3NBPA

Hiv-1 reverse transcriptase with aminopyrimidine inhibitor 2
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
557
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Transferase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 155
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3nbpA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nbpA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nbpA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nbpA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nbpA05
2HWIA 3TARA 4WZMA 4PWDB 1S9EA 3LP1B 3G6VA 3OLBA 1XI1A 4K50A 3ZT1A 4DTPA 4B9TA 4CJPA 1VRUB 4RNFA 3T5HA 1KLMA 1TK5A 1D5AA 3LAMA 4BDPA 4ZP7A 1T05A 1JXEA 1S6QB 5KG1A 3QIPA 3AVFA 4OLBA 4M42A 1RYSA 4WYWA 2IAJA 1BHLA 4ECSA 1FXXA 3NAIA 5KFGA 2D41A 3HVTA 5KT7A 2D3ZA 3C6TB 3HL8A 2HHTA 3DLKA 1ASWA 4FW1A 2D7SA 2ASJA 1RTDA 1S5JA 4Q8FA 4ID1A 2PYJA 3SV4A 1LWCB 2WONB 1C1BB 3OYGA 3RB0A 1IKVA 3VQAA 2ATQA 2PYLA 2YNFB 2BDPA 4ZPCA 4FCYA 4M3WA 5J1EB 4LSLB 2FBXA 1HPZA 1S9EB 3NF9A 1SH2A 4R0EA 5C25B 5I3UB 1L3VA 3CJ3A 4OGCA 1RDDA 4WE1B 2HHUA 2AX1A 3DOKA 4CEZA 4TY8B 3GIKA 4EBCA 3LDSA 3HJFA 1RT1B 1BIZA 3VQ4A 1RA6A 3AVCA 4CGDA 2F8SA 3HVWA 5KFRA 5KG5A 4M94A 4DFPA 2GBZA 1MU2A 3LPUA 3IN5A 1BQMA 1NJZA 1N6QB 1Z4UA 3QIDA 4NLDA 3M9NB 2IGIA 4FJ5A 1NK0A 5JS1A 3M8PA 3SPZA 1HYVA 3HM9A 4KB7A 1TL3B 4CF8A 1TL1B 1HYZA 1GX5A 1DLOB 3MR6A 4CHZA 4DL6A 3F73A 1IKXB 3OYMA 1NOYA 1TK0A 1D1UA 2A1RA 3GV7B 3T3FA 2XCAA 4B9SA 1S1TB 4BWJA 3DDKA 1WAJA 3HP6A 4NCBA 3OS0A 4CHPA 3QESA 4M45A 3FRZA 2D3UA 1KHVA 3PR4A 2FBYA 3QEVA 4K4ZA 3NGDA 4DTOA 4GMJB 2B5JB 1VK0A 3ZT3A 1ZTTA 2ZD1A 4WE1A 2C2DA 1EXQA 1NK9A 4Y2CA 1CZ9A 1U09A 4E7JA 3ZSQA 3D28A 3H59A 2C2EA 2HVIA 3OYCA 3MEDA 1TKZB 4FLVA 3V9WA 3V6DB 1C2PA 1VSDA 2D5RA 1SL2A 4FZYA 3NF6A 4IFVA 4DTJA 2AQ4A 1K1QA 4FK4A 3GILA 2HWHA 1SV5A 2R8GA 4CF1A 1TL3A 1TL1A 4CJEA 4KHRA 1N56A 3AVIA 4I7FB 1U48A 4M3XA 1Z25A 2Q3SA 2W8LA 5KG7A 3NMAA 1WSEA 3TAMA 3NF7A 4K4SA 5DMRA 4J2BA 3KTQA 1FKOB 1HQUB 1J54A 5T7BA 2OPQB 4N76A 4DQRA 5KFXA 3SUOA 3WNFA 5KT3A 2FBVA 2G8VA 1VSKA 3AV9A 2OZSA 1T03A 4F2RA 3CDWA 3MECB 2B5JA 4IOBA 2VG6B 1RT3A 1HQEA 4ECWA 4BE1A 3RR8A 1CXUA 1LV5A 3LWMA 1S1WB 3BGRA 2FC0A 3KLHB 5KG2A 1RTHA 3OL6A 1C0UA 4E1MA 4RW6B 4DEZA 4DTSA 4B9MA 2R2TA 4AHTA 2G8WA 4MK9A 1NJXA 3V6DA 3M8QB 4TSXA 4Z0UA 3L2RA 4DSKA 5DG7A 3KHGA 4F4ZA 5CY4A 3IRXB 3CFPA 1SKWA 4RUAA 3OYKA 5EU7A 2IM3A 4FJNA 3IGNA 5JUMA 3THVA 1L3TA 1JL2A 1R0AA 4NCAA 4CHNA 4URGA 2FBTA 1JLFA 2B6AA 3DLEB 1L3SA 1ZYQA 3AA3A 1WSHA 3MEGB 3OYIA 4I7FA 1RT6A 1J53A 4E1NA 4ZPDA 4IBNA 1TVRB 2BE2A 2ZQBA 3I5BA 1WNSA 3PV8A 4YFUA 1NOZA 4J9RA 4DSIA 4FJ9A 5KFYA 2VG7A 2ALZA 1N5YA 2P5OA 3GIJA 1BI4A 3I8DA 4OJRA 3ZSOA 3T5JA 4OKEA 5HBMA 3NH0A 4IH7A 1BQNB 4CGGA 2HVHA 4RW4B 3MEEA 4CFDA 4YMEA 3KHLA 2AX0A 2BANB 1RT3B 1KFDA 3QEPA 4MQ3A 3VA0A 4J9LA 4URQU 4GVMA 3LPTA 4FM1A 1NK8A 3LZIA 1S49A 3DRSB 4FJ7A 2W9BB 3OYNA 5KFAA 3VQPA 2XY7A 3K5MA 1I3AA 1RTJB 5DG9A 5HLFB 1C0TA 4CK2A 2F8TA 4J9OA 1RT7A 2YNGA 4RW9A 2F8EX 4EBEA 1TKDA 4DU1A 3D45A 2CJQA 4CFCA 3OYBA 4WFZA 1JLFB 4TQSA 3K5OA 3OL9A 3MEGA 3I0SA 3MR3A 2BQRA 3HVAA 3MXIA 4NLTA 3KKRA 1RT4B 3KHHA 1UWBB 2ZE2B 3BQ2A 5F8HA 5SWMA 2JEFA 1D9FA 1BI4B 1L5UA 4Z4GA 5F8GA 4EYIB 3TAPA 4HCCA 1QQCA 5FRMA 5KFCA 3V1RA 3LWLA 1QSSA 2WK4A 4ZPAA 4NCGB 4W5OA 3IS9B 4E19A 2OPRA 3T1AA 2E6MA 2J6TA 4DG1A 2VG5B 5KG4A 5J2NA 3HVRA 3M8SA 3DRPA 4FLTA 4HUEA 5F9NA 5F8NA 1WN7A 2Z1JA 3OYEA 4MK8A 1S4FA 2AWZA 4QCLA 4M3TA 1RTJA 1JX4A 3ICLA 4MFBA 3CWJA 4RW8B 2UVVA 1ITGA 5KFUA 3TI0A 4GC7A 5F8IA 4F2SA 3DMJB 3H98A 1WNEA 4ZTFA 1LW0A 5K14B 3KMQA 3D0PA 1RILA 3M9MB 3DYAB 2QK9A 2KFNA 4B9LA 4H4MB 5J2PB 3U6FA 1NKEA 4QAGA 1NK7A 5KFOA 5D3GB 3G6XA 3L2WA 4FJ8A 3C95A 3SUQA 4PQUA 4Y1CA 4LQ9A 5HRNA 4ED6A 2FJVA 5L1KA 1SL1A 4DTMA 5DQGA 3OYFA 3QGGA 4J9KA 3LP0B 3VA3A 4CJRA 2RPIA 4WXOA 3KJVA 1WSJA 1EP4A 5DK5A 3MXMA 3KK1B 2HNYB 4NCGA 3OYAA 3ASMA 1LAVA 1KLMB 2VG5A 3QNOA 4FJGA 3T5KA 1JLCA 1KVCA 3DRPB 5KT2A 1C1CA 4NLOA 4TQRA 3HYFA 4JLHA 4YR3A 4YP3A 3AVMA 3HT3A 4IG0B 3HVTB 2HHQA 4AHSA 2Y1IA 2G8IA 3VQ6A 5CYMA 3DLGB 3PW5A 4KB1A 4O4GB 4KI6A 1YVFA 1TAUA 4F8RA 3WNHA 4RW7A 1NKCA 1BCOA 4JRPA 1LW0B 4DL7A 4CCHA 3DYAA 2Z1IA 1IKYB 2IJFA 1U47A 4LD0A 3MR2A 3C6UB 4CK1A 1NK5A 3ISND 4F50A 5D3GA 4Q0BB 4N41A 4FS1A 2AJQA 1QE1B 2V0NA 2DY4A 2WTFA 3LZJA 3CDEA 4KTQA 4NLYA 2BQ3A 3AVNA 1RBTA 5KFPA 3LP0A 3KK3A 4PY5A 4EP5A 4N56A 2ASLA 1JLEA 1HYSA 1XR5A 4OPKA 4EZ9A 1LWEA 4CERA 1QHTA 3AVLA 3BJYA 2C2RA 3AVAA 5F8LA 3S3NA 2OYQA 3F9KA 1RT1A 1RAJA 4DFMA 5KFTA 1S48A 4KO0B 3KOAA 3LAKA 4KFBA 2BR0A 5CYQA 3TAFA 2IMWP 1J5OB 1X1PA 3FSIA 4URSA 4B9NA 4DU3A 2X6NA 4KPYA 4GW6A 3H2LA 4RNHA 5KG6A 4HTUA 1MMLA 3VQ7A 4B3OB 5FDLB 4RU9A 2V9WA 1DLOA 4RG8A 4CEFA 4WFYA 3HPGA 3PX0A 3MFIA 4Y3CA 4J9PA 2OPPA 4QPXA 5HROB 4FLZA 1TV6A 3RR7A 1EETA 3C6UA 4Q5VA 1Q9XA 3AO2A 4NZ0A 4NLXA 4AHCA 2UVUA 4QW9A 2IC3B 2E9ZA 2FVQA 3ZSRA 1N48A 5EWEA 3TQ1A 3QETA 1HNIB 1HYSB 4FJJA 3PW4A 4QWBA 3HPOA 1XHZA 4CF2A 3O3FA 4IFYA 1WLJA 4DL2A 3JYTA 3QO9B 4AILC 5KT6A 4NLRA 4C8MA 1NHUA 3MXJA 3L8BA 1ZBUA 3BSAA 4H8KA 4FZZA 3TAGA 2EX3A 3GIIA 1YT3A 1GOBA 2HW3A 5CYQB 3LALA 5HRPA 3RMBA 4I2PB 4CJ5A 3NCIA 1NK6A 4E7IA 2HHWA 3DM2B 3QZ7A 1K6YA 3PX4A 5KGWA 3D5MA 3U3YA 1C1BA 3KK2A 5KFBA 4RZRA 4Q45A 2GIRA 5JXSA 3EYZA 4DLGA 2AGOA 4F4KA 4I2QA 1JLBA 3KLIA 4CFAA 3AO5A 5J1EA 2OPPB 2B43A 4W5NA 3KLGA 4LSLA 1TV6B 3QGHA 2PY5A 2AGQA 4O4RA 5KG0A 3OS1A 4QOZB 5L1IA 4CEAA 5KFDA 2KZMA 2BQUA 4BWMA 3AA2A 4B8AB 4CE9A 4DF4A 1RDBA 4DWIA 1HARA 3RB4A 2BRKA 5JS2A 2G8HA 2IC3A 3RB6A 4J9MA 4FLXA 3V4IB 2JEGA 5KT5A 3CIZA 1RDRA 3OL8A 1U04A 4CF0A 4E0DA 4CJUA 3QO9A 4IH6A 3H5XA 1S1WA 3KLHA 1S97A 5DLFA 1TK8A 1JLAB 4E89A 1S1VA 2BRLA 1FKPB 3LP1A 5I42B 5KRSA 3GV5B 2IM1A 4QWDA 5KI6A 1CSJA 3TR8A 1F21A 1UA0A 3FFIA 3G0ZA 1T05B 1S6QA 4FBTA 2OZMA 2HMIB 4MIBA 3B6OA 4F3OA 1S1TA 4I9LA 4IG3A 3H5UA 3V9UA 3GYNA 3AVJA 4XPEA 4YR0A 2W7PA 1TVRA 3DLKB 4EEYA 3SFGA 3BQ1A 4ECXA 5KFSA 3VQEA 4FJHA 4K4WA 3AA5X 1S9GB 1SKRA 4CEEA 3KLFA 1WAFA 1VRTA 1RTDB 4RNOA 3VQCA 1CLQA 2I5JA 1BL3A 1RCHA 2YHBA 1TKXA 2YKMA 3DI6A 4HYKA 2YNHB 4K8ZA 4K4VA 3PW0A 2ITGA 4EZ6A 3MEDB 4CGFA 4Y2AA 2D0AA 5C24A 1GOCA 3T5LA 3KHRA 3V6KA 4K4YA 3TABA 4IFVB 3RB3A 3K2PA 2IOCA 2D0BA 1S1VB 2HAIA 2ZKUA 1HNVA 3NBPB 3VQSA 1Z26A 4CEOA 3ZCMA 3GQCA 5C25A 5I3UA 1JLGA 4ZTJA 3BQ0A 1J9AA 3B6PA 4KHMA 2W42A 2XRIA 3PR5B 2IA6A 3FFIB 3FQKA 3NGIA 4AHVA 2XCPA 3BDPA 3WNEA 3Q8PB 2OPSB 3MF5A 1TAQA 3NAEA 4FBUA 1XR6A 4DSLA 4KKOA 3QEIA 1MU2B 1JL1A 4QWAA 1N6QA 1ZTWA 1A5WA 2RF2B 3DRRA 4DSJA 3M8PB 2UVWA 4NLPA 4JS5A 1QUVA 3S3OA 3EPGA 2NUBA 4QW8A 4OPJA 2FLLA 4O0JA 3MAQA 1Q9YA 3SI8A 1JLQA 4R5PA 2YNHA 1S6PB 4XIUA 3P1GA 2HNZB 4JS4A 1VSIA 5HP1A 5KRTA 4ELVA 2DPJA 3O4NA 4TXSA 3UIQA 4U7CA 4TLRA 4KV8A 1VSHA 5EWFA 2ETJA 3G6YA 4PUOA 3NFAA 4CECA 1LW2B 3RMAA 3DOLB 4FJIA 5L1JA 2JLEA 1IG9A 3M9OB 2E9RX 1S9FA 3ZT0A 1JLGB 4IRCA 3MFHA 4J9QA 3NAHA 3SPYA 4MFBB 4ED7A 4KTWA 3BSNA 4ZPBA 4EYHB 1JKHA 4N47A 1NNDA 1TKTB 1KVAA 3SQ0A 1TP7A 3S9HA 3HK2A 4CJKA 4HHTA 4ED2A 4NYFA 2KW4A 3IG1A 2AU0A 4MKBA 4MK7A 5J2PA 4E7KA 1UOCA 3RWUA 5KFNA 4RW4A 4FK2A 3NGYA 4CFBA 2W9AA 3V6JA 4Q43A 2IM0A 4XPCA 4O3NA 3E01B 2LSNA 3NGZA 1BIUA 2DFFA 3ZSVA 3M8RA 3KLEA 4NYZA 4BE0A 5HRSA 2IM2A 4DFKA 3RBDA 3OS2A 3KJVB 1EP4B 4ECUA 5E41A 2HNZA 3QLHB 2C28A 3L2QA 3ZT2A 3OHBA 5HLFA 3K57A 3FQLA 3PHEA 4RUCA 4CESA 4EBDA 4Y34A 2E4LA 1ZBIA 1TGOA 3QINA 4UQGA 4KHWA 3ZT4A 3VQBA 4WFXA 2VG6A 4IG0A 4O0IA 1HQEB 4KHYA 2E6LA 4M3ZA 1RBVA 3E51A 3SFUA 4H4OB 3BGRB 4LSNA 3SNNA 2R8KA 4WYLA 1RTHB 3LP2B 1WSFA 4TYBA 1QAJA 2A1SA 4I9QA 4RW7B 1KFSA 1RT4A 4G3IA 2X74A 2DFEA 3PX6A 4OVLA 3M8QA 1BCMA 3KD1E 3UPFA 1IKYA 3V1OA 1KRPA 3SV3A 3H08A 3OJUA 1XWLA 2EHGA 4FVMA 1RNHA 3V81A 4Q0BA 1DTQA 1X9SA 4CJWA 4TN2A 3OVNA 3CJ0A 2ILZA 1KCFA 4NYNA 5KFQA 1VRUA 3IGVA 2YNIB 2OPRB 1NKBA 2GC8A 4OGEA 2V4RA 2RDIA 3G86A 3QYYA 2HNDA 4C8NA 2W9CB 3HKWA 3UDLA 4NLUA 4FK0A 2X78A 3NDKA 2IAJB 3OY9A 3V9ZA 4O44A 1HJRA 5HRRA 1S1XB 2Y1JA 5KFMA 1LWEB 2VG7B 3H4DA 2C22A 2UUTA 3KNAA 1XC9A 3AVGA 2J6UA 3VQDA 3TANA 4KB0A 5HBMB 4CGIA 4ZHRA 3AA4A 1GX6A 3CM5A 4CGHA 1IM4A 2E9TA 4MIAA 4KO0A 2GV9A 2EC0A 1RT5A 1T7PA 1LWFA 3LP2A 4YNQA 3U3GA 3RAQA 2W9BA 3SUNA 1KLNA 4B3OA 2RDJA 1VSLA 3ZSXA 3V9XA 4C8LA 4Z4FA 2XHBA 5F9LA 1CZBA 4F4WA 4CHQA 3NKYA 1HPZB 3VQ5A 1EETB 1RT7B 1RTIB 3V81B 4DF8A 4IH5A 4O3QA 1S1UA 1JIHA 4IDKA 3N6MA 1C0MA 4CJ3A 3DOKB 4R8UB 2YKNA 3KKSA 4LQ3A 3V6HA 3OL7A 4DL5A 1C1CB 3HHKA 4QWEA 4O44B 2ZE2A 2OA8A 4DTNA 4J9NA 1REVA 1RYRA 4DLEA 2O4IA 2FVSA 3JYTB 3SUPA 2XY8A 5FRNA 4B8CA 2JC1A 2D0CA 3SI6A 5CYMB 3DLGA 4M3YA 3ZSWA 2XC9A 4DSFA 2AGPA 2ATLA 2PZSA 1EX4A 4M95A 2V4QA 1W0HA 3OYHA 1VSMA 3TWHA 3KLVA 3BSOA 5KFJA 4I2PA 1RT5B 5J2NB 2DPIA 4CJVA 3QIPB 5C42B 2W7OA 4ZP6A 4Q44A 4YQWA 4OKJA 3N6NA 4NLWA 4ELUA 2KFZA 1WSIA 4RNMA 2GIQA 3T19A 2WB4A 1VSJA 3I5AA 1HMVB 3S3MA 3CFRA 1S1UB 3DMJA 3NH2A 4IDKB 5K14A 2P5GA 2JC0A 2F96A 1IH7A 4K4UA 4FM0A 4ECTA 4AHUA 2KZZA 3BREA 3V4IA 2YKNB 4FLUA 4K8XA 4DTUA 4CIEA 1IKVB 3MTKA 3VQ9A 4CHYA 1REVB 1VSEA 4KI4A 2I1RA 3OLAA 3CJ5A 1RT2A 4CIGA 5J2MB 2YV0X 1RDAA 3I5CA 1W9HA 1FKPA 5I42A 2KTQA 3HSTB 3KK1A 3PJXA 4NLSA 1KVBA 3K59A 4EO8A 4CEDA 2JEJA 1UAXA 4CJTA 3KIOA 4Z4HA 1XR7A 1SUQB 1Q8IA 4O55A 3EZUA 2VWJA 3HP9A 1ZBHA 2OPQA 4DS5A 3AVHA 3K58A 1ASVA 2WCXA 3TVKA 3BSCA 4W5RA 4TYAA 1T03B 2R7YA 4IKAA 3QZ8A 1HNIA 3PW7A 3L2VA 5DQHA 4DSEA 4CEBA 3PVXA 2XY5A 3QGIA 4MKAA 4JV1A 1U45A 5L1LA 2IBKA 1I6JA 2YKMB 3ZSYA 3GIMA 3SCXA 3I0RB 5KTQA 4J9SA 4B9UA 5EDWA 1D9DA 4O3SA 4DQQA 5DGAA 3SZ2A 4AHRA 2JGUA 4FJKA 4IQXA 4BDZA 4DFJA 1RT2B 3O3GA 1NHVA 3IRXA 3SQ1A 2VWKA 3KK3B 2XI3A 2IDOA 4KHSA 3QEWA 4EP4A 4KAZA 1K1SA 4FJMA 4ELTA 5CZ2A 1A5VA 2B6AB 3DLEA 3EY1A 2ZD1B 4DMNA 2HHVA 1JLBB 3KLIB 3C6TA 1KTQA 4KAIA 4Z4CA 1I39A 3Q8RB 2HHXA 4RNNA 1B92A 4YR2A 4CK3A 1X9WA 1KHWA 5KFLA 1TKZA 4HVJA 3CG7A 4J2DA 4O5BA 5DQIA 4F3TA 1LWCA 1GOAA 2BGGA 2WONA 4XO0A 4O3PA 2FVRA 4X2BA 3MEEB 4J2EA 3H40A 4OLAA 3KD5E 1DTTB 1RBSA 5KFKA 1L3UA 2YNFA 3A2FA 4KE5A 3O4QA 4CGJA 2O4GA 1B9FA 4NRUA 1JLAA 2WHOA 2FVPA 3DLBA 3DLHA 1QSLA 1S6PA 3I0RA 4L8RB 3TAMB 3UR0A 3CDUA 3UQSA 3PZPA 1SKSA 1OS5A 3IAYA 1HQUA 1FKOA 1C0TB 1FK9A 4ID5B 3SQ2A 4KSEB 1SL0A 4KV8B 2YNGB 4TY8A 3C94A 1JXBA 3OYLA 1LW2A 2VA3A 3CYMA 4ICLB 2W8KA 1ZBFA 3MECA 4FYDA 3AO1A 4C8KA 2FLPA 2RKIB 4ZVEA 4IFYB 1QTMA 5KG3A 1BQMB 1ASUA 2FVCA 1C0UB 4RW6A 2FLNA 1SH3A 5F8MA 5KFIA 3LP3A 4W5TA 3OYJA 1S9GA 4H54A 2JEIA 2QKBA 4K4TA 4IR9A 4HUGA 4GC6A 4ECYA 1VRTB 4CJQA 1RBUA 1D8YA 3DM2A 3DI6B 4LH4A 3FDSA 1IKXA 2ILYA 4M3UA 2QE5A 4KHQA 1YTUA 4ED0A 4DS4A 1C6VA 1DTTA 3ULDA 3E01A 4ECZA 5F8JA 3N6LA 1N4LA 1BISA 3KLEB 1RT6B 3H5YA 4FJXA 4JV0A 5KGXA 2BE2B 2HB5A 4LH5A 4DQIA 3ITHB 3OSNA 1S0NA 4Q8EA 1S0OA 3NBPA 1U4BA 2G8UA 3RRHA 4DU4A 3BR9A 3PUFA 2WOMA 1N5YB 2XWYA 3KMSA 5L9XA 1FK9B 4ID5A 4N5SA 1S0MA 5SZTA 4FW2A 3VN5A 4FS2A 2RN2A 4C8OA 2HHSA 2OPSA 3AVKA 3RMDA 4ICLA 3NHGA 2XY6A 4EO6A 1ZBLA 2GUIA 2BANA 4KTZA 4FLWA 2RKIA 3G10A 4Z4IA 4F4YA 4H4OA 4LSNB 4DTXA 3QERA 5DGBA 3TAQA 3DRSA 3AVBA 1QSYA 1SV5B 4IKFA 3K5NA 4KREA 2P51A 1QS4A 3AO4A 1CXQA 1W25A 3SQ4A 3EPIA 1A5XA 1JLQB 4MH8A 4DQPA 2FJXA 1JXLA 2FJWA 1DTQB 5CZ1A 4IRKA 4KHNA 5DLGA 4ED8A 3ZSZA 2HMIA 5KFVA 4B08A 5HP1B 4Z4EA 2VA2A 4WXWA 1O1WA 1YVUA 1G15A 4IG3B 5J2QB 4KHUA 4W5QA 4CF9A 2HNDB 1EKEA 3CFOA 4TY9A 3OSPA 3L2UA 3ALYA 3P83D 3ITHA 5FROA 3CJ4A 4KRFA 3DOLA 4IR1A 1UWBA 1C1AA 2UVRA 4O3RA 4FM2A 4WZQA 3WNGA 2WOMB 4QWCA 3KLFB 2R8IA 1T8EA 3V9SA 2I5JB 1S10A 1TKXB 3VQQA 2XGPA 4NRTA 5KFEA 4BDYA 1JKHB 1TKTA 3L3VA 4G1QA 1X9MA 5C24B 3PJWA 1IO2A 3IG1B 3H4BA 4E7LA 1NJYA 3RAXA 3RRGA 1LAWA 4HUFA 4NLGA 5T14A 4DTRA 4NLQA 1HNVB 4HCBA 1QE1A 4ZP8A 1R0AB 2QKKA 1T3NA 5KFWA 1WSGA 4CHOA 2B4JA 1NK4A 1TQLA 2X6SA 2WRMA 4BACA 2P1JA 4DQSA 1IKWA 3NF8A 4NLVA 4ZP9A 2ASDA 5KFFA 4ECQA 4KKOB 4PA1A 5J2QA 1T94A 4ED3A 4R8UA 1BQNA 2J6SA 2RF2A 3DRRB 4U6PA 4ECRA 3MR5A 2R2UA 2DFHA 2XGQA 4AH9A 3L3UA 4FXDA 2O5DA 4JV2A 1Y97A 4FZXC 5KFZA 3HO1A 4R5PB 5EWGA 2HNYA 4CJLA 3O3HA 1RBRA 1YTAA 4G1QB 1XHXA 4CEQA 4ZMMA 2OH2A 4LY7A 3JSMB 5HROA 1JLCB 3CO9A 4ECVA 4JUZA 4RW9B 3OYDA 5C42A 4PUOB 2QV6A 2IS3A 1HRHA 5KFHA 2R2RA 2YNIA 4JRQA 1UA1A 2G8FA 1U49A 2DTUA 4BE2A 3RBEA 3I0SB 4Y1DA 2W9CA 4O4GA 3CQ8A 1HMVA 3EZ5A 1RDCA 1D0EA 3SYZA 3DLRA 3RMCA 1IKWB 4J2AA 1S1XA 3CJ2A 5EUHA 2R8HA 3K5LA 3GV8B 3QEXA 2UUWA 2XO7A 4IRDA 2CKWA 4PWDA 4ZHRB 3PW2A 1SH0A 4M41A 3H5SA 4CJ4A 3V1QA 3AO3A 4DL4A 3VQ8A 3Q8SB 3NL0A 3IS9A 4OL8A 4M3RA 4ZVGA 2Z1GA 4ED1A 4DG1B 2R8JA 4CJSA 5J2MA 4KBIA 4E7HA 1RA7A 1LWFB 1JLEB 1B9DA 3Q8QB 3KK2B 2KQ2A 2G8KA 4ZVHA 2XI2A 4DL3A 3RTVA 3QLHA 3OJSA 3QIOA 4I2QB 3HXMA 3JSMA 5DG8A 3KLGB 2IJNA 4RW8A 1ZETA 3PY8A 3NE6A 3SJJA 1SUQA 1RTIA 3CM6A 4FJLA 2Z1HA 4B9VA 1BGXT 3QNNA 3ISNC 5C5JA 1NJWA 4OKKA 4CJFA 3NH1A 4F4XA 4KFBB 3CVKA 4CIFA 4O3OA 3P5JA 4H4MA 1VSFA 1J5OA 3PO5A 3PO4A 5KT4A 4HKQA 1QAIA 2QXFA 2YHAA 3HPHA 4PQUB 5FDLA 3TAEA 3OHAA 1KSPA 4FLYA 4K4XA 4ZVFA 3LANA 2R2SA 4E3SA
chains in the Genus database with same CATH superfamily
1ZPWX 7AT1B 5IC6B 1S9EA 4WFBL 4JKHA 3LP1B 3G6VA 2CYYA 4OYXA 4PHTX 5M1QA 4K50A 3D1HA 4B9TA 4WBFA 4MMOA 3K2YA 4ZVRB 3CXCR 3T5HA 2JVOA 1LNQA 1BHNA 1JXEA 3QIPA 3AVFA 3AA8A 5D8HB 4M42A 3T9NA 1RYSA 1O8BA 2AEMA 2IAJA 1WOQA 2CDRB 2B3TB 5KFGA 4CBUA 4HTLA 4Q7AA 5KT7A 4PKHA 4CLLA 2M3DA 2JLGA 1UFWA 3ULEB 5AE1A 5GAGP 1KVIA 1ASWA 4WQ5C 1PYSB 3MM8A 2ASJA 5JVGQ 1RTDA 3AXKA 2PYJA 5HMXA 2R7VA 2L9NA 4P73A 1RLDA 4LF9J 1VQMS 2KYZA 3Q2SC 2LEBA 1OYDA 2PYLA 2BDPA 2OO4A 3M1VA 2FBXA 2L9DA 3KUEA 1J27A 4YB6A 2R7QA 5CZVA 1NDKA 1ZM4A 2Q2RA 5C25B 5I3UB 2MKYA 4KY3A 2HHUA 2YWHA 4C9DA 3UCZP 3LTOA 5HVHA 2MY8A 4TY8B 2XQCA 3DC2A 1N32J 4EBCA 3LDSA 3HJFA 4JI2J 1RT1B 3VQ4A 1RA6A 3AVCA 3MMCB 4CGDA 5KG5A 2E8AA 4WK3A 4DFPA 2GBZA 1MU2A 3LPUA 4EUVA 1WEZA 2KRBA 1YAGA 1QQMA 1N6QB 2RB7A 4U67L 3SIPB 3QIDA 2GIFA 3T9ZA 2NUHA 1NK0A 4CNZA 3HM9A 3I33A 1HYZA 1GMWA 3HBTA 2V9KA 2YVSA 3UB5A 2ZBRA 3F73A 3SAHA 2WSFC 3UW1A 3T3FA 4P2XA 4G1IA 4B9SA 1S1TB 3FK4A 2ZJPQ 1ZA2B 4BWJA 2UXBJ 4NCBA 2EFVA 3QESA 1OIAA 2DNLA 4M45A 2D3UA 1KHVA 3QEVA 1CJKA 1VRQC 2ZH9A 1NGHA 2DR6A 4GMJB 4Z94A 2ZBCA 2P9SA 1VQMN 5DS7A 1ZTTA 5JVHQ 4M7YA 4I56A 4CLUA 2QJ3A 1WBDA 2CAJA 2Q97A 2R7XA 2L9WA 2UUAK 1SAZA 3LA0A 4C98A 3MURP 3EZOA 4DU8A 4YB1P 2XTJP 1IVZA 4JP8A 3QFUA 2YKPA 1PYOB 1W26A 2RUGA 4DTJA 3A3NB 3VGUA 3HHLA 4U9RA 3GE1A 4QS8A 5ETRA 2CIMA 4H0YB 2R8GA 1TL3A 3OTDA 2BKOA 1ILYA 4AL7A 4JNEA 1N56A 2HBMA 1FEHA 1ESVA 3C19A 4X65J 5CHIA 2MQQA 2Q3SA 2LA6A 5KG7A 2UUCK 3NMAA 3EWGA 1WSEA 4K4SA 4PYDA 4F04B 1BO5O 1JCGA 3ENBA 1V3ZA 3MAAA 3QNWB 5FLXU 5KT3A 2E44A 5LMNJ 3AAPA 3ZEUA 1VSKA 1CBKA 3AV9A 1K9MT 2OZSA 1YJNN 2H48B 2CQ3A 2MPUA 1YJTA 3MECB 2B5JA 4NZ6A 1GEHA 2VG6B 2FZKB 3RR8A 1GFWB 4AQYJ 1RGIA 4E1MA 4RW6B 3AA9A 3RW7A 4RPFA 4MK9A 3P8BB 2M52A 1UJ4A 1KOHA 5F0UA 3RYLA 4DSKA 2PFDA 3AGRA 1R8PA 1S72S 2GO9A 5CY4A 2WBNA 2WVDA 3O9QA 4DV1K 1F60B 4OV1A 2YY3A 3CMES 3IGNA 5B0BA 4CHNA 2R4FA 4RBTA 2B6AA 1BY9A 1NJIO 3AA3A 2JSXA 4I7FA 1RT6A 2ZQBA 3I5BA 4DDFA 2E1AA 3IBFB 3JAMU 3H1QA 4CZIA 5B0DA 2VG7A 2J0XA 2ALZA 1RBOB 2Y1RI 2LQJA 1X0PA 4USMA 1ZXOA 3GYGA 3W2WB 3ZSOA 4PPZA 1H7XA 3NH0A 4CGGA 1RWVB 2X1AA 2XWXA 3F41A 1SC6A 2AX0A 1KFDA 2CPEA 1RAOA 4OPHA 1PKUA 3VA0A 2VOPA 2XYPB 4FWRA 3EGVA 3DRSB 4FJ7A 3NY0A 2XY7A 4NYOA 4BC2A 2RMLA 3O1BA 1I94K 2IIHA 5HLFB 2IVNA 1KKHA 1YWXA 2F8TA 4DV5J 4RW9A 1TKDA 4DU1A 3CDBA 3OYBA 2QL7B 1V4TA 1JLFB 2E5LF 3L9ZA 3I0SA 1ATRA 2YJEA 5HSPA 1UL3A 1OH7A 2QWNA 3M8ZA 1FW6A 3HVAA 3HULA 3MXIA 1WTBA 3J7A1 1RT4B 1UWBB 1B0PA 2HQFA 3QBCA 3BQ2A 3R5AA 2YHXA 2NRHA 1FNXH 1N0UA 3MDQA 1L5UA 4FWNA 4H5RA 1A7GE 3TAPA 4AL6A 1P9YA 4DBQA 1U7LA 4WJBA 3H1VX 1QSSA 3CJQA 2ZJQL 4FPIA 2VICA 3ZFVA 2VQEF 4E19A 4I68A 2V4JB 2J6TA 3FNNA 4UUWA 3TEHB 1RKIA 1R3NA 3HVRA 4KHPJ 4HUEA 2IYIA 3E9OA 4MK8A 2FC9A 2AWZA 2Q0UA 4QCLA 4PL8A 4M3TA 4CD1A 1KEKA 1RTJA 3VGLA 4JI1K 3CWJA 1ITGA 1WACA 4CH7A 5KFUA 2D74B 2F4VK 2ADBA 1U2VA 4C3KA 2XHCA 3UWTA 3H98A 1NGAA 1LW0A 5K14B 3KMQA 2BOAA 5DM7L 3M9MB 3DYAB 2KFNA 4DV0F 2ZJQQ 3K9JA 1NKEA 5CYJA 1NK7A 1VQSA 4QPTA 5KFOA 1RK8A 3CMEN 4FJ8A 1DARA 4E8UA 3N79A 2GVZA 4R25A 3OYFA 4XK8C 4OHWA 3ZZYA 3LP0B 3OW2R 2C3OA 5E2QA 3CCVN 4KBOA 1J2VA 2CPHA 4NCGA 3H42A 2HWTA 2Y8YA 5DM6L 3D9BA 5D0RA 4CLPA 5DM7Q 1KLMB 4NZ7A 1XMQF 4HDHA 2VG5A 5LXRA 3QNOA 2MEWA 1JLCA 3Q24A 4YDDB 4BVPA 3DRPB 1UVLA 1SJQA 3O9TA 1G1XA 4TQRA 5ETKA 4YR3A 4UOGA 8RUCA 4CM2A 3HVTB 3SCKE 3IR6B 4B3RK 2Y1IA 5AJ3F 2G8IA 1F0XA 4HTJA 2V51B 4F26A 4F8RA 3MR7A 1NKCA 4BRIA 1N5TA 4FWSA 4LRBA 3FUYA 5BRFA 4L75A 3R5JB 4CD3A 1AUSL 2B9YA 1NBWA 2IJFA 3A8EA 1U47A 5H9EK 2VQEK 3OA9A 1HNZJ 4F50A 4Q0BB 1WBBA 3D68A 5A76A 2V8VA 2V0NA 3LZJA 1WEXA 3CDEA 4KTQA 2DY1A 5KFPA 1O13A 4PY5A 4N56A 2NZTA 2ZZMA 1BXNA 2HHHK 1BUPA 4EZ9A 1HNZF 4EIAA 3IC1A 3AVLA 4HT7A 2C2RA 4R79A 5EX0A 3DXBA 1MN9A 3W2VB 2M8HA 5F8LA 3S3NA 1ZAWA 2U1AA 3ZTRA 3F9KA 1RT1A 1RAJA 3DU6A 2H3EB 5LJ5Y 1S48A 3M30B 3KOAA 5HATA 4KFBA 4LSZB 2YKOA 3ZX3A 4BREA 1G7CB 2ZC3A 3OBIA 2IMWP 3FSIA 4K42A 2HS0A 4JI7J 4LF9F 4B9NA 2D9PA 2MLYA 2RVJA 1MMLA 3VQ7A 3HSZA 3RSEB 4E2FB 1RAGB 2V9WA 3FCVA 3E2EA 1Y9OA 4IXCA 4RG8A 4CEFA 4Y3CA 4J9PA 2XYHB 1EETA 1Q4RA 2G1HA 1Q9XA 4OI1A 4FF4A 4JHDB 2ZOFA 1JNZB 3BF1A 4X66J 1YQHA 2RHKA 3QFPA 2CADA 2QWOA 1PIEA 5CR4A 1KD1O 2FZGB 2VGNA 4FJJA 3HPOA 2Z58B 3UR3C 2JZ5A 1YJWN 1WLJA 2ZH8A 3RGIA 2KJVA 2IDLA 5CAAA 3QO9B 4N8OA 1WSVA 4IZ9A 4AILC 2YHWA 1FO1A 2EX3A 5KAKA 4JAXA 1X5SA 2LU1A 4DX7A 5HRPA 4U67Q 2O8BA 3DM2B 2IVFB 4E1JA 1N54B 3M05A 4FPAA 2ZOGA 2NNWA 5D4PA 3EYZA 5CA5A 2P9IA 2AGOA 2W2QP 5T41A 3AO5A 2W25A 5K8NA 1T9UA 4LSLA 1T9TA 2AGQA 3C8YA 1RZMA 2NXCA 2BQUA 3BZKA 5AQOA 4K5RA 1N33J 3AA2A 4B8AB 1HARA 4A5AA 1HBOA 4UTGA 4YY3F 1NDPA 2VDHA 1N8RT 2Z4PA 3KFWX 3V4IB 4F0MA 3U1LA 3QJLA 1TUWA 3CIZA 3U02A 2LP4A 5E26A 3OL8A 1U04A 4DV3K 4DV6F 4E0DA 2FY1A 4AM6A 1X3NA 1TK8A 1K73T 2H5IB 3SMZA 3UNGC 4UT4A 1FKPB 3CMAN 1C4AA 4Y0WA 3QWUA 3TR8A 3MOJB 3R6MA 4MTPA 1F21A 1JMTA 3KJQB 2XSFA 1T05B 5H1SQ 2H1YA 1VQ9N 2HGLA 2OTLN 4MIBA 3KWIA 3AB4B 2IJRA 2UUCF 1SJ4P 4I9LA 1DFDA 2FB0A 3EDRB 4ECXA 4DPTA 3VQEA 4K4WA 3L3CA 4IQMA 3VQCA 2I5JA 1RCHA 1VQLS 4GKJK 2GHPA 2BZ2A 2GHVC 3KWMA 3CC2N 4K4VA 3PW0A 4EZ6A 1W7AA 2CPXA 3BB5A 3VZIA 3W5XA 3KHRA 2MKCA 1YKWA 4K4YA 4IFVB 2XG8A 5LM7E 3A8IA 4Y00A 3RB3A 2DCUB 3DHWC 2QA4G 2ZKUA 2RU9A 3VQSA 4CEOA 3ZCMA 3S01A 3GQCA 3NOGA 3W7BA 2E1PA 3R97A 3ETMA 1GLAG 3PR5B 2IA6A 1KTVA 3WNEA 5AJ3J 2OPSB 1FWLA 2A3JA 4DSLA 2PDAA 1QD1A 1Y5LB 4JKFA 2IIRA 5BJRA 3M8WA 3HD2A 5A2QY 2CNKB 4NXMJ 3O1LA 3DRRA 2OGUA 2OTJS 2N7CA 3OT9A 2VV5A 1EWQA 4JS5A 1QUVA 1NDLA 2LEPA 4IO9L 1BQXA 3SK3A 4JI3F 4OPJA 1DRZA 2M0GB 2OSQA 1G2EA 3J81O 1N32F 1EO1A 3BGLA 3BDEA 3P1GA 5EN1A 4JS4A 3I56N 5JVGL 2DPJA 3SQOP 2DR8A 2ETJA 3G6YA 1D4XA 3HSGA 5DRKA 4CLTA 3ZT0A 1JLGB 1Q53A 4IRCA 4JKAA 3NAHA 4QQBA 2RILA 4Y2IA 4WF9L 2ZJPL 1P27B 4H03B 1JKHA 4MKVA 1NNDA 4S0MA 3VEZA 5CH7B 2RJZA 3HK2A 1AROP 4CJKA 4PZVA 2DRAA 2KW4A 4USHA 4JI5J 4E7KA 1KC8T 1UOCA 3TZWA 3D6FB 5KFNA 4RW4A 1CJTA 5H9FK 1RBLA 3NGYA 2R7UA 2B8PA 5AQXA 1KR4A 4O3NA 3E01B 1Q8KA 3NGZA 1VQ8S 4NYZA 5AQLA 4DCOB 2A10A 3RBDA 1FX2A 4LIWA 5E41A 3MEKA 4GKKJ 2J0QD 2A42A 1RHMB 3QLHB 2C28A 2V50A 4FWQA 2IHR1 3K57A 1KVKA 1KNZA 3NP5A 2P9UA 2RE1A 3KYLA 4BRCA 1F6TA 1TGOA 3QICA 3QINA 4DPYA 4O0IA 2EFGA 4P2MA 1RBVA 3E51A 4CLKA 1MN7A 2M7SA 2KT5A 4KPCA 1WSFA 2A1SA 4ANDA 1RTZA 2PE8A 1J6ZA 1RWPB 3WUHA 3M8QA 1BCMA 2BM0A 3KD1E 3UPFA 1IKYA 3Q7BA 3SV3A 1XWLA 4FVMA 2EHGA 3ENAA 1XIQA 3BGUA 1RNHA 3V81A 4Q0BA 1DTQA 2XYGB 3BF4A 1UPPA 3VF4A 5KFQA 2YNIB 2OPRB 4OGEA 3A8KA 2Y8WA 2HNDA 3HKWA 1U2RA 4OJHA 1WHWA 5K8PA 4FK0A 1PILA 2IAJB 3OY9A 1Q82T 5AZJB 1LWEB 5GADI 2UUTA 1FJEB 4FKXA 1VQOS 3TANA 4X65F 3ET6B 2PD1A 2UV8G 2VQFF 4LJMA 2NXNA 4K7QA 2E9TA 3BN4A 2H54B 4Y65A 4H0PA 4CLZA 1T7PA 3LP2A 1P1TA 3U3GA 3MCSA 2W9BA 2VPZB 3ZSXA 4ILJA 1GAOA 4X62F 3V9XA 3CCSS 2VIHA 2UUCJ 4Z4FA 3CCJN 3EE8A 4CHQA 3NKYA 4N8NA 3VQ5A 1J5EJ 1SIZA 3MAHA 1S1UA 2QRRA 4IYQA 3QAEA 3QMLA 3EUNA 3N6MA 1JJ4A 4YHHK 5BN9A 4YOVA 4L73A 1URRA 4UZCA 2B4UA 2WC9A 2VJVA 1Q5VA 2DGUA 4ZVQB 4OX8A 1Q81T 4P74A 2F4FA 4DL5A 3V2UC 2DRDA 1REVA 1LXJA 1RYRA 2XY8A 5HL7L 1U6ZA 2NR0A 5CYMB 3O9UA 2RSQA 2VQFK 3ZSWA 4J9VA 4K8RA 5AQJA 2AGPA 4M95A 1HKGA 3TA0A 1VSMA 3BSOA 3T1YK 3QIPB 4V19J 1FCAA 2ZBQA 4QBUA 4Q44A 4LFAJ 5LMUF 1AFJA 3FGVA 3OBYA 4NLWA 5D0HA 2MQLA 4BRMA 3HT0A 3ENHA 3U4LA 1GLEG 2GIQA 5AQTA 3ULEA 2WB4A 4KYZA 1K8AO 2JJ4D 2YTCA 2ZJRQ 2CQDA 3IM8A 1IM6A 4IDKB 2F96A 1EQ0A 2CPYA 4CZMA 5AFUA 1XJWB 3ZNJ1 4KGKA 3TZYA 2QWLA 1PSDA 4B3TF 4ECTA 2KZZA 3BREA 2BJ3A 3VQ9A 4BR0A 2EC2A 4CIGA 5J2MB 1RDAA 1U1QA 4FSVA 2KTQA 1NGGA 2DD8S 1WUAA 3HSTB 5E7OB 2QWRA 1EARA 2AKWB 3TJ9A 1YITS 3K59A 4EO8A 1R59O 4CEDA 3WQTA 3UDVA 2V2KA 2ASOA 2Z2ZA 4O55A 2XZWA 4UZBA 3EZUA 2VWJA 4RKUC 4NXMF 3DLLQ 2ZUGA 2CQHA 2OPQA 3K58A 5M2PA 2OFHX 1ASVA 3U8XA 3THXA 4NA2A 5AQZA 4W5RA 4TYAA 2R7YA 4CVNE 2CPJA 4B3SF 4ITSA 2I8EA 1U45A 3IWLA 4L76A 4DHVA 4WPAA 3QRRA 3I0RB 4O0NA 4CO5A 4PG5A 5KTQA 1VQ5S 2Q0RA 2NLWA 2DRBA 5DGAA 4AHRA 3PKYA 4BS2A 2BX6A 4AD6A 1RT2B 2Z0GA 2DNRA 3O3GA 1NHVA 1NU4A 2X1GA 2XZTB 4ZN3A 3NCPA 1IBLK 4EP4A 2OKQA 4FJMA 5CZ2A 4QIFA 5B8HA 1NMEB 4IO9Q 1YHQS 4WYBA 4B3TJ 1MSWD 1KTQA 3IMXA 4Z4CA 2PMWA 1VMBA 2XZDB 4YR2A 2DT9A 4IWVA 3CG7A 3Q2TC 4J2DA 2COLA 5DQIA 2HRTA 3WT0A 2YX7A 3W60A 4CLSA 4KJIA 1FJGK 1LWCA 3DRYA 5L38A 3KUGA 2BGGA 4O3PA 2AJ4A 3PLAA 4OLAA 1DTTB 1B7YB 2DY9A 3G6ES 4DXLA 4RWTA 4ZPWR 4CIOA 3O4QA 2V94A 4G1PA 1B9FA 4NRUA 1JLAA 2WHOA 3C7NA 4ED4A 3DLHA 4NWBA 1BWEA 2UXDJ 4DPUA 3CDUA 1IWGA 3U7JA 3QSYB 3PZPA 4EWTA 1OS5A 3IAYA 3I8BA 3SQ2A 3D2EA 2QSWA 1XMOF 2E66A 3C94A 3OYLA 2XS2A 1V5IB 2QI2A 3MECA 3AO1A 2D0PA 4ZVEA 4LF7F 3ILJA 1QTMA 2E7WA 2QG9B 1MWKA 1R31A 2CZ4A 3SCJE 3CEDA 2HEKA 1VHFA 3N28A 1ASUA 1SH3A 4A62A 5KFIA 4W5TA 4I6AA 2JEIA 2NS1B 3VOVA 4GC6A 2P9PB 5H9EJ 1VRTB 4CJ7A 1LQ9A 2R7TA 1RBUA 4HT5A 3TEGA 4V1Ak 1IKXA 4NA3A 4ETZA 1JB0C 4DS4A 2VGMA 1PC4A 1RCOB 3E01A 2FUG9 3N6LA 1BISA 1VQNS 2DGOA 3H5YA 2BOPA 3UVJA 2BE2B 2ZVIA 3ILLA 3RUBL 3OVSA 4LH5A 3ITHB 5AXNA 2QZ8A 3VAHA 3NBPA 1U4BA 3C6AA 5AT1B 2XMVA 5HMZA 2RNEA 4ID5A 1S0MA 3THYB 3E3XA 2RU3A 4BVOA 2XHWA 5ADXH 4FW2A 4C8OA 2HHSA 3OHRA 3RMDA 4ICLA 2XY6A 1Q79A 2AJ2A 3EVMA 3RAMA 2RKIA 1HJOA 2J9CA 1Y00A 1VFJA 1RJJA 4Z4IA 4F4YA 4DTXA 4DR1J 2IBOA 3B4DA 2M5YA 2XMUA 4TU7A 3TAQA 3MXHP 4BRNA 5FPEA 4KH0B 2E5HA 3AVBA 2WAQD 4CTAA 4KREA 4QIEA 3ZO7A 2KHOA 3SQ4A 2ZH5A 3TVYA 2NYHA 1JLQB 3OR1A 4DQPA 1S3XA 1JXLA 1F9EB 5CZ1A 4IRKA 1HD0A 1RWKB 3I56S 4DV6J 2VA2A 4WXWA 2XNQA 1WOPA 5HVGA 3MN9A 3TUPA 2QXLA 4CO1A 3J7ZT 1EKEA 4TY9A 3OSPA 3C15A 1O5JA 5IXUA 3T1YJ 3L2UA 1QVFR 4B1YB 3P4UB 4EHUA 4KRFA 3DOLA 3CJTA 1UWBA 1C1AA 4YS2A 4FM2A 5H1SV 1WC4A 4QWCA 1YIJN 2R8IA 4LFAK 2OTJN 1U0HB 4OYMA 3V9SA 2KM8C 5MLCQ 4GKJF 4WK1A 4WF9Q 1TKXB 3KUHA 2XGPA 4NRTA 4X84A 5HMWA 1ZAXA 4G1QA 1X9MA 3ETOA 2GV1A 4DR7F 4DX5A 3IG1B 2KYXA 2OANA 4GY2B 4ZLPA 4IJNA 1HLWA 2XNRA 2Z8QA 1KAXA 1M5KC 1IBMF 2XEXA 2ZEJA 3JSRA 2V7YA 2QKKA 1SQEA 1APSA 1CQMA 5KFWA 5EX5A 2E5GA 1RCXB 3SMPA 1YBAA 1SC4B 1IKWA 1U2VB 1U6FA 5KFFA 1YHQN 4LFCJ 3CC2S 3VAJA 1T94A 3OR2A 4USTA 4FNIA 1CVJA 3AY9A 1WWHA 4LT6A 5ETMA 2UZAA 4DV2K 4AQYF 3MN7A 3BN7A 2OEMA 4PXCA 2OSRA 2A41A 1DURA 2GX9A 3B8AX 3WC0A 2YWFA 3HO1A 4R5PB 4IEEA 1VQ5N 5HJYA 4JI4J 4UOCA 1LFPA 4K41A 2KH9A 1VQ9S 4WTYA 2OCEA 4ZMMA 4CZHA 1IBLF 2QV6A 4ZA1A 5AE3A 1KBRA 2GJ2A 5KFHA 4RUHA 5CD4A 3MDFA 4K0KJ 1UA1A 4JRQA 3CD7A 3KDNA 3S41A 4BE2A 1AZSB 2ZFHA 4DV0J 1BLUA 3JTPA 5AFUH 3CQ8A 3IP0A 3EZ5A 3LGHA 1Q7YT 1HHQA 3J7AP 3RMCA 1S1XA 5HQLA 1WF2A 6FDRA 3QEXA 1ZH5A 4B3TK 2C2KB 4JV5K 3G8QA 3D6RA 3OTEA 1SH0A 4M41A 4CJ4A 2GQQA 4DL4A 2QMXA 3Q8SB 4EHTA 3IS9A 4O8UA 4ED1A 4DG1B 2R8JA 1NGBA 3NGKA 2LQ5A 2MKIA 4Z37A 5LMUJ 3HSCA 2KQ2A 3ZLJA 2HF3A 4I2QB 3FMWA 3HXMA 2AYGA 4USVA 1NGEA 2ZHBA 3CSKA 2RQCA 4WFNL 3SJJA 4ILRA 3LOUA 4FJLA 2DK2A 3NH1A 4F4XA 4BCAA 4I1TA 3WX8A 4O3OA 4H4MA 3FVYA 5LL6Z 3PO5A 3HSDA 5LJWA 3K9KA 1RU1A 4DR1F 3OHAA 2CQ1A 4CLYA 1KSPA 2UYTA 4EGLA 4ZVFA 3LANA 5C0YA 4A8OA 2VBWA 3VR1A 4OYAA 4BRHA 1T3OA 4ZS6A 2QL9B 4LRFA 3D1OA 4DTPA 5JMVA 4GVLA 5IM0A 4CNYA 3CCMS 3LAMA 1T05A 3J8AA 3QT8A 3M6WA 3JSBA 4WYWA 1GH8A 4H5TA 4ZJQA 4IOCL 3R27A 3S6EA 3NAIA 2DNQA 4CRJA 3FFKB 5DETA 4CBXA 2D3ZA 2DO0A 4MT1A 2UXCF 3HL8A 2A6AA 2G4BA 1U25A 2K1RB 5IQQA 5EXWA 3EN9A 5D15A 1YJ7A 5H9FJ 1VR6A 2N7YA 2F7TA 1LWCB 2HFUA 3HCXA 2C2NA 3DLJA 3CCRN 3BM7A 1Q16B 2IRUA 5KPTA 2PI4A 3H2UB 3VQAA 2HZVA 3C14A 4J8FA 3DXMB 2OAUA 3TSPA 1X9JA 2QFJA 3VETA 4ZCLA 4FCYA 3N01A 4LSLB 3QGPA 2RDDA 4YY3J 4GKKK 1HPZA 1S9EB 3F56A 4L3KA 3CIMA 2ZHAA 1HQ2A 4BRKA 3NS6A 4A8QA 3VV2B 1FXDA 1L3VA 3CJ3A 1CJVA 5A0YA 3D2EB 4NA1A 3DOKA 2J9DA 5AR0A 3G25A 3CCSN 1BIZA 3AJ2A 2F8SA 2V8GA 3HVWA 4FYVB 3IMQJ 3GB0A 3UO0A 1TELA 3NNAA 3HHLB 3I96A 3EDQB 1Z4UA 4NLDA 1WJ9A 3O3LA 2IGIA 4FJ5A 1CLFA 3SPZA 4CF8A 2ZVSA 1TL1B 1GX5A 1DLOB 3MR6A 4CHZA 4DL6A 4FOEA 2DISA 2HZCA 5DM6Q 1IKXB 3OYMA 1NOYA 5SUHA 2A1RA 4I64A 3CD5A 3CJAA 2YQ1A 2F8HA 1RAHB 3BPDA 3RBZA 3DDKA 1P8GA 2B0GA 3LM9A 2PIIA 2PBDA 3PSFA 3ZZPA 3M2RB 4K4ZA 1UJ6A 3D67A 4CI0B 1GLBG 4DTOA 1YI2N 2D1KA 1V5VA 4ZIWA 3M6GA 2YQ0A 3ZT3A 3D0GE 4WE1A 3M6UA 1NK9A 4Y2CA 4P10A 4E7JA 4DV2F 2GWKA 1IBCB 3M2VB 3OYCA 3V9WA 1C2PA 1VSDA 1SL2A 2CQ0A 2A0FB 3NF6A 4DHYA 2P9KB 4IFVA 5BPNA 1K1QA 5L46A 4FK4A 3IA0A 4C23A 2BE7D 2HWHA 3J7ZO 3IFEA 1SV5A 4CF1A 4CJEA 1WC1A 4V19S 4I7FB 4M3XA 5M1OA 3PYEA 2W8LA 1ZS6A 1KXPA 2W4CA 5DMRA 5B0CA 2MQMA 2DIVA 1FKOB 1HQUB 5T7BA 4N76A 3EGNA 3O2IA 3F2KA 1T03A 3N4PA 3CDWA 5EOYA 4IOBA 1K9MO 4BE1A 1HBMB 1CXUA 2FQQB 1Q1KA 2DJWA 1S1WB 1S7IA 3UCUP 4FF3A 3OL6A 1C0UA 1KS2A 3AXMA 4DEZA 4DTSA 3W66A 2G8WA 1QDUB 1UWAA 2DGVA 3TYTA 3V6DA 4ZJLA 5EHHA 3GJSB 2YKQA 2UXCJ 2IVMA 3GBTA 3CFPA 4C6AA 4RUAA 2Z2YB 1ZAVA 3L7OA 2IM3A 4FJNA 5JUMA 5C10A 3THVA 1L3TA 1R0AA 4URGA 4FWMA 1L3SA 1MG7A 1T95A 2A6OA 1QZ5A 4JKEA 4PKGA 4M5HA 1O6XA 1XUPO 4E1NA 2M4MA 1LOTB 4OYOA 4X4QA 5G4DA 3CTRA 4J9RA 4FJ9A 3N4WA 1N5YA 1GMWD 4OKEA 4IH7A 1BQNB 4NMLA 2I6WA 1RSCA 2NXUA 3MEEA 1B3TA 4YMEA 2BANB 1RT3B 3NWRA 4J9LA 2I7PA 4QYRA 2G13A 4DJBA 2HS3A 4LIRA 1NK8A 4G6VB 5ETVA 4LF5J 4PCQA 3CHWA 3K5MA 1I3AA 1RTJB 4PG6A 3D2WA 1SBRA 3HM8A 1C0TA 3A5NC 1RADB 2D3O1 4JI1J 3GTYX 2CJQA 2VPXB 3VZHA 2O8FB 4WFZA 1UFLA 3K5OA 2POKA 1XNQJ 2CNOB 2MKSA 3GOIA 2BQRA 3VAGA 3CPWM 2BXJA 4JKCA 3NXZA 4NLTA 3W8PA 3IBCB 3R7NB 1RHRB 5F8HA 1D9FA 2OI2A 2MZ1A 4Z4GA 3W2WA 5F8GA 3NWGA 4LVNP 1QQCA 2MDAA 1EAYC 4HLBA 3V1RA 1UETA 3LWLA 2DVIA 3NGTA 4C4WA 4NCGB 4B3MJ 4W5OA 3IS9B 1KONA 5G0RB 3W0LA 4OYPA 2CQ4A 2OPRA 4QJVA 2CGLA 4DR5J 2VG5B 2EXUA 5KG4A 2GVDA 2CQCA 5LY3A 1YBTA 2CPZA 2W2MP 3K0JA 2XLKA 3PIPQ 1CC8A 1W2BR 3ICLA 2FSKA 2AEJA 1KC8O 1UEUA 1UAWA 4RW8B 1ROFA 4DR6K 3SQGA 4BROA 3TI0A 1PO6A 3MCOA 2V8PA 4GC7A 5F8IA 5AZIA 2HPUA 1RILA 2YQ3A 4KQZA 3M6XA 4TKTA 1NPPA 1GLLO 4H4MB 5J2PB 3EKSA 3U6FA 5F41A 3QFWA 2E1ZA 2HKEA 4Y1CA 5L1KA 2BA9A 5DQGA 3AFGA 4ANCA 4ZCIA 1S0VA 3GZ7A 3FZ2A 3MUVP 1G4CA 3VA3A 2GFFA 3LDOA 1CEZA 4CYUB 5DK5A 3MXMA 4L3QA 2LQ9A 4L74A 4X64J 4G65A 1LAVA 3CPWR 1XNRJ 5IFMA 3VTHA 5KQDA 2DGQA 5JLHA 4NLOA 1M90O 3MM6A 4BRPA 2GZOA 3HT3A 3C6HA 2N4CA 2HHQA 1WDDA 2DCLA 3Q89A 3EE3A 4FXVA 4OYBA 3VQ6A 1B70B 4C97A 3EKUA 4EFHA 3DLGB 4U8YA 3PW5A 3CD6S 4KB1A 4KI6A 1YVFA 1TAUA 1OY6A 4JI7K 1BCOA 4JRPA 3BEXA 3LL3A 2AJ1A 5B0AA 2Z1IA 1HBUA 4X4UA 3MR2A 1F5CA 3ISND 2YJFA 3LGMA 4NPOA 4N41A 1SC3B 2AJQA 1U1KA 1OO0B 4NI2B 3US5A 2X1BA 3VGTA 4NLYA 1RBTA 2ASMA 4YDXA 1T02A 1V3SA 1T44A 5M1NA 2OMOA 1XC3A 4X4NA 1RGVA 1NB7A 3FZLA 4DR4F 2UU9J 1IV0A 4CWBA 2HBKA 1ZOTA 4RX6A 4QU7A 4DFMA 4LR9A 3MWPA 3R5DA 1VC0A 1WHYA 4KO0B 4NOHA 3CGIA 1S77D 1T11A 1RWMB 1OJ4A 2X6NA 4GW6A 4HTUA 3QBWA 2FZCB 5FDLB 3TNVA 5THWA 1DLOA 4USWA 1BE4A 4WFYA 1VAZA 1M1KO 5HROB 3OV7A 4CBWA 1N5QA 3RR7A 3DGPB 3C6UA 1UPMB 3FEYB 1HUXA 2M88A 5E3AA 3L7UA 4K25A 2UVUA 4QW9A 2L41A 1N33K 2FVQA 3CE8A 1N48A 5EWEA 3HLUA 4C1NK 4CF2A 3O3FA 2Q79A 4IFYA 2V34A 2F9DA 4OYIA 4W90B 4XEIA 3WBZA 4A2AA 1NGCA 1YJ9S 1E3MA 3L8BA 4C8YA 8ATCB 4FZZA 3CCTA 3GIIA 4JI0J 2HW3A 3M30A 1YT3A 3CPEA 3EVWA 3QJPA 4KGVB 3LALA 3VAFA 3G8SA 3P31A 1NK6A 2HHWA 4C0BA 3PX4A 1X4DA 2BJ1A 3MX2A 3D5MA 3U3YA 1C1BA 1FWKA 1SS6A 3HHDA 4JOUA 3VAMA 5KFBA 4P2SA 4DR7J 3MN6A 4DLGA 3KLIA 4CFAA 1WOSA 4ZPTR 2OIHA 5J1EA 2OPPB 2B56A 2PY5A 2KZMA 4O4RA 2A40A 5L1IA 4LFCK 2IPOB 3UN2A 2YPYA 4DWIA 4CE9A 1KWMA 1RDBA 2WUSA 2CWKA 3RB4A 5K9FA 2IC3A 5F3ZA 2CVEA 3L7PA 2LA4A 3GSIA 3WEEA 4FLXA 3T6JA 3PSIA 1RDRA 2NRVA 4LFBF 4V19X 3H5XA 4X4TA 1EKRA 1JLAB 4E89A 1A6LA 1OH8A 1TL4A 3GDQA 3D54A 4CTAB 2HAFA 2IM1A 3LDQA 5KI6A 4QS9A 4LRDA 5E3CA 2AF6A 1T6DA 3QDKA 4DCHA 3TTCA 1UA0A 3G0ZA 4ZK7M 1WKJA 4M63C 2CG8A 4FBTA 4ZLJA 3Q23A 3DLLL 2DXEA 3ATUA 5AJ3K 1XNQF 1IQTA 3H5UA 3NEKA 2K2PA 3A3PB 3I9V9 2W7PA 1OY8A 1OH6A 1W7WA 3POTA 3BQ1A 3D7EO 3AA5X 4KHPK 1BWVA 3VEOA 3ZTQA 1SKRA 2MLZA 2DKOB 1WAFA 1CLQA 1BL3A 2F8MA 2MQ8A 1TKXA 4FDFA 2YWWA 2YNHB 2IRXA 2ITGA 3K0SA 1SQFA 4L72B 3MEDB 5C24A 1GMVA 4W92B 3NRBA 1NDCA 1GOCA 3V6KA 3TABA 3K2PA 3L95X 2HAIA 3HRGA 1HNVA 1Z26A 1AB8A 4JK8A 2G0CA 2PEBA 1AXQA 2ZJRL 4MJKA 2XRIA 1X3MA 3FFIB 1IXKA 3FQKA 2R7SA 3ZZZA 4B1ZA 4PYAA 3AOAA 3G82A 2YHYA 1EQYA 1NMDA 2KVIA 4F0KA 1TU0B 4KKOA 1VLYA 3KG1A 3HOSA 2NXJA 3DRXA 1ZTWA 2MKHA 4DSJA 3M8PB 1U2FA 5AQQA 2WW8A 3EPGA 4QW8A 2LFVA 1U1LA 2DR9A 2F63A 1JLQA 3OR1B 1D09B 1HD1A 1URNA 1VSIA 3RRKA 3UIQA 4U7CA 4TLRA 1VSHA 2X3DA 2H9ZA 3NFAA 4CECA 1IG9A 1P90A 3EL2A 3MFHA 4J9QA 2EPIA 3EXYA 1AZSA 1U0HA 1HFEL 3BSNA 2B4VA 4B1VA 4DV7J 5IT0A 4N47A 1QQNA 3GU0A 2N82B 2RE2A 1KVAA 3D3BJ 4TU9A 3S9HA 2OEJA 4OHXA 3K8WA 3IG1A 2AU0A 4MKBA 1NZ8A 5J2PA 4FNHA 3BEGB 3OBWA 4FK2A 5E3QA 4ENOA 2ASPA 1TL7A 4HHJA 4Q43A 4O23A 3W3SA 2IM0A 4XPCA 4B3MF 3CQYA 4BE0A 2G1DA 1HKAA 5IWAF 5HRSA 2IM2A 3KJVB 2BW2A 2PEHA 2P8IA 4CYUA 3SXLA 3CMAS 4ECUA 1PG5B 3KZBA 2HNZA 2E1RA 4JI3J 3AOCA 3L2QA 2QT7A 5D0EA 3ZT2A 3D6HB 5HLFA 3FQLA 4RUCA 4QYZJ 4Y34A 3ZC4A 4DL0C 2B8QA 3CDAA 1ZBIA 4PKIA 4UQGA 4KHWA 3VQBA 3GL1A 2VG6A 4F9OA 4KC5A 4A8WA 3AGKA 1ELOA 4H4OB 3BGRB 4LSNA 3SNNA 4WIQA 3LP2B 2CXEA 4TYBA 3R6LB 1QAJA 1VIXA 4I9QA 1ITPA 1T0TV 1KFSA 1IJJA 1H0HB 1RT4A 4G3IA 3LF0A 1VJWA 3PX6A 1MDUB 2DPNA 3V1OA 1KRPA 2CPDA 3C0BA 2SXLA 2ROGA 1SJRA 1KCFA 4WP3A 2R42A 3IGVA 4RR5A 4CW7B 2V4RA 3MTJA 3G86A 3QYYA 3UDLA 2X78A 3HFZB 2UUBJ 2FJDB 2K06A 5HRRA 2EG2A 1S1XB 2Y1JA 2VG7B 1GXTA 1FFGB 1XC9A 4U96A 3MUMP 3AVGA 1YJWS 3VQDA 1WC5A 3WIUA 5HBMB 4HWIA 4ZPVR 5K8MA 4JKGB 1NHKL 4CGHA 4KO0A 2EC0A 3EGZA 1FI4A 2XBPA 2VC0A 2V2VA 2ZH1A 4YOTA 4MIWA 4YNQA 3O80A 1KLNA 4ILHA 4WCEQ 4N77A 3ZNUA 1RWOB 4C8LA 3UD5A 1UZHA 3VWSA 2RS8A 3FEXB 3DGPA 4FYYB 1RT7B 1RTIB 4IH5A 4O3QA 5IT9U 3PFEA 3VGVA 4IDKA 4ATNA 2MLXA 1IN0A 4DR6F 2CQGA 1S7HA 4B1UB 4C7QA 2P6TA 3DOKB 4R8UB 1VOMA 2UXBF 2YKNA 1N36J 2XB2D 4PQAA 2ZE2A 4J9NA 1RAAB 4JKDA 2QX0A 2LLZA 1ICEB 2YWKA 3C16A 4M3YA 4DPXA 2XC9A 4LR7A 4DSFA 2ATLA 4QZVB 5IM0B 3M2UA 5D6GA 2V4QA 1BDGA 1E4FT 2V4JA 4DV1J 3TWHA 5GMDA 4I2PA 1RT5B 3I31A 3MN5A 4EFAC 2RRNA 4CJVA 1WHXA 3T7ZA 4OKJA 1FEEA 4ELUA 3CC7S 2KFZA 1WSIA 2W40A 4RNMA 3T19A 2LDYA 1F3VA 1VSJA 5AQNA 2BKNA 1S1UB 5T7LA 5HQMA 5K14A 4DV7F 4UY8T 1H2UX 3GIRA 4FM0A 1B4SA 4FZVA 2WVEA 3JQJA 3U1MA 2CZ9A 4WQ4A 4CQ1A 2QYCA 4FLUA 4DTUA 4CIEA 2EFPA 3MTKA 4CHYA 2E29A 3H25A 2I1RA 1Q7LB 2VDIA 3HZ6A 2YV0X 3PJXA 5F0XA 2IMOA 4DUYK 5A0YB 3CCWA 4F4AA 1UAXA 5E33A 1RABB 1V6HA 5BN8A 4JEPA 2PN6A 1IWAA 4Y2KA 2DHAA 4Y0FA 1PGZA 1WI8A 2PI5A 1WDTA 1K73O 3AVHA 5ELZA 4MYUA 2W6LA 3OTCA 4DMZA 1CJUB 1NSAA 5DDOC 2J5AA 3PW7A 3L2VA 3LW5C 5DQHA 2CNNB 4CEBA 1WF1A 3ATVA 2JHEA 5DZ7A 2DGTA 4JV1A 3FE1A 3R7BB 1QLNA 1I6JA 5HN0A 2P9NA 4RO0A 2YKMB 3GIMA 1GLFO 4YOYA 4B3SK 3W9JA 2ZC4A 4B9UA 4O3SA 4NEZA 3AB2B 2UXDK 3QJJA 2JGUA 4YB5A 1TMMA 3Q0AA 2VYPA 4BDZA 4H0VB 3IBWA 2QTDA 3IRXA 3KK3B 2IDOA 2E5IA 1PJ5A 3BKFA 5BYRA 1K1SA 1UVIA 3P49B 1A5VA 3PIOL 3EY1A 2ZD1B 3C65A 1VQ6N 3R6GB 1JLBB 2BUPA 4LF6K 4F7VA 3HHEA 3GCWP 2Y0SD 1R0BG 2NRRA 2HHXA 4RNNA 1X9WA 4X4OA 3M2VA 2RT3A 2BJ7A 3U27A 4HVJA 4BRDA 1Q82O 3M6VA 3VGMA 2E2QA 4F3TA 3M5RA 1VHIA 2FVRA 4W4MA 4X2BA 1VHXA 3E66A 3MEEB 3RSEA 4J2EA 3DWLA 1VK3A 3THTA 4JYAF 1F5AA 1RBSA 3FBCA 2YNFA 3A2FA 4KE5A 4FVUA 3WX4A 1LFWA 4WWSA 3LUYA 2YWEA 4Z7CA 4M5LA 2FVPA 2V69A 1S6PA 2CA9A 1MWQA 2F9WA 4JHDA 1XNRK 4L8RB 2ABYA 4CZCA 1UKUA 3O5TB 4KSEB 3A3OB 1YJRA 2VD3A 1XMQK 3V5RA 2W41A 4TY8A 3P3DA 1JXBA 4X62K 1LW2A 3UN5A 4ICLB 1U8WA 1R6VA 1ZBFA 2HF4A 2RRBA 3UFCX 2KG1A 4C8KA 2FLPA 3J7YI 2RKIB 4OX9J 1LK7A 3M32B 1HNXF 3M1FA 2YXLA 4WQ4C 1BQMB 3LH2S 2JWKA 4F0HA 5F8MA 3LP3A 3KHYA 3OYJA 2VKRA 4M7XA 2VPYB 2KT3A 2QKBA 4RWXA 4IR9A 3TZXA 5AQUA 2DXDA 2C2MB 1FE4A 1V4SA 3BZCA 3DM2A 4H5WA 3M8YA 2QE5A 4AE5A 1C6VA 1DTTA 2JL9A 3ULDA 4A8MP 4ECZA 4JK9A 5F8JA 1IR2A 2QSFA 1SJ3P 4JV0A 4JN4A 4ZCKA 2HIYA 3C7NB 2HFVA 3C46A 2UU9K 1S0OA 4OX6A 3K7RA 4DU4A 3BR9A 2WOMA 3MPYA 2FGOA 2XWYA 3KMSA 4IOCQ 1FK9B 5SZTA 3D3CJ 3BY5A 2CRLA 3VN5A 2OUGA 2OPSA 3AVKA 4XAKA 1JQGA 1T9VA 2GUIA 2Q36A 3C2PA 4FLWA 1M1HA 4P75A 4H4OA 4LSNB 2DNPA 3QERA 2FXUA 1TUVA 2D4WA 2HQCA 4DV1F 4OHYA 4IKFA 2P51A 1QS4A 2FDNA 1CXQA 2O8DA 5C2GA 3TUIC 2FJXA 2FJWA 1EX8A 4X66K 4LF1A 4KHNA 1OSDA 5KFVA 4GV6A 3Q8VA 2BMBA 2ZDOA 3W64A 1YVUA 1G15A 1HHTP 3MAAB 4CF9A 5FD1A 1HA1A 3UVJB 2KB2A 2FHJD 3P83D 3ITHA 2APOA 1HNXK 1FWPA 1LKZA 3QFHA 4IR1A 4KHPF 1A9NB 3TP2A 3CJ7A 4WZQA 3DHXA 2FJBB 1T8EA 2QWMA 5LJVA 4DR2J 2I5JB 3THYA 3VQQA 1HIYA 4A59A 2PC6A 1TKTA 3L3VA 1JCFA 2EVZA 2DHXA 1NJYA 3RAXA 3RRGA 1LAWA 2HVDA 3I4HX 3DDIA 3PACA 4NLGA 2ZDPA 4OPAA 2UP1A 2BUNA 4ZP8A 5GMEA 3K8VA 4LF8J 4BGAA 1NK4A 4BHQA 5HI7A 1YXQA 2X6SA 1MWZA 2GJFA 3A8JA 2HK2A 3AHPA 1VC5A 2QN6B 3CD6N 3VHQA 3NF8A 4ZP9A 4UY85 2O67A 3MM7B 3FBFA 4R8UA 2C3UA 4HEA9 3DRRB 3EJMA 4U6PA 3NOCA 2ZGYA 3GMGA 2XGQA 1SXLA 3L3UA 2LKZA 3T1HK 1Y97A 2VASA 4FZXC 2XMJA 3UD3P 3W8GA 1HNWJ 3DXSX 2HNYA 1K44A 1IBKF 4B9QA 1DQ9A 3O1WA 4CJLA 3O3HA 3QMQA 1YTAA 4G1QB 2E2OA 1FRXA 1R89A 4CEQA 3DDNA 4PPDA 2OH2A 4LY7A 2DNHA 3EVOA 3CO9A 1M0SA 2KU7A 3GP9A 4PUOB 3IRWP 1W97L 2DNYA 2HBZB 4JI2F 2G8FA 5M1FA 3I0SB 4Y1DA 3I55N 2W9CA 2RD5C 3SLCA 1DHMA 2YX6A 1IBMJ 1HMVA 1RDCA 1EQMA 3DLRA 3CJKA 5AZJA 4HL9A 3BBBA 3HDSA 2LYVA 3K5LA 2C42A 1YZ7A 1TUUA 2UUBF 2HBRB 3BS9A 3JXUA 2CKWA 1VDHA 3PW2A 1RKJA 3THWB 2E1MC 2OP5A 3CJ9A 4BG8A 2FPHX 2J0WA 2Q1LA 3NL0A 4ZVGA 2Z1GA 2HK3A 2R9LA 3SAGA 2KL8A 2HMPA 4KBIA 4E7HA 3D2FB 2W01A 4DQ8A 4H0XB 1LWFB 4WQ5A 3FSYA 4M5KA 3DOMA 1FDNA 1B9DA 3MM5B 3Q8QB 4NXNJ 5DDQC 2GX8A 1A0OB 4ZIVA 4DL3A 3RTVA 3QLHA 3EE9A 2NQPA 1X4CA 3EO3A 1TFWA 1U1MA 3KLGB 2IJNA 3OQ2A 1ZETA 3PY8A 2PFFB 4OO1J 5M2RA 1S57A 2K1RA 3CVKA 4NXMK 5BR8K 1HX1A 3LPEA 1VSFA 1AA1B 3PO4A 3QB0A 2VCPA 4HKQA 1C0GA 1FJ7A 2QXFA 3BKTA 4IOXA 2E88A 3G8TA 3PYDA 4K4XA 1HR0K 4E3SA 1DQ8A 2HWIA 3TARA 1ZM9A 4DUZF 2X51A 4PWDB 3OLBA 2BE9B 1XI1A 4IOAL 2YH1A 3ZT1A 4CJPA 2E5JA 3DFEA 1F3FA 4RNFA 4CZKA 1KLMA 1TK5A 2ZWPA 3QRQA 2GELA 4BDPA 5ADXA 3N5BA 4HVZA 2D3OR 1EWRA 1PJ6A 4ES1A 1BHLA 3CO0P 4ECSA 2DGXA 1XEZA 5BPLA 2CPIA 4GNIA 4LF4K 4ILMA 2D41A 3HVTA 3C6TB 3K5PA 1RAFB 1RLCL 3S8SA 4EAHD 4BRGA 2V52B 3OTOK 2Z2LA 1YK9A 2Y3YA 1B7FA 4QR2A 1JXVA 1AT1B 3CF5L 3GG4A 2D7SA 2MQNA 2QMUB 4JI8K 1OWXA 3I9ZA 1S5JA 3SBMA 4Q8FA 3B78A 4KRWA 3SV4A 1XTZA 1C1BB 3GFYA 3OYGA 2EWHA 3RB0A 2JX2A 2FHOB 1Y5IB 2YNFB 4ZPCA 3NCRA 1D8ZA 5J1EB 3H90A 2PA8D 3NF9A 1SH2A 1NCLA 1YG0A 4R0EA 1S6UA 1ZC6A 3CW2C 2P9GA 4NLCA 3TO8A 3NNCA 4WE1B 1QAYA 4FVCA 4MDAA 1QJHA 2O8CA 2AX1A 3R2CJ 1FD2A 7FD1A 2VBYA 4MLEA 3GIKA 3G82B 4BRAA 5A2QO 1U6BA 4ERDA 1AW0A 4LC9B 2ZH2A 5KFRA 3JS6A 2H5EA 5ADZA 4DV6K 3IN5A 4NLBA 2KHCA 1BQMA 2B51A 1R27B 2WZ1A 4A48A 3CXCM 5JMNA 5JS1A 5D78A 3M8PA 4NE9C 1HYVA 2I7NA 1N5VA 4BR5A 4LF9K 2FJAB 1UP1A 4C3MA 2RHQB 1NM2A 3Q86A 4WCEL 1YJUA 2HGNA 3CCLS 4OI4A 3HP6A 3P45B 3G71S 3OS0A 1E6VB 1U24A 4WFBQ 1KAYA 3PR4A 4CM0A 3CJBA 1OSCA 3EGWB 2FIUA 3TX0A 2W2OP 2C2DA 2G2ZA 1EXQA 3BBCA 3WQUA 1VBYA 3AARA 4JI2K 1VQYA 3ZSQA 3H59A 4AM7A 2Q1NA 3MMVA 3MEDA 1TKZB 4FLVA 3V6DB 3W65A 4FZYA 3P5BP 3HD1A 4BY9C 3Q83A 4JI6K 1E6YA 4LBHA 4RWWA 5DZ6A 4B1XB 3GILA 2XLJA 2V6AA 4WFAL 5C2DA 5F0WA 2ZZNA 4PG4A 2QA4S 2VPWB 4J37A 1TL1A 4DV2J 4KHRA 3BH6B 1FDDA 5KQ8A 3AVIA 4WTOB 1X8DA 2CZVC 4I69A 2JWNA 1Z25A 2KG0A 2HHHF 3KJFB 3L4BC 2MZTA 2ERRA 4J2BA 3Q22A 1YRTA 1J54A 2OPQB 5M1KA 4M63A 2RHSB 3SUOA 2XMTA 6FD1A 2FBVA 1OY9A 4DR3F 2G8VA 4DV4K 1XQSC 3M2RA 3G6EN 1IR1A 1P6TA 2E1CA 5GAHI 1RT3A 1HQEA 2DB1A 2QW9A 2RRAA 3BGRA 2FC0A 1WEYA 2AIRB 5KG2A 2CGKA 2M9KA 2R2TA 1FDAA 2KVQE 1YLXA 1IBMK 4LF5K 1TUGB 2ZH3A 1NJXA 1W2BM 1EB0A 4Z0UA 2LMIA 2VFSA 5DG7A 2MYFA 2PSZA 4F4ZA 3CMQA 2GQ2A 1SKWA 3W9HA 1U26A 4JV5J 5D4NA 1S76D 4OHZA 1WSHA 3P38A 5D0GA 4Z2XA 4OI3A 5A2QU 4ZPDA 4IBNA 4PWUA 2BE2A 1Y0HA 4ZVOB 1WNSA 2HG4A 3PV8A 2ZM6K 5BR8F 4DSIA 5KFYA 3MM7A 2P5OA 2QMWA 5GMKa 2V8HA 1RDUA 4CO3A 5MAOA 1TYQA 4RCHA 3D6TB 1SZ2A 5HBMA 2D69A 4OLOA 1TL7B 4CFDA 3O08A 3KHLA 4MQ3A 4B3MK 4GVMA 2DH8A 3OTBA 5IS2A 2YKAA 4FM1A 3I55S 3F0NA 1S49A 3LZIA 3O6QA 2MTLA 4M8LA 5DG9A 2ZH4A 2PAVA 5A8WA 1UCNA 1RT7A 1PCAA 2ROEA 3D0IE 2ACMA 3D45A 1YITN 3OW2M 1F9FA 4GVBA 4TQSA 1PBAA 3OL9A 3JQMA 3MEGA 4TNOA 3MR3A 1LCUA 3C15B 1OYEA 3IR7B 2VZ9A 1UW4A 2ZE2B 2BJDA 1FD8A 4DCPB 4K2XA 2JEFA 1BI4B 4XH4A 1UFKA 4EYIB 5IWAJ 2KXHA 4UOFA 2Q6BA 3NVMA 3OTOJ 1PYTA 3G2XA 3BGOP 2E6MA 3V4MA 5HL7Q 4DN9A 1VIOA 2HQ3A 2FJEB 1NBEB 3AD8C 4ILGB 4YOUA 4FO0A 3PDNA 3DOMB 5F8NA 5AQHA 3OYEA 1S4FA 4ALZA 1O51A 4LF6J 1S5ZA 1RP5A 1JX4A 1CQNA 4YOWA 4MFBA 4GV3A 1UVNA 4U7BA 2R7RA 4F2SA 1WNEA 4ZTFA 2W24A 2A1BA 2P9EA 4AF1A 1JJ2R 1MNEA 2WFBA 2O3DA 4PXEA 2FD2A 4YB7A 5L9NA 3J7Z5 5D3GB 3G6XA 2JNJA 4LQ9A 5HRNA 4AT1B 3OVBA 3PEHA 4USUA 4J9KA 2GO8A 2MZQA 4FF1A 4CJRA 3JB9k 2EFQA 3KK1B 1T9WA 1RUSA 3OYAA 1XMQJ 2HHHJ 3MMAB 4K59A 2GVDB 4NMXA 3CCQS 3UD4P 2DR5A 1CG2A 3OFHA 1S99A 1KVCA 5KT2A 1UEVA 2F7VA 1C1CA 5B0FA 2BJ9A 5HMYA 4P52A 2X3GA 3HYFA 4J7CA 1NMNA 3AVMA 4IG0B 1M90T 4DI6A 3C16B 4JD2B 4OX7A 3WNHA 5EGYA 4ZLNA 1BA0A 1BMQB 3ZYYX 5AZIB 3QBXA 3EEQA 2AP6A 1IKYB 4OJ3A 2BEFA 4RBUA 4LD0A 3C6UB 3R5BA 1RHKB 1NK5A 4CK1A 1QQOA 4FS1A 1QE1B 4CP5A 2VL1A 3AVNA 3KK3A 2RQMA 1IQZA 1FDBA 4EP5A 2DHGA 1JLEA 3FBBA 5CD4H 1XR5A 4OPKA 3ZETB 1R7IA 3W9IA 1XMOJ 1LWEA 2KN4A 4Y2MA 1XNRF 4UF4A 2VFRA 3TUJC 1NGJA 2OYQA 1FESA 1X5PA 1FFWB 2E5LJ 2I0XA 3T41A 3AD7C 3LAKA 3D66A 3R3TA 2BR0A 1F1BB 2HFOA 5TKYA 3LDNA 4W98A 2IVOA 1J5OB 4ISEA 4DU3A 2W4DA 5B7WA 3TTFA 5KG6A 4DKWA 4RU9A 1FF2A 3VEWA 3IXQA 3CJSA 1IBKJ 4NL5A 3HPGA 3MFIA 2OPPA 1Y3KA 3OXGA 1TV6A 5FLXO 2YX1A 4B02A 4Q5VA 4G9ZA 4PXBA 1NGFA 4NZ0A 1CPZA 4NLXA 3OVAA 2IC3B 2E9ZA 3ZSRA 3TQ1A 3WEEB 3QETA 1HLUA 2ZM6F 1HYSB 3RZAA 4K43A 1NZAA 3PW4A 3SSQA 2Z56B 4DR2K 2P9SB 1N33F 2EW9A 4I6WA 2EWSA 1N52B 4DL2A 5I3PA 2QLWA 3KWGA 3R3LA 5ETOA 4C8MA 1NHUA 3MXJA 2ALYB 5CXTA 2EFOA 5L8RC 3BO2A 2WVCA 3C3LA 3W63A 4C1NI 3TAGA 1NSQA 3QRPA 1GOBA 4DUZK 5CYQB 2Q43A 4B17A 2OD4A 4QR1A 3UE5A 4YHHJ 1NPKA 2P9LA 1K6YA 1DQAA 4M5GA 2W1BA 5CQGA 1FRHA 1VQ6S 4OLPA 3KK2A 3L09A 2CQBA 1HPMA 2P6SA 4LUBA 4M5NA 2K7KA 4J5OA 2V63A 3DXMA 4I2QA 5CZXA 1JLBA 3HI0A 4W5NA 5KG0A 2FTRA 3OS1A 4CEAA 4QOZB 3UI3A 3CCUS 3P6YC 4BWMA 5HO4A 4FWLA 2G2YA 3CULA 5IV3A 3QT6A 3VF2A 2BRKA 2G8HA 3P5TL 1K8AT 3RB6A 2KFYA 3SBGA 2JEGA 5JICA 3HHNB 3FZMA 3J81U 4HI2A 4CJUA 2M70A 1K0VA 1TL5A 3OUYB 5DLFA 2BRLA 3E9PA 3GV5B 1HWKA 4E98A 4QWDA 1CSJA 3MWTA 2W6KA 1R43A 3DNCA 3FFIA 1S6QA 2F40A 2QEXS 3CI5A 3J7YP 4DV0K 1I5OB 1KQSM 4F3OA 1BUXA 4WP8A 3V9UA 1Z6RA 4YR0A 1YVNA 4DR5K 4HI1A 3THXB 3DLKB 3SFGA 2AD9A 3H45C 5KFSA 4Y6IA 2AZ1A 1RISA 1S9GB 2J7WA 2EG1A 1EHWA 4CEEA 3H20A 1HI8A 2YHBA 3EM1A 4TU8A 3DI6A 1VQLN 3ZZUA 4K8ZA 2E2PA 5F3TA 3ENVA 3C14B 3MCPA 2K3IA 1WG1A 1BD6A 3CNQP 3OD2A 1HWUA 4CO2A 2IOCA 1S1VB 4M1KA 1VBKA 1IG8A 2WSCC 4ZTJA 5KOWA 4OYWA 3SCIE 3B6PA 3IKMA 2W42A 1H73A 3NGIA 2XMKA 4AHVA 2XCPA 3BDPA 3Q8PB 3NGRA 5AQPA 1HWLA 4ZVUB 4FBUA 1WC0A 1XR6A 4JK7A 4F3QA 3DAWA 3QWPA 3QEIA 2O1PA 4CZGA 2BKPA 4QWAA 4WKRA 1FRMA 3HF5A 4DR4K 2M2BA 2Y0BB 1A5WA 3LGNA 4IDHA 4NLPA 4UUXA 5TKWA 2V67A 3J80Y 3U9ZA 4M5DA 2X7IA 4O0JA 1Q9YA 1XN9A 2VOOA 2YNHA 1UTAA 2DNOA 4XIUA 2H65B 2C2OB 2HNZB 5HP1A 1U1PA 5KRTA 4ELVA 3GR1A 2QLBB 2JDJA 2C1EB 3W62A 4BRQA 2ZGZA 2HSEB 3B8HA 2HBQB 3O4NA 4TXSA 1X4AA 4KV8A 2V8DA 1X4HA 3GE9A 5EWFA 4PUOA 2LECA 3A5OC 3M9OB 2E9RX 3Q8UA 1ATSA 2NZ4A 4MFBB 2BTFA 1N0VC 5A8RB 4ZPBA 2CNLB 4EYHB 1U0SA 1M5PC 5AQVA 1TKTB 2ZHOA 2WVFA 2AJFE 3N5FA 2OFGX 3OXLA 4M5MA 3PIOQ 1LWXA 3A0IX 1QTNB 3V6JA 3TZZA 3PYGA 1MLAA 2I9SA 2LSNA 4HH1A 3T1YF 2GMJA 3M8RA 2I38A 4IUFA 3KLEA 1OPIA 1HKBA 1K8KB 4DFKA 3CCES 3OS2A 3J81j 1Q8BA 3PCOB 2ZH7A 3IWXA 5AXLA 3HMJG 5B08A 4A5BA 2MY7A 5ETTA 1ZBTA 4FWOA 3PHEA 3U1NA 4EBDA 5DJBA 2GTDA 4ZKAA 3ZT4A 4EI2A 4WFXA 1KD1T 4C8ZA 4IG0A 3PKMA 3L0QA 2E6LA 4M3ZA 4JYAJ 1HR0F 3SFUA 3HFVA 3A5MC 4DZDA 2R8KA 1RTHB 4WFNQ 2Z2MA 5A6PA 8AT1B 1Q18A 1H7WA 2DFEA 4JI5K 4OVLA 3OPKA 4MLHA 4O5FA 4ZVPB 1KVJA 1LOUA 4CJWA 3OVNA 3CJ0A 2ILZA 1J5EK 3BPSP 4NYNA 1T3VA 3UE2A 2A2DA 1NKBA 2GMHA 2KXNB 2GC8A 2RDIA 4OZ2A 2QM1A 4C8NA 2W9CB 4UOHA 4TVAB 3HZEA 3NDKA 5C15A 3FLCO 4WKYA 4X66F 4O44A 3BKUA 4C11A 2C22A