3NBPA

Hiv-1 reverse transcriptase with aminopyrimidine inhibitor 2
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
557
structure length
554
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAGIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Reverse transcriptase/ribonuclease H
publication title Discovery of piperidin-4-yl-aminopyrimidines as HIV-1 reverse transcriptase inhibitors. N-benzyl derivatives with broad potency against resistant mutant viruses.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Transferase
total genus 155
structure length 554
sequence length 557
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00075 RNase_H RNase H
A PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
A PF06815 RVT_connect Reverse transcriptase connection domain
A PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3nbpA01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nbpA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nbpA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3nbpA02
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3nbpA05
4TXSA 2V4RA 3O4NA 1RTHA 1TL1A 2DY4A 3S9HA 1K6YA 3DOLA 4GW6A 4FZZA 3Q8QB 3UR0A 1CZ9A 1KVAA 2DTUA 3FQLA 3UQSA 3ITHA 2R8GA 3TQ1A 3LP2B 4E7IA 2EC0A 4WE1A 4FJ7A 2BQRA 4DSJA 3SQ4A 1S6PB 4NLTA 3P1GA 3AVHA 1HQUB 5HROA 3SV4A 4BE2A 2HMIA 2Z1GA 4MK8A 4KTZA 4K50A 5FRMA 3AVLA 4KB1A 3ZT0A 3HVTA 4CF1A 3SUPA 1NK6A 4QWBA 4BDZA 3VQ4A 2EX3A 3HXMA 1VRUB 4ZVHA 5KFIA 4ED6A 4DTSA 5CYQA 3CJ3A 3AV9A 4CHYA 3DMJB 3KLHB 3QO9B 3QEPA 1ZETA 4FLYA 2HVHA 3GQCA 1ZYQA 4OGCA 4OKJA 3CG7A 2OPPA 4KSEB 2IS3A 2O4GA 1IM4A 4O3OA 3NFAA 2FVCA 3OYKA 1T05A 3MEDA 3VQCA 2G8KA 4F3OA 5L1KA 1J5OA 4DG1A 4ED0A 4CF0A 2V9WA 3FDSA 1S6QA 1RT7A 3CDEA 2W9AA 1NHUA 1TGOA 4FVMA 3V9ZA 3ISND 3M8PA 3O3FA 3T19A 3BSOA 4H4MB 4X2BA 4IBNA 5FDLA 1SL0A 5HBMA 3RB0A 3KLEB 2DFEA 3NDKA 4DTJA 5KFEA 1TK8A 4HUGA 1QS4A 1TKDA 3HL8A 3IS9A 1LW0A 2BQ3A 4LSLA 4O5BA 4ELTA 1RT1B 4FM2A 3DRRA 3VQSA 3NH0A 4J9KA 3SV3A 4W5NA 1DTTA 2YKMB 2ZE2B 4GMJB 4CIGA 1JXLA 3U3YA 4KHQA 3K2PA 4IKFA 4F4XA 4DFKA 4DFPA 4NCBA 2VG6B 2D3UA 4H4OB 2HHSA 2JC1A 1TKTA 1XHXA 1U45A 3HT3A 3H4BA 3RWUA 1R0AA 4MQ3A 4RW9A 5D3GA 4I2QA 3QGHA 1HYSA 1IKVB 1WNEA 5DLGA 4JV0A 2GUIA 3V6DA 1JKHA 3PR4A 1IO2A 4IDKB 4IQXA 1LWEA 1CSJA 1LV5A 1BISA 1KLMA 5DG8A 4Y3CA 1Y97A 3SFUA 1YVUA 3RAQA 2W9CA 1DLOA 4F4WA 5KT2A 3PX4A 3QIOA 2HWIA 1J54A 2XI3A 1JXEA 3DOKB 1S48A 3OL9A 1NK8A 2P1JA 4DSKA 1LWFB 3OYIA 2WB4A 4ZPBA 3T5LA 3O3HA 3D45A 1U49A 1BIUA 1LW2B 4N41A 4FBTA 1S1VB 1RT2B 4CFBA 3E51A 2XY6A 2OPRA 2B5JA 3KNAA 3OL7A 1HNVB 2A1SA 1BI4A 4I2PA 4ZTJA 1QSSA 1NOYA 2F8EX 2WK4A 1JLQA 1IKXA 4CJUA 2WTFA 1T7PA 4BE0A 4IG0B 5J2NB 3PX0A 1DTQB 4CFAA 3C94A 3G0ZA 2R2UA 2YNIA 2VWJA 1XR5A 4FW2A 4EZ9A 2ALZA 4DU3A 2V0NA 1RYRA 2B4JA 4ED8A 1L3UA 3BREA 3KLGB 4AHCA 3ZT1A 4IG3A 3M9NB 1W25A 2XI2A 1VSIA 1D9FA 1T94A 5C24B 3QERA 5C25A 5F8HA 3SI8A 3QIPA 4W5OA 3H08A 2G8HA 3OL6A 2WHOA 1KTQA 1S0OA 4LH5A 3H5UA 3RTVA 1RTDA 1VSMA 1JLBB 4CHOA 4FK4A 1HNIB 2UVVA 4ECZA 3M8SA 4QCLA 4IKAA 4FZYA 3KHGA 1JLAA 1S4FA 2KTQA 3EPGA 3SQ0A 4KPYA 2D3ZA 3OLAA 3HK2A 4DMNA 2DFHA 2XRIA 1S1UA 3PJWA 4KAIA 3SNNA 4DQQA 3MFHA 4O4GA 3OSNA 4QW8A 4NRTA 2BQUA 3ZSZA 3K57A 1N6QB 3KJVB 2HVIA 1QUVA 3ZSXA 2BRKA 3JYTA 2VG5A 4BDPA 3EYZA 3C6TB 2C2EA 2J6SA 3CIZA 3DLEB 4B9UA 4WZQA 1RT6B 5KTQA 2VA3A 3PW4A 3SYZA 5DQHA 1YVFA 5DQGA 1NJYA 3AVAA 3K58A 4PQUB 4E1MA 4CE9A 3T5KA 3L2QA 4HHTA 4B9TA 1HQEB 1ZTWA 1RDBA 4ED1A 4KHMA 3DLBA 4FJXA 1C1AA 4RW6B 2IM3A 1NJZA 3BSAA 5KFVA 4J9PA 1S1WB 2ZD1A 2P5GA 3BGRA 2ATLA 3V9SA 2AX1A 2VG7B 3M8QA 3CDUA 4HCCA 4ED7A 5F8NA 1REVB 1JLCB 4CESA 3SPZA 4M3RA 4W5TA 1SV5A 4DTMA 4QWAA 3AA3A 3LDSA 4AHRA 3TABA 3VQ6A 1RTIB 1MU2A 4CGIA 2HNZB 4J2BA 4ICLB 3S3MA 2XY7A 4RW8A 4Z4IA 4TY8A 5KT6A 4TSXA 4DQSA 3CM6A 1C1BB 2R8HA 4ECRA 1NJWA 4FCYA 1VSFA 3MAQA 5T7BA 1QAIA 2QE5A 2HAIA 1VSHA 4ZPAA 5KG0A 4O0IA 3IGNA 4KV8A 3HPHA 4M3WA 2Q3SA 1B92A 4YMEA 2GC8A 3QEVA 1FK9B 3BQ1A 1VSJA 3V81B 1LWCB 1HYVA 2X78A 4IFVA 4XIUA 3KD1E 1TKZA 5F8LA 2QKBA 1IH7A 5KFMA 3SZ2A 4IFYA 3I5AA 3OYNA 1T3NA 1OS5A 4ECYA 1NKEA 2RKIA 3SQ2A 4FLVA 5J2QA 2BE2B 5KG4A 1ZBFA 4O0JA 3LANA 3B6PA 3TI0A 4FM1A 4NLQA 3OY9A 2KZMA 3SUQA 3IGVA 4NCGB 3EZ5A 3MECA 3AO5A 1RDCA 3C6UB 3KK3A 3RR7A 3WNHA 4RNNA 3MR2A 3KK1B 3OYLA 3NCIA 3EPIA 2PZSA 5J2MB 4ZP6A 1JLFB 2E6LA 2FJWA 3QIDA 3KMQA 3KK2B 4EYIB 3OHBA 4WFYA 3OS0A 3L2WA 1RDDA 4CJ3A 3HPOA 4DQRA 4F4ZA 3RB6A 5F8MA 2IM1A 4Z4CA 3ZSRA 1WSFA 3V9WA 4EP5A 4LH4A 1WLJA 4UQGA 3RMBA 4C8NA 3KHRA 1N5YA 1SL1A 3VN5A 3SI6A 3MEGB 1NJXA 4IRDA 3LP0A 2X6NA 2HNYB 2AGOA 1SKSA 1RT5A 5C5JA 1C0UB 3N6LA 3M9MB 2JEJA 1FKPB 2G8FA 4FJIA 1VRTA 4H8KA 2R8KA 1BCMA 1B9FA 1I39A 2OPQB 4Q0BB 2BRLA 4CF8A 1KHVA 3HPGA 1RBRA 5I42B 3HVWA 3PUFA 2OYQA 3NL0A 3GV8B 3IRXA 1O1WA 4LSNA 4CEQA 3OYJA 1FXXA 4FXDA 4IH6A 3S3OA 4PUOA 4CJVA 1CXQA 3K5NA 4HUEA 3RRHA 2FBTA 4MFBA 4GVMA 4EBCA 3VQQA 4CGDA 3GYNA 4Y2CA 4NLSA 1FKOB 3H40A 3RBDA 4DEZA 4DL3A 3H98A 1S9FA 2R2SA 3KLVA 5CZ1A 3JSMA 1SUQA 4RNFA 4ECVA 1HMVA 1J53A 3IG1B 4ID5B 3DRPB 5KFXA 2BANB 3ZSQA 4HYKA 3DI6B 2RF2B 5KI6A 3V6HA 5HLFA 1LAWA 3CO9A 3I0RB 1C6VA 1WNSA 5EWFA 4E1NA 3TAPA 3LWMA 2HHQA 3QINA 4XO0A 3BQ2A 4FJMA 4R8UA 5KFFA 4RU9A 2F8SA 4U7CA 1TVRA 2IC3A 4WYLA 3PW7A 5KFKA 4NLPA 2XCAA 4OGEA 3NF8A 1QAJA 3T3FA 2JLEA 4F4KA 4KI4A 3SPYA 3LP2A 3MF5A 1IG9A 4DTRA 5C42B 3WNFA 5KFYA 1GX6A 2FBXA 1TL1B 1N48A 1BL3A 1S6PA 4R5PB 3CJ5A 3DOLB 1HQUA 1QQCA 1Z4UA 4YR2A 1SH2A 5KGWA 3CVKA 4ZP9A 4DQIA 3H2LA 4CK3A 2BGGA 4Q8FA 2IOCA 2I1RA 3VQPA 3NGDA 3I0SB 1VRUA 5EU7A 4DF4A 3HVTB 4CERA 3H5XA 2HHXA 1CLQA 2FBYA 3NF6A 3KKRA 1RA7A 2A1RA 3K5OA 1XR7A 4URGA 3DMJA 3KLHA 3QO9A 3NAHA 1ZTTA 2VWKA 3OVNA 2FC0A 1S9GB 4K4UA 3VQ5A 1TQLA 4CJRA 3FFIB 4CJFA 4I7FB 4I9QA 2KZZA 1QE1B 1Z26A 1U48A 5HRRA 2F8TA 3TR8A 5KFSA 2W8LA 3NAIA 1WAFA 2RDJA 2W8KA 4CCHA 3EY1A 2UUTA 2P5OA 4N76A 3PW0A 3OJUA 4ZVEA 1WSEA 1W9HA 1T8EA 4N56A 4BWJA 4DL6A 3PZPA 4FLUA 3NH1A 1NKCA 1UWBA 1BCOA 4DQPA 5I3UB 1YT3A 3KLEA 4J9MA 4E89A 5KFNA 3SJJA 5KG7A 3VQ7A 3AO1A 4OLBA 3NBPB 4Q43A 4YR3A 1NNDA 4DLGA 2YNGA 2BDPA 4NLGA 4CFCA 4IH7A 4J2EA 3PR5B 3HJFA 3MEEB 2WOMA 2FVQA 1I6JA 3T5JA 4URSA 1RT1A 1GX5A 3OL8A 4Q45A 4E3SA 1S97A 4B9MA 2AWZA 5CYMB 4NLOA 4CJSA 5KT5A 4I9LA 2JEIA 1UAXA 2YKMA 2ZE2A 3B6OA 3FSIA 3V6KA 2YV0X 2IA6A 4CHNA 1L5UA 3L2VA 4DFMA 3P83D 3P5JA 4NYNA 4CJ5A 4TQRA 2PYJA 2VG6A 4H4OA 4E7HA 1KHWA 3ICLA 3H59A 5KFDA 4CGFA 3N6MA 3BSNA 1RBVA 1RBUA 3G6YA 5KGXA 3DLKB 4LQ9A 1IKVA 5EWEA 3VQDA 4Z4FA 5KT4A 5D3GB 3V1RA 3LP1B 2WCXA 4B9SA 2D0BA 4DSLA 3AA4A 5CZ2A 2V4QA 4DS5A 4E19A 2Z1HA 2Z1IA 3MXIA 3TAMB 4MKAA 1S1TB 2HW3A 3DOKA 1NKBA 4ZVGA 3PY8A 1LWFA 5K14B 2HB5A 4Z4EA 1KVCA 4M94A 1RDRA 2G8VA 2UVRA 3U6FA 3Q8SB 1LW2A 4ECQA 3ZT2A 3DYAB 3RB3A 4O3QA 1VSDA 2YNHB 4CF9A 1RT2A 1S5JA 4FW1A 4Q8EA 2QV6A 4JRPA 3HSTB 3CJ0A 2O4IA 1HNVA 2OZSA 4KO0B 4DL2A 3TAQA 5F9LA 1SH3A 4FJGA 2OPRB 2B5JB 4FJ5A 3OSPA 1D8YA 2E9ZA 3TAGA 1XI1A 1KVBA 4FS1A 4KKOA 4O55A 4CK1A 5J2NA 1DTQA 4I2PB 2ILYA 3PJXA 4AHVA 1WSJA 1X9WA 3MFIA 4RW4B 3CJ2A 5KFRA 3H4DA 3KLGA 4R0EA 4RG8A 3UPFA 1N4LA 4GC6A 1S1XB 3CWJA 2QK9A 3SUOA 4FZXC 5C24A 3GIKA 4IR9A 4IG3B 4LQ3A 2GBZA 4TYAA 4G1QA 1NOZA 2R8IA 5KFJA 4WYWA 5KFZA 3RBEA 4FJHA 2VA2A 1D5AA 3K5LA 3DLHA 3ASMA 4MIBA 3QEWA 4K4TA 5SWMA 5KT3A 2HHUA 2UVUA 1JLBA 1NK4A 1W0HA 2FJVA 3Q8RB 1HNIA 4B8AB 5KFLA 1WSHA 3HKWA 1L3SA 4W5QA 2B43A 4J9NA 3HM9A 4TYBA 4FJ9A 4O3PA 1C0TB 1IKYB 4O3NA 2AQ4A 2OA8A 3SCXA 3I5CA 4J2AA 2D0AA 2E9TA 4CEBA 3LAMA 3VQEA 5EUHA 1NK0A 4CEEA 5KFPA 4KHNA 4HTUA 2YNFB 1JLEB 4RW7B 3AVBA 4B9LA 1RBTA 2ITGA 3RRGA 5HRPA 1N6QA 3KJVA 4JS5A 3OYDA 3LZJA 4BDYA 3C6TA 4M3XA 3G6XA 1S10A 4LY7A 1RT6A 1JL1A 4HUFA 2GIQA 5L9XA 4CHQA 3AA5X 4PY5A 1EP4B 4J9QA 3MR5A 4CJQA 4DU4A 4H54A 4PQUA 1HQEA 5J1EB 2PYLA 4FLXA 4YNQA 3WNEA 4CECA 1BGXT 1S9EB 4RW6A 5HP1B 1T03B 1VSKA 1D1UA 1TKXB 1G15A 4B3OB 4Z0UA 3TARA 2NUBA 1S1WA 4DTOA 4KHYA 4NYZA 2VG7A 4ZP7A 1IKWB 5T14A 4NLXA 1EETA 4DTXA 1JLCA 3LP3A 4CJKA 4EBDA 4CGGA 2FLNA 1JL2A 1RTJB 2HNDB 4CJLA 3AVFA 4FJKA 3GIIA 1RTIA 3AVCA 1SV5B 2YKNB 3V1OA 2HNZA 5KFWA 1VSEA 4ICLA 1WSIA 2ZKUA 5KG2A 1YTAA 1RBSA 3C95A 4KTQA 4E7LA 1XR6A 4M3ZA 2WONB 3L3VA 1TV6B 2IDOA 2OPSB 4DTPA 1JLGB 4KFBB 4O3RA 4ECXA 4HVJA 1X9SA 1X9MA 1RT3A 3NF9A 4EP4A 5DG7A 2IM2A 5J2PB 1X1PA 5KRTA 2JGUA 1FK9A 4FBUA 1S0NA 2KQ2A 1Z25A 4RUCA 3V81A 1LWCA 4OL8A 1QSLA 4URQU 4PWDB 1HYZA 2W7PA 4MK7A 1SH0A 2C28A 4TQSA 3E01B 4CEOA 4CJTA 4OKKA 1KSPA 1VSLA 3CM5A 1QSYA 3QLHB 3KLFB 3I5BA 3PV8A 4E7JA 3MR6A 2W9BB 2BE2A 2IJNA 3ZSWA 5KFTA 2X6SA 2FBVA 1HARA 2HWHA 2I5JB 1Q9XA 4NCGA 4E7KA 1BQNB 3C6UA 2IAJB 3U3GA 3KK1A 4K4ZA 4TY9A 5J2MA 4Z4HA 4QOZB 3G10A 2AJQA 1JLFA 5DLFA 3CYMA 4EYHB 3AA2A 3KK2A 4QWDA 3NMAA 3RMDA 1GOBA 2X74A 4BACA 4B8CA 4DFJA 5KFUA 2B6AB 3QZ7A 4NYFA 3RMAA 4RNOA 3L8BA 4JV1A 3MEGA 2AX0A 5KRSA 3HO1A 1GOCA 1WSGA 4O44B 1C0UA 2PY5A 1FKPA 5KFHA 1ZBLA 2IMWP 3DRSB 3H5YA 3OYGA 2OPQA 4NCAA 4Q0BA 3D5MA 4RUAA 5I42A 2C2DA 4CIEA 3VA3A 1VRTB 2FVPA 3UDLA 2ASDA 4CGHA 2CJQA 3QNNA 1EKEA 4KRFA 2R7YA 2KFNA 1K1SA 3BSCA 4JLHA 1BQMB 1C1CB 4OVLA 3UIQA 2LSNA 3V9UA 3LPTA 1RT4B 3L3UA 4Q5VA 1FKOA 4OLAA 3V4IB 4NLDA 4ZTFA 4DTUA 1L3VA 4ZHRB 3IG1A 4ID5A 3DRPA 2BANA 2IJFA 4DF8A 1TAQA 4KAZA 3DI6A 1UOCA 2RF2A 4KBIA 4Q44A 3WNGA 3I0RA 2XWYA 3GIJA 4ZP8A 1RAJA 2F96A 4ECUA 3PW2A 4RNMA 4MIAA 1HPZB 3V6JA 1RYSA 4K8XA 3PW5A 3DLGB 3KLIB 1NHVA 1TK0A 3DM2B 1TL3B 5KG5A 1A5VA 4FYDA 2RDIA 2XY5A 4M95A 1EX4A 3RAXA 3OHAA 1RTHB 1TVRB 4KHWA 5C42A 4IOBA 4CJ4A 1KCFA 3ITHB 4JUZA 1ASVA 4R5PA 4G3IA 3NGZA 2QXFA 4OJRA 1JX4A 3KOAA 4Y1DA 4WE1B 5KFGA 3BJYA 1ZBUA 4Y1CA 4XPCA 4F50A 3ALYA 5HROB 2J6UA 4FJLA 4Y2AA 2HMIB 2ETJA 3I8DA 4LD0A 1NK5A 4O4RA 3TAEA 4KHSA 2ILZA 5F9NA 1HRHA 4O3SA 3I0SA 4NLUA 3M8RA 1Q9YA 2G8UA 3LZIA 4NRUA 4KHUA 3CJ4A 3OJSA 5CYQB 4CHPA 4B9NA 3EZUA 1S9GA 4DTNA 3ISNC 3FFIA 2OPPB 1CZBA 1XC9A 4I7FA 5DQIA 1QE1A 1RA6A 3NGYA 1TK5A 4YQWA 4WZMA 3NF7A 3AVNA 3VQ9A 4BWMA 3GV7B 3DDKA 1T05B 3MEDB 4IH5A 3ZSOA 3CFPA 4GC7A 4WXOA 1J5OB 4DG1B 4M3TA 2G8IA 4Y34A 4IRKA 4J9OA 4B9VA 5F8GA 3K59A 4H4MA 1S6QB 5F8IA 3AVJA 1RT7B 5I3UA 5DMRA 4HKQA 4C8KA 3RMCA 3M8PB 3T5HA 2JC0A 5FDLB 1UWBB 4QPXA 3MR3A 5HBMB 1HJRA 3OYCA 3NBPA 4KREA 4K4XA 2D7SA 1C0MA 3QESA 3F9KA 3NAEA 2XC9A 3MEEA 3QETA 3N6NA 3IS9B 1LW0B 5KFBA 4LSLB 3M9OB 2YNGB 5CYMA 4F3TA 3H5SA 4M45A 3DRRB 2WOMB 4NZ0A 4ECTA 1DTTB 3HVAA 2XGPA 3HP6A 4BE1A 1TKTB 1ASUA 1R0AB 1UA1A 3VQAA 3VA0A 4F8RA 3DLKA 3QGIA 4RW9B 4HCBA 4I2QB 4IDKA 1WN7A 5KFCA 4PA1A 5E41A 5KT7A 4U6PA 3LPUA 1HYSB 3BR9A 3D0PA 3LP1A 4CF2A 3NH2A 2Z1JA 3CFRA 1D9DA 3V6DB 1JKHB 2GV9A 1LWEB 4DSFA 1KLMB 3O4QA 3TAMA 1RDAA 3AO2A 2Y1JA 5L1LA 1S1TA 2W9CB 1DLOB 4YFUA 4CEAA 5K14A 4DL5A 1XHZA 4F2RA 2GIRA 3FQKA 3AVGA 1SL2A 1S1VA 3LALA 3DYAA 2HHTA 4DU1A 2YNHA 1SKWA 2YHBA 2FLLA 5JS1A 5DGAA 4KO0A 4FJ8A 1RILA 3G86A 1S0MA 1WAJA 2XCPA 4M3YA 3V9XA 4IR1A 4IG0A 2W7OA 4KHRA 1BI4B 5KFOA 3BDPA 1JLQB 2Y1IA 1IKXB 2J6TA 3ZSVA 3RB4A 3F73A 2KW4A 2UVWA 3OYFA 4KKOB 2YNIB 4RW4A 2FJXA 1JXBA 4DWIA 4DLEA 3CQ8A 3ZCMA 3OS2A 2HHWA 1MMLA 3CDWA 1S1XA 3PVXA 3PO5A 2EHGA 4Z4GA 2ATQA 1C2PA 3L2UA 4FLZA 1BHLA 4KTWA 4CEDA 1U47A 4KI6A 1ZBHA 2XGQA 5C25B 5JS2A 3Q8PB 3QIPB 2R2TA 2IGIA 4G1QB 4MH8A 3D28A 4M3UA 4N47A 5EDWA 3SUNA 3QEXA 4DSIA 1RTDB 5KG6A 3OS1A 3TAFA 1KFDA 4K4YA 2XO7A 3TWHA 4CJEA 4CGJA 4ELVA 2JEFA 3AO4A 4AHTA 1JLAB 4RZRA 4TLRA 4MK9A 1IKYA 1C0TA 1F21A 1RNHA 5HRSA 3IN5A 4JRQA 3AVKA 1S1UB 1A5WA 4NLVA 4B08A 4KE5A 2YNFA 1JLEA 4RW7A 4O4GB 3DLRA 2YHAA 3O3GA 3G6VA 1B9DA 3HVRA 3PHEA 2CKWA 3DLEA 2FVSA 4ECWA 4QWCA 3KHHA 3VQ8A 3L2RA 3JYTB 2VG5B 4TN2A 3LWLA 3MXMA 2HHVA 2UUWA 4C8MA 1KLNA 1EP4A 1A5XA 3QZ8A 4F4YA 1EXQA 4JV2A 4K8ZA 1CXUA 5L1IA 3AO3A 5J1EA 4J9SA 4ELUA 3FRZA 4CJPA 3OLBA 5EWGA 3QGGA 3MTKA 1KFSA 1S9EA 5HP1A 1T03A 3TVKA 4EBEA 1TKXA 1SKRA 4B3OA 2QKKA 2IM0A 4CFDA 1LAVA 1REVA 1Q8IA 1TP7A 1IKWA 4DS4A 4NLWA 2ZD1B 3BGRB 4NLYA 3M8QB 5KFAA 1BIZA 1K1QA 2FVRA 3IAYA 4CIFA 3ZT3A 1RTJA 1EETB 5JXSA 2HNDA 3SQ1A 4J9LA 4CEFA 4E0DA 2YKNA 4K4WA 4XPEA 2E6MA 4RNHA 3K5MA 5FRNA 5DGBA 1MU2B 2C2RA 1C1BA 3BQ0A 3THVA 4CHZA 4YP3A 5L1JA 2D5RA 5F8JA 4RW8B 5DK5A 3S3NA 5HRNA 5JUMA 3MXJA 4TY8B 1J9AA 3OYAA 4FS2A 4EZ6A 4OKEA 2BR0A 4J9RA 4ED2A 4ID1A 3SFGA 1D0EA 2WONA 3HP9A 4DSEA 4ED3A 1TV6A 2OPSA 1JLGA 4KFBA 4AHUA 1KRPA 4KV8B 5CY4A 5SZTA 5J2PA 3AVMA 5FROA 1RT3B 1VK0A 4FJNA 4PWDA 4IFVB 2ZQBA 2RN2A 2KFZA 2RPIA 3PX6A 1QTMA 4KB0A 1TKZB 1YTUA 4MKBA 4FM0A 3E01A 3QLHA 3KLFA 4WXWA 4ZPDA 5KFQA 3KD5E 4IFYB 1NK9A 4JS4A 2W9BA 4NLRA 4EEYA 1I3AA 3A2FA 3OYHA 2JEGA 2AGPA 2AU0A 3V1QA 2RKIB 2ASLA 5J2QB 4EO8A 2FLPA 4CEZA 1JIHA 2I5JA 2D0CA 3OYMA 4DL7A 4AILC 4M41A 2O5DA 1BQNA 5KG3A 2IAJA 4OPJA 5DG9A 4K4VA 3MECB 4N5SA 4FLTA 3KK3B 4DL4A 4WFZA 3NHGA 4F2SA 4AH9A 3GV5B 1U09A 3NE6A 3KIOA 3KHLA 2DPIA 1ASWA 4CJWA 3CFOA 3PO4A 4FK0A 3LAKA 1L3TA 1XWLA 3AVIA 2XHBA 4ZVFA 2B6AA 2C22A 4AHSA 2HNYA 4CK2A 4ZMMA 3QYYA 3NKYA 4K4SA 2ASJA 3VQBA 1N5YB 4J2DA 2E4LA 3LP0B 4O44A 1N56A 4EO6A 3QNOA 2E9RX 4IRCA 3KMSA 2DPJA 1RT5B 3DRSA 4L8RB 2XY8A 3HHKA 4QWEA 3ULDA 4ECSA 1GOAA 1U04A 1TAUA 1QHTA 2G8WA 1RCHA 3QEIA 2IBKA 3NGIA 3KTQA 1ITGA 2R2RA 3GILA 4FLWA 2AGQA 3IRXB 3TANA 4LSNB 5KG1A 2WRMA 4OPKA 1BQMA 1C1CA 2R8JA 3OYEA 4PUOB 3KKSA 3ZSYA 4MFBB 2W42A 1RT4A 2D41A 3ZT4A 4W5RA 4FK2A 3V4IA 1NK7A 4ZHRA 4ZPCA 4QW9A 2DFFA 2P51A 4WFXA 4C8OA 3JSMB 1SUQB 3HYFA 1HMVB 3GIMA 1UA0A 2OZMA 3T1AA 5HLFB 4YR0A 4FJJA 1HPZA 3DLGA 4QAGA 3KLIA 3OYBA 3RR8A 3DM2A 4R8UB 1S49A 1TL3A 4M42A 4C8LA 1U4BA 1ZBIA 2OH2A 4KB7A 2IC3B
chains in the Genus database with same CATH superfamily
5IXUA 3D1HA 2RHKA 4GW6A 2LQ8A 1S22A 3CJ1A 3UR0A 3TZXA 4IOAL 1KVAA 2QJ3A 3FQLA 2DR9A 2R8GA 4E7IA 2EC0A 2YWGA 3LDLA 3PACA 3D2FB 3ZZUA 2EWHA 4JI0F 2DR7A 1HQUB 5A8KA 5HROA 3SV4A 1KAZA 4KHPJ 5G0RB 4KB1A 4B3MF 1X8DA 3HVTA 2QL7B 4LMZA 3M05A 2VFSA 3VQ4A 2EX3A 4BRNA 1OIAA 4FKXA 2FXUA 2HMPA 4ZVHA 5KFIA 1B70B 4ED6A 5CYQA 5B7WA 2LDYA 4IFEA 4CHYA 4CTAA 3KLHB 3QEPA 4H0TB 2WW4A 3VVTA 5AQRA 2CPXA 3DNCA 1X60A 1F5AA 4OGCA 3W2WA 3CG7A 1I51B 3A5NC 1A6LA 1MROB 2E5IA 2CVIA 3ID8A 3O1WA 1FD8A 4DBQA 3OA9A 1IM4A 1R6VA 1VYAA 2HQIA 3K8VA 5AE3A 1OJ4A 4BCAA 3MEDA 3VQCA 4PKHA 2V68A 3MM6A 4C6AA 4DG1A 2I2YA 1EWRA 2W24A 1IBMK 4ED0A 2P6TA 1GLLO 2G0IA 4ETXA 3JSRA 2AIRB 1RT7A 3V9ZA 2YJFA 3ISND 3M8PA 2D1KA 5IV3A 5FDLA 5J1NA 5IFMA 3TEGA 4NA1A 2N4DA 3L09A 4OHXA 4DTJA 1NPPA 4A48A 3CC4S 3IAS9 4HUGA 1QS4A 3HL8A 1SC1B 1WUAA 4FM2A 1RHQB 3GTYX 4JI7K 1D9AA 1DTTA 2YKMB 1JXLA 3UE5A 4KHQA 3W62A 3K2PA 4IKFA 1VOMA 2CPDA 2VG6B 3CNQP 5DDQC 3AB2B 3CXCR 2JC1A 5KPZA 2ZJQQ 4RW9A 4OO1J 1HYSA 4FWOA 1PSDA 2W2OP 3CPWM 4MMOA 3O9SA 4HTJA 1DHMA 2QWOA 1X31C 1ZH5A 1YVUA 2MJNA 1YRTA 1U8SA 5BPLA 4CLSA 5KT2A 4OZ5A 3QIOA 2HWIA 4FWLA 1JXEA 2YI1A 2FSJA 3ETMA 4F3QA 4BR5A 2W40A 1LWFB 4ZPBA 2NQPA 2ZM6F 3O3HA 2DRAA 2LXUA 2RE1A 1LW2B 2VCPA 1M1HA 4N41A 1F1BB 1YRXA 1D3WA 1S1VB 3HD2A 3RSEB 1R3NA 3E51A 4MKYA 3BGFA 2B5JA 1PJ7A 4JYAK 3ILLA 3MMBB 2HQDA 1EZZB 4BLGA 5ETLA 1WORA 2ALYB 1FF2A 4B3RF 2MHNA 4ZTJA 3G4SS 4BVOA 2WVCA 3EICA 4WFBL 1JLQA 1IKXA 3HSGA 3BF1A 2RT3A 2J7KA 2NLWA 5J2NB 3PX0A 1MW7A 1T11A 4H0OA 3ENAA 4I56A 4NLBA 3OBWA 3C94A 2YNIA 2L08A 4PWUA 4FW2A 5KPRA 1ZAXA 2VQFK 2RNEA 2B4JA 2MSSA 3OFEA 2NZCA 1L3UA 2HAFA 1MN9A 1M5SA 3ZT1A 5AQFA 4CW7B 4IG3A 4LF7K 1W25A 1UFWA 3CC2N 2VU5A 2V63A 5C24B 1FA0A 4JI2J 2CQHA 4BRQA 5AZJA 3RYLA 4OHYA 3RBXA 2ZH5A 4K2JA 3GWCA 4AQYJ 4LH5A 3RTVA 1VSMA 1XNRJ 4PKDB 1XTZA 5ETOA 2YPZA 2VBYA 2WTUA 2XZWA 2JH3A 3M8SA 4QCLA 1FXRA 4WKRA 4FZYA 3PTWA 1UVKA 4K5RA 4KPYA 5AQHA 4DR5F 4DMNA 2DFHA 3FBBA 4DQQA 5AQTA 2O8EB 4X64F 4Q7AA 2ZH7A 2BQUA 2QLFB 3CCEN 1QUVA 3ZNUA 5HVHA 4UOHA 9RUBA 3CIZA 1N5VA 2XB2D 2OTJN 5CH7B 3PW4A 3SYZA 1N34F 3R27A 4CE9A 1VR6A 4IUFA 2ZH1A 3DLBA 4OHWA 3Q89A 2VYPA 1C1AA 2QTWA 3MPWA 5KFVA 3GSIA 5HQLA 3D6RA 3M8QA 2RSQA 3BN4A 4ZK7M 2YPYA 4ED7A 3G82A 2XM3A 2L9DA 4CESA 2H65B 2CJAA 4W5TA 1SV5A 4BC7A 4HACA 3DRXA 5K8NA 5GADI 1VHIA 2VBXA 3LDSA 4AHRA 3MEKA 1RTIB 1YJNS 2P9IB 3POTA 3DCAA 4Z4IA 3ENBA 3QSYB 4TY8A 1M5HA 2R8HA 2ZNYA 3LDNA 4B9QA 3LO3A 4JK9A 2Y0BB 3IGNA 1YZ7A 1U0HA 2YKQA 3HPHA 5F1XA 4M3WA 2UXDK 2Q3SA 2BE7D 2GC8A 5AQYA 3CJ7A 1RAGB 4USKA 2VODA 1JJ2R 1OH7A 3KD1E 3TYTA 5HMZA 2AEMA 4DV2K 1N32J 2VWBA 1V4SA 3TR5A 4ER8A 4CLLA 3BN7A 5D77A 2AJ1A 3OYNA 4KY3A 1T3NA 2ZEJA 4BC3A 5ELZA 2BE2B 1EQ0A 2BOAA 2F4FA 4QYZK 3LANA 4FM1A 7FD1A 3OY9A 2KZMA 3SUQA 3IGVA 2KN4A 1Y0HA 4NCGB 1ZM4A 3ZETA 3C6UB 5RUBA 1BHNA 5BJRA 3EPIA 4CI6A 1JLFB 2ZOMA 3KK2B 3EJMA 2YX7A 4UT4A 4CJ3A 2UUAF 3HPOA 4F4ZA 1NGIA 4FWNA 1SC4B 1URRA 2IM1A 2ROEA 3R6GB 2AMCB 3V9WA 4AL5A 4LRDA 2HRTA 3OV7A 5CXTA 5LJVA 3RMBA 4C8NA 1N5YA 1EWQA 2HFVA 1HNXJ 1NJXA 3LP0A 1C0FA 5M1NA 2X6NA 3CJKB 2HNYB 4PEOA 1HNWF 3N6LA 1Q82T 1FKPB 4FKYA 4LSZB 1BCMA 4Q0BB 2BRLA 3GONA 1YQHA 3HPGA 2JNJA 4ERDA 2HQFA 2C1EB 3NL0A 3GV8B 5HMWA 1O1WA 3HTVA 3OYJA 1FXXA 1FFWB 4AL6A 4PUOA 4CJVA 1NHKL 3MGJA 4MFBA 1VQ8S 3CQXA 2DGWA 1UL3A 4RO0A 3MWBA 3VQQA 2Q97A 4CGDA 2PFFB 3GYNA 4N8NA 1ATNA 1P8GA 3VEYA 2KXHA 3UD5A 4DL3A 1PCAA 5GAHU 1HMVA 2ACYA 1UWAA 4Y2KA 3VZHA 2Z2YB 3S8SA 2ZBQA 3V6HA 5KI6A 4OX6A 1JCGA 3PRVA 5KOXA 1FJGF 3SXLA 1C6VA 3ZZZA 5EWFA 5HATA 1GLBG 4NXMK 3LWMA 3UB5A 2HHQA 3L0QA 4UW2A 2CG8A 2WW8A 1XMOF 4LFBJ 4R8UA 2F7TA 2L41A 2WFBA 4JD2B 4OJ1A 3GCWP 4U7CA 2ADCA 2IC3A 2GVDB 4Y28C 3T3FA 3LP2A 3MF5A 5AQQA 5C42B 3HHLB 4OMFG 1EB0A 5KFYA 4DTRA 1GX6A 2GHWA 2AA4A 1BL3A 3DOLB 3CI5A 1VQYA 3DXKA 4JV5F 1JNZB 3M1FA 2CJ9A 5KGWA 4X66J 3U1LA 4DI6A 2MLZA 4CK3A 2B56A 4Q8FA 2IOCA 1Z1ZA 1FRKA 5LT5A 4DR2J 1VRUA 4P72A 3HHLD 2FBYA 2QSFA 3KKRA 1U2VA 1RA7A 2A1RA 3K5OA 1XR7A 4C8ZA 4URGA 3DMJA 3M1VB 3HSJA 2OJ3A 4KRWA 4I6YA 3L7UA 3ENVA 2FC0A 1S9GB 4YDUC 5GAHP 5F2RA 2J76E 1CC7A 4CJRA 1ILYA 2J0WA 2LYVA 4CT9A 3EE8A 1RFQA 5H9EJ 1Q16B 2E1PA 3TR8A 5KFSA 4WKYA 4FWKA 1WAFA 1Q7YO 1R8BA 4DKWA 3MMCA 3SLCA 4ZVEA 5I9EB 4BWJA 2OSRA 4DL6A 1UWBA 1PC5A 4DV4J 5B0EA 4DPTA 4FWSA 5I3PA 2ACMA 2GAHC 5I3UB 1PC4A 2QTDA 1EKSA 5DDPC 3BGOP 3CCMN 3KJFB 3AARA 4XAKA 4OLBA 1UPPA 2Y8YA 3VENA 1MWYA 1NNDA 2JHEA 3OTDA 4DLGA 1U1QA 2ASYA 4CFCA 4IH7A 3PR5B 3HJFA 3UN5A 3CD0A 1I6JA 5ETRA 5ETKA 3T5JA 3OL8A 4Q45A 1S97A 4B9MA 1WUUA 2CDQA 4FYXB 1BD6A 4CHNA 2LEAA 3L2VA 1PAEX 2E1YA 2C2KB 2ZVSA 4H4OA 2FZKB 3MTJA 4CGFA 3IC1A 1FRIA 2CNOB 1KQSR 3BSNA 5GMDA 2GWKA 2HBLA 5KGXA 1QLNA 4JI6F 1U1PA 4OYAA 3KWGA 2IJRA 2MXYA 3D68A 4P75A 4CD3A 3AA4A 5CZ2A 2V4QA 1M1KO 4B3MK 4BGAA 2Z1IA 2FY8A 3TAMB 4MKAA 4PG5A 5EX3A 4ZVGA 2OIHA 3D6FB 3Q8SB 2YTCA 3L6QA 1VSDA 4NXNK 1RT2A 2DPNA 4FW1A 2H48B 1T6DA 3HSTB 5D4NA 2O4IA 4KH1B 2DJWA 4CO2A 2I9SA 3R6LB 3VGLA 1D8YA 1BUPA 3VAHA 3RUBL 3VHQA 1XI1A 4FS1A 4KKOA 1B64A 4BRFA 2IBOA 3A1YG 4AHVA 4RUHA 3P8BB 3FEZA 4XDDA 1X9WA 3CJ2A 5KFRA 2D9OA 1CS4B 3KLGA 2ZHBA 3D6HB 3UPFA 3WC2A 4QJVA 2R7XA 1NGDA 1N4LA 1TL5A 2H3GX 2ZBCA 1Q8KA 3T69A 1SQFA 4F0MA 3OTOJ 4OV1A 2JDJA 1EKRA 5C2CA 1HWIA 1NOZA 2NRZA 4CBXA 2QN6B 5KFZA 3M30B 5GVQA 3H2VE 3HD1A 5SWMA 4WCEL 4JB8B 2HHUA 1FX2A 4K8RA 4ZVPB 2FJVA 3KK7A 1WSHA 3HKWA 4WFNL 5HI7A 2B43A 4J9NA 1C0TB 1IKYB 3JQKA 5C2FA 1QUPA 4O3NA 4OX8A 2AQ4A 1WF1A 3BO3A 1MWZA 2FQQB 1TFWA 4I1TA 4CZCA 1NK0A 2Q31A 2YNFB 4RW7B 3EGNA 3VETA 3E8OA 2D4WA 2CQBA 4ZS6A 3EKSA 4JI4K 1FFSB 2ITGA 1N6QA 2EKNA 3LZJA 1I5OB 1FFGB 4KGVB 1WHWA 2CQ1A 5D0EA 3AA5X 2ZM6K 4PY5A 3EDQB 2KM8C 1M90O 4Y00A 1RGVA 3OT9A 4H54A 4PQUA 3C65A 3C15B 3AT1B 1K47A 2F3JA 5J1EB 3AH6A 1KVIA 4DMZA 1BGXT 4RW6A 1VSKA 2Q79A 2MMYA 2JZ5A 4B1VA 1S1WA 2HHHJ 2RAQA 4KHYA 2VG7A 4ZLPA 2YQ0A 3WXJA 1EETA 2HF3A 1JLCA 4HVZA 2ZWPA 5DDRC 3C14A 5ITHA 4CGGA 2HEKA 2HFZA 3R7NB 4CJLA 3J7Z5 3AVFA 1OH5A 5H9FJ 1HW9A 1Q1KA 1X4GA 1VSEA 2E5LK 5A2QO 1KEKA 1R31A 4CLWA 3I4HX 1RBSA 5HVFA 5E33A 5FIIA 4OZLA 4NI2B 9ATCB 2J7WA 3BBCA 4UY8O 2FHOB 3AGRA 4P52A 2GQCA 3LQVA 1GMUA 2IHR1 4EGLA 4DXLA 5AQUA 3WQUA 4NASA 4O3RA 1AB8A 1HBNB 2V50A 3BV8A 5HJYA 3MX2A 4KYZA 1LXNA 3TUPA 5J2PB 2W2MP 2JGUA 1FK9A 4FBUA 4YHHF 1I3OB 4URQU 4DR6K 3K2YA 2LQ9A 4JI3K 3U8XA 4CIOA 1HYZA 2W7PA 2QEXN 5GIOA 2C28A 4TQSA 4DPOA 1KSPA 3CM5A 2B8QA 1RP5A 4USHA 5FLXY 2YWFA 3TJAA 2Q1LA 3C46A 4DV7J 3WDOA 2VPZB 4LF9F 3GFXA 4E7KA 1BQNB 4GO7X 3JAMY 1RK8A 4DV1J 1GXLA 3ETOA 4NL5A 2XMVA 1N34K 3G10A 3CYMA 4EYHB 5EHHA 2PI5A 4F25A 3NMAA 3RMDA 1JCEA 2C3YA 1TL7A 1N54B 4M5DB 5DM6Q 2B6AB 2COLA 4NYFA 2BA9A 5GAGI 5HQMA 4JV1A 3D2EB 4YB5A 2Z58B 2ZGYA 3B8AX 3U1NA 2OPQA 4K25A 1LK5A 4HHHA 1VRTB 2DTJA 2W4DA 4CGHA 3K8WA 2LDIA 4FOIA 2KFNA 3BSCA 1T3VA 1YI2S 3UIQA 2DNZA 1FKOA 1NGEA 3HLUA 5B0CA 4JI5K 1RWWB 1RUSA 2J9CA 2HS0A 4PXCA 2OD6A 1L3VA 1NGCA 3R97A 3AJ2A 1IR1A 3MM7A 2BANA 3OVBA 4KAZA 3DI6A 1Q0NA 4Q44A 1LFWA 2Y1RI 1HKGA 1G4CA 3I56S 1RAJA 3KUGA 1EAYC 4ECUA 4QS7A 3V6JA 1KN6A 1T44A 1H7XA 3CJRA 1J2VA 3DLGB 3KLIB 4LR9A 2O8BB 1NHVA 1TK0A 1G7CB 2DGOA 2XHWA 4ANEA 3WIVA 5A6PA 5TKYA 4LFAK 3OHAA 1RTHB 2F1FA 4CJ4A 3TA2A 3ITHB 3SMPA 4JUZA 1V9OA 1JX4A 2DO0A 4WE1B 4JI8F 1G6BA 3BJYA 3TSPA 4XPCA 2OI2A 4OPHA 3NVMA 5EX5A 2C2OB 4ZLNA 3U9ZA 2ILZA 4JKAA 4D3GA 2DVIA 1PYOB 1P27B 4GVLA 1IJFB 1JWWA 4NLUA 3M8RA 3CGIA 3LZIA 3O1LA 4Y6IA 4KHUA 5C0YA 3CJ4A 1NDPA 3OJSA 1V3RA 4CD1A 4O8UA 3KDNA 2NS1B 1MWQA 1QDUB 4YUDA 2UU9J 1Y10A 2V2QA 3CT9A 1AXQA 5CA5A 1UVLA 2NZTA 3FFIA 3TZWA 2OPPB 1QE1A 3VGUA 1RTZA 3NF7A 4BRCA 3SBGA 1Z05A 3GV7B 1X5OA 3PYFA 2HBJA 1J5OB 4CLPA 1XK8A 4Y34A 2DHXA 2OHDA 3MDQA 2MQLA 4IRKA 4J9OA 5F8GA 1Y00A 4WJBA 4QYRA 5DMRA 1VBYA 1T9XA 4C23A 1HJRA 2MJUA 4KREA 1FJGK 2D7SA 5B0BA 1K0VA 3QETA 4Y2IA 3WXKA 1LW0B 3M9OB 4LSLB 1XMOK 4YEAA 2YNGB 1MN7A 4W92B 2OEMA 1G99A 5AQIA 3H5SA 3MOJB 2WOMB 1S72S 2VJVA 2L3MA 3CE8A 2BKNA 3HP6A 4GV9A 5DS7A 4CBUA 2DXEA 3VQAA 4F8RA 2CADA 3GFYA 3QGIA 4HCBA 4DR7F 1WN7A 2UXBK 5KFCA 4M5GA 2P9NA 1U7LA 3LP1A 4CF2A 4OZ0A 1TU0B 3V6DB 4IWVA 3T1YF 2CNNB 4XEIA 3G2XA 2P8IA 3VMFB 3O4QA 3KFWX 4H5RA 2ZJPL 4DN0A 5K14A 4DL5A 5IT9Y 3ZEUB 4K0KJ 1NRKA 1H38A 1S1VA 5KAKA 5D4OA 4ZJLA 2HHTA 3I31A 2BV3A 1HD0A 3F5TA 2YHBA 2WBNA 4H4KC 2PA8D 2XNRA 2MKYA 2LVWA 1WAJA 3DXMA 3VAKA 5BPNA 2W7OA 4A8OA 2YX4A 4P71A 2ITMA 4LF8F 3RB4A 2EBEA 2FJXA 2VDIA 1IUJA 4U67L 2HHWA 2X3GA 3N0VA 2HS3A 5L8RC 3PVXA 4F9OA 1NPRA 2C2ZB 2V8VA 4Z4GA 2ATQA 1C2PA 3L2UA 3RBZA 4KTWA 4KHPK 2LKZA 2MPUA 1U47A 3ATUA 3SCKE 3OTCA 2A6AA 2XMUA 2CQCA 2BW2A 1ZS6A 3B4MA 4M3UA 2L48A 3PSFA 4D3HA 3M5RA 1FDAA 5KG6A 3TAFA 4K4YA 4FDFA 2QGFB 3TWHA 4P73A 1UKUA 1UCNA 4CJEA 1UMJA 2JEFA 3AO4A 1JLAB 2NRHA 2NRRA 4TLRA 4MK9A 3CC4N 4IOCQ 1U8WA 2AZ1A 3GE9A 2ZH3A 2ZJRQ 1R8PA 3IN5A 1IR0A 2A2CA 3AVKA 2HIYA 1HBOB 3CCLS 1JLEA 2I6WA 1VK3A 1ESVA 3S41A 3O3GA 3VAGA 4RCHA 4DUZF 3MN5A 1B9DA 3PHEA 2V94A 2XQCA 3L2RA 3KHHA 3JYTB 3LWLA 3LW5C 1VQ7S 2DYAA 1EP4A 3M6XA 2ZKTA 2OSQA 1W7AA 4IXCA 2AT1B 2KJWA 4F4YA 5F3TA 3S7RA 3TPQA 4K8ZA 3R1XA 4ZPTR 1ACMB 1P9QC 4J9SA 2A0FB 1SKRA 4ZIVA 4UOFA 2D3OR 1LAVA 1KR4A 1IKWA 3A8EA 3R9LA 4DS4A 3O8WA 4NLWA 4QZVB 4NLYA 3MWPA 5KFAA 1F6TA 1PIEA 1BIZA 4OJHA 2D69A 5JXSA 3SQ1A 4CEFA 2FC9A 2YKNA 4K4WA 4XPEA 2VASA 4UOCA 3K5MA 3CF5L 3AB4B 1MU2B 1HKBA 1FEHA 4ZVRB 4ZCMA 3G4SN 3BQ0A 3THVA 3UKRA 5T7LA 5DK5A 2DGTA 3CJ9A 4QIWD 4FOEA 3ZFVA 3HP9A 1LCUA 1TV6A 4AHUA 2FHJA 2GVZB 4PXEA 2DNOA 2ZH9A 5SZTA 2DGUA 1WDDA 2OKQA 3AVMA 5FROA 3O9QA 1E3MA 1ZBTA 1RT3B 2DRBA 3CEDA 2BYCA 2POKA 3GCXP 2LU1A 4TU8A 2ZQBA 5GIPA 1TKZB 1B4SA 1PKUA 2O8FA 2X1FA 2RHSB 4FZVA 3NLCA 3AY0A 3KLFA 5KFQA 4IOAQ 1I3AA 2JEGA 2AU0A 2F9WA 1AT1B 4U9RA 5A6WA 2RKIB 3V1QA 1B3TA 3AHPA 2IRXA 5C12A 3HFKA 1ZA1B 2IAJA 1HHTP 3QT7A 5DG9A 3M6GA 4N5SA 4FLTA 5AXMA 3KK3B 4DL4A 4C2MA 2A2DA 4I64A 3EGZA 1VJWA 1YX2A 4GVEA 1ASWA 4JI2K 2F65A 2R3VA 2GJ2A 3B8HA 3LAKA 1L3TA 1S0VA 5AJ3F 5G4DA 2C22A 2P9UA 4PG8A 1MNEA 1NDLA 1DT9A 4AQYK 2HNYA 4CK2A 2KHOA 1XNRK 2P5VA 3QYYA 1UJ6A 2ASJA 4J2DA 2DB1A 2R4FA 4O44A 4EO6A 4DR1F 3QNOA 5IWAJ 2E9RX 4BRDA 4IRCA 3R8YA 2DPJA 4YB6A 1YUWA 1RT5B 3OVSA 1XERA 3HHKA 4QWEA 3ULDA 4ECSA 2ATCB 3HJVA 3NP5A 2QFJA 1RCHA 2IBKA 2A41A 5HAOA 2J7UA 1JJCB 1SI9A 4FLWA 2CA9A 4LC9B 4ZA1A 3A3NB 3HSCA 3K89A 2R8JA 2XMMA 2XMWA 3THYA 5A8WA 4BROA 4WFAL 3MMVA 4OYIA 3QSIA 2DFFA 1TFYA 4WFXA 4BG9A 4PQAA 4C8OA 2MKKA 4MTPA 4G1PA 1YJNN 4X65J 3THWA 1RAFB 2WVBA 1S59A 1FKAF 1NNEA 2HBKA 3MD3A 4YOEA 4ZIWA 3T1AA 1Q5VA 3QRPA 4YR0A 4FJJA 3SCJE 4WK3A 2J9DA 1GLJO 2YBVA 4M42A 4N7TA 2JLFA 4C8LA 4ED4A 2CPYA 4ILLA 3WNGA 1OH6A 4X62F 3D3CJ 2V4RA 4QQBA 2DY4A 1K6YA 3DOLA 3IBFB 3H20A 1PBUA 4LREA 1ZAVA 4CO4A 4N8OA 1S6PB 2CRLA 1YRUA 4NLTA 3VGTA 2KRRA 3DAWA 2HMIA 2Z1GA 3ISZA 1NK6A 3SUPA 2Z4PA 3IUCA 3LUYA 1FT8A 2HBMA 2KT5A 4DTSA 4Y0WA 4B17A 3M6VA 2YCHA 4C0OC 5LSOA 2UUBJ 4WFBQ 1RADB 2IVMA 4KSEB 4YDUA 1N32K 2O4GA 2BW7A 2EVZA 2G0CA 2FVCA 3OYKA 2YVSA 1T05A 3TNVA 4F3OA 2YH1A 5L1KA 4MDBA 3FMWA 2BZ2A 2CPJA 4HI2A 2V7YA 3FDSA 4YOUA 1WF2A 3PEHA 4KGKA 3ENOA 3DLLL 2XWXA 2W9AA 3VTHA 1TGOA 3T19A 1X4BA 3JTOA 4ILGB 3PIPL 1SL0A 4LF5J 3RB0A 3KLEB 2E7XA 2DFEA 2V8HA 5LMNF 2P9EA 2KXFA 4USMA 2JFDA 5FLXU 3D1OA 1M5VC 2ZF5O 1IBLJ 2D0OA 5B08A 1VQ8N 4YOWA 1NJIT 3H7HB 2CJXB 1KONA 3DRRA 3VQSA 4J9KA 3JAMU 3RVCA 1HNXK 4KH4A 4A57A 4W5NA 4CIGA 1U6FA 4F4XA 2PDAA 4NCBA 2UU9F 2D3UA 3H4BA 4EFAC 1R0AA 2DXFA 2P9SB 3QWPA 3C7NA 4JI8K 1S12A 1IKVB 1X0PA 4JV0A 2GNKA 1JKHA 1IO2A 4IQXA 1LWEA 4PR6A 2HZAA 2QZ8A 5HMXA 2V67A 5LXRA 1G1XA 1UVNA 4RWTA 1KLMA 5DG8A 3T1HF 2W9CA 1DLOA 1DY3A 2FY1A 3PX4A 1J54A 3M4XA 2LLZA 1S48A 4AD6A 3OL9A 3VAFA 4ITSA 4A59A 4P9SA 4DSKA 3CPEA 3OYIA 2WB4A 3T5LA 2RVJA 1U49A 3T9ZA 1BIUA 4GRSA 2WUSA 4CFBA 1T9WA 3MWTA 5F0UA 5E3PA 4UY85 3H45C 3KNAA 2LQ5A 3VAJA 2Q6BA 3OFFA 2F7VA 4M5JA 3LM9A 4LFBK 3W63A 4CI0B 1BI4A 1W2BR 1Y64A 2F8EX 5AQWA 2WK4A 3LH2S 5HVGA 2WTFA 4CJUA 1U6BA 3GB0A 2VFUA 3W2VA 1DTQB 4JHDB 2YX1A 4TU9A 5CE3A 2VWJA 2M7SA 2BJ1A 3ET6A 2RB7A 4DU3A 2V0NA 3L7PA 4OX9J 1SXLA 3AXMA 1CJTB 2ASMA 3M9NB 4DPUA 2LXFA 1VSIA 4X66K 4R0JA 1T94A 1B0PA 1OY9A 3CJAA 3QERA 3QIPA 2V51B 5MLCV 3H08A 4DR2K 2G8HA 2VPXB 2VGMA 2WHOA 1S0OA 3OR1B 4G6VB 1RTDA 5M1FA 3J7AN 1Z2LA 3PNIA 4CHOA 4FK4A 1HNIB 2UVVA 2PC6A 4KPCA 4EI2A 4ECZA 1IBKJ 3KXDA 1WG5A 1WHYA 4LRBA 3WBZA 4M5KA 2D3ZA 3D9BA 3Q8YA 3BZQA 2BTFA 4KAIA 5H9EK 2J9DE 3MFHA 2BXJA 4O4GA 4NRTA 1HI8A 4JP8A 1GLAG 4ES3A 3KDOA 3BO2A 3PM9A 1NLVA 1RBAA 3KJVB 4EK2A 2FZCB 2VG5A 2GO8A 5DJBA 4DV4K 3C6TB 1FNXH 1RT6B 2Q1NA 1XIQA 2IIHA 3SAHA 3ELHA 3QMQA 2GX9A 1YVFA 5DQGA 1NJYA 1NZAA 3N4QA 1TUYA 2IYGA 4B9TA 1HQEB 4E98A 1ZTWA 1RDBA 1RACB 2H54B 2KT3A 3PYEA 3M2RA 4B3SF 4FJXA 1NMEB 2IM3A 1NJZA 5FPDA 4J9PA 5M1QA 4BR2A 2V8PA 2H4WB 2ZD1A 2QMWA 3BGRA 2ATLA 3QFWA 1YDLA 1ROFA 1REVB 5F8NA 2HRYA 3SPZA 1ZPVA 1NMDA 5IM0B 2GELA 5D0GA 2QFIA 4YDDB 4Z7CA 3PDNA 3VQ6A 4CGIA 4ETZA 4B3TJ 2HNZB 3ZX3A 4JEPA 4CZIA 1XJWB 7FDRA 1VIXA 2XY7A 4RW8A 4C3LA 4J37A 1E6YB 1Y9OA 3CCWA 3CM6A 4LUBA 1DQ9A 4KR0B 1SJ4P 4FCYA 1VSFA 2E2NA 5T7BA 1HBNA 1QAIA 2XYHB 4TVAB 1VSHA 4WQ5C 1VIOA 1XMQJ 4ZPAA 3IXQA 5KG0A 4O0IA 5HK4A 4UQTA 4KV8A 2RJZA 5BREA 3NWRA 4TNOA 4DV3F 1B92A 4YMEA 3JXOA 4PABA 4ANCA 3V81B 1LWCB 4DR3J 4ID8A 1OSDA 3I4PA 4PRFA 4GMKA 4USWA 5IOLA 3G87A 3SZ2A 4IFYA 5IT9U 2GX8A 2R7RA 3B78A 3QJLA 2O8DA 4HT7A 4ECYA 3J7AP 4FLVA 5J2QA 1LQ9A 2R7TA 4LRCA 1GH8A 3AO5A 3RR7A 4RNNA 3FZHA 2NSCA 3OYLA 3QGPA 4L76A 1CJUB 2J5AA 2PZSA 3OTOK 5DO2A 2FJWA 4XDCA 3TX0A 3OHBA 4WFYA 3OS0A 1RDDA 1T02A 3RB6A 4Z4CA 3ZSRA 1WSFA 4JNEA 4EP5A 3N28A 4UQGA 3ZZOA 1ZM9A 3CCSS 2VBWA 3O08A 3VN5A 1RZMA 3MEGB 2DR8A 2ZBIA 3NGUA 1N0UA 4BQZA 1KDNA 3FE1A 4PG4A 2JEJA 2IYIA 1Q18A 2G8FA 1VRTA 2YH0A 3D1QA 2HFUA 4H8KA 5IT0A 1I39A 3DDNA 2N3OA 2MB0B 1RBRA 5I42B 4CLKA 3HHNB 3CCRS 3IRXA 1HLUA 4FXDA 4HUEA 2FBTA 1IXKA 3FBCA 3TUIC 1N36J 4X4PA 2DCUB 4BS2A 1WC0A 3E9LA 1IBMF 1N0VC 2CWKA 3RBDA 4DEZA 2MQ8A 5GAEI 1OH8A 3H98A 3AGKA 4YB1P 1S9FA 4H03B 4USJC 3LGNA 1L3KA 3IG1B 4JOUA 3DRPB 5KFXA 4HYKA 4IO9Q 2RF2B 4IDHA 1LXJA 4JKBA 3MMJA 1FERA 3OQ2A 3TA0A 1LAWA 2NRVA 3I0RB 5HJXA 5EX0A 3KUHA 1RAIB 2EWSA 2CFXA 3SEOA 4FJMA 1UW9A 2LCWA 3M2UB 4JKGA 3DN9A 3PW7A 3CJTA 5KFKA 4HL9A 1RAEB 2XCAA 2AV5A 4M5LA 4OGEA 3NF8A 2H5EA 2JLEA 4F4KA 4KI4A 3SPYA 2LQJA 4GO5X 3O80A 1IJJA 3MN6A 5H9FK 1TL1B 1N48A 3TRGA 3CJ5A 1SAZA 4A62A 4USTA 1VQSA 2YQ3A 1QQCA 2P9CA 4YR2A 1SH2A 2YY3A 1N33J 2B7CB 3RZAA 4CO0A 4ZP9A 4DQIA 3H46O 3WEEB 5ETMA 3WX4A 3NGDA 1U6ZA 3QRQA 4AUKA 1FWKA 1FO1A 3P31A 3HCXA 4LJMA 1OKJA 2O8CB 1F5CA 4X65F 3QO9A 4FNHA 1ZTTA 2VWKA 3MMAB 1BWFO 1DURA 4K4UA 3PYGA 2XZDB 4H0YB 1FXLA 2HGMA 5LM7E 1OYDA 1RWVB 4JYAF 1DQ8A 4DCHA 2W8KA 4CCHA 2UUTA 4DV7K 2P5OA 3PW0A 3I55S 2Q2RA 3OJUA 2B51A 1HR0J 1T8EA 4N56A 3VEOA 4DV1K 1BCOA 3AFGA 4LRFA 4DPXA 3A8KA 2VQFF 4E89A 3SJJA 3EO3A 3EZOA 3AO1A 4LF7F 3NBPB 1HIYA 4NMLA 2YXLA 1K8KA 4C11A 2EW9A 2YNGA 3OW2M 2BJDA 5LMUJ 4K5SA 3MEEB 1YI2N 2WOMA 1WHXA 2HGLA 2XMKA 1AZSB 1RT1A 4E3SA 1JQGA 2AWZA 5CYMB 4NLOA 4CJSA 5KT5A 1IV0A 3I82A 2ZE2A 2A42A 2YV0X 1NB2A 1XNQJ 3P83D 4NYNA 3M32A 3KJQB 2QWLA 3H59A 3PKMA 5KFDA 1JNRB 3N6MA 2FLOA 3GLJA 1RWKB 1RBVA 3I56N 2K1RB 2MTLA 3DLKB 5EWEA 2GGPB 1VDHA 1FWLA 3VQDA 5KT4A 5BRHA 4FVCA 5D3GB 3ONQA 3Q0AA 4QOTA 1U1NA 2NYHA 4OI0A 4HHJA 3ZTQA 3PXGa 3OPKA 5K8PA 5LY3A 4ISEA 4USUA 1S1TB 3IMQJ 3DOKA 3PY8A 3OBIA 2HB5A 1KVCA 2VC1A 2HVZA 2G8VA 4PL8A 2HK2A 3BEXA 5M2PA 3TUZC 4MDAA 2A10A 2YNHB 1RHMB 3MM9B 2CJBA 1S5JA 4MT1A 2CQ2A 4H4KA 4ISFA 3SK3A 3CJ0A 1HNVA 3D3BJ 3TAQA 1SH3A 3EXCX 3QB0A 1M5PC 1J27A 2J9EA 4QPTA 3IM9A 3TP2A 4O55A 5DZ6A 2RILA 2LEBA 1OVQA 2DNHA 3IBWA 1D4XA 3MFIA 3HZGA 1MMNA 1S7HA 1SBRA 3CIPA 2OEKA 2P9KB 4ZJOA 3A8YA 4DR4J 4BR7A 4BR4A 1Q7YT 5AXNA 1U1KA 4NPOA 4USVA 2JSXA 4FZXC 4RWWA 3GIKA 4U7BA 4IR9A 3VF4A 5FPMA 3OBYA 5KFJA 3FSXA 2VA2A 1Q8BA 3K5LA 1D5AA 3DLHA 3T6BA 2ZC3A 4MAKA 1JLBA 3Q8RB 3MM5A 1W0HA 1PILA 4DHVA 1NU4A 3DLJA 4YY3J 3TWZA 2UU9K 2DY9A 5ETSA 4L6V3 3DGPB 3HM9A 2UXDF 3SJHA 3MCPA 2A6MA 2E9TA 1NZ8A 4MLEA 5EUHA 4YOVA 4LR8A 4P2FA 4PKIA 3AVBA 1HBUB 1YTYA 4B9LA 1S72N 5HRPA 4RX6A 4L3KA 3OYDA 3BBBA 4OQJA 3QBXA 4BRAA 2HFNA 3G6XA 4C0HA 1JL1A 2GIQA 4BRMA 3UNYA 2R7WA 4CHQA 3SSRA 1XUPO 1M1KT 2F8MA 2GMHA 3FJ2A 3BH6B 1WI6A 2QWNA 3GMGA 2PYLA 5BR8J 4FLXA 1Y5IB 5F0WA 3FUYA 1S9EB 5HP1B 3AOAA 3PEJA 1D1UA 3D2WA 1TKXB 4H5NA 1G15A 4Z0UA 2NUBA 1A7GE 4DTOA 4NYZA 3RG6A 3HSZA 4BGBA 1CG2A 4JI1J 2FLNA 3J81O 1RTJB 4OLPA 4CLZA 4F3MA 5GAGU 4FJKA 4LIWA 2F4VJ 4K7QA 5KFWA 3CJ8A 1DARA 4ICLA 1WSIA 3C66A 3E2EA 4TKTA 3LF0A 4EHTA 3M7VA 4WU3A 4E7LA 3CCZA 3UVJA 2CIMA 1RCOB 1VQPS 2E1ZA 3DXBA 2B9EA 2LU2A 2OPSB 2Z2LA 4K0KK 4Y0FA 1JLGB 4KFBB 2H5JB 3ZZPA 4ECXA 1X9SA 3Q7BA 1RT3A 2YHXA 4EP4A 1W2IA 2IM2A 2KQ2A 1Z25A 1T9UA 4DX8H 3EKUA 3R5CA 4M7YA 2DRDA 1SH0A 1YJTA 1GNKA 4OYOA 1NGHA 1VLYA 2EPIA 4CEOA 5AQLA 1APSA 1QSYA 3QLHB 4NXMF 4W4MA 3UKUA 3R5JB 4OJGA 1SVDA 3V5RA 1FEEA 2HWHA 1U1RA 2I5JB 4UUXA 1Q9XA 2W6LA 1HNZJ 2OCEA 1TUUA 2ERRA 3KK1A 3TOQA 5AQPA 5J2MA 2MEWA 3KKFA 5BRFA 2AJQA 3CCLN 2JWLA 2MLXA 1G2EA 1KVKA 3B4DA 1GOBA 2X74A 2U2FA 4B8CA 2MSTA 1X4HA 1M90T 4B1ZA 3L8BA 1VQ7N 2AX0A 2V8GA 3CULA 2UXCJ 1FDBA 2CDRB 4FSVA 2NZ4A 2HQ3A 3HO1A 3LTOA 2VOPA 1C0UA 5KFHA 4H0PA 2IMWP 3DRSB 2BM1A 2QO3A 3OYGA 1I94J 4Q2MA 3D5MA 4R25A 2KVIA 4CIEA 2ASDA 2FVPA 1FRXA 2VHGA 5BRDA 1OSCA 3QNNA 4KRFA 3EEQA 2R7YA 5BYSA 1H2UX 1BQMB 2YKOA 4J8FA 4X4NA 1RT4B 2V2ZA 3L3UA 2G2YA 3NMUA 2NYIA 4NLDA 2PI4A 1K0TA 3HKZD 1NGFA 1UVJA 4ID5A 2Q36A 4DV3K 1B0TA 4UY8T 3VV2B 4HTLA 3K5PA 4KBIA 1WG1A 3MPYA 3PW2A 5HL7Q 2J0QD 1HPZB 3OR2A 1RYSA 2ZBPA 2XTJP 1CJKB 3PW5A 5BYQA 1KAXA 3THXA 4OI1A 1RAAB 5KG5A 1A5VA 3A5OC 5AQKA 1J6ZA 1CPZA 3RAXA 4KHWA 4IOBA 3E1YA 4ZN3A 4R5PA 2QXFA 4OJRA 1ZOTA 3KOAA 4Y1DA 4OZ2A 2ABYA 4NMXA 1ZBUA 1VQOS 5A8KB 3ALYA 5HROB 4FJLA 4QS8A 2ZJPQ 2QWQA 3QJJA 2XLJA 4KHSA 1HBMA 3M3ZA 3I0SA 5CZVA 3BPSP 2A1BA 3AODA 3CUNA 2G8UA 3DFEA 1H98A 1KKHA 4NRUA 2VIHA 4GKKF 5CYQB 5DZ7A 2CH6A 3VQTA 4CTAB 2DD8S 3EZUA 4BC2A 1X0FA 3ISNC 5ETQA 3W2WB 3HBTA 4NXNF 2XLKA 4LF4J 4LBIA 4I7FA 5DQIA 2DCLA 4YQWA 3AVNA 4B1XB 1VQKS 4RUBA 5GAHI 3VERA 4U67Q 3MEDB 2ZC4A 3ZSOA 3EM1A 2XS2A 3MM6B 3RAMA 4WXOA 4H5WA 4MO4A 4DG1B 3M2VA 4DUYJ 3K59A 2KB2A 5F8IA 3CD5A 1RT7B 2SXLA 5LL6Z 4IO1A 3IR7B 4FF1A 3M8PB 1CJVA 5M2UA 1HD1A 3I32A 3ID6A 4IEIA 5FDLB 2MQOA 4MKVA 1N88A 3TJ9A 1PG5B 3D54A 3KNGA 2B9WA 3AAPA 4K4XA 2UP1A 2BJEA 3F9KA 2BX6A 1XMBA 3FBEA 4U95A 5KFBA 2FB0A 4NOHA 1RWPB 2WAQD 2G1HA 1DTTB 2XGPA 5IWAK 2PEHA 4MO5A 4BE1A 2QXLA 1UA1A 2APOA 5JLFA 1NSKL 4RW9B 4PA1A 5KT7A 3MURP 5AZIA 1HYSB 4F4AA 4BRKA 3CFRA 5EY4A 3K0JA 4DU7A 5CD4H 1U2CA 4DSFA 4C4WA 3O6QA 1RDAA 2Y1JA 3R8EA 3UWTA 4JI4F 2V5HG 5F3ZA 4YFUA 3UDEA 4X4RA 4V19X 4F2RA 1S3XA 3AVGA 4X65K 3DYAA 1PYSB 4HWIA 1HX1A 2G9OA 1U1MA 2QL5B 3CD7A 4GVBA 3FSYA 5DGAA 2UUCJ 2FGCA 1TYQA 4KO0A 3O9UA 5K9FA 3Q2TC 4F02A 2QC3A 4IR1A 1TL4A 1H7WA 1VQ4S 4KHRA 1SQEA 4OZ3A 3BDPA 2M70A 1JLQB 1IKXB 2J6TA 1XNQF 4QYZJ 4A8XA 3F73A 3CB4A 2FF3B 2DO4A 2YNIB 5THWA 4RW4A 1T6CA 3ZYYX 3CQ8A 2QA4S 2JFKA 2FJEB 3BP8A 3NNHA 4M5NA 3CDWA 3NEKA 2E1AA 1S1XA 2EHGA 3GYXB 4FLZA 3C6AA 2XGQA 3G96A 2E5LF 1NM1A 3Q8PB 1URNA 1V3SA 3CJQA 5B0GA 4G1QB 3BZCA 4N47A 1C4CA 5EDWA 3SUNA 2F40A 1J5EJ 4CZHA 1WOOA 1BC6A 4GV3A 2XO7A 1VI7A 2FJAB 5AE1A 4BR9A 3MZIA 4CGJA 2UUBK 2KHDA 2QG9B 4RZRA 5A2QY 1Q86O 1NCLA 5IZHA 1F21A 4LFCJ 4P2MA 4KC5A 3ILJA 5HRSA 1VC0A 4JRQA 4DR6F 1B0VA 4JI3F 3V4MA 3OXLA 2Q0UA 4KE5A 3DU5A 3DLRA 1HI1A 2QRRA 4ZPWR 3CC7S 4V19S 1Q5YA 3CCJS 2V34A 1K73O 2UV8G 2FVSA 2AYBA 1RLDA 4QWCA 3VQ8A 1RWNB 2AEJA 3BKFA 5CZXA 1F2GA 1XEZA 1YJUA 1LWXA 3MXMA 5M1PA 1A5XA 3BEGB 4LF5K 4JV2A 1CXUA 1NDCA 5AQJA 3G9CA 3J7YI 4EFHA 3FRZA 4CJPA 1IBLK 3W0LA 3OLBA 4CYUA 3MTKA 4M5IA 1T03A 5AQMA 4EBEA 4G1IA 3WHIA 4B3OA 2QKKA 1S7IA 3HZEA 2WSFC 1REVA 2LECA 4CZKA 1QZ5A 3BBFA 2H3EB 3GIRA 1K8AO 2CQ4A 4CDIA 3SMSA 3M8QB 1QVGM 3FZLA 3G82B 4HACB 1WC6A 2HNDA 2NCKL 2MGZB 4J9LA 4E0DA 2E6MA 1QAXA 2D74B 3QDKA 5L1JA 3POTB 5F8JA 2C3PA 3O5BA 4OI2A 3S3NA 3VEXA 4TY8B 2ROGA 1YHQS 4U96A 1SQKA 1FNOA 4EZ6A 2WONA 1JXVA 4WQ5A 2EFVA 2RH3A 3VR1A 3G71S 1BU6O 3M8ZA 2KRBA 1U0HB 2KVQE 3GP9A 2QW9A 4JI5F 4DU8A 2B4OA 2XNQA 1VK0A 4PWDA 3NS5A 2VOOA 2RN2A 2KFZA 3BPDA 2PA3A 4KB0A 1YTUA 4FM0A 3E01A 2C3OA 4ZPDA 3KD5E 1NK9A 3C16A 5DRKA 1F0XA 2W9BA 3OYHA 1O51A 4AXIA 1WG4A 1YWXA 2A3ZA 4KH5A 1KOHA 2FLPA 1Y11A 1JIHA 4JI1F 1UJ5A 4DL7A 2HURA 1BXNA 1VJQA 2W2QP 3CPWR 1NGJA 4OX9K 2J0SD 4LFAF 4OPJA 3ZETB 2FUG9 2EG2A 5JICA 1RWUA 4CH7A 3NHGA 1IR2A 3AOBA 2IVOA 4BRHA 3CHWA 3AOCA 4CJWA 4X4UA 1XWLA 3NWGA 4FF2A 1YBAA 1YGYA 1LOTB 4HTIA 3UR3C 2X1BA 2MQMA 2YJEA 3NKYA 5LJ3Y 4K4SA 3K9KA 3VQBA 1N5YB 3LP0B 2FPHX 1SCJB 1IBKK 4C3KA 8ATCB 1VAZA 2FHKA 3D6TB 1S76D 3J7A1 1U04A 3R3LA 4JI0J 1TAUA 3R2CJ 1HI0P 2W41A 4YOTA 2QLWA 4XTTA 2CQPA 1ITGA 3MCMA 2QMUB 2R2RA 2HLTA 3W3DA 4AL7A 2FC8A 3MN7A 4WBFA 2AGQA 2WRMA 3DLLQ 1C1CA 2JOQA 3OYEA 4PUOB 3KKSA 2R7QA 4M7XA 1R59O 2DK2A 4MFBB 5C2DA 4S0MA 3PIPQ 2HVEA 3M6UA 1MLAA 1B7FA 3ZT4A 4DB3A 3J80O 4FK2A 3V4IA 5B0DA 3SQGB 2DNYA 1QQNA 4ZHRA 4QW9A 2OLWA 2P51A 3THPA 3ZZ0A 5AXKA 3UFCX 2IVFB 4OLOA 3HYFA 3UO0A 1HMVB 3DOMA 3SDEA 1NWKA 3HRGA 1UA0A 2X51A 2ZUAA 2QWRA 5IQQA 3M2UA 4DZ6A 2CVEA 2YHYA 3GSDA 4QAGA 4CLFA 3RR8A 3DM2A 4R8UB 4CM2A 3T7ZA 1TL3A 3D0HE 4OJ3A 1U4BA 4FYVB 2E2QA 3I96A 2OH2A 1Q4RA 2IC3B 1BE4A 3O4NA 1TL1A 2W1BA 3HHLC 3Q8QB 1CZ9A 3OUYA 3TQ1A 2E2PA 3LP2B 4DPWA 3A13A 4JKEA 4FJ7A 2BQRA 4B3TK 5K5MA 3JQMA 3P1GA 3DXKB 1VS3A 3QFHA 3OHRA 3L3CA 1S4EA 2UXBF 4MK8A 4K50A 1SZ2A 3AVLA 4LRAA 3ZT0A 2K8GA 2DNKA 2R7VA 3QBCA 4QWBA 1LFPA 3OXFA 2BJ8A 4BDZA 2OANA 3CCVS 1XMQK 1BWVA 2XZTB 4PPDA 1VRUB 3NGKA 5A8RB 3MMAA 3CJ3A 4LT6A 1H6KX 1U2VB 3AV9A 3W8GA 1DBDA 4ANDA 3DMJB 2AJ2A 1ZYQA 4DR3K 4OKJA 5E3QA 2I8EA 3UE2A 2IS3A 2WSCC 3OTEA 3NFAA 1R43A 5IC6B 3HM8A 2DGQA 3CCSN 3U02A 2HVDA 3MX5A 2QYGA 2O67A 3MMCB 1YKWA 2MKJA 5B8HA 1S6QA 1SPBP 1WOSA 3QFUA 3IR5B 2ZM6J 3O3FA 1E6VA 4OYPA 4A2AA 5HBMA 3VOVA 3CCRN 3DGVA 5KFEA 1TK8A 2HKEA 5LJ5Y 4B3RJ 1XQSC 1XN9A 4KHPF 3IS9A 2E7VA 2BQ3A 4O5BA 5H1SQ 2VQEJ 1LKZA 2ZH8A 3SV3A 4I69A 1U24A 3CTRA 2PMZD 2YKAA 4DFPA 3ZZTA 4H4OB 2HHSA 1U45A 1TKTA 4QIVA 4DZDA 2ZH2A 5D3GA 4I2QA 1RAOA 2FZGB 1VQLS 1CSJA 1LV5A 4UF4A 4NB4A 3VEWA 5CAAA 3G8SA 1N36K 2QMXA 2W7AA 1OQ3A 4WQ4C 4F4WA 1RABB 1RHJB 2EFNA 3F2KA 2NSBA 2BKPA 2P1JA 4GKKK 3MM9A 4Y2MA 4DPYA 1AUSL 3HFZB 4FBTA 1RI7A 4DR5J 1RT2B 4OZNA 2DGSA 4AE5A 3TTFA 2XY6A 2FD2A 1N52B 3OL7A 4DV6J 1W97L 3CCUS 2A1SA 4X64J 1QSSA 1NOYA 1GMWA 3BZKA 3K17A 1T7PA 3OFGA 4IG0B 4PYAA 3UNGC 3H1QA 4Z2XA 3G0ZA 3H3NO 3P5TL 2KO1A 2P9PA 2ALZA 2GCFA 3W5XA 2RS2A 3AA9A 2Q6CA 3LPYA 1TUWA 3FMBA 3BREA 3KLGB 4AHCA 1HL6A 1U2RA 3MCOA 2FJBB 2F63A 2XI2A 1D9FA 1N33K 3L7OA 2GIFA 1KQKA 2NPIA 5C25A 5DDOC 4R79A 1X3MA 3I55N 1KTQA 1X7VA 1LOUA 3H5UA 6FDRA 2V4JA 4IKAA 4PG7A 3CJBA 3EPGA 3EVMA 3H3OB 5HANA 2M8HA 1VBZA 5FPEA 1CULA 3R1LA 2ZHAA 1IN0A 1S1UA 3PJWA 4IJNA 3SNNA 2GO9A 4L3QA 1F5BA 1WEYA 4JKHA 3FKBA 4CZLA 4QW8A 4DJBA 1IM6A 4FPRA 1HLWA 5F0XA 1REGX 4DOZA 3K57A 1FRLA 3FCHA 5D0HA 1N6QB 2IDLA 2HVIA 3ZSXA 1HR0K 2BRKA 4BDPA 2C2EA 1I1GA 4WF9L 3DLEB 1KQGB 1T9YA 5KTQA 2E2OA 4BG8A 5DQHA 2XMAA 3H1VX 2XSJA 4PQUB 4E1MA 3L2QA 1QAYA 3KWIA 3NMRA 2N7YA 5LMUK 4KHMA 3UN3A 4JI2F 4C7QA 4RW6B 1YAGA 2XYGB 3BSAA 1U1OA 3R3TA 2PAVA 3UCGA 1S1WB 3PYDA 1XNQK 4C98A 2P5GA 3V9SA 2AX1A 2VG7B 3CJCA 2I0XA 4AQYF 1FW6A 3CDUA 4FL9A 4HCCA 2CPEA 1XNRF 1JLCB 4P6QA 3TA1A 5M1KA 2EFGA 4DTMA 1WOPA 4YORA 1YVNA 3AA3A 3SBTA 1GTEA 1FHTA 4L3NA 3MM8A 2E1RA 3VZIA 2A40A 5FD1A 1NAQA 4F26A 3MD1A 3P39A 2UUAJ 2U1AA 3R1HA 1HPMA 4DQSA 4TSXA 4K42A 2DHHA 1NJWA 4PWWA 2QE5A 2PGCA 1AW0A 2HAIA 1UTAA 3ULEA 4RTFD 2CPIA 3IBCB 2NNWA 4CLUA 1KS2A 2AF6A 1HJOA 1HNWJ 3MN9A 4W90B 4UZCA 1FK9B 3BQ1A 2G4BA 3X3UA 3VEVA 1HYVA 2R7UA 5EGYA 4IFVA 4XIUA 4A8SA 3GR0A 4IOCL 2QKBA 1IH7A 2QL9B 5GMKa 5KFMA 1VCTA 2ROPA 3L4BC 3OXGA 5AFUH 1OS5A 3S01A 4PZVA 2PT0A 1NKEA 4O0JA 2NRXA 3TI0A 1WC3A 1RB0A 4HH1A 1KP6A 3EZ5A 4DR4K 3MECA 1WC1A 3MR2A 3NCIA 4A8MP 4LF6J 4ZP6A 3FEYB 1FJGJ 5CQGA 1BY9A 2E6LA 3QIDA 3KMQA 2OGUA 4EYIB 2DNRA 1TL7B 5E84A 5F8MA 1RHRB 1CQNA 4CLTA 1VFJA 2E88A 1TR0A 4CLYA 5ADZA 4CQ1A 4LH4A 1KQFB 2MKCA 3FFKB 2VL1A 2ASOA 1RE1B 1SL1A 5TKWA 4YY3K 1FNMA 2HBQB 2AGOA 2W4CA 5C5JA 1CZAN 4V1Ak 1MA9B 2PFUA 4JV5J 2OPQB 1ZZNA 1A0OB 1VC5A 1NGGA 1N32F 3PUFA 2AJFE 3CDAA 4LSNA 2RU9A 4IH6A 4KGXB 3S3OA 4LIRA 3K5NA 1CXQA 2FIUA 4AM6A 5BPMA 5A2QU 3ENHA 2V7ZA 5KQ8A 4NLSA 4YN3B 3IWNC 5E3CA 3R5BA 1FKOB 2VUGA 2XO6A 3DU6A 1JCFA 3TTCA 2R2SA 3TU5A 3KLVA 1X9JA 3JSMA 3U4LA 1SUQA 4ECVA 3MM7B 2BANB 2NR0A 3ZSQA 5CHCB 4UZBA 1DRZA 3DI6B 3UDVA 3J7ZO 5HLFA 1V4TA 3D67A 5BR8K 2H4YB 4E1NA 3VF6A 1VQPN 4WWSA 4OIXA 5E2QA 4XO0A 3BQ2A 2MKSA 2R7SA 3TJ8A 3IKMA 4RU9A 5DM7L 2HBZB 4WTOB 2BMBA 4WYLA 2QA4G 3B54A 4A47A 5JMNA 3EE9A 1HNXF 4JI1K 2AJ4A 4RL1A 1W7WA 4NO7A 4BRGA 3WNFA 2F4VK 3D2FA 2FBXA 2IRUA 2C2MB 2GJIA 1RSCA 3S1TA 1HQUA 4CWBA 1WTBA 3GDQA 2VDHA 1FE0A 1X4FA 1Z4UA 4YOXA 2OAUA 4CRJA 4JKDA 5G0RA 4AYBD 3CVKA 3H2LA 2BGGA 2I1RA 3N4PA 1OMSA 4F67A 5EU7A 4PL7A 4DF4A 4CERA 2HHXA 1CLQA 3PKYA 4G9ZA 3NF6A 1HA1A 2DNMA 4OYBA 3W9HA 1Q7LB 5BXIA 3KLHA 5L46A 2QM1A 3SAGA 2HQCA 3HHDA 3OVNA 2YWWA 1MROA 3VQ5A 1TQLA 4OYZA 2CGLA 4JI6J 3FFIB 4CJFA 1F9EB 2KZZA 1QE1B 5HRRA 2F8TA 4FWPA 2W8LA 3VCDA 2OELA 4DCOB 4LFBF 2RDJA 4AF1A 2Z8QA 3A3OB 4XH5A 1EIYB 4DQ8A 4N76A 2XYPB 1HNZK 3NH1A 1FX4A 1NKCA 2V8DA 1VHFA 3EGVA 4CO5A 3LDPA 3BYRA 1YT3A 3ZO7A 3DC2A 5KFNA 1WC4A 1BA0A 1TUGB 1ZC6A 2OO4A 4X66F 2PN6A 1SB6A 2BDPA 2A6OA 1P1LA 4J2EA 4OYMA 3LGMA 3L4IA 2FVQA 4URSA 3JS6A 1JJ2M 4I9LA 2BVZA 2J8AA 1GLEG 2YKMA 3B6OA 4N77A 4DR2F 3V6KA 2UXCK 4DFMA 2VG6A 4LVOP 4E7HA 3ICLA 2O01C 4JK7A 4UTGA 4C8YA 1I94K 3G25A 1RBUA 3G6YA 2BACA 2E5GA 4BVPA 4LQ9A 1GLFO 1Y4ZB 5I4MA 4MIWA 4Z4FA 2P9NB 3V1RA 2DGXA 3LP1B 2WCXA 4B9SA 4DSLA 1NMNA 4DS5A 1Y3KA 2MDAA 2Z1HA 3THTA 3FBFA 1DZ5A 1T95A 1KOOA 2M88A 1KTVA 2B8PA 3VAIA 1N5SA 1RLCL 1FRMA 1LWFA 5K14B 4Z4EA 1N5QA 3H90A 4DV4F 4M63C 3U6FA 1LW2A 3PHTA 4P7VA 3RB3A 2CZ9A 1VQON 3RSEA 4I68A 3D0GE 1IBCB 3HULA 3PRBA 2QV6A 4ILRA 2X3DA 3MMBA 1NH7A 2OZSA 3C0BA 2ZHOA 2B4UA 5F9LA 2VQEF 3DXMB 4PXBA 4DX7A 2OPRB 4ES2A 3BS9A 2E9ZA 3TAGA 2GHPA 4CK1A 5J2NA 4I2PB 3PJXA 2QA2A 3MUMP 1WSJA 4Z94A 2I38A 1X4EA 4KH6A 2VPWB 3V2UC 2K3IA 2EFPA 4RG8A 4GKJJ 4JKCA 2H9ZA 2LA6A 4GC6A 2QK9A 3C6HA 2E5HA 3SUOA 1VQKN 2KYXA 5C24A 1YF5L 4ATNA 2GBZA 4TYAA 4G1QA 2LA4A 2W01A 4WYWA 3F41A 4AFFA 1PGZA 1ZXOA 3ASMA 3QEWA 4K4TA 1X4CA 5KT3A 1EQMA 2UVUA 3VWSA 1M5KC 4B8AB 4PYDA 2DT9A 5KFLA 2XG8A 1YIJS 3L95X 4W5QA 1RU2A 2MYFA 2RDDA 1RBLA 4TYBA 4J7CA 3PRDA 2FF6A 1KC8O 4LF4K 1P9YA 4DV6F 2MZQA 2OA8A 1FJ7A 3SCXA 3I5CA 4J2AA 2D0AA 3LAMA 3EN9A 3FNNA 4FF4A 4O23A 2O8EA 4JBCA 4ILJA 3NCRA 4CEEA 5KFPA 4KHNA 4Z37A 1JLEB 4IYQA 2BUNA 3BYPA 1CC8A 3RRGA 1RBTA 4HI1A 1IQTA 4DV0J 4JS5A 3TW0A 4FP9A 1IJEB 4DUYK 4CH0S 3WZ0A 4BDYA 5L9NA 1T9TA 3QMLA 4M3XA 1H2TZ 1NGAA 4ED5A 1EP4B 4YHHJ 3MR5A 3Q83A 4DU4A 3C2PA 5GMEA 5AXLA 3CERA 1VISA 4E2FB 3R6MA 3WT0A 3ZC4A 3OTOF 4YNQA 3WNEA 3UD4P 1ATSA 4CECA 3WXLA 1R8AA 1LNQA 4A4JA 3TARA 3I8BA 2WVDA 2KJVA 1IKWB 5T14A 1NBEB 2MGZA 4PCQA 4LF9J 3C8YA 2BEFA 4EBDA 1K44A 3GU0A 5ADXA 3D6MB 1NM2A 3KJNB 4WTYA 3GIIA 1RTIA 3NGTA 2YKNB 3IWLA 2P9IA 2MY7A 2KKHA 3MI7X 3EMTA 1VQ4N 3GPAA 2O1PA 3UKRB 3FK4A 5T7LB 1VLOA 2D3O1 3C95A 3N4WA 2M9KA 2J4RA 4OI3A 1QY7A 3MHYA 2DBBA 1S57A 3L3VA 4P2SA 1TV6B 2IDOA 4DTPA 2GZOA 4HEA9 2QA4N 3ZLJA 1X9MA 4HVJA 2GQQA 4A5BA 1S0NA 4JN4A 2UUCK 1YITS 2BUPA 4KGMA 3CMES 2HQGA 2O8FB 5E3AA 2Y3YA 3KLFB 1KQSM 5EXWA 1Y5LB 3I5BA 3JSYA 2FHJD 4E7JA 3MR6A 3SIPB 2HHHF 2BE2A 3TX8A 5KFTA 2X6SA 2FBVA 1HARA 5JVHL 3BB5A 1WBDA 4NCGA 2GMLA 3DXSX 3C6UA 3A5LC 2DNNA 2IAJB 1WTFA 3LM2A 4I6WA 4X4QA 4CJ7A 1JLFA 5DLFA 4OX7A 3L4QA 3KK2A 1R7IA 4QWDA 5D15A 1QVFM 3CC7N 3BGUA 3P4UB 4DFJA 5KFUA 3CCJN 5D0RA 5M2RA 4OHVA 2I7PA 1C4AA 2P9UB 3RMAA 3P96A 4RNOA 1J5EK 5A76A 1QTNB 3FVYA 3CJKA 3TEHB 2B7BB 4RU2A