3NBPA

Hiv-1 reverse transcriptase with aminopyrimidine inhibitor 2
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
557
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Transferase
total genus 155
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3nbpA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nbpA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nbpA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nbpA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nbpA05
4KO0B 5DGAA 2PYLA 4I2QA 4NLSA 2IC3A 1NJYA 1HYSB 3MR6A 5FRMA 1ZETA 4YR0A 3D0PA 4J2AA 3O4QA 1QSYA 4URGA 4AH9A 3KLGB 1NNDA 5J2MB 3LDSA 2VWJA 5KFWA 4DLGA 3E01B 4FLWA 4FJNA 1XI1A 4NYZA 5KFXA 3LANA 1CZ9A 3AA2A 1S1UB 2WCXA 4NYNA 2OPQB 4IDKB 1FKPA 1TKTB 1JLGA 3ISNC 3RB0A 3BGRB 2WTFA 1IM4A 1BQMB 5CYMA 3N6NA 3H2LA 1NKBA 1S1VB 4KAZA 5KG3A 1U45A 4BWMA 4IH5A 4E7KA 4IH7A 1ZTTA 3K5LA 4DFMA 4KHYA 4OVLA 5HRNA 3QLHA 2VG5B 3LALA 2YKNA 4CIGA 1RT1A 3IGNA 3V9ZA 5I42B 1VSMA 2E6MA 2W7PA 2VG6A 4QWBA 3RB3A 3V9XA 1J5OB 3KOAA 4FZXC 3I0SA 4I7FA 1IKVA 4QW9A 3MR3A 1C1CA 4Z4GA 4FM0A 4XPEA 3FDSA 2FC0A 2XRIA 1RT2B 3C6UA 2BRLA 4ECTA 3L2WA 5DQIA 2D0CA 3NGIA 1TK0A 3PX4A 5KFOA 1KRPA 4F3OA 3SUQA 4DTUA 2WOMA 5D3GA 3M9NB 3UDLA 4J9LA 1S97A 5KFHA 3ZT1A 5KFZA 4LQ3A 4Y3CA 4WYLA 1S0MA 4KV8A 4F4WA 4PQUA 3TAFA 1RTHA 5J2PA 4R5PA 4IG3A 2FVSA 1SL2A 2ATLA 2XI3A 1G15A 4DSEA 1JLQB 1HPZA 4FS2A 4EP5A 2W8KA 5JS1A 4O3SA 2IMWP 4O0JA 4NLTA 4MQ3A 1EETB 2BE2A 4G3IA 2IS3A 2AU0A 2X74A 3HKWA 2P5OA 4M45A 2HWIA 4DTXA 4TXSA 3LP2B 4IFYA 3NE6A 5C25B 3DRPB 3PR5B 3KHHA 4CGFA 4CHYA 2G8HA 4WFYA 5I3UA 1R0AB 1L3SA 3HVAA 4H4MA 3IN5A 3OY9A 4J9RA 2RKIB 3AVIA 2ASDA 4WYWA 2E4LA 1C0UB 2VG7B 3AVNA 3V1QA 4CESA 5DG9A 3UR0A 4B9MA 4FK4A 1RTJA 4YR2A 5JXSA 3DRSA 5KG4A 1JXBA 4RW6B 3ZSXA 4ZP7A 2VA3A 1XHXA 1T03B 1DTTA 1VK0A 4KTWA 1SV5A 4O3RA 4LSLA 2ZD1A 3V1OA 1JL1A 3QEXA 4TYBA 3OS0A 1N56A 1KVCA 3CDEA 4I2QB 2IC3B 3OYMA 1N5YA 3CFOA 3BDPA 3NDKA 3PHEA 3RMBA 2RF2B 1S5JA 2G8UA 1CXQA 4F4YA 4ECRA 4M3RA 4DQQA 4CK3A 1SKSA 3L3UA 1C6VA 4HUGA 3JYTA 4TLRA 2NUBA 4KHUA 4URQU 3BSCA 3OYGA 4R8UB 2HNDB 3DOLA 3HPHA 1RT6B 4TQSA 1RDAA 1KFDA 4O3PA 5C5JA 5KFDA 3MEGB 3TQ1A 4ECVA 4ZPCA 3CYMA 1JLGB 3GV5B 1J54A 4MFBB 3HHKA 4KHSA 5CYMB 1ZBLA 4N5SA 3CJ4A 2DFFA 1XR5A 3LP3A 1NOYA 2Z1HA 3FFIA 4FS1A 4FVMA 3QLHB 2XWYA 2YKNB 1X9SA 4F4KA 4FLTA 5L9XA 4ZP9A 1CZBA 5KI6A 4DTNA 3NBPA 2VG6B 4ZTFA 3QGIA 3ISND 5KFIA 4PWDA 1HNIA 3I0SB 3AVAA 1IKVB 1L3UA 2W9CB 3AO1A 3L2VA 1C1CB 3HL8A 4PUOA 1GOBA 4DQIA 1WSEA 3ASMA 3L3VA 1JLCB 4E7JA 3V81A 1YVFA 5J1EA 4C8LA 1VRTA 4DL7A 1CXUA 1SUQB 3CM6A 3ZT2A 4FYDA 4CGDA 1S1TA 3I0RA 2WOMB 4M3ZA 1TVRA 5D3GB 1RDRA 5FRNA 3LWMA 2GBZA 4CJUA 2BANA 4FM2A 3RRGA 4W5RA 1WN7A 3WNEA 2XI2A 3RMDA 5KG1A 3HVRA 3MXMA 1JLFB 4JV1A 1ZYQA 1QHTA 4KV8B 4PQUB 4CF0A 2JEJA 1RTHB 5J2PB 4R5PB 3U3GA 2D41A 2UVUA 4M3YA 3SPZA 3MEEA 4KI4A 3GIIA 1HPZB 1KLNA 5L1IA 2YNHA 3TAQA 4NLWA 1B9FA 2BE2B 3SFUA 3HPGA 2C2EA 4B8AB 4EP4A 1BCMA 3SPYA 2A1RA 4OL8A 4IFYB 3O3HA 3CIZA 1J53A 3K57A 1C0TA 2F8EX 4H4MB 2BDPA 2BRKA 2OPPA 2EC0A 4DF8A 4M41A 1TV6A 2YV0X 5KFTA 4ED7A 1T05A 2AGPA 2A1SA 4DQSA 3SQ1A 3VQ4A 3IRXB 4CJPA 4RNMA 1SKWA 3OL7A 4CHZA 4FJHA 4DSIA 3RRHA 4DLEA 3VA0A 4ED0A 3SI8A 2FJWA 4ZPDA 2DY4A 5HLFA 2IM3A 5KFEA 2BQ3A 1TK5A 2UVVA 4LSLB 3NMAA 1TL3B 5KT7A 3OYCA 3SUOA 1X9MA 2PZSA 4ED3A 4ECYA 1S1XA 3AVKA 1TKZA 4W5NA 1TP7A 1KTQA 1S9GA 1RTDB 3MR5A 1RYSA 4RG8A 4DG1B 3OYNA 4ZP6A 3IS9A 5C24B 2WK4A 2YHAA 4O44A 3RTVA 4DS4A 4CJ4A 3NF9A 1S6PA 3JYTB 1REVB 3KK3B 1OS5A 4DMNA 4QWDA 3DOLB 5FDLA 4O3OA 2IJFA 2BR0A 1HYVA 3MEDA 3MXJA 4OPJA 3KNAA 4MK7A 1DTQA 2HMIA 2CJQA 1C2PA 3HP6A 4WZQA 2B4JA 5KG5A 2HB5A 5T7BA 4EEYA 1TKDA 2I5JA 1RNHA 1RA7A 4DSLA 4ZMMA 4J2DA 1BHLA 1C1AA 4HCCA 4WE1A 4FBUA 4ED6A 3M8QA 3OVNA 4PWDB 3P83D 3VQEA 3M9OB 5KT4A 4PUOB 5KFAA 4CJEA 3QNNA 4NRTA 2Z1JA 3T5LA 3TR8A 2C2RA 3LP0B 2CKWA 1U09A 4TY8B 4KHWA 5J1EB 1VRTB 3BQ0A 3OLAA 4CFAA 3DLEB 4B08A 5KFPA 3O3FA 3PW2A 3AVGA 1TVRB 4F4ZA 2BANB 2D0BA 3CO9A 5F8NA 5KG6A 2PYJA 3KLIB 4KREA 3N6MA 2QKKA 2W9AA 1NHUA 5K14A 1RBRA 4KFBA 4RW4A 3KLEA 3SFGA 1BCOA 4CGIA 4N41A 1CLQA 3S3MA 4QCLA 2X78A 2YNHB 2FLNA 4K8XA 4M3WA 4DQPA 2XGPA 2D3ZA 4TSXA 5KT2A 2B43A 4AHUA 4URSA 5KG0A 4DL2A 5DG8A 3H5SA 3HVTA 3GIKA 4J9KA 1K1QA 2FBYA 4NYFA 5KGXA 1WSFA 3RR7A 4NLUA 4E0DA 4C8KA 3KHGA 3U6FA 4ZHRA 3SQ4A 4E3SA 4Q0BB 4NCBA 4ICLB 1TV6B 5CYQA 4Q8FA 4AHVA 2W42A 4FXDA 1T05B 3KHLA 3T19A 2DFHA 4O5BA 5HROA 2W9BA 3LZJA 4KI6A 3GV7B 3FSIA 2DTUA 1ZBIA 1RBUA 2FBXA 3SV4A 3I8DA 3DOKA 4Z4HA 3SI6A 2GC8A 4DTMA 5EWGA 5HLFB 3TWHA 1S4FA 3EY1A 4DTRA 4BDZA 3KMQA 5CZ2A 1C0MA 2YKMA 2KFNA 3DI6A 2WONA 3MFIA 2R2RA 4HHTA 3M8SA 5KFNA 4Z4FA 1S1XB 1TKZB 3NH2A 2AQ4A 3EZ5A 4LSNA 3H98A 1EP4A 2OYQA 1UWBA 4Z0UA 1RTIA 3ZSOA 3IS9B 4K4TA 4O44B 1S6PB 1W25A 5DK5A 3VQBA 4OPKA 3QO9A 2AWZA 1VSDA 4CJVA 5CZ1A 4CIEA 4ECXA 3KLFA 1JLEA 4F8RA 1LW2B 4ELUA 3CM5A 3HO1A 4LD0A 2KQ2A 3TAGA 3DLRA 3MEDB 4ED8A 3VQAA 3DMJA 2KTQA 2BQRA 2G8KA 1QAIA 3ZSRA 4Q44A 4E1MA 3QESA 4FZYA 4CEZA 4DU3A 1HMVA 1BI4A 4O4GB 4ID5B 4IRKA 2I5JB 1FKOA 1UA0A 1T7PA 4ZVGA 1LW0B 2J6SA 2G8IA 4CJLA 4IKAA 4B3OA 1S48A 1VRUA 3Q8PB 1Q9YA 1JLBA 4DL6A 3HJFA 1LWEA 2QE5A 4KSEB 2OPSA 3OYIA 2JEGA 4ZPAA 2EHGA 3OYKA 3D45A 1BGXT 3OYJA 4ZVFA 3PR4A 3H08A 2JC1A 3AA5X 2ZQBA 4OGCA 5KT3A 3HM9A 3ZT0A 2GIQA 1RILA 4E1NA 1EKEA 4CEFA 3A2FA 3BSNA 3K58A 3QZ8A 1XWLA 2HHWA 4DL3A 3DDKA 4W5TA 2XY8A 4B9LA 3QEWA 3KLEB 4N76A 5F9NA 4K4XA 4EZ9A 4KHQA 1VSIA 2YNIA 4CE9A 4CECA 3T5JA 3OYBA 3JSMA 4M94A 3TAPA 4B9VA 4J2BA 3HVTB 4YP3A 5KFKA 4IRCA 1W9HA 1T94A 4ZHRB 4HUEA 5E41A 2YNGA 3QZ7A 3AVLA 5CYQB 5HP1A 4BWJA 3PX0A 1UOCA 2R8GA 3VQSA 1NKEA 1U49A 5KTQA 1IH7A 2W9BB 1F21A 2VA2A 4FK0A 1VSKA 5KT5A 2DPIA 1T3NA 3DOKB 4EO6A 4EYHB 2G8VA 1KVAA 1FK9B 3BQ1A 2ZE2B 4QAGA 3NFAA 2YNFA 3HXMA 5JUMA 4F3TA 1NJWA 2HNYB 5SZTA 4J2EA 3DI6B 4B9UA 1KCFA 5KG2A 3NGYA 3VQ5A 4CJTA 3VN5A 3GILA 4W5QA 4CJ5A 3NGZA 5KRSA 3DLKB 3V4IA 3Q8SB 3T5HA 4R0EA 3MAQA 4FLVA 2XY7A 1QTMA 3CDWA 4ECWA 1XHZA 2ASLA 3OYDA 3PJWA 5DGBA 1HQUA 4C8OA 4FJXA 2X6SA 5F8MA 5JS2A 3VQ8A 2ZKUA 3KLFB 2IM2A 1ZBFA 4CF1A 3WNGA 3SUPA 4FLUA 3S3NA 2ATQA 1L3VA 4LH5A 4CEOA 4RW8B 3ZT4A 2B6AA 4YFUA 1XR6A 4WXOA 5KFJA 2IA6A 1HYZA 3DM2A 1I6JA 4FW1A 2OPRA 2V4QA 4NLXA 4B9TA 2QV6A 2FLPA 1HMVB 3EPGA 5J2QA 4PA1A 4YQWA 1UAXA 1GOAA 3BSOA 4MKAA 4KAIA 4U7CA 4CFDA 1ZTWA 4RW9A 1XR7A 4GVMA 1TL1A 4ECZA 1RDCA 4OKJA 4N56A 1MU2A 4EBCA 4B3OB 2F8SA 4IG0A 1JLBB 1Z25A 1LWEB 2OZSA 4I9QA 2OPSB 1YTAA 4WFZA 3SNNA 3RAQA 1NK6A 3MFHA 1FKPB 2IM1A 4CJ3A 4U6PA 2RDIA 1WNSA 3PO5A 1FXXA 4FJ8A 3L8BA 4F2SA 5HBMA 2XGQA 1Y97A 3H5UA 3BR9A 3CWJA 4NLQA 4JRPA 2RPIA 1D9DA 5SWMA 1RT1B 3AO3A 3DLBA 3NHGA 3QGHA 4BACA 5KFUA 4Y34A 1RA6A 2YNIB 4FM1A 4I7FB 3OSPA 2JLEA 2ILYA 1KVBA 2WB4A 4EO8A 3OS2A 3SZ2A 2C22A 4UQGA 3G6VA 4K4UA 1D1UA 4Z4IA 1UA1A 3C6UB 1N48A 1Q9XA 3ZT3A 2QKBA 4LH4A 3ZSQA 3M9MB 3OLBA 5DQGA 3QIDA 4E7LA 1S0NA 2IJNA 3VQ9A 2DFEA 3P1GA 3AVJA 2AX0A 4IG3B 4TY9A 3T3FA 2ILZA 3NAHA 4NLRA 4ECQA 2FVCA 4QWEA 2HVHA 4NRUA 2XC9A 3MECA 2YNFB 4CK2A 3H4DA 3OYLA 4NLDA 3OYAA 2FJXA 1YTUA 5KFBA 2GUIA 2E9TA 3QIPA 3HP9A 1NK4A 5EWEA 5I3UB 4CHPA 4XO0A 4E7IA 3PV8A 3H40A 4KKOA 5KFYA 2W7OA 4FK2A 1D9FA 1WLJA 3V6JA 2HHVA 4CJWA 1RTJB 3UQSA 4J9QA 1HQUB 3DRSB 3G6XA 2AGOA 3PW0A 4IRDA 4AILC 1RDBA 1LWCA 2B5JA 3KJVA 4O55A 4TN2A 2FVPA 4CHOA 3AVHA 4N47A 1DTTB 1BQNA 1SV5B 4DU1A 2B6AB 2ZD1B 1S1WA 4OKKA 3DM2B 4Q45A 4F50A 3SUNA 1NK8A 2KZMA 4G1QA 2EX3A 2X6NA 1RYRA 4NLGA 4C8NA 4RUCA 4FJIA 1N5YB 1RAJA 1LWFA 5KRTA 3SCXA 1HNVA 4RW9B 3AVBA 1J9AA 4QPXA 2OH2A 1MU2B 3KIOA 4IG0B 4CGGA 4O4RA 1S6QA 5KFCA 3TAMA 4XIUA 4CEEA 3CJ5A 3PVXA 1ZBHA 2D0AA 1IKWA 4KB0A 3V1RA 4GC6A 4K4ZA 4CK1A 1WAJA 4IQXA 5DQHA 4Y2AA 1NKCA 4KHRA 1RT7A 3FFIB 1N6QA 2XHBA 1HQEA 4H54A 4OGEA 5F8LA 1TQLA 1DLOA 4MK9A 2R8HA 2E6LA 3VQDA 2KW4A 5L1LA 4LQ9A 3LAKA 5T14A 4M95A 3NBPB 4QWAA 4DFJA 4M3TA 1SH2A 4ID1A 4M3XA 4DU4A 3PX6A 3L2UA 1HNIB 4JV0A 1RCHA 4KO0A 4EZ6A 4KE5A 3O4NA 1I39A 1TGOA 3HYFA 3V81B 4M3UA 3KMSA 3O3GA 2WHOA 3QEPA 1RBVA 3KKRA 4FJJA 1S1TB 3I0RB 3E01A 3IG1A 3V9SA 1NK0A 4FCYA 1NJXA 3LAMA 3RWUA 1JLAA 2OPQA 3EZUA 4K50A 2XY5A 4PY5A 2E9RX 1Z26A 1BL3A 1RDDA 3MEEB 3V6HA 2DPJA 3RMAA 4Y2CA 3NH0A 3MECB 3BSAA 3C95A 3VQQA 4HKQA 4CGHA 4KBIA 3V6KA 3F9KA 1D8YA 1B92A 4DWIA 3AO5A 2VG5A 4Y1DA 1KHVA 3C94A 3D28A 3QIPB 3NKYA 1JKHA 1ASVA 3GV8B 3B6PA 4OLBA 1C0TB 4Q43A 3K5MA 2J6UA 4DSFA 2OPPB 3QERA 3OL9A 3TAEA 4AHSA 4YMEA 3UPFA 5F8JA 1RT4A 5KT6A 2JEFA 4BE1A 1RT2A 1RT3A 4K4YA 4HTUA 4FJMA 4CJFA 4J9NA 4Q5VA 3AA3A 3QNOA 2B5JB 3OJUA 3CG7A 4E89A 3KTQA 4I9LA 2Y1IA 4X2BA 2O4IA 3SJJA 1BQNB 2GIRA 3OYFA 3ZSVA 4CHQA 2V4RA 3E51A 3OSNA 4G1QB 5KFMA 3IAYA 3Q8QB 3HVWA 2BGGA 1JLQA 1S9GB 1RBTA 3BJYA 1WSIA 2F96A 1HNVB 2XO7A 3I5CA 3LP2A 3DRPA 4NLOA 1TK8A 2JEIA 4K8ZA 2RKIA 1D5AA 4Z4EA 3N6LA 1L5UA 3TAMB 3RBDA 5FDLB 4ZPBA 2KZZA 3Q8RB 1C0UA 1D0EA 4J9PA 1VSFA 3V6DA 2OA8A 4CF2A 1U04A 4K4VA 1S9FA 3GQCA 1DTQB 2HMIB 4JS4A 3HT3A 2LSNA 4RW6A 3P5JA 3LZIA 3S3OA 1N6QB 1SL1A 1HQEB 4H4OA 4LY7A 4WE1B 3DLHA 4B8CA 2IGIA 1BISA 3VQCA 3NGDA 4ELTA 4DEZA 3M8QB 4YR3A 4CIFA 2JC0A 2ASJA 3RBEA 3G0ZA 5KFVA 4OJRA 4MKBA 1K6YA 5L1KA 1JXEA 4QW8A 4KRFA 1VSEA 3K59A 3KK2A 3SQ2A 3M8PA 5KFLA 2RF2A 4BDPA 4RZRA 3IG1B 2UUWA 1ASWA 1NJZA 2R2UA 3OJSA 3AA4A 2ITGA 3F73A 3RR8A 4DTOA 4R8UA 4EBDA 1VSHA 5K14B 2HNDA 1JLAB 1RT6A 4KFBB 4FW2A 3MEGA 4RW4B 4CFCA 3IGVA 2BQUA 4IH6A 4MFBA 4GMJB 1EXQA 4L8RB 1X9WA 2FBVA 3ZSWA 3NF8A 2Z1IA 1LAVA 5HRSA 1IKXA 4ZVEA 5DG7A 1VSLA 2FLLA 2D3UA 4CGJA 3NAEA 4FJLA 2FVQA 3L2QA 1IO2A 4Y1CA 2IDOA 2R8KA 1JKHB 4WFXA 2HHSA 1HJRA 1BIUA 1JL2A 4JUZA 1TKXA 3THVA 3UIQA 2IM0A 2W9CA 4CEQA 4F4XA 3H5YA 4DSJA 3DYAA 2J6TA 5HROB 1RT4B 4TYAA 1JLCA 3GIMA 1RT3B 4WXWA 5CY4A 3WNFA 4FJKA 4ECUA 1SUQA 3CJ0A 1RT5A 3B6OA 4KTZA 2QK9A 5DMRA 1KLMA 4NLPA 1HRHA 4I2PA 4F2RA 2HVIA 3EPIA 2JGUA 1GX6A 1QQCA 1JLFA 4ZVHA 3TARA 2YKMB 5F9LA 2WONB 4QWCA 4JS5A 2XCPA 3H5XA 3KLHA 3KD1E 4LSNB 3PZPA 2WRMA 4O3NA 3NAIA 1EP4B 3AO2A 4J9MA 4IKFA 4QOZB 4RW7A 3HPOA 2R8JA 1UWBB 1RTIB 3CJ3A 3OS1A 5C42A 4J9OA 1GX5A 5EU7A 2HW3A 4M42A 4EYIB 1A5XA 3QO9B 2OZMA 2QXFA 4FZZA 4MH8A 1JLEB 3KK1A 1U4BA 3V6DB 1VSJA 1BIZA 4DS5A 3PW4A 3VQ6A 5EWFA 3IRXA 1QSLA 3DMJB 1WNEA 3PJXA 4Z4CA 4JV2A 3CFPA 1YT3A 4GW6A 2ALZA 4KPYA 1BI4B 2YHBA 4H4OB 1FKOB 1SKRA 2HHQA 2PY5A 1TL3A 4E19A 1S10A 1KSPA 1VRUB 3C6TA 4ED1A 1RTDA 3QIOA 4DFKA 5KGWA 4BDYA 3KK2B 1QE1A 3M8PB 2Z1GA 4C8MA 2AGQA 4NZ0A 4DG1A 2AJQA 3DRRA 4IOBA 4AHRA 3V9WA 5C24A 5F8HA 4CCHA 5KFSA 3KKSA 1REVA 3KK3A 4E7HA 3ALYA 1JX4A 4IR1A 4J9SA 3ZSZA 4O0IA 3ITHA 3L2RA 2G8WA 4CHNA 2XY6A 3MXIA 3LP1A 4CEAA 1IKXB 3AVFA 5J2NA 5FROA 3QEVA 3JSMB 3T5KA 4BE2A 1TAUA 2C2DA 4FBTA 4OLAA 4ED2A 1ZBUA 2RN2A 4HYKA 3WNHA 2YNGB 1TKXB 5HP1B 1L3TA 3FRZA 3H59A 3FQLA 4NLVA 3CJ2A 3BQ2A 3DYAB 3FQKA 4RNNA 2O5DA 4WZMA 3LP0A 4TY8A 2UUTA 4NCGA 3DLEA 5KG7A 1RT5B 3LWLA 3G86A 2HNZA 2UVRA 4DL5A 1KLMB 1ASUA 2G8FA 4FJ7A 4I2PB 4CEBA 3KLIA 3OYEA 4GC7A 5F8IA 4IBNA 3VQPA 1LAWA 2IAJA 3TVKA 3MR2A 1XC9A 1X1PA 3G6YA 1TAQA 4DL4A 2HHTA 3BREA 5KFGA 1Q8IA 1KFSA 3KLHB 3D5MA 4HCBA 3AV9A 4CJRA 3RAXA 3V4IB 3CDUA 1K1SA 1WSGA 5DLFA 4RW7B 4ELVA 3ULDA 3DLGA 2E9ZA 3RMCA 5C42B 4AHTA 1YVUA 1QAJA 1QSSA 2R2TA 4Q0BA 4ICLA 3SQ0A 1S9EA 3KK1B 3RB4A 3H4BA 2ETJA 3OYHA 2HHUA 4K4WA 4JLHA 3PW5A 4RUAA 3K2PA 4K4SA 3KD5E 2OPRB 3K5NA 1S49A 3GYNA 4DFPA 1U48A 4MIAA 2RDJA 5J2QB 3OHBA 2UVWA 4NCAA 2R8IA 3QEIA 3MTKA 1NHVA 4ZTJA 1N4LA 1WSHA 4DQRA 1IG9A 4DTPA 3TABA 1T8EA 1NK5A 3SV3A 1TL1B 2IOCA 5L1JA 4AHCA 1SH0A 3PUFA 4CJSA 4KB7A 3C6TB 1NK9A 2W8LA 3MF5A 2AX1A 1HARA 5F8GA 1W0HA 1C1BA 1QE1B 3HK2A 1EX4A 1QUVA 4CF9A 3DRRB 4IFVA 1CSJA 3AO4A 3QGGA 4FLXA 5HBMB 2P51A 2Y1JA 3TI0A 2HAIA 4DTJA 4YNQA 3VA3A 1LW2A 2V0NA 4KHNA 5EUHA 1U47A 4OKEA 3ITHB 4FLYA 3CVKA 4CFBA 4HUFA 4DSKA 4FLZA 4HVJA 2KFZA 3LP1B 1IKYA 2C28A 2O4GA 4DTSA 5J2NB 4O4GA 4ID5A 1HYSA 4O3QA 2GV9A 1I3AA 2P5GA 3KLGA 1LW0A 4B9NA 5J2MA 1WSJA 2V9WA 1O1WA 4CERA 2FBTA 4KB1A 4CJQA 3GIJA 1S1UA 4RNHA 2R2SA 2FJVA 4IDKA 1TKTA 1NK7A 4NCGB 3BGRA 3KHRA 1MMLA 1BQMA 5KFQA 2HNZB 3PO4A 1S1VA 3ZCMA 2HHXA 2XCAA 4DF4A 3CQ8A 3M8RA 4ECSA 2IAJB 4MK8A 2Q3SA 3OHAA 1LV5A 5I42A 1JIHA 1S0OA 3I5AA 1J5OA 3K5OA 3TANA 3S9HA 4FJ9A 2FVRA 3NCIA 4KKOB 3SYZA 5KFRA 3AVMA 3OL6A 1Z4UA 4KTQA 3DLGB 3QINA 3RB6A 3PY8A 3NL0A 2VWKA 3NF6A 3EYZA 5EDWA 1LWCB 3KJVB 1SH3A 1RBSA 4TQRA 1A5WA 1S9EB 4H8KA 2I1RA 4BE0A 3CFRA 1S1WB 4ZP8A 2D7SA 1QS4A 1KHWA 4EBEA 1JXLA 3V9UA 4CJKA 3ICLA 5DLGA 1FK9A 3LPUA 1EETA 3QYYA 1WAFA 2ZE2A 5HRPA 3VQ7A 2R7YA 4JRQA 1LWFB 4W5OA 3LPTA 2P1JA 2HNYA 5KFFA 3NH1A 3NF7A 5C25A 4B9SA 4NLYA 2IBKA 3U3YA 3OL8A 3HSTB 1R0AA 4CEDA 5HRRA 3G10A 3DLKA 1S6QB 1C1BB 1SL0A 3T1AA 2F8TA 2D5RA 4XPCA 3QETA 2VG7A 4FJGA 4MIBA 4RNFA 4RNOA 1IKWB 4IFVB 4IR9A 3AVCA 4CF8A 1T03A 1RT7B 1NOZA 4RU9A 1A5VA 1B9DA 3KLVA 3I5BA 2HWHA 4KHMA 1DLOB 4Q8EA 4RW8A 1ITGA 1GOCA 3PW7A 4FJ5A 3ZSYA 1IKYB
chains in the Genus database with same CATH superfamily
2CQ1A 3H25A 3S41A 4CD3A 4BG8A 4OYXA 4UQTA 3CDAA 3GSIA 1X8DA 5M2UA 2QWRA 3D0PA 3KXDA 3O4QA 4URGA 4DV0F 3O8MA 4FYXB 2VWJA 1PBUA 1XI1A 5AQKA 1S1UB 3IXQA 4NYNA 4CD1A 4IFEA 1FKPA 1GQEA 1X4BA 3ISNC 4FN5A 4TLQA 2E5LK 1NKBA 1H72C 3AA9A 3H90A 1WKLA 4B1VA 1FRLA 4IH5A 1MA9B 2HFNA 1ZTTA 4E7KA 4PKHA 2F8HA 2XS5A 4OVLA 5HRNA 2FZGB 3QLHA 1SKUB 1RT1A 4DUZF 1RADB 3D2WA 2HBRB 4M5DB 2ROEA 4YB5A 4ZJQA 1XUPO 3FGUA 2LU2A 3KOAA 3I0SA 4ANEA 1C1CA 3S6EA 2J0QD 5AQLA 2UXCK 1U1PA 4P71A 2DRAA 3GE9A 3E9LA 1RT2B 4M5GA 2A6MA 5K8OA 5DQIA 4ECTA 3PX4A 3W7BA 3SUQA 4DTUA 3DDIA 4KGMA 4KR0B 2CG8A 1X9JA 3UDLA 4J9LA 1S97A 4DCJB 5KFHA 1VQLS 5AJ3K 3I31A 5KFZA 4WYLA 2P2CB 4F4WA 4PQUA 1V3ZA 3TAFA 1SL2A 5D78A 1G15A 4LBHA 2L9WA 4DSEA 1N36K 5HAOA 1N0UA 2F3JA 1CJTA 3FEYB 3OT9A 4GV3A 4WKRA 1AB8A 2CQ4A 4G3IA 2IS3A 2X74A 3HKWA 2J9DE 3ZNUA 2FGOA 4YUDA 4DTXA 3KYLA 3KG1A 3NE6A 5C25B 1UAWA 3HD1A 1WC6A 1LCUA 3BB5A 2A6AA 3CB4A 2QYCA 3PJ9A 3IN5A 4A59A 3AVIA 4Z37A 3D2FB 2E4LA 1C0UB 1QZ5A 4CESA 4FNIA 4FK4A 3J81j 3E9OA 2H3EB 2VFRA 5KG4A 1JXBA 4RW6B 2OD6A 3ZSXA 4QZVB 1XHXA 8AT1B 1Q86O 2QIFA 4PG7A 5E3AA 1YZ6A 4A8KA 2E88A 2KHCA 4Z94A 1ATRA 1J2VA 1SV5A 5AXLA 2ZD1A 3P39A 1CJUB 1JL1A 3QEXA 3M8WA 5CCMA 3CD6N 3TX8A 2DBBA 5ETMA 3SSQA 3CC7S 1S7HA 4DHYA 1YG0A 2VQFJ 3NDKA 3MEKA 5IT0A 2DNGA 1CXQA 4ECRA 4QU6A 5AQOA 4DPOA 1TUYA 3JYTA 4JHDA 3CMEN 4KHUA 4URQU 1RQ0A 2MQOA 3OYGA 1TUWA 4R8UB 3K0SA 3HPHA 1XMOJ 1BO5O 2DR6A 2CYYA 3TQ1A 3MPWA 2H65B 4LMZA 1KBRA 3GV5B 3EE3A 1HI0P 1J54A 1VK8A 1N33K 4KHSA 5CH7B 4QIVA 2Z1HA 3FFIA 4A4JA 1O8BA 3HSCA 3QLHB 3ZXWA 4IOAL 5B0BA 3ZZOA 5KOWA 4ZP9A 2W2MP 2ZBIA 4DCPB 1LWXA 4B9QA 3CCRS 4JI0K 2KT3A 3NBPA 4WP3A 3ISND 1NH7A 1MN9A 4PWDA 3AD9C 3I0SB 1L3UA 3AVAA 1C1CB 4PUOA 3L3VA 1OVQA 2N4CA 3S7RA 1JLCB 3MM7A 2OCEA 1FD2A 3CM6A 3J80O 4M3ZA 2ACYA 1RDRA 2G13A 4CJUA 4FM2A 4W5RA 2HHPA 3IFRA 3B78A 1JLFB 1OY9A 4PQUB 4CF0A 2JEJA 1VGYA 3THPA 2N4DA 1JNRB 3D68A 1G99A 4UUWA 4A8FA 3SFUA 3MCAB 4EP4A 4B8AB 4RUHA 1RAAB 3AAPA 4A8SA 2ALYB 4WYBA 4OYMA 1C0TA 5LMNF 1H6KX 1RGVA 2EC0A 1FWPA 4M41A 1TV6A 1NGCA 4UTGA 5IV3A 2CIMA 2AGPA 2IVMA 4Q2MA 3IRXB 4CJPA 3OL7A 2QTWA 3AHPA 4ED0A 2BVZA 4DV6K 3T6BA 3T1YJ 4BHQA 2BQ3A 1HI8A 5KT7A 1X9MA 1HR0F 1NWKA 4ECYA 1FNMA 2BX6A 2DR5A 4LRAA 2JZ5A 3MAHA 2M4MA 4QIEA 5HQ8A 1KOOA 2RE2A 3IDHA 1JJHA 1RYSA 4RG8A 3EKSA 4JI2K 3CC2N 2WK4A 5C24B 3RTVA 4DS4A 1U1RA 4CJ4A 3X3UA 3JYTB 4JHDB 2DHGA 4QWDA 5AT1B 3D67A 2D3OR 5JLFA 4C0OC 1NGJA 4BRPA 1RAFB 2ZH4A 3JAMU 3NCQA 3KNAA 4MK7A 3IFEA 1N34F 1WC4A 3O9UA 3HP6A 3G87A 2AEFA 4ZDNA 1UFWA 4BRHA 1JJCB 3J80Y 1RAEB 1WG1A 5KG5A 1TKDA 4ES2A 3GOIA 1RA7A 1TELA 3GG0A 4HCCA 1YIJN 1ZA1B 4JI7J 1VC0A 1TL4A 4ED6A 1NMDA 4F3MA 1X3NA 1IVZA 4WFAQ 4PWDB 4OI4A 2LQ5A 3M9OB 4OMFG 4PUOB 3L09A 3OTBA 4KPCA 3CCSN 5H9EJ 2C2RA 1K8KA 2IA0A 3OPKA 2CFXA 4WTYA 4B08A 2FZKB 3VTHA 2H1YA 3O3FA 3PW2A 3LO3A 4OI1A 4E2FB 2XSFA 2D0BA 1NCLA 3THXA 3N6MA 4WP9A 1RBRA 1PIEA 4UZBA 3VALA 1BCOA 3BYPA 4N41A 4C9DA 3LDOA 2FLNA 1UCNA 4C3KA 4DQPA 3C7NB 2XGPA 2D3ZA 3QT8A 2B43A 4OX9F 1EKRA 5DG8A 3H5SA 3HULA 3CSKA 1WSFA 3Q23A 1GT8A 2B9XA 2O66A 2WUSA 4ILMA 4E0DA 4C8KA 4ZHRA 1VHXA 1RUSA 2RNEA 4E3SA 3Q2TC 1TV6B 4AHVA 3J7AN 1P27B 3A4TA 4O5BA 1KS2A 3G2XA 4KY3A 3W1YC 3GV7B 5E5NA 2DGSA 3FSIA 3PFOA 2PMHA 3QDKA 4X66J 3W8PA 5LJVA 1EQYA 2CDRB 3K17A 4HEA9 3SI6A 1NM1A 3AFGA 5EWGA 4UY85 3JXUA 3BO4A 2EFQA 3J7YI 2QWPA 1R3NA 4Q2LA 3P5BP 1TR0A 3PRDA 1N32J 2YKMA 2KFNA 3DI6A 4PKGA 5BR8J 3GCWP 5HANA 3DNCA 3AGRA 1W7AA 4L73A 4ZLPA 3R1LA 4Z0UA 4N8NA 1RTIA 3CJ1A 2RSQA 1W25A 5DK5A 1VQON 3HD2A 4ECXA 2A41A 2M3DA 4LD0A 5GAHP 4CH7A 2QYGA 2KTQA 3QWUA 3R1HA 1OH7A 2G8KA 3ZSRA 3NWGA 3ULHA 2OANA 2M52A 1NGDA 4DU3A 1GFWB 4FWLA 1BI4A 1VIXA 2PE8A 5AQUA 3VPZA 4UW2A 3W5ZA 1W26A 3FVYA 1LW0B 2ZOMA 5IM0A 3Q8PB 4FF3A 4OYWA 3QT7A 1DRZA 2QM1A 3BPDA 2HFSA 2HFOA 4LF6K 1K8KB 3IP0A 1VQ7S 2DNRA 3D45A 1SJ1A 2ZBQA 8ATCB 3FCWA 3PR4A 5DDQC 1U0HB 2ZQBA 3F44A 4PG8A 3EO3A 3HM9A 1GLEG 3ZT0A 1XTZA 1VQYA 4DI6A 3IBCB 2BKPA 4F3QA 3QEWA 2IIRA 2LQ9A 4DR2J 1U6ZA 2ZHAA 1IUJA 3M4XA 4UOCA 4CECA 3WUHA 4YY3K 2UU9K 3DGVA 3JSMA 5THWA 2D74B 5MLCV 4J2BA 2O67A 3OBIA 4IJNA 4IRCA 3AD8C 2R7OA 1T94A 2JL9A 4ZHRB 3D2EA 4HUEA 5E41A 4OYPA 3LM2A 5AQMA 4KH0B 5HP1A 1NH8A 4DR5K 3CETA 3PX0A 1YK9A 2DPNA 2K7JA 2QLJB 3R8EA 1YBAA 4MDBA 3A5OC 3QT5A 1X3MA 5KT5A 2DPIA 2B8PA 3SDEA 3CHWA 4A8YA 2ZE2B 2E1AA 4B3SJ 1HUXA 1EZZB 3QRQA 1NJWA 4P52A 1RAIB 2AP1A 5AQWA 3DI6B 4C7QA 5LXRA 3CCLS 2Q6CA 2A10A 3DRYA 3VQ5A 2GHWA 1HKGA 4IEIA 3ZZTA 2ZC3A 1H1VA 3GILA 4CJ5A 1UJ5A 3QFUA 3T5HA 1CULB 3MAQA 3CDWA 5ETPA 2J0SD 4ECWA 2E1MC 1AXQA 2FJEB 4F0MA 2R7TA 2ADCA 4DHVA 2Q79A 2IM2A 1ZBFA 4CP5A 2OLWA 4NASA 3ZT4A 2E1PA 4XK8C 1I6JA 2C2OB 4FW1A 2OPRA 2V4QA 4NLXA 4B9TA 2FHJA 4DPWA 2UUCK 1BLUA 5J2QA 4YQWA 5CA5A 1UAXA 4MKAA 1FE4A 2OUGA 4EHUA 4U7CA 4CFDA 1ZTWA 2HBZB 1TL1A 4IO9L 1RDCA 3CC4S 4OKJA 5IM0B 3BZCA 2YTCA 2F8SA 2OZSA 4I9QA 3HSGA 3SNNA 3R27A 3RAQA 2GZOA 2Y0SD 1FW6A 4BR5A 4P2SA 1HX1A 2FXUA 2Z56B 1HKBA 5BRDA 2EKNA 3W5XA 4F2SA 3LDQA 3EDRB 3EZWA 3N4WA 3CO0P 2B4UA 3KDNA 3HFVA 1D9DA 4HI1A 1E3MA 4LRBA 3R5BA 3DLBA 4DJBA 2LCWA 2NRZA 3NHGA 3QGHA 1WC0A 2J9CA 4IO1A 4YDDB 2BA9A 3R6GB 4FM1A 1E6YA 5GMEA 3OSPA 1QY7A 2JLEA 1NSKL 4IEEA 1Q81O 2ILYA 3KDOA 4UQGA 5DM7Q 1D1UA 2KVQE 4P7VA 3C6UB 3PXGa 1UA1A 2QKBA 1X4HA 1WBDA 1J5EF 3D2EB 4USTA 2R7RA 5C12A 2UUBK 3GFXA 4DV1J 4E7LA 1QVGR 2BJ3A 1EX8A 3CJCA 3VQ9A 4C4WA 4IG3B 1G7CB 2KYZA 1RHRB 3ZTSA 3NAHA 4NLRA 1Q8LA 1SAZA 1XMBA 4NRUA 2H5EA 2XC9A 2NLXA 2YHWA 4CK2A 3CW2C 2E2QA 2KJWA 4ED4A 2VODA 1YTUA 2GUIA 4NA3A 4WIQA 3QIPA 3HP9A 1F5CA 1NZ8A 1HBOB 2XLKA 3G8TA 5M1OA 4TU9A 4BRDA 3H40A 4C1NK 1Q5VA 3MM8A 2F40A 5ETVA 3CJ9A 4FK2A 3TZXA 5A2QO 3H2VE 2VDHA 4Z7YA 1RTJB 3UKUA 4BRAA 1HWLA 2RQKA 2YWEA 3UQSA 3QFWA 1ATNA 2W24A 2AGOA 4FPIA 2VGNA 4IRDA 4AILC 2HS3A 1LWCA 4O55A 1Y10A 2XMJA 2HK3A 1CJKA 2KL8A 4NLBA 2FVPA 3TEGA 3TYTA 4N47A 4LFAJ 1PO6A 2YXLA 4UY8T 4QPTA 3LOUA 1S1WA 4Q45A 2KZMA 3SUNA 3R5AA 3FJ2A 3GBTA 5LL6d 1RJJA 4GKKJ 4DUYF 4FJIA 2G4BA 4KH4A 1DY3A 1X5SA 3LM9A 4JKGA 4Y65A 2Z8QA 4YN3B 3V5RA 1NXIA 2D1KA 3HOTA 4DR3K 4BLGA 1IJJA 3T69A 2JVOA 1S6QA 3TAMA 5B0AA 3PVXA 3S8SA 3CNQP 3VENA 1WF0A 1FRIA 3M6GA 4KB0A 2PDAA 4BGAA 4C8ZA 2AA4A 3O80A 1MWKA 3LPEA 1Q86T 1NKCA 2W7AA 2XHBA 1N6QA 4H54A 2IVFB 5CE3A 2E6LA 4ZVUB 2KW4A 3LAKA 2QWLA 2UUAJ 2XTJP 4K25A 4DFJA 1F2HA 3W9IA 1HNZJ 1WHVA 3PX6A 4DU4A 1HNIB 2QSWA 4F36A 3MN7A 3VESA 2I6WA 4CBUA 2Y9HA 3OTOJ 2FY1A 5C2FA 2HBJA 1I39A 1F60B 3HYFA 2CPEA 1M90O 5J1PA 1HNXK 2KG0A 2EWHA 3KMSA 3KKRA 3BN7A 5CZXA 2GELA 2HFVA 1LXNA 3IG1A 2CAJA 1R8HA 2FSNA 3SLCA 3V9SA 2E2NA 4YDUA 1SXLA 3TNVA 5H9FJ 3CJ8A 1YF5L 1K8AT 2F9TA 5TKYA 1RDDA 2BJ9A 5A2QY 3V6HA 2DPJA 4Y2CA 5BR9A 5DM6Q 3VQQA 2WB1D 2G1HA 2ZBRA 4CGHA 2MGZB 3D1HA 2VG5A 4Y1DA 3I33A 4ZCLA 3QIPB 2FSJA 4G65A 4AQYJ 3K5MA 1A6LA 5HL7L 5B0DA 1CZAN 1Q7YT 4AHSA 2HZAA 4JV5J 2PMWA 1NPKA 4YMEA 2F4FA 3BF4A 3JQJA 1EKSA 4FWQA 2P9NA 1F1BB 3UKUB 2JEFA 4ES3A 4LF7J 3NWRA 4U67L 4GMKA 2NRHA 2DNQA 5EOYA 5AXKA 3OJUA 1CJKB 2Y8YA 2ZUGA 5CAAA 3OYFA 1GLFO 1O13A 4CHQA 3E51A 4KT0C 1XMOF 4A8QA 3IAYA 4OZ5A 3HVWA 2NXUA 1JLQA 4B1WB 5HQMA 3RAMA 1CQMA 4JKGB 3NGTA 1X4CA 2XO7A 2FDNA 3K5PA 4ZN3A 3VQTA 3ZFVA 4HH0A 4EHTA 1YLXA 5K9FA 4K8ZA 2Q66A 4EU0A 3TAMB 2KZZA 1D0EA 4ILLA 3V6DA 1U04A 4XTTA 2NUHA 1RAGB 8RUCA 1DTQB 3GQCA 1HWUA 3D4JA 4JS4A 1QDUB 3R5DA 1M1HA 2HSEB 2NSBA 1KXPA 1RHMB 1N6QB 2BEFA 3FEZA 1ZPWX 2HBKA 3EJMA 2UXBJ 4ZK7M 2VASA 2ZHBA 1RTZA 3PSIA 1BA1A 2JC0A 1HHSA 4MIWA 2CWXA 3D7EO 3RBEA 3CCEN 2XEXA 1K6YA 2ZJQL 5L1KA 4QW8A 5IWAJ 4RJVA 1VSEA 4ZCKA 3JTOA 3M8PA 1TMJA 2ZVIA 5KFLA 1K73T 4HACA 3IMQJ 4BDPA 2NZTA 4RZRA 2U2FA 3IG1B 5BPMA 4Z7CA 1B99A 1NJZA 1WJ9A 2FD2A 2ITGA 3T1HK 2AW0A 2VFVA 1BUXA 2YPZA 1VSHA 4FWNA 4WQ5C 4KFBB 3MEGA 4RW4B 3IGVA 1U2VA 4GMJB 3ZSWA 3QBXA 2Z1IA 2AEJA 1XNQF 1FFGB 2V2ZA 3GJRB 4DR4J 2LEPA 4CGJA 1DURA 2IVNA 2R8KA 4WFXA 3MGJA 3QBCA 1NM2A 1WEZA 1U0SA 4QS9A 4B3TJ 3UIQA 2D9PA 1GTEA 2NSCA 4DV7K 2J6TA 4R25A 3IM9A 2E1CA 1TU0B 3GIMA 4WXWA 2E5IA 4FJKA 4ECUA 1SUQA 3CJ0A 4J90A 5L39A 3F0NA 3R5GA 3N5BA 1B7YB 4NLPA 5I3PA 1V5IB 3A8YA 2G2YA 2WSCC 3TARA 2C1EB 3MR7A 3M7VA 4RPFA 3WBZA 1NB7A 3N0VA 2XCPA 3H5XA 1PSDA 3CCZA 2ZUAA 5JJBA 2H51B 4Q7AA 1DT9A 3MM5A 3RU0A 4EK2A 3ZLJA 3ZX0A 3H3NO 3NAIA 5GADU 2V2QA 4ZKAA 4J9MA 3AO2A 3O3LA 4QOZB 4RW7A 3CC7N 3C15A 3OS1A 2DNOA 5K20B 1KDNA 1XJWB 4FZZA 3CUNA 5KPZA 4J91A 1VJWA 3V6DB 3PW4A 5E3CA 2KH9A 5EWFA 5GADP 1QSLA 3NXZA 2CQ0A 5AZIB 4JV2A 4RBUA 1BD6A 4HR2A 1JJ4A 2ZH8A 3ZZRA 1SKRA 4YORA 4CZIA 1TL3A 2Q0UA 2OIHA 1WHYA 1KSPA 3OVSA 5A0YA 2GV1A 3J7ZO 3SCLE 4BDYA 3M8PB 4V1Ak 2AJQA 2O8BB 4MYUA 5F8HA 3KKSA 5JVGL 4CH1A 2ZOFA 3ALYA 4X62J 4Y28C 1SJRA 4J9SA 1U1NA 2V67A 3L2RA 4LF9F 1NMEB 1ZAXA 2MLXA 1U2VB 2EKYA 3WEEB 3NLCA 3MXIA 3WX8A 2NPIA 3AVFA 3MWPA 1KC8T 2P9KA 4CO5A 2JWKA 2ZGYA 4O5FA 4FBTA 4OLAA 3GZ7A 1ZBUA 3CPEA 2JH3A 1WF1A 4CZCA 1VQ9N 4NB4A 2G2OA 3FQKA 4KBOA 2MYFA 3LP0A 3IR7B 1HKCA 1DZ5A 3DLEA 4X65K 4EI2A 2HNZA 2HF4A 1WACA 3Q7CA 2ZM6F 1ASUA 2G8FA 4L6V3 2W2OP 3OYEA 4GC7A 4JYAK 2DYAA 3G6YA 4DL4A 3ENOA 5HVHA 5KFGA 1HHTP 1I94J 4LVNP 3MM5B 4CJRA 1X7VA 1WSGA 4RW7B 3DLGA 1XK8A 3LGMA 2E9ZA 3BYRA 3F9MA 3RMCA 1VQ8S 1YVUA 5IT9O 1ICEB 3KUEA 3N9UC 3TTDA 4HHJA 4CWBA 2HVZA 4H5NA 1CQNA 5HMYA 1AROP 4YOEA 3FZ2A 4DFPA 3UCGA 5HVFA 3J81U 1GH8A 3OHBA 4RLEA 2UVWA 4ZTJA 1N4LA 4DQRA 1RWOB 4I0WA 3TABA 1NSAA 2IRXA 3C3LA 4A48A 3ZTQA 1IBLJ 2VHGA 3BH7B 4ZIVA 1NGGA 4XDCA 2DVIA 3TVYA 2OEMA 4IOXA 1WC1A 1NK9A 5A0YB 3TQEA 2NZ4A 3D6MB 1FJGK 2KXNB 1X0FA 4YB6A 1TYQA 2YHYA 1NSQA 2HHHK 1QUVA 3NEKA 1X4FA 1UJ6A 4ETXA 3PDNA 3SCIE 4FLXA 2P51A 4RUBA 3CE8A 4JI8K 1N8RT 1NHKL 2HAIA 3VA3A 1HA1A 1KQFB 3BZQA 1M1KO 3FBCA 3WC0A 1VQSA 1VRQC 5AFUH 4MT1A 4O4GA 1HYSA 2P9KB 4LF5F 2DY1A 2GCFA 1N33J 2J0XA 1I3AA 3OUYA 5H1SV 5J2MA 1NU4A 2ERRA 5FLXO 1O1WA 2PN6A 2FBTA 3MCPA 2YKQA 3U1LA 2R2SA 4DR6F 5GAEU 5EGYA 3Q2SC 3KWGA 1KN6A 3MWBA 1TKTA 3VERA 2ZOGA 3BGRA 3MK6A 4PG6A 1BQMA 2YI1A 3P96A 2HNZB 5CD4H 1S1VA 3ZCMA 2HHXA 2HRUA 4LFBF 4B17A 4ECSA 3VZHA 4OHVA 4DMZA 1DHMA 5IT9Y 2Q3SA 3OHAA 2M88A 2E66A 5GAEP 4DU8A 5I42A 3EL2A 4K42A 1MWQA 3N5FA 2RS2A 3I5AA 1UZHA 1RAOA 2NXEA 4FJ9A 2FVRA 1HL6A 2JLFA 1EO1A 4I6MA 5KFRA 3DLGB 1WHWA 4J9UE 3PY8A 3NS5A 3NL0A 2VWKA 3EYZA 2PI4A 2DNYA 4ISFA 1RHJB 1DQ8A 2JJ4D 3LDLA 4KGKA 4BC5A 2MKSA 2ZITA 3DN9A 1T9XA 1S4EA 2F63A 4EBEA 2QGFB 3NMRA 1KTVA 3M05A 1FK9A 2FHKA 4OYAA 5HRPA 2R7YA 4M5KA 3VEZA 4LRFA 1BC6A 2HNYA 3I32A 4DOZA 1RFQA 3B4MA 3UVJA 1CJVA 5EX5A 3DLKA 1LFWA 1TYQB 3ZZZA 5EY4A 4NEZA 3C8YA 4P73A 4KGZB 1VQ7N 5LXYA 4IR9A 1A0OB 3UE5A 1YJ9N 3AVCA 5FLXY 1K0TA 2UXDK 3GONA 3W66A 3RJMB 3O9QA 1DLOB 1HD1A 3MDQA 1U6BA 4OV1A 4LFCK 3DDNA 4ISGA 3NCPA 4FJ5A 2H54B 1LOTB 1ROFA 4ILHA 3QICA 4KO0B 4RBTA 5DGAA 2PYLA 4BVPA 3BKUA 5AQVA 3QQCD 4J5OA 1NJYA 2Y1LB 1HYSB 4LF4F 4LRDA 1QSYA 2LEAA 4DV3F 4BC2A 4RR5A 5J2MB 3UDVA 1T44A 4FLWA 1OH8A 1AYEA 4EFHA 1CZ9A 2I0XA 1UP1A 2OPQB 4WWSA 3R2CJ 1TKTB 4JKCA 3W5YA 1U25A 3RB0A 3BGRB 2WTFA 1BQMB 4DX8H 1S1VB 4JI1K 5KG3A 1U45A 4DV2K 1JMTA 4IH7A 3K5LA 4DFMA 4KHYA 4LRCA 2NRRA 3L4IA 2NUUG 2B9YA 2GX8A 2VQEJ 3CMQA 3IGNA 1F2GA 3FNNA 5I42B 1VSMA 2E6MA 4G6VB 4LSZB 3CCLN 3RB3A 2ZVSA 2CGLA 4FZXC 3T9ZA 4CLWA 4QW9A 3MR3A 1YKWA 2MY7A 3W3DA 2HIYA 4I6MB 3FDSA 2BZ2A 3NGIA 3L2WA 2D0CA 2GVDA 1KRPA 4F3OA 1NNEA 3JSBA 4FOEA 4DR7J 2HAFA 3CXCR 1Q1KA 5IC6B 4KV8A 3CPWM 1RTHA 5J2PA 1P1LA 2ATLA 1FEEA 3ILLA 4K41A 4UT4A 1UEVA 5M2RA 5DDRC 1S3XA 2QA4G 4ISEA 3M6XA 3CCMS 4JI4F 4NLTA 4QIFA 2DNPA 2V4JA 2P5OA 3RYLA 3LP2B 1OH6A 4LUBA 1GMUA 3DRPB 2HGMA 3PR5B 3KHHA 4CGFA 1CJVB 2VV5A 7FDRA 3PYGA 4CHYA 4YEAA 3OY9A 5D0HA 3HZ6A 3EGNA 3K0JA 4WYWA 2MEWA 5AQSA 4DB3A 2BJ7A 4B9MA 3ZETB 2MQQA 4YR2A 2DGVA 2P9LA 3SMSA 2QA2A 3KJQB 2FZCB 1X4AA 4ZP7A 2Q2RA 1VQ5S 3THTA 3TJ8A 1MWZA 1BMQB 4HHHA 3OR2A 1DTTA 2V7YA 4KTWA 4NI2A 1JCGA 4TYBA 1XERA 3OS0A 1N56A 1UVKA 4WF9Q 3OYMA 1CC8A 1N5YA 1KQSR 3BDPA 3CFOA 3PYDA 3PHEA 3H1VX 2P8IA 4LF1A 2ZGZA 2RF2B 1VQ6S 1Y00A 2FC9A 1TL7B 3AXMA 2VBWA 4DQQA 4P2XA 1SKSA 1C6VA 4BREA 4M5IA 3BSCA 4OQJA 1RDAA 4TQSA 4BC9A 2VPWB 1WORA 3WIUA 1RHQB 4MFBB 2JWNA 3SSRA 4N5SA 3ENAA 1W2BR 3CJ4A 2DFFA 1XR5A 3DWLA 1YTYA 3K9JA 1RKIA 5LJWA 3G9CA 1NZAA 4K43A 4CT9A 1CZBA 2OO4A 1RB0A 5KI6A 4DR1F 4DTNA 4NXNF 2CDQA 3QGIA 2ASOA 5KFIA 5KPTA 3P3DA 4M8LA 2ZBPA 3AO1A 3L2VA 2R7SA 2RD5C 3ASMA 2W6LA 4RL1A 4E7JA 3V81A 4C8LA 2DITA 4FO0A 4CJ7A 1S1TA 1MMDA 1TVRA 2E1YA 3LWMA 3OVBA 2BANA 3RRGA 2AJ1A 2RQ4A 1WN7A 3HTVA 3RMDA 3LF0A 1U8SA 1RU2A 3FR0A 4H5VA 5C7PA 3IR6B 4CM2A 4AT1B 4KV8B 3MD3A 1AUSL 5GIOA 1RTHB 5J2PB 4JI3F 3U3GA 2D41A 3SPZA 2W1BA 3MEEA 3D6RA 5LMUK 2H3GX 1ULRA 2YNHA 4PAAA 4OZ2A 1B9FA 1EWRA 2AP6A 4DV0J 3HPGA 2IY5B 3CJRA 3NS6A 1IR2A 1Q5YA 4Y2KA 5K8PA 1J53A 4KHPK 2UXBF 1NBEB 2BXJA 2QMXA 2BDPA 2ZWHA 2QMWA 2OPPA 1WTFA 4DF8A 1HFEL 4Y0FA 1GLLO 2YV0X 3PIOL 2A1SA 3SBTA 3QMLA 4DQSA 3GJTB 4ID8A 1QVFM 1GNKA 3VGTA 4RNMA 4CHZA 3CCTA 4WCEQ 4DLEA 1Z2LA 4FPRA 4E8UA 4DUZJ 3E66A 2HQIA 2FJWA 2BJEA 3OR2B 2IM3A 4LF2A 1NDPA 2UVVA 3EKUA 1ACMB 1VBZA 2GUPA 2BJDA 3HF5A 1U8WA 2R7UA 1S1XA 4LC9B 1S9GA 2HQGA 2EG1A 2HWTA 2Q1LA 2OGUA 3TUZC 4ZITA 5IXUA 2ZKTA 4NZ6A 2VC0A 1SS6A 5BXIA 4ZP6A 3IS9A 5CXTA 4DMNA 3NCRA 2J0WA 2MSSA 1WEYA 2RS8A 3U9ZA 5FDLA 1FKAF 2IJFA 2W01A 2BR0A 1HYVA 4B3TF 1NRKA 3MXJA 4KRWA 2HMIA 2RRAA 1C2PA 1XNRF 4WZQA 3D0GE 3ILIA 3BGUA 5T7BA 4DSLA 2I5JA 4ZMMA 1C1AA 2ZZMA 3B4DA 3EZOA 1XMQF 4IZ9A 3P83D 3VQEA 2GQCA 2XBPA 4B3MF 5KT4A 5KFAA 4NRTA 4ZVTB 3AB4B 1KAZA 4C3LA 3TA2A 4ANDA 4TY8B 4KHWA 4J9VA 2LVWA 1T9YA 3MMCA 3AVGA 1TVRB 4F4ZA 3LPYA 4DXLA 2BANB 5GAHI 4CLYA 3AARA 2APOA 1P1TA 5K14A 1T11A 1VIOA 4K0KF 4GO7X 3THWB 1VJQA 4PR6A 2XYPB 1CLQA 3S3MA 2YNHB 3AA8A 2QI2A 4M3WA 2MTLA 2K3IA 1D8ZA 4AHUA 3MD1A 4URSA 2OTLN 3M2UA 3HVTA 2W4DA 3GIKA 1ELOA 2FBYA 2VONA 3HI9A 1Q95G 1G4CA 4NLUA 1TFYA 4Q0BB 4NCBA 4LF5K 2W42A 3KHLA 4OI0A 2DFHA 5HROA 2JOQA 4KI6A 3KWMA 1KONA 5AQGA 1VYAA 1Z1ZA 3MM9A 1ZBIA 2L3MA 2GC8A 4DTMA 1WDTA 2F7TA 2YWHA 4OZLA 2XZDB 2O8CA 3EY1A 4DTRA 4BDZA 3KMQA 1S79A 1WG4A 3S01A 1C0MA 3VEVA 3NY0A 2R2RA 4HHTA 4JI5K 3JAMY 2A40A 5KFNA 1S1XB 2HQFA 3DKDA 4H0VB 5IQ6A 4HVZA 4GVEA 4PL8A 1FE0A 5AQNA 4JD2A 1QJHA 4LSNA 2NCKL 2OYQA 4LF8K 1PG5B 4W92B 3CT9A 4CT8A 3IS9B 3TRGA 2XQCA 1FEHA 1CPZA 4RWWA 2DGTA 2E5LF 3UNYA 4F8RA 3HHLB 3HMJG 2F8MA 4ZVSB 1FRMA 4ELUA 3HO1A 3CM5A 2G9OA 2KQ2A 2B8QA 4ED8A 3DMJA 3I96A 1QAIA 3UN5A 4UOGA 3LH2S 2MQNA 1FVQA 2I5JB 1FKOA 1UA0A 5ADXA 1T7PA 4ZVGA 4KC5A 3P4UB 4CVNE 2UXCF 2OEJA 1H7XA 1C0FA 1VRUA 2CUYA 2MLZA 3QPIA 1FXDA 4DL6A 2QE5A 1U1OA 4ZPAA 2EHGA 3WX4A 4RWXA 5AJ3F 3NOGA 3RUBL 1VOMA 3M32B 3AA5X 4CLFA 2PGCA 2AF6A 1EARA 1RILA 4E1NA 2QFIA 1TTHB 1EKEA 1N36F 4BRFA 2XMAA 3A5MC 3M6WA 3DDKA 3G4SN 1HNXJ 2DR8A 4W5TA 2XY8A 1RCOB 4ZLJA 1BHNA 6FDRA 1M1KT 3C2PA 2ZNYA 1VSIA 5LM7E 1R8BA 5D0EA 1VQNS 1CG2A 4AUKA 3OYBA 3KZBA 1NGIA 4MLEA 4M94A 3HBTA 3M2UB 4B9VA 1HNWK 3HVTB 4X64K 4ZPTR 4YP3A 3EXYA 5KFKA 3M3ZA 3MMBA 1W9HA 3PLAA 3EEQA 3I56S 2YNGA 3QZ7A 1I1GA 4GV9A 3UDEA 1DBDA 5E84A 1N34J 2BJ1A 1IH7A 1H2TZ 1F21A 2VH7A 2VA2A 1R8CA 2CQCA 1KAXA 4YOYA 4USVA 4EO6A 2QLFB 1YHQS 2B4PA 3FZBA 3BQ1A 3HXMA 2WVBA 3GP9A 3FSXA 2C3YA 2GMHA 3BPSP 5C2CA 2CPDA 4J2EA 3THYA 5KG2A 1YI2S 3NGYA 1NUEA 4CJTA 2HFZA 3VN5A 1F9EB 4W5QA 3O9TA 4OFZA 2CVEA 5KRSA 3V4IA 3UN3A 5D77A 2QMUB 3MPDA 4R0EA 2XY7A 1QTMA 2QEXN 2NZCA 2XM3A 4TVAB 3EX7B 5IFMA 3ZYYX 3R9PA 3OYDA 5IQQA 5A8KA 5DGBA 1IBMF 1HQUA 4FJXA 2ZBCA 1Y64A 3BEGB 1N33F 5F8MA 2V52B 2AJFE 4FLUA 3S3NA 2ATQA 3P8BB 2B6AA 3GJSB 1JJ2M 1XR6A 1M1GA 4WXOA 1HYZA 1U1MA 4OLPA 2P9IA 4OX9J 4JI0F 2FLPA 2F7VA 4ZJOA 1T3VA 4GO5X 1GOAA 3BSOA 4RW9A 1XN9A 5LSOA 2WW4A 4N56A 3IBFB 4FSVA 2P5VA 1Z25A 1UW9A 2F9JA 4WFZA 2M8DB 3MFHA 4U6PA 1WNSA 4H03B 2HQCA 3FZHA 4YDUC 1NGBA 4CYUA 1IV0A 1C0GA 2XGQA 3CWJA 4NLQA 4JRPA 4NPOA 2RPIA 1N5VA 2Z2ZA 5SWMA 3AO3A 3TTCA 1OSDA 4KGXB 2BKNA 4BACA 2GVZA 1Z05A 3GR0A 2P9PA 3HT0A 1S12A 4QJVA 1LQ9A 4JI6K 4I7FB 1VK3A 1V3RA 1KVBA 3OS2A 2UV8G 4FZVA 3SZ2A 4K4UA 1H38A 4Z4IA 2QN6B 1Q9XA 3MMBB 4RWTA 2FJBB 2QWOA 3M9MB 1CLFA 3Q7BA 2OHDA 1IBKK 3OLBA 2MY8A 2VFSA 2ASMA 3D3CJ 3J80U 1FJEB 3DOMB 1BY9A 2IJNA 4DV6F 2DFEA 2XYGB 4ZPVR 1S77D 3HLUA 2MPUA 3T3FA 3QJLA 4WQ5A 3WC2A 1DJ0A 2OMOA 4ECQA 2FVCA 4QWEA 2HVHA 5IT4A 5K8NA 3IUCA 1WEXA 3LL3A 1IWGA 3OYLA 4USUA 2FJXA 5FD1A 3J8AA 5B0GA 3CI5A 4ER8A 5EWEA 4FOIA 5I3UB 4JI2F 4CHPA 2IVPA 1RBLA 4EGLA 3PV8A 4DX5A 4DV5K 2M5YA 3CULA 4KKOA 5KFYA 2W7OA 4AD6A 2Y1RI 1D9FA 1WLJA 3MUTP 2F4VK 2HHVA 5HMXA 1S59A 2E5HA 4CJWA 1RE1B 4J9QA 3PCOB 1HQUB 3DRSB 3G6XA 5GVQA 2HLUA 3GFZA 3UFCX 3KJVA 4RKUC 3JQMA 2GNKA 1CS4A 3A3NB 4CHOA 4NXMK 2KXFA 5D15A 2NYIA 2B6AB 4CO3A 2VDIA 3WHIA 2KFYA 2Z57B 2HURA 4BROA 3C46A 2P9IB 2CG4A 1RYRA 2HQDA 2PA3A 3P5TL 3KUGA 1LWFA 4RW9B 4PYAA 2CADA 1J9AA 4QPXA 1WB9A 2D1CA 3KIOA 2AJ4A 2CPFA 4WPAA 4O4RA 1N52B 4CEEA 3E3XA 2CRLA 3CJ5A 4E98A 1ZBHA 4UOHA 3VGLA 1IKWA 1UVNA 4CYUB 1URNA 4K4ZA 4CK1A 3NGSA 4Y2AA 1QQOA 2XNQA 3OVAA 1MDUB 4WTOB 1HQEA 4B1YB 3I55S 3D6TB 3CMAS 2B3TB 3VQDA 1YQHA 2IPOB 4X4VA 5T14A 4QWAA 5DM6L 3ZX3A 1SH2A 2GVZB 4AF1A 2JLGA 2XLIA 1YJRA 1RCHA 5G4DA 3N28A 4KE5A 2KB2A 3CCWA 1HBUB 2MZSA 4I64A 3CCVS 3HCXA 4B1XB 4M3UA 2MMYA 1RBVA 5LY3A 1XQIA 3I0RB 4QOTA 2XHCA 1S0VA 3RWUA 4YDXA 1JLAA 2VJUA 3JXOA 4PY5A 2K3KA 3HM8A 1BL3A 2BUPA 3GSDA 4QR0A 1M5VC 3BSAA 1YJWS 4HKQA 3F9KA 4P2MA 3CF5L 2FIUA 1FFSB 4A5AA 5L38A 2VZ9A 3NKYA 1JKHA 3GV8B 1NEEA 4M5DA 4GKJF 3VF0B 3EGZA 4A57A 2PFUA 2G2ZA 3R7NB 2VB6A 2DO4A 1R27B 1SJ4P 2SXLA 4ILJA 2BH1A 2V63A 1VR6A 3GWCA 5KT6A 2I2YA 4BE1A 1RT2A 1ZM2A 5LJ3Y 2Q31A 2W40A 4J9NA 5GAGP 2BACA 1NLKL 3BR8A 1FCAA 3KTQA 2Y1IA 4I9LA 2YH1A 4X2BA 2O4IA 3MWTA 1WD6A 3ZSVA 1RACB 4F04B 5KFMA 5BN9A 2OKQA 4KH1B 4JEPA 3UI3A 4OO1J 3Q8QB 2FHMA 2R7WA 2YQ3A 4KIAA 3BJYA 1WSIA 4K0KK 1SC3B 2F96A 1T6CA 1J5EJ 1B0PA 3I5CA 2DNMA 1RBOB 4LF6F 1UVIA 2JEIA 3NGKA 4Z4EA 4OJGA 2ASYA 1L5UA 2DHSA 3BKTA 1C0UA 2JFDA 5ETOA 2DHHA 5D4NA 1JCEA 2VQFK 2FC8A 4FNHA 5AZJB 4HDGA 2CQ3A 4M5LA 3HT3A 1Q82T 4RW6A 3HHDA 1F9HA 1HQEB 4H4OA 4LY7A 4N8OA 4YY3F 2UU9F 4WE1B 4IO8A 1SJ3P 1BISA 4F4AA 2AYEA 3NGDA 4ELTA 4DEZA 3M8QB 4WU2A 4YR3A 2ASJA 4JI8J 3MCNA 5KFVA 4OJRA 3RSEB 4MKBA 3S1TA 1E6VB 1UTAA 1ZZFA 3KK2A 4DR5F 1RSCA 3MPYA 2OFHX 1FJ7A 5BPLA 1ASWA 3AA4A 5GADI 3RR8A 2WTUA 4R8UA 1B4SA 4X4SA 2QXLA 1JLAB 2RT3A 2RDDA 2CPIA 3W60A 1UKUA 2JSXA 3HSZA 4DUYJ 1EXQA 2OEKA 1X9WA 3NF8A 3DXKA 5BYRA 1LAVA 3T41A 2ZH6A 1AW0A 3CCMN 4ZVEA 5DG7A 3PRVA 3ISZA 2FLLA 2VBXA 2D3UA 4FJLA 4CO1A 4RO0A 1IO2A 1JKHB 1SC6A 2GMJA 3BF3A 5F0XA 2DD8S 1TKXA 4GVBB 3KWIA 4WQ4A 3DLLL 3BY5A 1YJ7A 5DO2A 1I3OB 3NNCA 1JLCA 3MPVA 3V4MA 1RT5A 3U1MA 1X4EA 3I82A 2QK9A 3SQGA 3HJVA 1HRHA 4I69A 2DH9A 4LJMA 4F2RA 1VQ5N 3EPIA 4CLUA 5DDOC 1ZAWA 1P8GA 2DGWA 2YWGA 3CD0A 1JLFA 2UUCF 2GQ2A 3MXHP 3ENHA 4UY8O 5F9LA 2WONB 4QWCA 4JS5A 3HDSA 1Y5NB 3EVMA 3KLHA 1XIQA 3ELHA 3VF4A 4O3NA 4YOVA 1EP4B 3AOBA 3CQYA 3HPOA 3L7PA 3T1YK 1UWBB 3VGUA 3DCAA 5C42A 4J9OA 1GX5A 2HW3A 1VQ6N 4M42A 2OELA 2OZMA 3QO9B 1JLEB 3OW2M 3FBFA 2RAQA 2VGMA 3VQ6A 1OH5A 1Y0HA 3IRXA 1WNEA 1DARA 4JKFA 3PJXA 4PG5A 4ETZA 4QIGA 1YITS 4GW6A 1S6UA 1S6OA 2ALZA 4H4OB 1SIWB 3HZEA 2HHQA 5GMDA 5BYQA 4E19A 3GJQB 4PPDA 2GGPB 5K8MA 3L3CA 3NP5A 4W4MA 3QIOA 1BA0A 5JMNA 2UUBF 2HF3A 3KK2B 3DAWA 1QE1A 1OIAA 2PMZD 4NZ0A 4AXIA 1FRXA 4PWWA 4JI7K 4IOBA 4AHRA 5C24A 5IV4A 4QBUA 4CCHA 2VF3A 5KFSA 1XC3A 4E7HA 4IR1A 1S7IA 1B7FA 1QTNB 5LSLA 4NL5A 3ITHA 3R5CA 1IBMK 2MZTA 5H9EK 4HTJA 2XLJA 1K8AO 2H4YB 4IO9Q 1UPPA 3DXKB 4CEAA 5J1NA 5JVHL 4EIAA 5G0RB 2W25A 2FHOB 2Q1NA 1NGFA 3ZX2A 4F0HA 1WSRA 4HYKA 3CMES 4FWOA 3EMTA 2VC1A 2HFUA 1AUDA 1TKXB 2BW2A 1IN0A 1YGYA 4M63A 4NLVA 1Q7YO 2O5DA 1RT5B 3LWLA 3G86A 1OQ3A 1K44A 3SQGB 5C10A 1IBCB 4FJ7A 4ZPWR 2FF6A 5D0RA 5F8IA 4KH5A 3MR2A 3O2IA 1XC9A 2DNZA 4USHA 2HHTA 1OWXA 1N5TA 5ETSA 4X66K 5B0CA 1KFSA 3KLHB 3TX0A 2A3ZA 4DR3F 2GX9A 3VR1A 3AV9A 3RAXA 4U7UK 3C7NA 2CQHA 3CDUA 5IZHA 5DLFA 4ELVA 3ULDA 1MROA 2LP4A 5C42B 1N32K 4CLPA 5A2QU 2HYIB 2NRVA 2XS7A 4BS2A 1SC1B 3MMAB 4HWIA 1QAJA 5BR8K 2DR9A 2V7ZA 4NWBA 1JCFA 2HSTA 1V6HA 1FNXH 2DNKA 3RB4A 1ZM4A 2N7YA 4K5RA 2HHUA 2KT5A 4CLSA 3PW5A 1XNQJ 4BRGA 4K4SA 4ZVRB 1S49A 1U48A 2FSKA 4PEOA 2C3PA 5GAEI 1YBTA 2R8IA 1NHVA 1IG9A 4DTPA 1NK5A 2XMTA 2QO3A 2LMIA 1JNZB 2IOCA 2P6SA 4AHCA 4JKDA 3PKYA 1HNXF 3C65A 3ZTRA 2V50A 3CJAA 3AAQA 3FZFA 1HARA 4YHHF 1C1BA 1XBWA 1QE1B 3HK2A 2A3JA 4O8UA 1K73O 2M9KA 1JB0C 1C4AA 5HBMB 2YWFA 3ULEB 4X4RA 2HVDA 3TI0A 3EVWA 2IYIA 4ZVQB 5M2PA 5AQQA 2V0NA 4KHNA 5EUHA 1U47A 3ITHB 4FLYA 3CVKA 4CFBA 3VTIA 4DSKA 4FLZA 3QMQA 4OI3A 2LEBA 2RILA 2FF3B 3EUNA 2C28A 3VF2A 2B4VA 2OTJS 3FLCO 4O3QA 3W64A 1U1KA 4H5TA 2X1BA 2HGLA 3CC2S 3MN9A 1Z2ZA 1LW0A 4OZNA 1IG8A 4DR2K 2MZ1A 4G9ZA 1VLYA 3OD2A 2BJ8A 3LW5C 4RNHA 3B54A 4IDKA 1WDDA 4CLLA 4KGVB 3PRBA 2LXIA 2AYGA 2B51A 1U0HA 2LQBA 2DKOB 2OAUA 4PZVA 2NS1B 3CPWR 1UMJA 1V3SA 2BABA 4NLCA 1WG5A 4LIWA 4MK8A 3D7SB 1JIHA 1S0OA 3FZMA 3N01A 3K5OA 3CTRA 3AJDA 1T9UA 4Y6IA 1M5HA 4OV6A 1LEOA 3OL6A 4B3SK 1MROB 5E33A 1QVGM 3RB6A 4U8VA 1QZ6A 1EHWA 3FCHA 2D0OA 2QLWA 4FPAA 1VQPS 4LF9J 1A5WA 4H8KA 1R7IA 2YCHA 3SAGA 1EB0A 2VFTA 2C3MA 4DCOB 2F65A 4KHPJ 2D7SA 1QS4A 1KHWA 1JXLA 4CZEA 3BGFA 4AYBD 1NMNA 3ICLA 1TUVA 1CC7A 2FUG9 5DLGA 1WAFA 2ZE2A 3G71S 1UEUA 4W5OA 1U2RA 1Y5IB 5HL7Q 3LPTA 3TZYA 2KJVA 1K47A 1URRA 3QSYB 5JLHA 2IRYA 1RWNB 4B9SA 4NLYA 4F67A 3IC1A 3OL8A 3N4PA 3B8HA 1BE4A 4U67Q 3OFHA 1C1BB 2B56A 3T1AA 3K7RA 1SL0A 4QS7A 1CULA 4BBYA 2D5RA 4XPCA 2C42A 2VG7A 2XB2D 3T1HF 3LQVA 4GKJK 3W61A 3TZWA 4MIBA 4N77A 2ZM6J 2KO1A 2QW9A 2QA1A 2YX4A 1UVLA 1T03A 1RT7B 4BGBA 1GMWD 3I5BA 2HWHA 1NGHA 2ASPA 3FZKA 1EJ7L 2AT1B 2I9SA 4USWA 1FDAA 1ITGA 4K5SA 1GOCA 1EIYB 2E44A 1QQMA 3TR5A 5A8RB 3G6EN 2DGXA 2V8GA 1KC8O 1FDBA 3MMJA 1SZ2A 2YKPA 4DV7F 4USJC 3JB9k 5KFWA 3TSQA 3E01B 1VQOS 1I51B 2AV5A 5KFXA 3LANA 3VAHA 1Y11A 4IDKB 3FGVA 1MSWD 5IC4B 1JLGA 1IM4A 3TUPA 3UW1A 5CYMA 3N6NA 1LKZA 3P31A 1T95A 2FTRA 1XQSC 3M2VB 2VD3A 4BWMA 1WOQA 3FKBA 4ITSA 5HJXA 4I6YA 2HMPA 3GG1A 4UOFA 4DV1K 2Z2MA 1N0VC 2ZJQQ 4CIGA 4H5RA 3V9ZA 3OFFA 2KG1A 2W7PA 4QWBA 1TMMA 4XH5A 3V9XA 1YI2N 3CCQS 4HHUA 2UYTA 2MJUA 2ROGA 2K2PA 4JKAA 3W2VB 4FM0A 3C66A 3M1FA 4IOCL 4XPEA 3KG0A 4UUXA 2GAHC 2XRIA 3C6UA 2BRLA 2P9UB 2E20A 1TK0A 2O8EB 5KFOA 3QJPA 5IOLA 2WOMA 5D3GA 3M9NB 4CZLA 4CLKA 4CZFA 1NJIO 1ITPA 1QVFR 3ZT1A 3SIPB 2COLA 3GYGA 5F0WA 4IG3A 2FVSA 2HS0A 1P9QC 1AFJA 4LF5J 3L4BC 2W8KA 4O0JA 3NMUA 4MQ3A 4MJKA 2BE2A 3GU0A 2AU0A 2CPXA 4DBQA 4LFAK 3MTJA 4TXSA 1B0TA 4USMA 4WF9L 3US5A 6AT1B 1HBOA 2G8HA 4DR6J 1UFKA 3IWLA 3HVAA 4H4MA 2RKIB 3EVOA 2ASDA 5M1KA 4GKKK 2VG7B 3AVNA 3W0LA 4IYQA 3UR0A 1WSVA 1RWXB 4PHTX 1NAQA 1RTJA 4H0TB 4LFBJ 1R8AA 5F2RA 3KJNB 5FPDA 1NPPA 2VA3A 2EFNA 1T03B 3N79A 1N8RO 2CNNB 4X4TA 3U8XA 4L3NA 1OKJA 1VK0A 1YAGA 1PJ6A 4LSLA 5ETNA 2M2BA 2LFVA 3MZIA 2L41A 1KVCA 1WHXA 2EFVA 1OJ4A 2E7VA 3CDEA 2J7WA 1L3KA 2LQ8A 1A7GE 2LXFA 3L9ZA 1K0VA 3RMBA 3MHYA 1W97L 4MMOA 2G8UA 1Q8BA 4F4YA 2UUAK 2ABYA 1R31A 4CK3A 1HNZK 5U47A 4ZA1A 4HUGA 4TLRA 4X65F 2NUBA 1WOPA 4OJHA 1ZM9A 2HNDB 2HS4A 1RT6B 3OTOK 1KFDA 5C5JA 2K1RB 4ZPCA 4JYAF 2E2OA 1JLGB 1VQKN 3TU5A 5CYMB 3G96A 4LBPA 4DV4K 5A8WB 2HRTA 4FVMA 3AJ2A 1X9SA 2DIUA 4FLTA 2WBNA 1BOTO 1PKUA 1RABB 5H9FK 4GNIA 1KKHA 4PL7A 4ZTFA 3ZEUB 4QYRA 1HNIA 4LREA 1KEKA 2YQ0A 2W9CB 4NMLA 3PIPL 1GOBA 2E5GA 2Q43A 2JDJA 3I6PA 1SI9A 4P9SA 3ZZPA 4PXCA 4WFBL 3WXKA 1FO1A 5J1EA 4DZDA 4WIIA 3RRKA 4FYDA 3H7HB 4OPHA 4AE5A 2WOMB 5D3GB 1Q79A 5FRNA 5AQYA 2L9DA 4BC4A 1IWAA 3WNEA 2ZH1A 1NO8A 2YHXA 5KG1A 1JXVA 4OX6A 4JV1A 4X64J 1QHTA 3ENQA 2Q97A 4JV5K 1U02A 2UVUA 2QL7B 4WCEL 3M2RB 2EK6A 3B8AX 4KI4A 3GIIA 4LF7K 4LF4J 1Q78A 3TAQA 3PTWA 4NLWA 4P74A 2BE2B 4NA1A 5EX3A 4DV3J 2C2EA 2FQQB 2MGZA 1FJGF 2C3OA 2R7QA 4OL8A 5CYJA 3O3HA 3CIZA 3BO2A 2HHHF 3RW7A 2CVIA 2IIHA 3K57A 2CPZA 2XMVA 4AL7A 4H4MB 2VOPA 1OYDA 1BWVA 5KFTA 1APSA 2JWLA 4ED7A 4BC3A 5IT9U 4JI8F 1EWQA 3SQ1A 2DY9A 4X4PA 5CABA 4FJHA 2A2CA 3RRHA 3VA0A 2EK1A 3SI8A 1GAOA 1TK5A 3SMZA 3I55N 4LSLB 2YX7A 3ET6A 4NX9A 3CMAN 3SUOA 2PZSA 4ED3A 4PYDA 3PYFA 1GLCG 3AVKA 4B3RK 1TP7A 1KTQA 3CD5A 1RTDB 3PACA 3HHLD 3U7JA 1U1QA 4BR2A 4K7QA 1BDGA 4Y0WA 1LFPA 1KVKA 4CZKA 3CCVN 4DG1B 1DQAA 3OYNA 2V2VA 1Y4ZB 3AOAA 3SQOP 4O44A 2X3GA 3KNGA 3NF9A 1S6PA 1REVB 3KK3B 1OS5A 2EPIA 2ZF5O 4F9OA 4P72A 4I1TA 1VQ4S 4BRQA 5IWAK 3MEDA 4OPJA 4JI4J 1DTQA 3GFHA 1OVYA 5TKWA 5C2GA 2Y0BB 4YS2A 1Q0NA 2B4JA 2X7IA 2GMLA 1SC4B 4J2DA 1BHLA 1HBNB 2CQPA 3U9DA 1B64A 4C1NI 3QAEA 5FLXU 1NBWA 5F1XA 3ILJA 2RE1A 1O0PA 3T5LA 3TR8A 1RWKB 4CLTA 4X4QA 4DR4K 5AXMA 1U09A 5J1EB 4CFAA 2OSQA 4N7TA 5KFPA 3O5TB 4JI6J 5F3TA 3UN2A 4YHHK 5F8NA 3M6VA 3KLIB 2E2PA 4A61A 2CJAA 2A42A 1H0HB 4KFBA 4RW4A 1YJNS 3QFPA 3SFGA 3L6QA 4CGIA 4TU7A 3ENBA 3W62A 1R0CB 1X60A 2U1AA 1M5SA 4QCLA 4WU3A 1FX2A 3LTOA 1CBKA 4TSXA 4A47A 3CCJS 4BC7A 5KG0A 3A8JA 4NYFA 2Q6BA 3ZNJ1 2MZJA 5D8HB 2HG4A 4ICLB 4FVUA 4Q8FA 1G6BA 1RBAA 3T19A 3QJJA 1QUPA 3D6FB 1OY6A 3A8EA 3MOJB 4IWVA 2W9BA 4MO5A 2UXDF 2NRXA 3LZJA 4TNOA 3JSRA 2DTUA 4H0PA 2DCUB 2NPFA 2FBXA 1RWMB 3P38A 3DOKA 4LFCF 4Z4HA 2LA4A 2M70A 4CI0B 4DR1J 1JJ2R 3RBZA 4NXNJ 1S22A 3U27A 1JK9B 2BM0A 3TWHA 1UL3A 4I6AA 4GV6A 3G8SA 3ET6B 5CZ2A 2CJYB 3MFIA 3BN4A 4Z4FA 3SXLA 2ZFHA 1LK5A 3KG4A 2A6OA 3NH2A 5DS7A 2AQ4A 2AZ3A 3EZ5A 2CJXB 2MJNA 3H98A 5ADXH 2FYXA 2LA6A 4WK1A 1PILA 3ZSOA 4K4TA 4O44B 1UETA 1S6PB 4OPKA 2RB7A 4CJVA 4JI3J 1RKJA 5CZ1A 4CIEA 4JI1F 1LW2B 3DU5A 5LJ5Y 4DV2F 3BDEA 1IR0A 2RUGA 3TAGA 3MEDB 1WI6A 3VQAA 3MAAA 2BBEA 1FRJA 4Q44A 2YPYA 2CZVC 5AZIA 2HBYB 4M1KA 4FZYA 4CEZA 1HMVA 4ID5B 4X62K 4A8XA 4FYWB 1SQFA 1GEHA 2NXNA 2J6SA 1BQXA 2WVFA 4NYPA 4B3OA 1S48A 2CJ9A 4OHWA 3HJFA 2QG9B 1LWEA 3QFHA 3R8YA 3OYIA 2JEGA 2G0IA 3OYJA 1QHAA 2JC1A 2O8BA 2GTDA 4OGCA 5KT3A 5AQXA 3A2FA 2UZAA 3QZ8A 3CJ7A 2IJRA 4DL3A 1LXJA 3W65A 1VQLN 1KR4A 4N76A 3WEEA 4EZ9A 3CCES 2YNIA 1UZDA 3QB0A 3WZ0A 3T5JA 3PFEA 2X3DA 3X1LB 3MN5A 3TAPA 1RAHB 1PC4A 2IMOA 2DTJA 5LL6Z 4L3QA 1RWPB 2ZWPA 1I94K 3NG8A 4BWJA 4KQZA 2DEIA 1NKEA 1ESVA 3P45B 2W9BB 4FK0A 1XNRJ 2CJKA 1PJ7A 1T3NA 3WXLA 3DOKB 1Y9OA 1F9FA 3LA0A 1GLBG 4EYHB 1YITN 1LK7A 3NFAA 1XMQJ 2ZJRQ 2DGQA 4BQZA 4ZN1A 2VWBA 3L7UA 2DEJA 3U1NA 4F25A 4JK9A 4B3MJ 4B9UA 2KDOA 3GDQA 4U9RA 2ROPA 2O1PA 1DAXA 2DH8A 3BM7A 3NGZA 1NG9A 3Q8SB 4FLVA 1AFIA 3W9HA 1YRUA 2V5HG 1XHZA 4E1JA 1ZC6A 1IBLK 4C23A 4C8OA 2CNOB 4A62A 5JS2A 1NPRA 2W2PP 4K0KJ 1IM6A 3GL1A 2X1FA 4CF1A 2E7XA 3GIRA 3WNGA 3K2YA 3SUPA 2B9EA 4RW8B 5HMZA 3MAAB 3JQKA 4M5NA 4C2MA 1RHKB 2MKKA 1HMVB 2FPHX 1GXLA 3C6HA 4PA1A 1VHIA 1IJEB 4KAIA 4PXEA 3G82A 3AJ1A 1WC3A 4ECZA 3T9NA 4WFNQ 5GINA 3CCRN 4EBCA 4B3OB 2V34A 2W2NP 4HTLA 5BPNA 1LWEB 2VL1A 1FKPB 2IM1A 4CJ3A 2RDIA 4D3GA 2VPYB 4FJ8A 1GMVA 2POKA 4F7VA 3BR9A 5LMUF 4H4KA 3WQTA 3V2UC 1RT1B 4DL0C 1ZPVA 2E29A 5KFUA 4Y34A 1RA6A 2YNIB 3AD7C 4KHPF 3A13A 2EWSA 2WB4A 5AQFA 4EO8A 2RQMA 2CNLB 2MQMA 2GS8A 2R9LA 3G6VA 4CM0A 1N48A 2MKCA 4JKHA 3ZT3A 2E5LJ 4LH4A 1GLDG 3ZSQA 4K59A 2DISA 4ZOSA 5DQGA 2EBEA 1ZAVA 1U26A 2V9KA 3QRPA 2CPHA 2CJBA 1WWHA 3AVJA 1SQGA 3VWSA 3P4IA 1E4GT 1CJTB 3C6AA 1YRTA 3MECA 1T9VA 3MX5A 2UXCJ 4C6AA 3ZC4A 3O1WA 3D0HE 2RH3A 3KFWX 1KVIA 1SVDA 3Q8VA 2E9TA 2IRUA 2NXJA 2X51A 1Y5LB 3M8ZA 2QJ3A 4E7IA 1VQ9S 3CJQA 3OR1A 3AY0A 3OTEA 5AJ3J 1MN7A 2WZ1A 2ZHOA 2B0GA 4I56A 1VQMS 3VAMA 2DGUA 1N36J 3CXCM 2MXYA 1M5PC 3ZTPA 3PW0A 1EQMA 4DPTA 1T02A 1PGZA 1RDBA 4F02A 4TN2A 1NJIT 3NRBA 1H74A 3AVHA 2ATCB 3ATUA 3SMPA 1BQNA 1SV5B 4DU1A 2W41A 2ZD1B 4A8WA 4OKKA 4F50A 3R6MA 2HLTA 2X6NA 2EFPA 1E4FT 4EMDA 2Q36A 5B08A 4OZJA 3PM9A 1SJQA 5ETLA 3HRGA 2ZH7A 5KRTA 3SCXA 3G82B 3PIOQ 2OTJN 2QWQA 3AQOA 2QA4S 3VEOA 1KOHA 2VCPA 2OJ3A 1RCXB 2MKYA 1HWIA 4JB8B 4CGGA 4BRMA 3BO3A 4XIUA 5A6PA 5HMWA 5GAGI 3N4QA 4MKVA 2D0AA 2KHDA 4IXCA 2A18A 2Z2LA 2YWWA 3TZZA 1WAJA 4IQXA 3RW6A 4FWKA 5DQHA 2NRWA 4DUTA 1ZM3A 3FFIB 4FXWA 2MHNA 1NLVA 2GFFA 3HFKA 1VI7A 5F8LA 1DLOA 4MK9A 2R8HA 4LQ9A 4LR8A 4M95A 3NBPB 4CH0S 2ITMA 1KQSM 1F5AA 4JV0A 4Y2MA 2FB0A 4KO0A 3B82A 4EZ6A 5DZ7A 1IBMJ 3MM7B