFKA 2DY1A 4Z7CA 5DDPC 1UETA 3WXJA 3CETA 4FJJA 1BQMA 4ZN3A 4QOTA 3CMES 1ZBFA 3L0QA 3TANA 2WOMB 4AE5A 1O1WA 2HWHA 2R8JA 3CUNA 3VMFB 3THYB 4CI0B 3EKUA 5L1LA 3B8HA 2V2KA 4CIEA 3P49B 2Q3SA 1X5PA 4NLBA 3TAQA 4WQ5A 2RJZA 3VZHA 2VASA 1VK3A 3CC2S 4WK1A 3AB2B 4MIBA 3ALYA 3KHGA 2VG6B 2Z58B 4LIRA 4USUA 2OO4A 3D2EB 2D74B 3D66A 3C3LA 1DARA 2XS2A 1H2VZ 3ZT3A 2IJRA 1H2TZ 1RDWX 4W5RA 3NOGA 3W2WA 4N41A 1GOAA 2PAVA 1QM9A 2GO9A 3OJSA 3PW0A 2UUBF 5C24A 4YP3A 4WP9A 4TKTA 2Y1IA 1RTHA 3RRHA 2R2TA 3CJ9A 6FD1A 2DEIA 1S6QA 2IA0A 4P2SA 1HWUA 2QO3A 2NUUG 3SUOA 2D3OR 2AT1B 2CZVC 2V8DA 3ZT1A 1VSLA 3QEPA 2V34A 1LXNA 4CF2A 4PKDB 3CHWA 3AV9A 2YNFB 3SQ2A 1Q9YA 2NXEA 3VOVA 3VEYA 4LF5J 2X1BA 4BRNA 3ENBA 3TUIC 2G2OA 3QINA 1KVKA 5EN1A 4N7TA 3ZYYX 4DFJA 1NOYA 2IDEA 1OO0B 5AZIB 2XMKA 3M6UA 4JD2B 4J7CA 5B8HA 4NLYA 3E9PA 4BE2A 2P5VA 2BJ1A 1X1PA 2HB5A 4EHTA 4WFNQ 5KFXA 2YKQA 2MY8A 1KR4A 4MIAA 3DOLB 5H1SQ 1S3XA 4HEA9 4CFAA 2DR7A 2FBYA 1PJ5A 1WEYA 3AA9A 5E3CA 5C42B 3CJKB 2QA4G 1ZA1B 3MR7A 1FJCA 1CBKA 1AZSB 2D3UA 2J7KA 2XSFA 3NVKA 1S59A 4DUYK 3BQ0A 2GIFA 3C0BA 2E7VA 3HL8A 1G6BA 4PG4A 1HR0K 3FRZA 4LFBK 3FJ2A 1FT8A 2JGUA 5LOQA 2VPXB 4NA3A 1WKKA 3WXIA 4Y28C 1QS4A 3WNFA 1WTBA 2F8HA 3QT8A 3K58A 4RW6A 2WOMA 2YBVA 4WFAQ 1Y7PA 3DOMB 3FZMA 2CJYB 3SLCA 2EI5A 4N56A 1Q5VA 4CH7A 3IWLA 3CJRA 2A0FB 1RISA 2RT3A 2PDAA 3BV8A 4KHYA 9ATCB 4DU7A 1N32K 4FJHA 2CQ0A 2B5JA 1PJ7A 4J90A 2CQHA 2XWYA 1S1UA 1NK8A 2RE2A 3EY1A 4FLTA 4B3OB 3GIIA 1N0UA 1MMDA 4OYAA 4H0PA 1SIWB 2ALZA 3NMRA 4B9VA 3M32B 2PEBA 4W4MA 1S1VB 3L7PA 4Q5VA 1RWXB 4DV3F 4OKKA 4H4OB 1KC8O 3GONA 2GVDB 4PQUA 1L3VA 3P38A 2APOA 1RBSA 2DGQA 3TO8A 2E5LF 3SJHA 4BRKA 4XIUA 2D69A 4IDKB 4B3RF 4JI1K 2VFTA 3UN3A 2NS1B 1HBMB 1MWKA 4FXWA 2GV9A 3GSIA 3PXGa 4WTOB 4CIOA 1WSIA 4BS2A 3O08A 2BOAA 2ZH6A 2CPEA 2KYXA 4BDPA 4M5DB 3NFAA 5F8LA 3NNCA 5EGYA 1ATSA 4H4KC 2ZJQQ 1NGHA 2F5GA 2VC1A 4QR2A 2P2CB 4CHYA 1UFWA 2K2PA 1H73A 1C6VA 4KGVB 4DCHA 1BA0A 1YAGA 5LMNK 2OD4A 1LKZA 2NSBA 3KG1A 3K8VA 3PYFA 4PUOA 2WRMA 2JOQA 1T05A 4H0TB 2IVYA 4QYZK 4C1NK 3DDKA 4DPXA 2MPUA 2WW4A 4X65F 4JUZA 1TAQA 3P96A 3TQ1A 1NLKL 3EEQA 2CNOB 5ADXH 2HG4A 1J5EK 1O51A 4IQMA 3GR1A 1N6QA 4OV1A 5A2QO 2XSJB 4K8XA 1XTZA 3Q8VA 4CEBA 4DV6F 3SFUA 2ITMA 3O9QA 3SQGB 5KFJA 4F8RA 1VQ4S 1FJ7A 5ADZA 1IKVB 5J2NA 5AZJA 3AOCA 4IBNA 2B4PA 5AQVA 4CJSA 3SBGA 4K4VA 2DNYA 1S76D 4O4GB 4XK8C 1Z1ZA 4MLHA 1XNQF 1N5QA 4L76A 1YUWA 3JQKA 5D6GA 1HNIA 1C1BB 5AJ3F 2R3VA 1VIOA 4I6WA 1TUGB 5KG3A 2ZF5O 4ICLA 3X3UA 2DGVA 2PI4A 3OFEA 4ZCIA 2YHYA 4MKBA 1SJ1A 2DXDA 2FZCB 1QAXA 3TZXA 4DSKA 4CGDA 3PSIA 1H7WA 2V7ZA 1R8CA 5SUHA 4RUAA 4LF2A 2RQCA 2VOPA 4RG8A 3EMTA 2DHXA 2OIHA 1U1PA 4JI4K 4WU2A 1VI7A 3DI6B 4CEFA 1RE1B 3R7SB 1XC9A 2BGGA 2VBYA 2ZH1A 4IFYA 4EI2A 3HOSA 4KTZA 3NHGA 1Q8IA 4U9RA 4JI8J 4PG5A 1IKYA 4HHUA 4NL5A 4M63A 1T9TA 2Z2ZA 4KH0B 3OVSA 4M95A 1GK8A 3PW2A 2KZZA 2XI3A 4LJMA 1YRUA 2OPQB 2LA6A 1PGZA 2E5LK 4DTUA 4PXCA 4M3ZA 1T9WA 1U49A 4OZ5A 5D0RA 3MN6A 4ZIWA 2YX1A 2JH3A 5B7WA 5L1KA 4LQ9A 4FKXA 1SCJB 4A48A 1SJFA 1JLEA 1F2GA 2GX9A 3CFRA 3G6YA 3AQPA 3HX9A 1HPMA 3S3MA 5HK4A 2KI2A 4FWQA 5EWEA 1NCLA 1UPMB 4USIA 4OLBA 4WJBA 3OSNA 3CPEA 2VGNA 2B8QA 2W2MP 4LR7A 3EL2A 1N32F 4Q45A 4ITSA 3C16B 2RIJA 4J37A 1T6CA 3EZWA 4JKDA 1WG1A 4HYKA 2UU9K 4CVNE 3HYFA 3WIVA 2OUGA 4C9DA 2UUBJ 1Y5NB 5MLCQ 3AVFA 4NLPA 3KYLA 1YF5L 3SI8A 2M3DA 2PD1A 5DZ7A 4JYAF 2NLWA 3Q7CA 2ZWHA 3TPQA 1WTFA 4Y3CA 4FJ5A 2ETJA 5EY4A 3TEHB 4RX6A 4OO1J 3S8SA 2WVDA 1HNIB 3ENAA 3BKFA 4Z4GA 4XPEA 1AT1B 3H0PA 4M5DA 3MEGA 4EWTA 1HLUA 4NCBA 4JN4A 2CFXA 2HK2A 1FDAA 2XMWA 4YEAA 1H0HB 1YXQA 1RTIB 5D78A 3Q86A 4QOZB 2A10A 5KPRA 2YQ3A 1F21A 3S1TA 3R6LB 1RUSA 3NGKA 3P5JA 4ES3A 2ZH7A 5GAHU 5LL6d 1ZTTA 2BTFA 3RMAA 2QX0A 2PIIA 3CULA 4MFBA 4ZJQA 3IBWA 4EP5A 4LBPA 3MWBA 5HATA 2AJ0A 3D1HA 2B6AA 1GXUA 1GLCG 2C42A 2C2EA 3ID6A 3PW7A 2J9EA 3IR5B 5ETVA 2BJ7A 4W90B 3CF5Q 2HSTA 4B3MJ 1UEVA 1MWZA 4N76A 1BWVA 5FLXY 4OJ1A 2ZNYA 4J9UE 4OHVA 3SCLE 3CTRA 1WHXA 1I39A 2NZCA 1HUXA 2I1RA 3CCZA 3QZ7A 2BKNA 3CJQA 4BQLA 4AUKA 2LXUA 2R8GA 1U48A 5M2RA 3RAMA 1Q86T 1V4SA 3DC2A 4IO8A 4QS8A 3M8SA 5KPZA 1CJKA 4J91A 1AA1B 3SBTA 1WBDA 5AQYA 3KLEB 2Q1NA 1QQCA 1RAOA 1KXPA 2G0JA 5EWGA 4OLOA 2V7YA 2YJFA 4DL4A 1SIZA 3RB0A 1S9FA 4LF7F 3F9MA 1DFDA 1WWHA 1KSPA 3R8YA 2YXLA 2Z57B 4DHYA 3G10A 2HFZA 3AOBA 4H5WA 1JLAB 3VF0B 4FDFA 3V6DB 5GAHI 1CQNA 4GKJF 3JSBA 4ATNA 3AVAA 4C48A 2KFYA 3MMCA 3K9KA 2V4JA 5L39A 3EN9A 2QXLA 5KFSA 3D1OA 3DOKB 5D8HB 1SKWA 3WXMB 3T5LA 3SV3A 3BGRA 1UWAA 2RS8A 2YWWA 1XBWA 4BRGA 1F2HA 4W5OA 1R8HA 2W2PP 3UNGC 1FJGK 3TAMA 5J2NB 3QSYB 4LF6K 2C2DA 4DI6A 3HLUA 2CXEA 3TAFA 1S9GB 3D3BJ 1RTZA 4J9OA 4CO1A 3P4UB 1GMWD 4FM1A 5HQLA 3W3SA 3OTCA 1U04A 1WOSA 4DJBA 4YDDB 3AB4B 1GTHA 3W2VB 1NK7A 3AVCA 1TL1B 5CZXA 5C25A 1G4CA 4I9LA 1U25A 3UDLA 3HTVA 3AJ1A 5JVGQ 3THWA 1F3FA 3S01A 1RHRB 2OELA 1U8SA 3MAAB 2Z1IA 4GY2B 1YJTA 4OZ3A 4FYYB 4XO0A 4A8OA 4ANEA 2W41A 2W9AA 3H5SA 1PAEX 3R7NB 4I7FA 1MU2B 3R1HA 2B0GA 1DLOA 1ULRA 1T9VA 1ZC6A 2DGWA 3CCMN 4DCPB 4M94A 4RUCA 4FKYA 2C2RA 3FFKB 4ZLPA 4CEZA 3OYKA 2O67A 4K2XA 1C0TB 2CJQA 2CJXB 3OLBA 3G25A 2CQDA 3VAMA 3VF4A 1H38A 3CJ2A 4FZYA 4JI1J 2W1BA 1C4CA 4I6MA 5GIPA 3HFZB 2O8DA 2NNWA 2UYTA 1SBRA 2HFNA 5K14A 4ILLA 1TP7A 1S49A 4YNQA 1OVYA 4OYBA 5KFUA 1X5OA 1OSDA 1ILYA 3I9ZA 5JLFA 3NF8A 2CPDA 1IN0A 4JKFA 5KPTA 2BV3A 2HQ3A 3ZLJA 1QAYA 4JI0F 2JFKA 2QC3A 4CZCA 4P10A 1VLOA 5AFUH 4M63C 1RK8A 3ZTQA 4NLVA 4F02A 2J0WA 2YCHA 3SFGA 1DKGD 3G6EN 2MJUA 1VK0A 3RW7A 2LEAA 4FOEA 3KLGA 3AGKA 3GB0A 5AQKA 1RSCA 5ETOA 3G82B 2VQEJ 3DGVA 1V4TA 4IG3A 1U2RA 5BREA 3SMPA 3AGRA 2LDYA 5CYJA 1CC8A 4UY8O 1VAZA 4PHTX 3OS2A 4JB8B 1HQ2A 2KKZA 4I2PA 2DRBA 1VQPN 5HROB 5HSPA 1BCOA 1Z26A 3AA8A 4ZJLA 5AXMA 3CC7N 2A2DA 5GAGP 3CCVS 2OCEA 3L4BC 4DS4A 5HRSA 1Z25A 2E44A 2B9XA 3MPVA 1PO6A 3L3CA 1FNOA 3PJ9A 1JNZB 3NS5A 3M2UA 2HURA 1MSWD 3GIRA 2MKIA 3W2WB 1LNQA 2XNRA 2JZ5A 1S1UB 3MXHP 4E8UA 3NGSA 1RDUA 3THXA 1Q1KA 3MXMA 2XZWA 3G87A 1TELA 3CDUA 1TKXA 1IBLF 1S1WB 4USJC 1RT6A 3O1WA 2VG6A 3WNHA 4CNYA 3QSIA 4HHTA 2ZJQL 4Y2AA 5K8OA 4K8RA 4A8WA 4NASA 4LF5F 1U2VA 3LPUA 4KKOB 2Z2LA 2O8CB 3VGSA 2EVZA 4ECUA 4B1XB 1VRQC 3WC0A 3MCNA 1ITGA 2J0QD 2RHSB 3V4MA 4H0VB 3ILOA 2HQCA 1BWEA 2EX3A 4R5PA 3AFGA 3GE9A 2AYEA 1SC3B 2PSZA 3CCTA 2MZRA 1WDTA 1NGCA 1RT7A 1PKUA 1YJRA 4E1JA 4OV6A 2MEWA 3QMQA 3V6JA 3WX4A 1TVRA 3BZQA 4HR2A 2W2QP 2P9SB 2V67A 1RU1A 1CJUA 5K14B 1YVNA 2GJIA 5JJBA 1MW7A 4LREA 3J81Y 4Z4CA 4B3RK 4PR6A 1RHMB 4PXBA 3T6JA 4YOEA 4IXCA 3OYJA 2MXYA 2HGMA 5EUHA 2I38A 4DV4K 4FJ7A 3OTOJ 3CPWR 2ZVIA 1FHTA 3CJSA 4BR9A 4PYAA 4AM6A 2LSNA 1S1XB 1VQ5N 2H4WB 2C2OB 1N36F 4MKVA 3DRSA 1U09A 3ICLA 1Q8KA 3DMJA 3RBZA 1U2CA 1V9OA 4K50A 2JSXA 3CDWA 4CP5A 5EX0A 3MMVA 4AILC 1SC6A 1CJKB 1D0EA 3TRGA 1SH2A 4M42A 4OYIA 1VQNS 1HYSB 2OP5A 5M1PA 4YHHK 5KI6A 3DM2B 4GVEA 3OYMA 1XMBA 1F5AA 4IFVA 3VEZA 4NRUA 2V69A 4WFYA 2PZSA 4I2PB 3ZNUA 1NGIA 3GPAA 3HP6A 2RHKA 3LP2B 2VG5B 4DV3J 3K89A 1YJ9S 4U7BA 2MTLA 4X84A 4DR4J 5GVQA 4BC9A 2P9PB 4FVMA 5C7PA 1X7VA 2QL9B 3M1VB 1SL2A 1S9EB 3CD5A 2N3OA 2CPFA 3E1YA 4DX7A 1NK4A 3HHLD 3M30B 1R0AB 3CCUS 4B3SK 2JJ4D 1QQOA 5CZ2A 2LEPA 3V4IB 3KK2A 1EQ0A 4K43A 1KOHA 5IC6B 2ZUAA 4MK7A 1OH5A 3D5MA 5JXSA 1EJ7L 4AQYF 2V52B 4CHZA 3AJDA 3I56N 2HF3A 2CNNB 3SK3A 5AQRA 1XMQJ 4MLEA 4TXSA 5C5JA 1OPZA 4LF4K 1ZBIA 4NCGB 4CWBA 2OANA 1UEUA 5I3UB 2WTUA 4PYDA 2FPHX 3OBWA 4FPIA 2FSNA 4DQRA 2XMTA 3R6MA 4A4JA 4X2BA 3PIOL 3NL0A 4DSJA 3KZBA 3QEVA 2BEFA 3JTOA 2YWKA 3N6MA 2HMIB 2GJFA 2DFEA 1EP4B 3HHKA 2FSKA 5EDWA 4ZP8A 4RKUC 1S1XA 5J2PB 1YTUA 1C4AA 1ZOTA 4RUHA 1X5TA 3TSUA 3Q8QB 1JWWA 2QFIA 4O3QA 1ATRA 4E7LA 2ZOMA 4NMLA 1FJGJ 1WBBA 3MF5A 2AEJA 2DNMA 1SZ2A 4JI7K 3T5JA 4LMZA 1VHXA 3KK1A 5DG8A 1N33K 4BRDA 2WSCC 2I2YA 1HMVB 1KVJA 2C3PA 2PT0A 5FROA 2O3DA 2RMLA 1EAYC 3LP0B 2XRIA 3MGJA 1K9MO 1JLBB 4M5GA 4BVPA 1FKOB 3CD6N 3Q24A 4RNOA 4EO8A 1HNZF 2W6LA 4YORA 3V4IA 1CQMA 1X4DA 4Q44A 5D3GA 1D1UA 3CO9A 4ZK7M 1QE1A 2IRXA 4FF4A 4O3OA 2CQ4A 5KRTA 2Z8QA 4DX5A 5L1IA 1HNWF 5E3AA 1SJ4P 2C3UA 2BW7A 4KSEB 5CD4A 1I94J 1F5CA 2P9PA 4Z0UA 4U7CA 3RR8A 5DGAA 4K4TA 2ROEA 3CCMS 1B92A 1NJXA 5E3PA 2VF3A 2A6MA 3BPSP 1HNXF 2AMCB 3VQ6A 3BREA 2WC9A 3VGTA 1WF0A 3IAYA 5D4NA 4FJKA 2FY1A 4LRAA 1E6YB 1FNXH 3HM9A 3SCIE 4PAAA 5KOWA 3BKUA 1Q16B 3TR5A 4EBDA 4ECXA 1Q81T 3QT6A 3OLAA 2DJWA 4CZJA 4V19X 2Y8WA 1TQLA 2DIVA 2UVUA 1HNXJ 2CAJA 1KFDA 1R8BA 1SQEA 3C95A 4BROA 4CJ7A 3UKRB 3TZWA 1YIJN 3IC1A 3IAM9 2HBZB 4F0KA 2ZWOA 5IM0A 1BA1A 3VA0A 1HWKA 3P8BB 5G4DA 4BRFA 2B4VA 3QIDA 2A3ZA 5IWAK 4IFVB 4B9QA 3TNVA 1VQ8N 4B8AB 2LMIA 3QQCD 2UXCJ 1YQHA 4DDFA 4PPZA 4AM7A 3GDQA 1KCFA 2H4YB 2XULA 2LCWA 2NUHA 1RT3A 1SKSA 2E1YA 1HPZA 2YVSA 4ED7A 1W7WA 4C3MA 1NSQA 2M70A 2RE1A 3BH6B 4B1YB 4ECYA 2XY7A 3OD2A 3EE8A 1TMJA 3GJSB 2ZE2A 1RBAA 2F40A 3MMBA 1HKGA 5KG1A 4HI2A 1S6QB 1FRXA 3BKTA 1C0GA 5GMDA 3ASMA 3HM8A 4S0MA 3D7EO 1HNVB 3KKFA 2MMYA 3FZFA 4CO5A 1XMOF 3LWLA 2BJ8A 2DITA 4FWKA 3HZEA 5F8HA 5J1PA 4FJ9A 3K7RA 1M5SA 3GIMA 1LW2A 2QWLA 4CLYA 4EK2A 2MQLA 3QWUA 4M45A 5FLXO 1VDHA 2HHQA 2C3MA 3LZJA 4DTPA 3CF5L 1NWKA 1H6KX 4RW6B 2HNYB 2BVZA 3T1YK 1R3NA 1ZBSA 5AQQA 2EPIA 3QEXA 3TUJC 4FW2A 4UQGA 2R4FA 4R8UA 3ZTRA 1JLQB 1KAZA 2NRTA 4OYPA 4PKIA 1JQGA 1Q82T 3Q22A 1G15A 1YVUA 1HI1A 2ZKUA 2Q43A 2F9JA 2DNQA 4FS1A 4I2QA 3GJTB 4K4XA 4HUGA 2V63A 2ERRA 1LW0A 2CPHA 2YNHB 1X9SA 4V1Ak 4CF9A 3G4SN 3FBCA 2KHCA 4ED1A 1XK8A 3VESA 3K0SA 2XYHB 3N4QA 2Y8YA 3A8IA 2F8TA 1MWYA 1WUAA 1TMMA 4OX9F 2PA8D 4PKHA 1F9EB 3H4DA 4BRQA 3OFGA 1CJVA 2W4PA 5A2QU 3GG1A 4ZJOA 1WACA 4ALZA 1HHTP 4OPAA 3K8WA 2I0XA 2HVIA 4FWLA 3QRRA 4CJKA 2ZH8A 3MCOA 1GX5A 1GT8A 4F4KA 1NDCA 1XNRF 3E2EA 4X64K 4P75A 1GOCA 1QJHA 2QLWA 2M5YA 2KM8C 4DV0F 4TU8A 3A8JA 2PN6A 2OZSA 3KLHB 2J9DA 3EVMA 1X4HA 1MROA 4WF9Q 5ETNA 3AA3A 1X3MA 4KQZA 2MJNA 1Z4UA 4QIFA 4IZ9A 2OA8A 3W61A 1IKWA 1NXIA 1JK9B 2BR0A 5JS1A 4KTWA 2RDDA 4Y1CA 1OY9A 5U47A 3KLVA 4PA1A 3N28A 2GBZA 3DLGA 2UZAA 5KFYA 4DLGA 3QERA 5KG6A 2OYQA 2AEMA 3BF3A 2K7JA 2L08A 4FNIA 4A8MP 3W2VA 4IH7A 3KLGB 4LF1A 1S0VA 1ICEB 4HUEA 3O5BA 2NPIA 2WSEC 4RNHA 1QSSA 2DHHA 4J5OA 3HULA 2CKWA 4PXEA 2LQ8A 3MPUB 5F1XA 4GC7A 2BOPA 1HNWK 3IG1A 2MZSA 3LF0A 2QWOA 5D4PA 3M6VA 3V6DA 2FVCA 3NBPA 3UIQA 2FJDB 2QWNA 1N6QB 3BQ1A 3QO9A 1WKLA 3S3NA 4KGZB 4KO0A 1TGOA 4BGBA 4FXVA 5B0DA 2KXFA 2F7TA 3C66A 4YFUA 2DPIA 2VWBA 1XR6A 3KDNA 3I6PA 4KHMA 1EIYB 1A9NB 3CC4S 2DEJA 3QNWB 4KBOA 1Q7YT 4M5MA 1WF2A 2FLNA 4ED2A 3SDEA 4HDGA 3WDOA 5GADI 3EXYA 3C6AA 4PL7A 4DU8A 1B3TA 2BANB 2NRXA 2P9KB 1YWXA 4YOWA 1L3SA 4TY8A 5KT5A 2OMOA 2Q3PA 3QDKA 1R8PA 1FJGF 4JKGA 2I7NA 3AA4A 1S6PB 4DV5K 3ONQA 1NPRA 3CMAN 1JIHA 2CZ9A 4DU1A 2RN2A 4CD1A 2J6SA 2OPPA 1ZBUA 3PW5A 4WXWA 5FRMA 3HSJA 2MQNA 2DNGA 3TUPA 3WQTA 4BR0A 3VERA 3DKDA 1V3RA 2AEFA 1HNZJ 2HS3A 1WI6A 3SIPB 2B43A 2N3LA 2XMVA 5AQZA 3DDIA 2MY7A 4C8ZA 4OZNA 5BXIA 4A8SA 1HL6A 5JMNA 1O0PA 2QTWA 3CDBA 3HK2A 2C2KB 2FQQB 5ELZA 2V8GA 1DURA 1RHJB 2QLFB 3GV7B 2ZD1A 3BUZB 5IT4A 2K06A 4KHRA 5K8PA 3L2UA 2FXUA 2DR6A 4ECTA 5HP1B 3IBFB 2N7YA 5HJYA 4BY9C 4XPCA 2EW9A 2O8FB 3H3NO 4FWNA 3N6LA 4JV5F 2BJ9A 4IQXA 5KG4A 3KNGA 3F0NA 3IO1A 3H98A 2V8HA 5A6WA 5A8RA 4L3QA 3VEOA 2BRLA 3ZT4A 2YNGB 5F3TA 4CEEA 3Q8PB 2BMBA 2AU0A 2AKWB 2FBTA 2RDIA 2MQMA 4USVA 4CFCA 5E84A 2YNIA 2JNJA 4URQU 3ENHA 3UCUP 3FE1A 3T41A 4IOXA 4CBUA 3BEXA 1FEHA 2ZM6J 4QW8A 4FLYA 2GVZA 3CG7A 2RKIB 2MKJA 5AQUA 2KVIA 1CVJA 3POTB 3ULEA 5HO4A 1FI4A 4NPOA 3DXMB 5IC4B 2GUPA 3SDEB 4JI8F 3P4IA 2W9BB 2VDIA 4FLUA 2KYZA 2XQCA 4W5TA 2PYLA 2E1CA 4IRKA 5ITHA 4YDUC 4WQ5C 1S6OA 3LGMA 3OS0A 4AL6A 1Q79A 3NG8A 2VJVA 3UQSA 1R0CB 1HKAA 5IT9Y 5FPNA 4DV2K 1VJQA 1X4CA 3MN5A 2QA2A 4YOXA 1T95A 1FXLA 1BI4B 1IKVA 5HMYA 4JI2J 3PDNA 4LR8A 3KLFA 3CCJN 1JLQA 1IVZA 1S6PA 5AQNA 3U7JA 3PY8A 2G8FA 3R9LA 3HF5A 4PPDA 1P8GA 1NPKA 3DAWA 5A8WB 3CCVN 5CZVA 3W66A 3E01A 3BGOP 1LCUA 1WSEA 4WK3A 1QQMA 4NCGA 4B3MK 3L09A 3VAKA 1YBUA 1VQ9S 2ILYA 6AT1B 2AYGA 1RI7A 4A8FA 3C2PA 4LFCJ 4ECVA 3HO1A 4G9ZA 1S77D 2ZZTA 3UO0A 2JLGA 2BXJA 4FO0A 2G8IA 3S3OA 3OXLA 1C1CA 2E4LA 3ISNC 2EFOA 4ETXA 3EZ5A 1RTIA 2EXUA 1KTVA 1JJ2R 1I3OB 3ZTOA 1HNXK 2VKZG 2J9DE 5FIIA 4B02A 4I4BA 5J2QB 4USTA 1CZAN 3ITHA 1NNEA 2CJAA 1W0HA 2DKOB 3BF1A 2ZHOA 5F9LA 3D0PA 1GLBG 2I7PA 1WSHA 2JEFA 5DM7Q 3R5AA 4LF4F 1YI2S 4JKAA 3LP2A 3HT0A 2P9GA 2VU5A 4U67Q 4CJUA 4A8KA 1EX4A 2O01C 4RU2A 4NWBA 1RWPB 4DTSA 3IWXA 1HRHA 2NSCA 3GZ7A 4ID8A 4EMDA 3O9RA 2GC8A 4ZP6A 2MKCA 1CZ9A 4UOCA 4JI4F 2HBJA 3JTNA 2BACA 2L3MA 2G9OA 3W63A 3T6BA 3VZIA 3F56A 1D5AA 2W9BA 5HVHA 2BJ3A 3P5TL 3PX6A 2MZTA 1ZAVA 3POTA 5DMRA 5MAOA 4LR9A 4HHJA 2ZUGA 3G9CA 4UUXA 1WF1A 4LF8F 2IDOA 3QGHA 2MZJA 1QZ6A 2ZQBA 5HL7Q 4Q8FA 3MFIA 5CD4H 1U8WA 1FFGB 4EU0A 1BD6A 1Q53A 4WTYA 1VSMA 1UW9A 1BL3A 4BRCA 1U2FA 1YX2A 1QY7A 3CD7A 3IWNC 5FPMA 5EXWA 3J7YP 5E26A 4LF8J 2CDRB 3PYEA 1M90O 4F4WA 2GQCA 2D9PA 4O3NA 4EZ6A 1NGEA 4DV6K 1IWAA 1SH3A 5B0BA 2IPOB 1QD1A 4X62F 5DZ6A 3AAWB 2IVNA 2LXFA 5BR9A 4W92B 2XS7A 3L6QA 3RGIA 3DLHA 4DG1B 2UXBJ 2XGPA 3FGUA 4GMJB 2HFOA 1M90T 2ZH9A 5IFMA 1YHQN 1WELA 3KDOA 3IA0A 3KK7A 5K20B 1U47A 2B9EA 3CCLS 3MPDA 4LIWA 2OTJS 2Y9HA 2MKYA 4WPAA 2VC0A 1FW6A 2WFBA 3NGZA 2DH8A 2G8WA 3I0SB 4LUBA 1GNKA 3ZZOA 3PIOQ 4YB1P 3FSIA 4X4UA 1HARA 2H5IB 1T3NA 4DL3A 1VSDA 3KUEA 4WFXA 1IWGA 3TA2A 2YKOA 4FYDA 3UD3P 1FESA 3RBEA 2BJEA 1RDDA 1JLGB 2R9LA 1UVIA 4KJIA 2XSJA 1NHKL 1LV5A 1S48A 2Q1LA 2WW8A 2E29A 5C2FA 4ILMA 5KRSA 2BQRA 4DL2A 4OI1A 4B1WB 4MTPA 4I6AA 4PY5A 4EHUA 3SQ1A 2GIRA 5CYQB 3GR0A 2IM2A 1CSJA 4DV5J 1HNWJ 4K4SA 3OT9A 1B4SA 1WSFA 2CUYA 3IR7B 4ZVGA 2GZOA 3HP9A 3PX0A 4KREA 3DYAA 1LEOA 5CHCB 1U2VB 4IR1A 2PC6A 4XEIA 1HNZK 3DLEA 4DTXA 1NNDA 3UD5A 2HK3A 4J9KA 4J2EA 3VGLA 1M0SA 3D2WA 4ED6A 4ZP7A 3FDSA 3V9XA 1DHMA 2DH7A 1RAIB 1K73O 3DLLL 4LF8K 3CJBA 1TK0A 1J53A 3EZUA 1BUPA 4NA1A 1XUPO 3LTOA 2FHOB 2XO7A 1JNRB 2VGMA 1T94A 4IR9A 2X78A 4YOVA 3MAAA 4USWA 5DM6Q 1AFIA 4IDKA 2QEXN 2DFHA 4I68A 4CLUA 2U2FA 1VBZA 3LGHA 3L4QA 4QCLA 4DQIA 5I3QA 1R7IA 3CB4A 1I5OB 2QL5B 4L75A 2R8IA 1SQKA 1O13A 1VQSA 2XCPA 1N34K 4EYIB 3OR2A 3TX0A 4KI6A 1EETB 2G8VA 1NGDA 1X5SA 4DR3K 4C8MA 3IGVA 1HI0P 4M5KA 1RFQA 5A2QY 3VTHA 4FSVA 2CZ4A 4M5JA 2CJBA 2E66A 3DRXA 3HDSA 4W5QA 2X3GA 1HNVA 1R27B 4O0IA 4CHNA 2DYAA 4ZITA 4OPKA 3ZEUB 2QE5A 1CZBA 3PCOB 1ELOA 4TVAB 1M1HA 3AXKA 4PXDA 1ASVA 2OAUA 2GMJA 1JCGA 3CCUN 1T9YA 2AJ4A 2HKEA 1JXVA 4IWVA 4OZ1A 3A2FA 3GFXA 3TJAA 2B3TB 2YX4A 4LBIA 5KFWA 4DV7F 3MEDB 4KHWA 3PZPA 2D0BA 4B3MF 3TTFA 3QO9B 4KYZA 1IO2A 2UP1A 2C2ZB 2V2QA 4WP3A 2RNEA 1Z2ZA 4DCJB 4YHHF 5KFEA 2QZ8A 1U0HB 2YTCA 4FL9A 4IH6A 2IBOA 1VQNN 4BLGA 1QDUB 3VVTA 1REVA 1DGKN 2NREA 2FJVA 3UCGA 1FX4A 1RT6B 5D0GA 1K9MT 4E89A 1NLVA 4ED3A 2QWMA 4DBQA 1DY3A 3CYMA 3NNHA 3TVYA 3D6RA 3MWPA 2V0NA 2LKZA 1FNMA 1UJ6A 5DG9A 1RCHA 3SQ4A 8AT1B 3M9MB 2JLFA 4LF4J 2GTDA 3V1RA 4TU7A 1RT1A 3CJ4A 2UUTA 2UUCF 3NCQA 5L38A 3M3ZA 1SUQA 4IYQA 1IQTA 3GQCA 3I8BA 3Q2SC 4UOHA 2IBKA 3N01A 2RD5C 4MKYA 1VSHA 3VF6A 2GHVC 3OTOK 2IIRA 2FVQA 2XNQA 5KFAA 1BC6A 5GAGI 3CJ0A 3CQXA 1NM1A 2F1FA 3V9SA 3SPZA 4M3RA 1RWVB 4CEQA 3HJVA 3RAQA 2VQFF 2KT5A 4FZVA 2F96A 5JMVA 3ZSWA 2IJNA 3ZZTA 1JLEB 3R3LA 4CE9A 2HBKA 3FZLA 2E88A 4KT0C 3M2VB 2FVPA 3HPGA 3MM7A 1NRKA 2WAQD 2VBWA 3SAGA 1KVCA 3MM9B 1U24A 3AO3A 4AL5A 5LMNJ 2CDQA 1DTTA 2RF2B 1IBKJ 4MK9A 3W9HA 2DB1A 3BS9A 2IRYA 1HWJA 3M6WA 4KHPJ 4B8CA 4NMXA 4F4AA 3JSMA 7FD1A 1YK9A 4A62A 1TV6B 2JRSA 1UWBA 3TABA 5J2MA 4JKGB 2ZHAA 3ETOA 3T5HA 3NWRA 4RBTA 4OX7A 4P52A 3BDEA 2AJ2A 2A6OA 4DPUA 2OEKA 4HLBA 5E5NA 2LQJA 4BC4A 4X66J 1HHQA 4WFNL 1U26A 2W25A 2P51A 4O55A 2UXBK 4YOYA 1Q8BA 4BWMA 2OSQA 4CTAB 3DDNA 5T7LA 4F3OA 3C6UA 4O3SA 2B6AB 5GADU 2M4MA 1G1XA 1UTAA 4QZVB 3PJWA 1AW0A 3GYXB 4Y6IA 4GNIA 1VR6A 3BR8A 1NJWA 5G0RA 4ERDA 2G0IA 4QW9A 4MDAA 2EHGA 3M30A 3BSAA 3FBFA 5ETQA 4X4NA 2OD6A 1KVBA 3LL3A 2MGZB 1NUEA 3B8AX 2EBEA 4ER8A 1SB6A 3H1QA 1YKWA 2ZE2B 1V6HA 3FFIA 4CESA 4BDYA 2DXEA 2PE8A 3NGUA 5JVHL 1S12A 2QN6B 5CXTA 4ILRA 1PILA 1UZHA 2KLAA 4DV2F 2V6AA 3RYLA 1GAOA 2O8EB 3KMQA 3O1LA 2Q2RA 1KAXA 3D2FA 2C28A 3OHAA 1EO1A 2D4WA 4YQWA 3T9NA 3J7ZT 1XEZA 4MJKA 5DJBA 4C3KA 1T7PA 1OKJA 4K59A 2G8HA 4AH9A 2P9IA 4JI8K 4FK4A 4UZCA 4CEDA 3UN5A 2OHDA 5CAAA 2JLEA 5A8KB 5HAOA 4PWDB 3G71S 4A5BA 1CS4B 2NRHA 4E19A 1TK8A 4R25A 3EGNA 4F26A 3GIKA 3W0LA 4GKKK 4AL7A 1R6VA 1K73T 3P45B 3ENQA 4WU3A 2GW8A 3MUMP 2CQIA 4UOGA 3I0RB 3HSCA 4FYXB 3J8AA 3JTPA 2Y3YA 1WORA 2RKIA 1GLEG 4DR6J 4M7YA 4TQRA 4M3XA 4X64F 4L72B 3ZZ0A 1SAZA 1QTNB 4CF1A 3AXMA 3EICA 5GAGU 3NKYA 3N4WA 1FKOA 1N5YA 3QLHA 2YX6A 3J7A1 3RUBL 4RCHA 2KM8B 3J81U 3AY9A 3SPYA 4C8LA 1S9GA 4P7VA 2O8CA 2PY5A 2V5HG 3MI7X 3OSPA 1FDBA 4UQTA 3SEOA 2GJ2A 3QFPA 3H45C 4HI1A 5DQGA 3E8OA 3KJNB 3ZSVA 4IEEA 5GINA 3AVBA 1KKHA 2AGPA 1LK5A 5KG5A 4ID5A 1VSJA 1VBXA 4NXMJ 3CC2N 2XZDB 4AXJA 2VD3A 3MEEB 2UXDF 4AQYK 3LQVA 3C65A 1RTJA 4NYNA 2V4QA 1IM6A 1WD6A 4JKCA 3DI6A 4ZLNA 1B64A 5H9FJ 1HWIA 1W26A 4BRPA 4GV6A 2FHKA 2AZ1A 1MDUB 3OYDA 1FCAA 1V3ZA 5KT3A 3U6FA 4HVJA 4EIAA 1WSRA 5DG7A 2BQUA 2O8BB 1EKSA 4OPHA 5F0WA 5D4OA 3TSPA 5GAEU 2GFFA 3QIPA 2D0AA 1XWLA 1FX2A 3G82A 2EC0A 3EDQB 3GLJA 5I42B 1RDAA 2BX6A 2WCXA 4X4PA 4O3PA 2YY3A 1S97A 1RWOB 1D09B 5ETPA 2KFZA 4TU9A 3MD3A 2WB4A 4H54A 4JV0A 2B9WA 2GIQA 1S7IA 3F73A 3O44A 5B0CA 5BPLA 1LWEA 2G8KA 3VAGA 5KFIA 1RNHA 3OQ2A 4OX8A 1LQ9A 1LWFB 2YHAA 5HBMB 1AUSL 2KHOA 1BLUA 3KK2B 1PC4A 1TUWA 4WIQA 2QV6A 1WG5A 3BPDA 3LM2A 4EUVA 3PACA 4Y2IA 4ZPBA 1LW0B 5AQPA 1VQYA 4K25A 3SSSA 5M2PA 3MOZA 2CQBA 3QETA 3NRBA 5AXKA 3QIOA 1TAUA 3GV8B 2ACYA 3L7UA 3ILLA 1S0OA 4Z4FA 3RRKA 2C22A 4WKYA 5T7LB 3M8QB 4JYAK 5M1KA 3GTYX 1C1BA 3OTEA 3JYTA 1FO1A 4K42A 4BACA 1Y5IB 3HI0A 4RZRA 4IJAA 4DTMA 2KN4A 4MIWA 4C11B 5LMNF 2HHHF 4W5NA 2NR0A 2I5JA 3VGMA 4J9MA 1O6XA 2FVRA 1TYQA 5RUBA 3FMWA 4TY9A 5KFQA 2M52A 4J9VA 2UVWA 2QMWA 3CCRS 4RJVA 1M1GA 3KWIA 3D0HE 2QWPA 3V1QA 4OYZA 2J7UA 1HR0F 4YB7A 2GELA 3PM9A 2C2NA 4TYAA 3SYZA 1FRIA 1S72S 5LMUK 3RWUA 4EEYA 4NCAA 4JLHA 3R2DJ 1IBLK 1MROB 4K0KK 3IS9A 4ED0A 1BXNA 3WNEA 1IV0A 4GV9A 1XR7A 4FBTA 3D2EA 1FF2A 1OMSA 1VQKN 2COLA 3I32A 1QHTA 2XO6A 3AAQA 5AT1B 4CIGA 4OYOA 2HQIA 2DISA 4KH5A 3HVAA 3TAGA 4D3GA 2XB2D 2ALYB 3K9JA 5IXUA 4JI5F 3F9KA 5ETRA 1T0TV 3RB3A 3MECB 3AD8C 4J2BA 3DGPB 3OFHA 1UJ4A 1BUXA 3DOLA 1JXBA 1JLCB 2DR9A 4CBWA 1B0PA 1N52B 2E9TA 3H2LA 3RBDA 3M8QA 2PMWA 4KB7A 2X7IA 2OPSA 2AP1A 4LVNP 3AH6A 1H7XA 1VFJA 4BR5A 1YITS 5AJ3K 1AZSA 2Q66A 3LP1A 2QXFA 1RLCL 4LRFA 2XHWA 1KQFB 1SJRA 2LP4A 3SQOP 4DSLA 5HJXA 3ZSXA 2FJAB 5A0YA 4A57A 2NCKL 2QW9A 2CQCA 4B08A 2O5DA 3W5YA 3VVUA 2B7BB 1BQMB 1L5UA 3EZOA 2VG7A 3V5RA 3PIPL 1IBCB 2M7SA 2VV5A 1NJIO 5DLGA 1S4FA 1LOTB 2CJKA 1ZA2B 2ATCB 1XQIA 1CG2A 3K5LA 2E9ZA 4FPAA 2Z1GA 3MEEA 3ULHA 2QYCA 3QGPA 3LH2S 1MG7A 2QLJB 2E1ZA 1EWRA 2HF4A 1FRKA 2UVVA 4X4TA 4Q0BB 2MQ8A 4U8VA 3I55N 1FRHA 3NS7B 2CIMA 3QFUA 5E3QA 3I56S 4DV2J 3QAUA 5C24B 4NX9A 2DNLA 4GMKA 2CYYA 5KTQA 4O44B 3NGTA 4G3IA 4ZCKA 2DK2A 4YR2A 3VR1A 4Y0WA 5B0GA 2WBNA 1JLAA 3LDSA 3J7ZO 3LOUA 3PV8A 3BZCA 1TK5A 1XQSC 2H5JB 1OYEA 1A5VA 4Q2LA 3KIOA 1ZAXA 5GIOA 2E6LA 3QBWA 2VPYB 5B0FA 3A0IX 4A8XA 3WC2A 1X0FA 3HSZA 3E51A 3A12A 3RSEA 4CJLA 4DUZK 2AX0A 3FCWA 1WB9A 4HL9A 2R7WA 1FWLA 2VQFK 4JK7A 1YJ9N 2QA4S 1HMVA 4FNHA 1FKPA 4GKKJ 3KLIA 1VQ6S 3HBTA 3CC4N 2BDPA 2I9SA 4ED8A 5LJWA 5BR8K 1IJJA 3I31A 3OL9A 5DK5A 3MZIA 4CF0A 3DXSX 3QEIA 3A5NC 2OPSB 3NAIA 1RGVA 2P9CA 2NUBA 3KUHA 4ZIVA 4KB1A 2IGIA 4YR0A 4KPYA 1RTDB 3FGVA 4JI0J 4NLSA 2GAGC 2FF3B 4I67A 3LPYA 4FWSA 2IRUA 3R8EA 3EO3A 3EE3A 3V81B 5M1FA 4Q2MA 3NH0A 3CIPA 1ZM2A 3HHNB 2IHR1 3QYYA 2OZMA 2A1SA 4JD2A 4LSNA 1LWEB 5HI7A 3AQOA 4V19S 1VC5A 4F04B 3VQ9A 2UXDJ 1YJUA 1UWBB 2VH7A 5EU7A 1P9QC 1VLYA 1RTHB 5GAEP 3QBXA 2BBEA 2UU9J 4O8KA 1LFPA 1O8BA 5BR8F 1BIUA