3NBRA

Crystal structure of ketosteroid isomerase d38np39gd99n from pseudomonas testosteroni (tksi) with 4-androstene-3,17-dione bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
b'NTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVENGVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPINHFRFNGAGKVVSMRALFGEKNIHAGA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Crystal Structure of Ketosteroid Isomerase D38NP39GD99N from Pseudomonas Testosteroni (tKSI) with 4-Androstene-3,17-dione Bound
rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
total genus 31
structure length 124
sequence length 124
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nbrA00
3EF8A 1OH0A 2YFJB 4FCJA 4RZMA 3VGNA 4X2HA 2PZVA 4XBTA 4WYKB 4HZBB 1ULJB 3KKGA 5AIGA 5KP1A 3LZAA 2UX0A 3NHXA 4WWUC 4L8OA 3OWSA 3EBYA 2QIYA 3SOYA 2Z76A 1VZZA 3B7CA 4KVHA 2XRXB 3DUKA 5AIFA 3E99A 3STDA 1QJGA 2GEYA 2F98A 3EN1B 3EN8A 2OWPA 1ISKA 3NV0B 4HJLB 4L8PA 1NU3A 3FSDA 3GZXB 3NM2A 1JB2A 3FF2A 3F9SA 1JKGA 1IDPA 4XBXA 3DM8A 3MSOA 5AIHA 1QMAA 5JPPA 1O7PB 1O7MB 1CQSA 3EHCA 1ASKA 3K7CA 1Q42A 3GRDA 2RCDA 2HMNB 4J8TA 1K41A 3BB9A 5CXOA 1E97A 1OHOA 4HM6B 1DMNA 1JB4A 3FF0A 3NXJA 1JN5B 4WP5A 3RGAA 1TUHA 3WMDA 3G16A 2F99A 5D82A 1OF5B 1OCVA 3F40A 3OX9A 1EG9B 1GYBA 3HX8A 1HKXA 3EX9A 2HMKB 5KP3A 1OPYA 1Q40B 1TP6A 3B8LA 3F7XA 4LGQA 5CLKA 5FW5A 1NWWA 1SJWA 2JQ5A 4K1VA 3FLJA 3OV4A 2QGUA 3H51A 3NUVA 4R9LA 5IENA 5IERA 3KZTA 1O7WB 3ECFA 3D9RA 3KE7A 3EJVA 4H3UA 3T8UA 3GZRA 3EBTA 3CNXA 4J9AA 3GWRA 2B24B 5DREA 3A76A 4FCMA 7STDA 3MKIA 2HMMB 3UNLA 1NDOB 3S5CA 4HM5B 3DXOA 2BMQB 5BXQA 1UUWB 3F7SA 3RGRA 4HM7B 5AI1A 2YFIB 5DRVA 1A2KA 4XBYA 3VSYA 5IG3A 1S5AA 5KP4A 4XDVA 1E3VA 1W6YA 1STDA 2HMLB 4IIAA 3MHEA 1E3RA 2Z7AA 3HZPA 3ROBA 4OVMA 2GEXA 4XB5A 1AR0A 2BNGA 3FKAA 4HVNA 5CF2A 2BMRB 1EA2A 4HM2B 5IEOA 3MG1A 1C7HA 5STDA 2HMJB 3GZYB 1JKGB 3EQQB 2INXA 2Z77A 5D83A 2XR8B 4OUQA 3B4OA 3F8XA 1WQLB 4R1KA 2B1XB 2A15A 4HM3B 5IG0A 2R4IA 1GS3A 3G0KA 4PEJA 3JUNA 2BMOB 8CHOA 4WYKA 2XSHB 3SOAA 4HM1B 5CF1A 1BUQA 4HM8B 3ER7A 4HM4B 2F86B 3JUOA 1OGZA 3CPOA 3JUPA 4LEHA 5BVBA 2CKFB 2CHCA 1ZO2A 2RFRA 2IMJA 4HM0B 4GB5A 3CNMA 5AIIA 4HKVB 1U5OA 1GY7A 3FGYA 4N3VA 3GZBA 2RGQA 1Z1SA 5AEUB 4U13A 2K54A 3UJMA 5IG4A 2YFLB 3NV0A 4XM4A 3T8NA 4ORLA 3JUQA 3NBRA 2GXFA 3JUMA 1O7NB 1O7HB 4X2OA 2I9WA 1JB5A 1UUVB 3M8CA 3BLZA 5G2GA 4R9KA 5HGRA 3OWYA 1W00A 3F14A 5IEPA 3FH1A 3B4PA 3K0ZA 5JPUA 5EVHA 5AEWB 4HZ9B 2GBXB 4L7KA 2W2CA 3IPTA 3EC9A 2GBWB 5D81A 1ZX2A 4CDLA 3I0YA 3Q90A 1JN5A 1OHSA 3HK4A 5IG5A 4Q53A 3OWUA 4K1UA 4STDA 3H3HA 1OF5A 3OXAA 3DMCA 3F8HA 1O7GB 4I4KA 1GY6A 3G8ZA 1W02A 4MJDA 3LYGA 1OHPA 3MG3A 1DMMA 1Q40A 1DMQA 4LMIA 1ULIB 2STDA 1GY5A 3SEDA 5TGNA 3DZLA 3MYTA 5CK6A 6STDA 3KSPA 3CU3A 3MG2A 3FZWA 2XSOB 1OGXA 5IF6A 2HMOB 1OUNA 1W01A 4XDWA
chains in the Genus database with same CATH superfamily
1W2B2 3EF8A 4RNYA 1OH0A 1RGKA 2OTL3 4GSPA 1VQ63 2YFJB 4FCJA 4RZMA 3VGNA 4MMXB 1YVBI 1W7CA 5ELUA 1KQS2 3D79A 4X2HA 1RN7A 3ZFZA 1IQXA 1QVF2 2PZVA 3UL6A 2O9UX 1TU5A 3CMA3 1RDSA 1RTUA 1QAFA 4XBTA 5M19A 4WYKB 4HOHA 4HZBB 1ULJB 3HIIA 1PYLA 2P38A 3KKGA 3DGNA 5AIGA 5KP1A 1IVVA 1K28A 2QEX3 2ZA4A 2K3DA 3LZAA 3SYUA 3CCV3 4NREA 2UX0A 1RMSA 4JRFA 3NHXA 3X40A 1WMOA 1Q814 4WWUC 5HOHA 1IU7A 3BU4A 4L8OA 3OWSA 1FGTA 4O3VA 3EBYA 1RGGA 2KAAA 2QIYA 1RGHA 1BSDA 3SOYA 3DGLA 1X1WA 2Z76A 1VZZA 3B7CA 1DVCA 4FMCA 3X41A 3CCM3 4KVHA 2UUGC 1JJ22 1MWRA 2XRXB 2CFGA 3DUKA 4G1MB 5AIFA 1R4CA 2GU1A 2BO9B 3AHWA 3E99A 3STDA 3SVAA 1QJGA 1RNBA 3FG1A 2GEYA 1FUWA 1K9M4 2CH9A 1VQ83 2CG0A 1ROAA 1N5PA 2F98A 3EN1B 4R80A 4EXRA 3EN8A 1UCIA 4JF8A 1YI23 1LVNA 2UGIA 1FGMA 2OWPA 4AKZA 2K0MA 4LYLB 2W9PA 1ISKA 3NV0B 4HJLB 4L8PA 3BNBA 6GSPA 1GD3A 1NU3A 3FSDA 1AVKA 7GSPA 1GOYA 3GZXB 3N54B 4MMYB 4N6TA 1LRAA 1R4YA 1ROVA 3WOFB 1I8VA 3NM2A 2WGQA 2CK3H 1VQQA 2L1SA 3NX0A 1JB2A 4R4KA 3FF2A 3F9SA 2Q07A 1JKGA 1BNRA 3I553 1IDPA 1IQ8A 1I70A 1RLSA 3WDGB 1MOLA 3DGMA 4XBXA 3DM8A 1K8A4 4O2HA 3K9MC 1MWSA 3MSOA 1YGEA 3CME3 3BNDA 1FUSA 5AIHA 3K63A 3SLUA 1QMAA 2P09A 5JPPA 1RGCA 2P05A 2C10A 3CXC2 1O7PB 1O7MB 2W9QA 1VQ73 2CX1A 1CQSA 3EHCA 3WODG 2XGNA 3LTAA 1PFPA 1BRIA 1B20A 1ASKA 3S67A 3CCS3 1BAOA 3K7CA 1Q42A 4ZM8A 3GRDA 2RCDA 1JV2B 1BNGA 1GSPA 2HMNB 2O3OA 1WMPA 4HBRA 2W03A 4EW5A 1W6GA 4KT3B 2WOHA 1A2VA 4J8TA 1K41A 1VQP3 1UW1A 1OACA 3BB9A 5CXOA 2OCTA 3V98A 1E97A 1MNLA 1OHOA 2CWTA 3KSED 4HM6B 2CX0A 2MC8A 1DMNA 3Q3FA 3CC73 1I3FA 1JB4A 3FF0A 3Q2PA 3LXUX 1BNFA 3NXJA 1JN5B 4CCVA 1KC84 1BRSA 1HYFA 3AMOB 3UL5A 1UCJA 4H61A 4FCZA 1S723 4WP5A 3AGOA 3RGAA 3WA2X 1VQO3 1YNVX 1C54A 4BL3A 1TUHA 3ZG0A 1QVG2 1D6UA 1BSCA 3WMDA 3G16A 1LQMB 2GSPA 2F99A 5D82A 4KFFA 1OF5B 1OCVA 4EV2A 3F40A 3PS8A 3OW22 2CC3A 3OX9A 5M1AA 1MGRA 3IJEB 1VQ93 2GU3A 1EG9B 1BU4A 1GYBA 3WR2A 3HX8A 1NJI4 4EV5A 1RN1A 1HKXA 1IT8A 3EX9A 3CCL3 2W56A 2IA7A 2Y74A 4MEIA 2HMKB 1I2EA 3EB8A 5M18A 1JBSA 5KP3A 1OPYA 1Q40B 1TP6A 5ELJA 1SIIA 2KF5A 1ZS7A 3B8LA 3F7XA 3KFQC 2W04A 3PXMA 3S29A 3QK9A 1BSBA 1BGSA 1TJDA 3D4AA 4LGQA 4BL2A 2KF3A 5CLKA 1B27A 5FW5A 3G4S3 1NWWA 1SJWA 1JBRA 2JQ5A 4K1VA 3FLJA 3CCQ3 1FUTA 1TRPA 3PYJA 3OV4A 2QGUA 2V1LA 1T3BA 1BSAA 3H51A 5IW9A 2YX9A 1ZGXA 3NUVA 3AHSA 4R9LA 4KZ1A 2IYJA 3V92A 5IENA 3X3YA 5IERA 1AVLA 3KZTA 1B21A 1B3SA 1O7WB 1MGWA 1X1YA 3D9RA 3ECFA 3JVCA 3KIIA 4OK0A 2LQVA 2XEPA 3KE7A 1SPUA 1HZ1A 1TTOA 3D5GA 1N8QA 2XFSA 3EJVA 4H3UA 1RRLA 2CWUA 3T8UA 5RNTA 3URPA 3CCR3 2F56A 3GZRA 1A67A 3EBTA 2ZHXB 2OTJ3 2CFLA 2C4BA 3CNXA 4J9AA 3I563 3GWRA 4IT7A 2B24B 5DREA 3NM7A 3A76A 4FCMA 1VQL3 7STDA 3MKIA 2HMMB 4FMAA 1V58A 2W6JH 2XH9A 2OOVA 1KSIA 4EBGA 3LT8A 3EE1A 1M1XB 3UNLA 1UCKA 2XGLA 1GOUA 1Y4KA 1NDOB 3S5CA 1RJOA 4HM5B 1FYSA 4N6UA 3DXOA 2BMQB 5BXQA 1UUWB 3F7SA 4KFDA 2KCDA 1NB3I 3DGYA 4NPBA 1CEWI 3RGRA 2ML5A 4J5GA 4HAAA 4HM7B 5AI1A 1RHLA 2YFIB 5DRVA 1YHQ3 4K61A 1A2KA 2OQEA 2E2UA 4XBYA 1M904 1BSEA 1CH0A 1BRKA 1D6ZA 3VSYA 3X42A 1FGOA 3BNCA 1V74A 1BRHA 5IG3A 1YIT3 1KD14 1S5AA 5KP4A 1RRHA 1TFKA 3ALAA 4RBNA 2BHMA 2F5MA 2H0GA 2LYXA 1BNEA 1E3VA 2OQEC 1W6YA 3N9HA 4XDVA 4WHAA 1STDA 4FMDA 2J8XB 1RGLA 3LTCA 1EQKA 1WMNA 1STFI 2HMLB 4IIAA 3MHEA 2CFDA 3FCSB 1E3RA 3GAXA 3CCJ3 2BIRA 1JBTA 2Z7AA 3HZPA 1LXEA 2KF4A 3ROBA 3U97A 3G6E3 1G0TA 4OVMA 2GEXA 4XB5A 1AR0A 2BNGA 3FKAA 4HVNA 5CF2A 1IYYA 2RBIA 1IVWA 2BMRB 1EA2A 4HM2B 5IEOA 3MG1A 1C7HA 1G96A 2OOVC 1IV7A 1DYUA 1MWTA 1UI7A 2HMJB 3GZYB 4LZIA 5STDA 2H0IA 5AYSC 1JKGB 3EQQB 1N9JA 2C11A 5G1LA 2INXA 1WTHA 2Z77A 1B2SA 5D83A 1YJ93 2XR8B 4OUQA 1UDII 5AYRB 3A5EA 3B4OA 3LTBA 2FXTA 1AV4A 4LSOA 4N6NB 1YJW3 2P0XA 4QWTA 1BOXA 3AGNA 1LOXA 1J2BA 3F8XA 1IQYA 1WQLB 4R1KA 1AY7A 1LOYA 1RCKA 2B1XB 2A15A 4HM3B 5GSPA 5IG0A 1DE3A 2BT3A 2E2TA 2MF7A 2R4IA 4I5QA 4NHFA 3LMLA 1GS3A 3KCHA 3TDGA 1TFOA 3G0KA 2L4VA 4ILFA 1PU4A 4PEJA 1VQN3 3JUNA 1X1XA 1FGRA 2W0QA 1YVSA 3BNEA 2D42A 4FR9A 2BMOB 1RGAA 8CHOA 1UCLA 1RNTA 4WYKA 2XSHB 1LNIA 3SOAA 1X1UA 4HM1B 5CF1A 1BUQA 4HM8B 3ER7A 2SBLA 4HM4B 1NB5I 2F86B 3JUOA 2WOFA 1OGZA 2RNTA 3Q1CA 4KFEA 3CPOA 3JUPA 3X3XA 4LEHA 3D5IA 1GMQA 2WGOA 2Z6BA 5BVBA 1I3IA 2CKFB 2CHCA 1UUGB 2WO0A 4O02B 1A2PA 1YJN3 1ZO2A 2RFRA 2IMJA 3HI7A 4HM0B 3ZG5A 4N6V0 1UGIA 1M1K4 2KF6A 2RSXA 4GB5A 2AAEA 3CNMA 2M7OA 2KRTA 1YIJ3 2JDIH 1A90A 1IVXA 1I2GA 5AIIA 4WFOA 2W56B 4HKVB 1U5OA 4N6LA 3CCU3 1GD4A 2ZDJA 1GY7A 1HU9A 3HIGA 3FGYA 1IV9A 3GZBA 1QALA 4N3VA 2RGQA 4N6MA 1Z1SA 5AEUB 4U13A 3K5TA 2FNQA 3LH4A 3UB1A 2CIUA 2K54A 3UJMA 3NQZA 5IG4A 2YFLB 3NV0A 1EUIC 4XM4A 1RCLA 3T8NA 4ORLA 3SX1A 3JUQA 1JNQA 1W4NA 4AEQA 4DKIA 4EC6A 2KXGA 3NBRA 2GXFA 1F8NA 1KWIA 3JUMA 4BU4A 5JBSA 3J7Yd 3X3ZA 2CW9A 3FG4A 1IT7A 1VQ53 1GMRA 1BNJA 1BVIA 1W6CA 3CPW2 1O7NB 1Q864 3RNTA 1RGFA 4BTXA 3U1WA 3CC23 2QA43 1O7HB 3D3LA 4X2OA 3DH2A 3S28A 2IY2A 1BRGA 2I9WA 4CJNA 4RNTA 1JB5A 1UUVB 5FGOA 3M8CA 3BLZA 5G2GA 4R9KA 5HGRA 4BTYA 5EEOA 2E2VA 2F4YA 1FGQA 1N5HA 1FZUA 2BU4A 1GOVA 3QRDA 4O8SA 2F5WA 3OWYA 3NBJA 1W00A 2HOHA 3F14A 5IEPA 3FH1A 1DVDA 1LOWA 1BRNL 3B4PA 1YGWA 3K0ZA 3LOYA 1Q7HA 5JPUA 1Q7Y4 1WNHA 1BNSA 1BRJA 3IMAB 3T0UA 4CPKA 5EVHA 1VQ43 3LTDA 5AEWB 2FGTA 2GBXB 4HZ9B 4L7KA 3WOEB 2W2CA 3N8BA 3PZWA 1DETA 3IPTA 1T5YA 3HOHA 2H0HA 3EC9A 1TRQA 1UI8A 1MWUA 2GBWB 5D81A 1ZX2A 3S27A 1VQK3 1US1A 3NBBA 3I0YA 5EQLA 4CDLA 1EKMA 3WHOA 1Q9EA 2IUJA 3O8YA 4N6OB 3Q90A 1RSNA 3GSPA 3KN4A 4K90B 1CYUA 3V99A 1RGEA 5BU4A 8RNTA 1B2ZA 1AQZA 1JN5A 1OHSA 1W2ZA 2CFKA 3AMOA 3HK4A 3RDEA 1U8CB 5IG5A 1RKYA 1K734 1B2XA 1RN4A 2ML6A 1JRQA 1IVUA 1JZOA 1B2UA 1SIHA 4J5KA 4Q53A 3LT9A 4FMBA 3OWUA 4K1UA 9RNTA 4STDA 3DGOA 3H3HA 1LOVA 1OF5A 2SARA 3DMCA 3F8HA 3OXAA 4GHOA 4TX4A 3SXXA 3CCE3 1FW7A 1SQWA 1O7GB 3CC43 1Q824 2AADA 2ZL8A 2R41A 4I4KA 3PGBA 3WA3A 1GY6A 3BIRA 3G8ZA 1N9EA 1W02A 4MJDA 3VF1A 4AKYA 5A0OB 3LYGA 1OHPA 4RNZA 3MG3A 3MPHA 5LC7A 1V57A 2CFWA 3FG3A 2XF3A 3NQYA 1DMMA 1Q40A 1DMQA 4IPBA 4BIRA 1IK3A 1CYVA 1T2IA 1ULIB 2D1WA 2STDA 1GY5A 1QAKA 1TIJA 4LMIA 1L5GB 1T2HA 7RNTA 1SARA 1I0VA 1M9GA 3SEDA 5TGNA 1VQM3 4MMZB 3DZLA 3G713 1D6YA 1PY3A 3MYTA 5CK6A 6STDA 3KSPA 3CU3A 1G02A 4GL6A 2IUKA 4HYZA 3CD63 4BTWA 3MG2A 3MWZA 2P0MA 5LC6A 1FA3A 3PCRA 3FZWA 1UGHI 2XSOB 2PNCA 1OGXA 5BIRA 5I97A 1B2MA 3DY5A 3L0RA 1BUJA 1BANA 1GMPA 1JZDA 5IF6A 2XFTA 2CG1A 1I2FA 2HMOB 1BIRA 2Y73A 1N8R4 1I0XA 1EEJA 1OUNA 1W01A 2CWVA 1LNHA 1NNVA 4EYCA 4XDWA 3PCSA 1W5ZA 1NO3A 1LQGC 5G1KA 1BNIA 6RNTA
chains in the Genus database with same CATH topology
1W2B2 3EF8A 4RNYA 1OH0A 2OTL3 1VQ63 2YFJB 4FCJA 4RZMA 3VGNA 4MMXB 1YVBI 1W7CA 5ELUA 1KQS2 4X2HA 1RN7A 1IQXA 1QVF2 2PZVA 3UL6A 2O9UX 1TU5A 3CMA3 1QAFA 4XBTA 4WYKB 4HZBB 1ULJB 3HIIA 3KKGA 2P38A 5AIGA 3DGNA 5KP1A 2QEX3 1IVVA 1K28A 3LZAA 3CCV3 4NREA 2UX0A 4JRFA 3NHXA 3X40A 1WMOA 1Q814 4WWUC 1IU7A 4L8OA 3OWSA 1FGTA 4O3VA 3EBYA 2QIYA 3SOYA 3DGLA 2Z76A 1VZZA 3B7CA 1DVCA 4FMCA 3X41A 3CCM3 4KVHA 1JJ22 2XRXB 2CFGA 3DUKA 4G1MB 5AIFA 1R4CA 2GU1A 2BO9B 3E99A 3STDA 3SVAA 1QJGA 3FG1A 2GEYA 1FUWA 1K9M4 2CH9A 1VQ83 2CG0A 1ROAA 1N5PA 2F98A 3EN1B 4R80A 4EXRA 3EN8A 4JF8A 1YI23 1LVNA 1FGMA 2OWPA 4AKZA 2K0MA 2W9PA 1ISKA 3NV0B 4HJLB 4L8PA 3BNBA 1GD3A 1NU3A 3FSDA 1AVKA 3GZXB 3N54B 4MMYB 4N6TA 1ROVA 3WOFB 3NM2A 2WGQA 2CK3H 3NX0A 1JB2A 4R4KA 3FF2A 3F9SA 2Q07A 1JKGA 3I553 1IDPA 1IQ8A 3WDGB 1MOLA 3DGMA 4XBXA 3DM8A 1K8A4 4O2HA 3K9MC 3MSOA 1YGEA 3CME3 3BNDA 5AIHA 3K63A 3SLUA 1QMAA 2P09A 5JPPA 3CXC2 2P05A 2C10A 1O7PB 1O7MB 2W9QA 1VQ73 1CQSA 3EHCA 3WODG 2XGNA 3LTAA 1PFPA 3CCS3 1ASKA 3S67A 3K7CA 1Q42A 4ZM8A 3GRDA 2RCDA 1JV2B 2HMNB 2O3OA 1WMPA 4HBRA 2W03A 1W6GA 2WOHA 1A2VA 4J8TA 1K41A 1VQP3 1UW1A 1OACA 3BB9A 5CXOA 2OCTA 3V98A 1E97A 1MNLA 1OHOA 2CWTA 3KSED 4HM6B 2MC8A 1DMNA 3CC73 1JB4A 3FF0A 3Q2PA 3LXUX 3NXJA 1JN5B 4CCVA 1KC84 3AMOB 3UL5A 4H61A 4FCZA 1S723 4WP5A 3RGAA 3WA2X 1VQO3 1TUHA 1QVG2 1D6UA 3WMDA 3G16A 2F99A 5D82A 4KFFA 1OF5B 1OCVA 4EV2A 3F40A 3PS8A 3OW22 2CC3A 3OX9A 3IJEB 1VQ93 2GU3A 1EG9B 1GYBA 3HX8A 1NJI4 4EV5A 1HKXA 1IT8A 3EX9A 3CCL3 2W56A 2IA7A 2Y74A 4MEIA 2HMKB 3EB8A 5KP3A 1OPYA 1Q40B 1TP6A 5ELJA 1SIIA 3B8LA 3F7XA 3KFQC 3PXMA 2W04A 3S29A 3QK9A 4LGQA 3G4S3 5CLKA 5FW5A 1NWWA 1SJWA 2JQ5A 4K1VA 3FLJA 3CCQ3 3PYJA 3OV4A 2QGUA 2V1LA 3H51A 5IW9A 2YX9A 3NUVA 4R9LA 5IENA 4KZ1A 3V92A 3X3YA 5IERA 1AVLA 3KZTA 1O7WB 3ECFA 2OQEA 3D9RA 3JVCA 3KIIA 4OK0A 2LQVA 2XEPA 3KE7A 1SPUA 1N8QA 2XFSA 3EJVA 4H3UA 1RRLA 2CWUA 3T8UA 3CCR3 3GZRA 1A67A 3EBTA 2OTJ3 2CFLA 3CNXA 4J9AA 3I563 3GWRA 4IT7A 2B24B 5DREA 3NM7A 3A76A 4FCMA 1VQL3 7STDA 3MKIA 2HMMB 4FMAA 2W6JH 2OOVA 2XH9A 1KSIA 4EBGA 3LT8A 3EE1A 1M1XB 3UNLA 2XGLA 1Y4KA 1NDOB 3S5CA 1RJOA 4HM5B 4N6UA 3DXOA 2BMQB 5BXQA 1UUWB 3F7SA 4KFDA 2KCDA 1NB3I 1CEWI 3RGRA 2ML5A 4HM7B 5AI1A 2YFIB 5DRVA 1YHQ3 4K61A 1A2KA 2E2UA 4XBYA 1M904 3VSYA 1D6ZA 5IG3A 3X42A 1FGOA 3BNCA 1V74A 1YIT3 1KD14 1S5AA 5KP4A 1RRHA 1TFKA 3ALAA 4RBNA 2BHMA 4XDVA 2LYXA 1E3VA 2OQEC 1W6YA 3N9HA 4WHAA 1STDA 4FMDA 1EQKA 3LTCA 1WMNA 1STFI 2HMLB 4IIAA 3MHEA 2CFDA 3FCSB 1E3RA 3GAXA 3CCJ3 2Z7AA 3HZPA 1LXEA 3ROBA 3U97A 4OVMA 2GEXA 4XB5A 1AR0A 2BNGA 3FKAA 4HVNA 5CF2A 1IVWA 2BMRB 1EA2A 4HM2B 5IEOA 3MG1A 1C7HA 1G96A 2OOVC 1IV7A 1DYUA 1UI7A 4LZIA 2HMJB 3GZYB 5STDA 5AYSC 1JKGB 3EQQB 1N9JA 2C11A 2INXA 1WTHA 2Z77A 5D83A 1YJ93 2XR8B 4OUQA 5AYRB 3B4OA 3LTBA 2FXTA 1AV4A 4LSOA 4N6NB 1YJW3 2P0XA 4QWTA 1LOXA 1J2BA 3F8XA 1IQYA 1WQLB 4R1KA 2B1XB 2A15A 4HM3B 5IG0A 2BT3A 2E2TA 2MF7A 2R4IA 4NHFA 3TDGA 3LMLA 1GS3A 1TFOA 3G0KA 2L4VA 1PU4A 4PEJA 1VQN3 3JUNA 1FGRA 2W0QA 3BNEA 2D42A 4FR9A 2BMOB 8CHOA 4WYKA 2XSHB 3SOAA 4HM1B 5CF1A 1BUQA 4HM8B 3ER7A 2SBLA 4HM4B 1NB5I 2F86B 3JUOA 2WOFA 1OGZA 3Q1CA 4KFEA 3X3XA 3CPOA 3JUPA 4LEHA 2WGOA 2Z6BA 5BVBA 2CKFB 2CHCA 2WO0A 4O02B 1YJN3 1ZO2A 2RFRA 2IMJA 3HI7A 4HM0B 4N6V0 1M1K4 2RSXA 4GB5A 3CNMA 2M7OA 2KRTA 1YIJ3 2JDIH 1A90A 1IVXA 5AIIA 4WFOA 2W56B 4HKVB 1U5OA 4N6LA 3CCU3 1GD4A 2ZDJA 1GY7A 1HU9A 3HIGA 3FGYA 1IV9A 3GZBA 1QALA 4N3VA 2RGQA 4N6MA 1Z1SA 5AEUB 4U13A 3K5TA 2FNQA 3LH4A 3UB1A 2CIUA 2K54A 3UJMA 3NQZA 5IG4A 2YFLB 3NV0A 4XM4A 3T8NA 4ORLA 3SX1A 3JUQA 1JNQA 1W4NA 4AEQA 4EC6A 5JBSA 2KXGA 3NBRA 2GXFA 1F8NA 1KWIA 3JUMA 3G6E3 3J7Yd 3X3ZA 2CW9A 3FG4A 1IT7A 1VQ53 1W6CA 1Q864 3CPW2 1O7NB 4BTXA 3U1WA 3CC23 2QA43 1O7HB 3D3LA 4X2OA 3S28A 2I9WA 1JB5A 1UUVB 5FGOA 3M8CA 3BLZA 5G2GA 4R9KA 5HGRA 4BTYA 5EEOA 2E2VA 1FGQA 1N5HA 3QRDA 4O8SA 3OWYA 3NBJA 1W00A 3F14A 5IEPA 3FH1A 1DVDA 3B4PA 3K0ZA 3LOYA 5JPUA 1Q7Y4 1WNHA 3IMAB 3T0UA 5EVHA 1VQ43 3LTDA 5AEWB 2FGTA 2GBXB 4HZ9B 4L7KA 3WOEB 2W2CA 3N8BA 3PZWA 3IPTA 1T5YA 3EC9A 1VQK3 1UI8A 3S27A 2GBWB 5D81A 1ZX2A 1US1A 3NBBA 3I0YA 5EQLA 4CDLA 1EKMA 2IUJA 3O8YA 4N6OB 3Q90A 3KN4A 4K90B 1CYUA 3V99A 1JN5A 2CFKA 3RDEA 1OHSA 1W2ZA 3AMOA 3HK4A 5IG5A 1RKYA 1U8CB 1K734 2ML6A 1JRQA 1IVUA 1SIHA 4Q53A 3LT9A 4FMBA 3OWUA 4K1UA 4STDA 3DGOA 3H3HA 4TX4A 1OF5A 3OXAA 3DMCA 3F8HA 3SXXA 3CCE3 1SQWA 1O7GB 3CC43 1Q824 2ZL8A 4I4KA 3PGBA 3WA3A 1GY6A 3G8ZA 1N9EA 1W02A 4MJDA 3VF1A 4AKYA 5A0OB 3LYGA 1OHPA 4RNZA 3MG3A 3MPHA 5LC7A 2CFWA 3FG3A 2XF3A 3NQYA 1DMMA 1Q40A 1DMQA 4IPBA 1IK3A 1CYVA 4LMIA 1ULIB 2D1WA 2STDA 1GY5A 1QAKA 1TIJA 1L5GB 1M9GA 3SEDA 5TGNA 1VQM3 4MMZB 3DZLA 3G713 1D6YA 3MYTA 5CK6A 6STDA 3KSPA 3CU3A 4GL6A 4HYZA 2IUKA 3CD63 4BTWA 3MG2A 3MWZA 2P0MA 5LC6A 1FA3A 3PCRA 3FZWA 2XSOB 2PNCA 1OGXA 5I97A 3DY5A 3L0RA 5IF6A 2XFTA 2CG1A 2HMOB 2Y73A 1N8R4 2CWVA 1OUNA 1W01A 1LNHA 4EYCA 4XDWA 3PCSA 1W5ZA 1NO3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EF8 A;  1OH0 A;  2YFJ B;  4FCJ A;  4RZM A;  3VGN A;  4X2H A;  2PZV A;  4XBT A;  4WYK B;  4HZB B;  1ULJ B;  3KKG A;  5AIG A;  5KP1 A;  3LZA A;  2UX0 A;  3NHX A;  4WWU C;  4L8O A;  3OWS A;  3EBY A;  2QIY A;  3SOY A;  2Z76 A;  1VZZ A;  3B7C A;  4KVH A;  2XRX B;  3DUK A;  5AIF A;  3E99 A;  3STD A;  1QJG A;  2GEY A;  2F98 A;  3EN1 B;  3EN8 A;  2OWP A;  1ISK A;  3NV0 B;  4HJL B;  4L8P A;  1NU3 A;  3FSD A;  3GZX B;  3NM2 A;  1JB2 A;  3FF2 A;  3F9S A;  1JKG A;  1IDP A;  4XBX A;  3DM8 A;  3MSO A;  5AIH A;  1QMA A;  5JPP A;  1O7P B;  1O7M B;  1CQS A;  3EHC A;  1ASK A;  3K7C A;  1Q42 A;  3GRD A;  2RCD A;  2HMN B;  4J8T A;  1K41 A;  3BB9 A;  5CXO A;  1E97 A;  1OHO A;  4HM6 B;  1DMN A;  1JB4 A;  3FF0 A;  3NXJ A;  1JN5 B;  4WP5 A;  3RGA A;  1TUH A;  3WMD A;  3G16 A;  2F99 A;  5D82 A;  1OF5 B;  1OCV A;  3F40 A;  3OX9 A;  1EG9 B;  1GYB A;  3HX8 A;  1HKX A;  3EX9 A;  2HMK B;  5KP3 A;  1OPY A;  1Q40 B;  1TP6 A;  3B8L A;  3F7X A;  4LGQ A;  5CLK A;  5FW5 A;  1NWW A;  1SJW A;  2JQ5 A;  4K1V A;  3FLJ A;  3OV4 A;  2QGU A;  3H51 A;  3NUV A;  4R9L A;  5IEN A;  5IER A;  3KZT A;  1O7W B;  3ECF A;  3D9R A;  3KE7 A;  3EJV A;  4H3U A;  3T8U A;  3GZR A;  3EBT A;  3CNX A;  4J9A A;  3GWR A;  2B24 B;  5DRE A;  3A76 A;  4FCM A;  7STD A;  3MKI A;  2HMM B;  3UNL A;  1NDO B;  3S5C A;  4HM5 B;  3DXO A;  2BMQ B;  5BXQ A;  1UUW B;  3F7S A;  3RGR A;  4HM7 B;  5AI1 A;  2YFI B;  5DRV A;  1A2K A;  4XBY A;  3VSY A;  5IG3 A;  1S5A A;  5KP4 A;  4XDV A;  1E3V A;  1W6Y A;  1STD A;  2HML B;  4IIA A;  3MHE A;  1E3R A;  2Z7A A;  3HZP A;  3ROB A;  4OVM A;  2GEX A;  4XB5 A;  1AR0 A;  2BNG A;  3FKA A;  4HVN A;  5CF2 A;  2BMR B;  1EA2 A;  4HM2 B;  5IEO A;  3MG1 A;  1C7H A;  5STD A;  2HMJ B;  3GZY B;  1JKG B;  3EQQ B;  2INX A;  2Z77 A;  5D83 A;  2XR8 B;  4OUQ A;  3B4O A;  3F8X A;  1WQL B;  4R1K A;  2B1X B;  2A15 A;  4HM3 B;  5IG0 A;  2R4I A;  1GS3 A;  3G0K A;  4PEJ A;  3JUN A;  2BMO B;  8CHO A;  4WYK A;  2XSH B;  3SOA A;  4HM1 B;  5CF1 A;  1BUQ A;  4HM8 B;  3ER7 A;  4HM4 B;  2F86 B;  3JUO A;  1OGZ A;  3CPO A;  3JUP A;  4LEH A;  5BVB A;  2CKF B;  2CHC A;  1ZO2 A;  2RFR A;  2IMJ A;  4HM0 B;  4GB5 A;  3CNM A;  5AII A;  4HKV B;  1U5O A;  1GY7 A;  3FGY A;  4N3V A;  3GZB A;  2RGQ A;  1Z1S A;  5AEU B;  4U13 A;  2K54 A;  3UJM A;  5IG4 A;  2YFL B;  3NV0 A;  4XM4 A;  3T8N A;  4ORL A;  3JUQ A;  3NBR A;  2GXF A;  3JUM A;  1O7N B;  1O7H B;  4X2O A;  2I9W A;  1JB5 A;  1UUV B;  3M8C A;  3BLZ A;  5G2G A;  4R9K A;  5HGR A;  3OWY A;  1W00 A;  3F14 A;  5IEP A;  3FH1 A;  3B4P A;  3K0Z A;  5JPU A;  5EVH A;  5AEW B;  4HZ9 B;  2GBX B;  4L7K A;  2W2C A;  3IPT A;  3EC9 A;  2GBW B;  5D81 A;  1ZX2 A;  4CDL A;  3I0Y A;  3Q90 A;  1JN5 A;  1OHS A;  3HK4 A;  5IG5 A;  4Q53 A;  3OWU A;  4K1U A;  4STD A;  3H3H A;  1OF5 A;  3OXA A;  3DMC A;  3F8H A;  1O7G B;  4I4K A;  1GY6 A;  3G8Z A;  1W02 A;  4MJD A;  3LYG A;  1OHP A;  3MG3 A;  1DMM A;  1Q40 A;  1DMQ A;  4LMI A;  1ULI B;  2STD A;  1GY5 A;  3SED A;  5TGN A;  3DZL A;  3MYT A;  5CK6 A;  6STD A;  3KSP A;  3CU3 A;  3MG2 A;  3FZW A;  2XSO B;  1OGX A;  5IF6 A;  2HMO B;  1OUN A;  1W01 A;  4XDW A; 
#chains in the Genus database with same CATH topology
 1W2B 2;  3EF8 A;  4RNY A;  1OH0 A;  1RGK A;  2OTL 3;  4GSP A;  1VQ6 3;  2YFJ B;  4FCJ A;  4RZM A;  3VGN A;  4MMX B;  1YVB I;  1W7C A;  5ELU A;  1KQS 2;  3D79 A;  4X2H A;  1RN7 A;  3ZFZ A;  1IQX A;  1QVF 2;  2PZV A;  3UL6 A;  2O9U X;  1TU5 A;  3CMA 3;  1RDS A;  1RTU A;  1QAF A;  4XBT A;  5M19 A;  4WYK B;  4HOH A;  4HZB B;  1ULJ B;  3HII A;  1PYL A;  2P38 A;  3KKG A;  3DGN A;  5AIG A;  5KP1 A;  1IVV A;  1K28 A;  2QEX 3;  2ZA4 A;  2K3D A;  3LZA A;  3SYU A;  3CCV 3;  4NRE A;  2UX0 A;  1RMS A;  4JRF A;  3NHX A;  3X40 A;  1WMO A;  1Q81 4;  4WWU C;  5HOH A;  1IU7 A;  3BU4 A;  4L8O A;  3OWS A;  1FGT A;  4O3V A;  3EBY A;  1RGG A;  2KAA A;  2QIY A;  1RGH A;  1BSD A;  3SOY A;  3DGL A;  1X1W A;  2Z76 A;  1VZZ A;  3B7C A;  1DVC A;  4FMC A;  3X41 A;  3CCM 3;  4KVH A;  2UUG C;  1JJ2 2;  1MWR A;  2XRX B;  2CFG A;  3DUK A;  4G1M B;  5AIF A;  1R4C A;  2GU1 A;  2BO9 B;  3AHW A;  3E99 A;  3STD A;  3SVA A;  1QJG A;  1RNB A;  3FG1 A;  2GEY A;  1FUW A;  1K9M 4;  2CH9 A;  1VQ8 3;  2CG0 A;  1ROA A;  1N5P A;  2F98 A;  3EN1 B;  4R80 A;  4EXR A;  3EN8 A;  1UCI A;  4JF8 A;  1YI2 3;  1LVN A;  2UGI A;  1FGM A;  2OWP A;  4AKZ A;  2K0M A;  4LYL B;  2W9P A;  1ISK A;  3NV0 B;  4HJL B;  4L8P A;  3BNB A;  6GSP A;  1GD3 A;  1NU3 A;  3FSD A;  1AVK A;  7GSP A;  1GOY A;  3GZX B;  3N54 B;  4MMY B;  4N6T A;  1LRA A;  1R4Y A;  1ROV A;  3WOF B;  1I8V A;  3NM2 A;  2WGQ A;  2CK3 H;  1VQQ A;  2L1S A;  3NX0 A;  1JB2 A;  4R4K A;  3FF2 A;  3F9S A;  2Q07 A;  1JKG A;  1BNR A;  3I55 3;  1IDP A;  1IQ8 A;  1I70 A;  1RLS A;  3WDG B;  1MOL A;  3DGM A;  4XBX A;  3DM8 A;  1K8A 4;  4O2H A;  3K9M C;  1MWS A;  3MSO A;  1YGE A;  3CME 3;  3BND A;  1FUS A;  5AIH A;  3K63 A;  3SLU A;  1QMA A;  2P09 A;  5JPP A;  1RGC A;  2P05 A;  2C10 A;  3CXC 2;  1O7P B;  1O7M B;  2W9Q A;  1VQ7 3;  2CX1 A;  1CQS A;  3EHC A;  3WOD G;  2XGN A;  3LTA A;  1PFP A;  1BRI A;  1B20 A;  1ASK A;  3S67 A;  3CCS 3;  1BAO A;  3K7C A;  1Q42 A;  4ZM8 A;  3GRD A;  2RCD A;  1JV2 B;  1BNG A;  1GSP A;  2HMN B;  2O3O A;  1WMP A;  4HBR A;  2W03 A;  4EW5 A;  1W6G A;  4KT3 B;  2WOH A;  1A2V A;  4J8T A;  1K41 A;  1VQP 3;  1UW1 A;  1OAC A;  3BB9 A;  5CXO A;  2OCT A;  3V98 A;  1E97 A;  1MNL A;  1OHO A;  2CWT A;  3KSE D;  4HM6 B;  2CX0 A;  2MC8 A;  1DMN A;  3Q3F A;  3CC7 3;  1I3F A;  1JB4 A;  3FF0 A;  3Q2P A;  3LXU X;  1BNF A;  3NXJ A;  1JN5 B;  4CCV A;  1KC8 4;  1BRS A;  1HYF A;  3AMO B;  3UL5 A;  1UCJ A;  4H61 A;  4FCZ A;  1S72 3;  4WP5 A;  3AGO A;  3RGA A;  3WA2 X;  1VQO 3;  1YNV X;  1C54 A;  4BL3 A;  1TUH A;  3ZG0 A;  1QVG 2;  1D6U A;  1BSC A;  3WMD A;  3G16 A;  1LQM B;  2GSP A;  2F99 A;  5D82 A;  4KFF A;  1OF5 B;  1OCV A;  4EV2 A;  3F40 A;  3PS8 A;  3OW2 2;  2CC3 A;  3OX9 A;  5M1A A;  1MGR A;  3IJE B;  1VQ9 3;  2GU3 A;  1EG9 B;  1BU4 A;  1GYB A;  3WR2 A;  3HX8 A;  1NJI 4;  4EV5 A;  1RN1 A;  1HKX A;  1IT8 A;  3EX9 A;  3CCL 3;  2W56 A;  2IA7 A;  2Y74 A;  4MEI A;  2HMK B;  1I2E A;  3EB8 A;  5M18 A;  1JBS A;  5KP3 A;  1OPY A;  1Q40 B;  1TP6 A;  5ELJ A;  1SII A;  2KF5 A;  1ZS7 A;  3B8L A;  3F7X A;  3KFQ C;  2W04 A;  3PXM A;  3S29 A;  3QK9 A;  1BSB A;  1BGS A;  1TJD A;  3D4A A;  4LGQ A;  4BL2 A;  2KF3 A;  5CLK A;  1B27 A;  5FW5 A;  3G4S 3;  1NWW A;  1SJW A;  1JBR A;  2JQ5 A;  4K1V A;  3FLJ A;  3CCQ 3;  1FUT A;  1TRP A;  3PYJ A;  3OV4 A;  2QGU A;  2V1L A;  1T3B A;  1BSA A;  3H51 A;  5IW9 A;  2YX9 A;  1ZGX A;  3NUV A;  3AHS A;  4R9L A;  4KZ1 A;  2IYJ A;  3V92 A;  5IEN A;  3X3Y A;  5IER A;  1AVL A;  3KZT A;  1B21 A;  1B3S A;  1O7W B;  1MGW A;  1X1Y A;  3D9R A;  3ECF A;  3JVC A;  3KII A;  4OK0 A;  2LQV A;  2XEP A;  3KE7 A;  1SPU A;  1HZ1 A;  1TTO A;  3D5G A;  1N8Q A;  2XFS A;  3EJV A;  4H3U A;  1RRL A;  2CWU A;  3T8U A;  5RNT A;  3URP A;  3CCR 3;  2F56 A;  3GZR A;  1A67 A;  3EBT A;  2ZHX B;  2OTJ 3;  2CFL A;  2C4B A;  3CNX A;  4J9A A;  3I56 3;  3GWR A;  4IT7 A;  2B24 B;  5DRE A;  3NM7 A;  3A76 A;  4FCM A;  1VQL 3;  7STD A;  3MKI A;  2HMM B;  4FMA A;  1V58 A;  2W6J H;  2XH9 A;  2OOV A;  1KSI A;  4EBG A;  3LT8 A;  3EE1 A;  1M1X B;  3UNL A;  1UCK A;  2XGL A;  1GOU A;  1Y4K A;  1NDO B;  3S5C A;  1RJO A;  4HM5 B;  1FYS A;  4N6U A;  3DXO A;  2BMQ B;  5BXQ A;  1UUW B;  3F7S A;  4KFD A;  2KCD A;  1NB3 I;  3DGY A;  4NPB A;  1CEW I;  3RGR A;  2ML5 A;  4J5G A;  4HAA A;  4HM7 B;  5AI1 A;  1RHL A;  2YFI B;  5DRV A;  1YHQ 3;  4K61 A;  1A2K A;  2OQE A;  2E2U A;  4XBY A;  1M90 4;  1BSE A;  1CH0 A;  1BRK A;  1D6Z A;  3VSY A;  3X42 A;  1FGO A;  3BNC A;  1V74 A;  1BRH A;  5IG3 A;  1YIT 3;  1KD1 4;  1S5A A;  5KP4 A;  1RRH A;  1TFK A;  3ALA A;  4RBN A;  2BHM A;  2F5M A;  2H0G A;  2LYX A;  1BNE A;  1E3V A;  2OQE C;  1W6Y A;  3N9H A;  4XDV A;  4WHA A;  1STD A;  4FMD A;  2J8X B;  1RGL A;  3LTC A;  1EQK A;  1WMN A;  1STF I;  2HML B;  4IIA A;  3MHE A;  2CFD A;  3FCS B;  1E3R A;  3GAX A;  3CCJ 3;  2BIR A;  1JBT A;  2Z7A A;  3HZP A;  1LXE A;  2KF4 A;  3ROB A;  3U97 A;  3G6E 3;  1G0T A;  4OVM A;  2GEX A;  4XB5 A;  1AR0 A;  2BNG A;  3FKA A;  4HVN A;  5CF2 A;  1IYY A;  2RBI A;  1IVW A;  2BMR B;  1EA2 A;  4HM2 B;  5IEO A;  3MG1 A;  1C7H A;  1G96 A;  2OOV C;  1IV7 A;  1DYU A;  1MWT A;  1UI7 A;  2HMJ B;  3GZY B;  4LZI A;  5STD A;  2H0I A;  5AYS C;  1JKG B;  3EQQ B;  1N9J A;  2C11 A;  5G1L A;  2INX A;  1WTH A;  2Z77 A;  1B2S A;  5D83 A;  1YJ9 3;  2XR8 B;  4OUQ A;  1UDI I;  5AYR B;  3A5E A;  3B4O A;  3LTB A;  2FXT A;  1AV4 A;  4LSO A;  4N6N B;  1YJW 3;  2P0X A;  4QWT A;  1BOX A;  3AGN A;  1LOX A;  1J2B A;  3F8X A;  1IQY A;  1WQL B;  4R1K A;  1AY7 A;  1LOY A;  1RCK A;  2B1X B;  2A15 A;  4HM3 B;  5GSP A;  5IG0 A;  1DE3 A;  2BT3 A;  2E2T A;  2MF7 A;  2R4I A;  4I5Q A;  4NHF A;  3LML A;  1GS3 A;  3KCH A;  3TDG A;  1TFO A;  3G0K A;  2L4V A;  4ILF A;  1PU4 A;  4PEJ A;  1VQN 3;  3JUN A;  1X1X A;  1FGR A;  2W0Q A;  1YVS A;  3BNE A;  2D42 A;  4FR9 A;  2BMO B;  1RGA A;  8CHO A;  1UCL A;  1RNT A;  4WYK A;  2XSH B;  1LNI A;  3SOA A;  1X1U A;  4HM1 B;  5CF1 A;  1BUQ A;  4HM8 B;  3ER7 A;  2SBL A;  4HM4 B;  1NB5 I;  2F86 B;  3JUO A;  2WOF A;  1OGZ A;  2RNT A;  3Q1C A;  4KFE A;  3CPO A;  3JUP A;  3X3X A;  4LEH A;  3D5I A;  1GMQ A;  2WGO A;  2Z6B A;  5BVB A;  1I3I A;  2CKF B;  2CHC A;  1UUG B;  2WO0 A;  4O02 B;  1A2P A;  1YJN 3;  1ZO2 A;  2RFR A;  2IMJ A;  3HI7 A;  4HM0 B;  3ZG5 A;  4N6V 0;  1UGI A;  1M1K 4;  2KF6 A;  2RSX A;  4GB5 A;  2AAE A;  3CNM A;  2M7O A;  2KRT A;  1YIJ 3;  2JDI H;  1A90 A;  1IVX A;  1I2G A;  5AII A;  4WFO A;  2W56 B;  4HKV B;  1U5O A;  4N6L A;  3CCU 3;  1GD4 A;  2ZDJ A;  1GY7 A;  1HU9 A;  3HIG A;  3FGY A;  1IV9 A;  3GZB A;  1QAL A;  4N3V A;  2RGQ A;  4N6M A;  1Z1S A;  5AEU B;  4U13 A;  3K5T A;  2FNQ A;  3LH4 A;  3UB1 A;  2CIU A;  2K54 A;  3UJM A;  3NQZ A;  5IG4 A;  2YFL B;  3NV0 A;  1EUI C;  4XM4 A;  1RCL A;  3T8N A;  4ORL A;  3SX1 A;  3JUQ A;  1JNQ A;  1W4N A;  4AEQ A;  4DKI A;  4EC6 A;  2KXG A;  3NBR A;  2GXF A;  1F8N A;  1KWI A;  3JUM A;  4BU4 A;  5JBS A;  3J7Y d;  3X3Z A;  2CW9 A;  3FG4 A;  1IT7 A;  1VQ5 3;  1GMR A;  1BNJ A;  1BVI A;  1W6C A;  3CPW 2;  1O7N B;  1Q86 4;  3RNT A;  1RGF A;  4BTX A;  3U1W A;  3CC2 3;  2QA4 3;  1O7H B;  3D3L A;  4X2O A;  3DH2 A;  3S28 A;  2IY2 A;  1BRG A;  2I9W A;  4CJN A;  4RNT A;  1JB5 A;  1UUV B;  5FGO A;  3M8C A;  3BLZ A;  5G2G A;  4R9K A;  5HGR A;  4BTY A;  5EEO A;  2E2V A;  2F4Y A;  1FGQ A;  1N5H A;  1FZU A;  2BU4 A;  1GOV A;  3QRD A;  4O8S A;  2F5W A;  3OWY A;  3NBJ A;  1W00 A;  2HOH A;  3F14 A;  5IEP A;  3FH1 A;  1DVD A;  1LOW A;  1BRN L;  3B4P A;  1YGW A;  3K0Z A;  3LOY A;  1Q7H A;  5JPU A;  1Q7Y 4;  1WNH A;  1BNS A;  1BRJ A;  3IMA B;  3T0U A;  4CPK A;  5EVH A;  1VQ4 3;  3LTD A;  5AEW B;  2FGT A;  2GBX B;  4HZ9 B;  4L7K A;  3WOE B;  2W2C A;  3N8B A;  3PZW A;  1DET A;  3IPT A;  1T5Y A;  3HOH A;  2H0H A;  3EC9 A;  1TRQ A;  1UI8 A;  1MWU A;  2GBW B;  5D81 A;  1ZX2 A;  3S27 A;  1VQK 3;  1US1 A;  3NBB A;  3I0Y A;  5EQL A;  4CDL A;  1EKM A;  3WHO A;  1Q9E A;  2IUJ A;  3O8Y A;  4N6O B;  3Q90 A;  1RSN A;  3GSP A;  3KN4 A;  4K90 B;  1CYU A;  3V99 A;  1RGE A;  5BU4 A;  8RNT A;  1B2Z A;  1AQZ A;  1JN5 A;  1OHS A;  1W2Z A;  2CFK A;  3AMO A;  3HK4 A;  3RDE A;  1U8C B;  5IG5 A;  1RKY A;  1K73 4;  1B2X A;  1RN4 A;  2ML6 A;  1JRQ A;  1IVU A;  1JZO A;  1B2U A;  1SIH A;  4J5K A;  4Q53 A;  3LT9 A;  4FMB A;  3OWU A;  4K1U A;  9RNT A;  4STD A;  3DGO A;  3H3H A;  1LOV A;  1OF5 A;  2SAR A;  3DMC A;  3F8H A;  3OXA A;  4GHO A;  4TX4 A;  3SXX A;  3CCE 3;  1FW7 A;  1SQW A;  1O7G B;  3CC4 3;  1Q82 4;  2AAD A;  2ZL8 A;  2R41 A;  4I4K A;  3PGB A;  3WA3 A;  1GY6 A;  3BIR A;  3G8Z A;  1N9E A;  1W02 A;  4MJD A;  3VF1 A;  4AKY A;  5A0O B;  3LYG A;  1OHP A;  4RNZ A;  3MG3 A;  3MPH A;  5LC7 A;  1V57 A;  2CFW A;  3FG3 A;  2XF3 A;  3NQY A;  1DMM A;  1Q40 A;  1DMQ A;  4IPB A;  4BIR A;  1IK3 A;  1CYV A;  1T2I A;  1ULI B;  2D1W A;  2STD A;  1GY5 A;  1QAK A;  1TIJ A;  4LMI A;  1L5G B;  1T2H A;  7RNT A;  1SAR A;  1I0V A;  1M9G A;  3SED A;  5TGN A;  1VQM 3;  4MMZ B;  3DZL A;  3G71 3;  1D6Y A;  1PY3 A;  3MYT A;  5CK6 A;  6STD A;  3KSP A;  3CU3 A;  1G02 A;  4GL6 A;  2IUK A;  4HYZ A;  3CD6 3;  4BTW A;  3MG2 A;  3MWZ A;  2P0M A;  5LC6 A;  1FA3 A;  3PCR A;  3FZW A;  1UGH I;  2XSO B;  2PNC A;  1OGX A;  5BIR A;  5I97 A;  1B2M A;  3DY5 A;  3L0R A;  1BUJ A;  1BAN A;  1GMP A;  1JZD A;  5IF6 A;  2XFT A;  2CG1 A;  1I2F A;  2HMO B;  1BIR A;  2Y73 A;  1N8R 4;  1I0X A;  1EEJ A;  1OUN A;  1W01 A;  2CWV A;  1LNH A;  1NNV A;  4EYC A;  4XDW A;  3PCS A;  1W5Z A;  1NO3 A;  1LQG C;  5G1K A;  1BNI A;  6RNT A; 
#chains in the Genus database with same CATH homology
 1W2B 2;  3EF8 A;  4RNY A;  1OH0 A;  2OTL 3;  1VQ6 3;  2YFJ B;  4FCJ A;  4RZM A;  3VGN A;  4MMX B;  1YVB I;  1W7C A;  5ELU A;  1KQS 2;  4X2H A;  1RN7 A;  1IQX A;  1QVF 2;  2PZV A;  3UL6 A;  2O9U X;  1TU5 A;  3CMA 3;  1QAF A;  4XBT A;  4WYK B;  4HZB B;  1ULJ B;  3HII A;  3KKG A;  2P38 A;  5AIG A;  3DGN A;  5KP1 A;  2QEX 3;  1IVV A;  1K28 A;  3LZA A;  3CCV 3;  4NRE A;  2UX0 A;  4JRF A;  3NHX A;  3X40 A;  1WMO A;  1Q81 4;  4WWU C;  1IU7 A;  4L8O A;  3OWS A;  1FGT A;  4O3V A;  3EBY A;  2QIY A;  3SOY A;  3DGL A;  2Z76 A;  1VZZ A;  3B7C A;  1DVC A;  4FMC A;  3X41 A;  3CCM 3;  4KVH A;  1JJ2 2;  2XRX B;  2CFG A;  3DUK A;  4G1M B;  5AIF A;  1R4C A;  2GU1 A;  2BO9 B;  3E99 A;  3STD A;  3SVA A;  1QJG A;  3FG1 A;  2GEY A;  1FUW A;  1K9M 4;  2CH9 A;  1VQ8 3;  2CG0 A;  1ROA A;  1N5P A;  2F98 A;  3EN1 B;  4R80 A;  4EXR A;  3EN8 A;  4JF8 A;  1YI2 3;  1LVN A;  1FGM A;  2OWP A;  4AKZ A;  2K0M A;  2W9P A;  1ISK A;  3NV0 B;  4HJL B;  4L8P A;  3BNB A;  1GD3 A;  1NU3 A;  3FSD A;  1AVK A;  3GZX B;  3N54 B;  4MMY B;  4N6T A;  1ROV A;  3WOF B;  3NM2 A;  2WGQ A;  2CK3 H;  3NX0 A;  1JB2 A;  4R4K A;  3FF2 A;  3F9S A;  2Q07 A;  1JKG A;  3I55 3;  1IDP A;  1IQ8 A;  3WDG B;  1MOL A;  3DGM A;  4XBX A;  3DM8 A;  1K8A 4;  4O2H A;  3K9M C;  3MSO A;  1YGE A;  3CME 3;  3BND A;  5AIH A;  3K63 A;  3SLU A;  1QMA A;  2P09 A;  5JPP A;  3CXC 2;  2P05 A;  2C10 A;  1O7P B;  1O7M B;  2W9Q A;  1VQ7 3;  1CQS A;  3EHC A;  3WOD G;  2XGN A;  3LTA A;  1PFP A;  3CCS 3;  1ASK A;  3S67 A;  3K7C A;  1Q42 A;  4ZM8 A;  3GRD A;  2RCD A;  1JV2 B;  2HMN B;  2O3O A;  1WMP A;  4HBR A;  2W03 A;  1W6G A;  2WOH A;  1A2V A;  4J8T A;  1K41 A;  1VQP 3;  1UW1 A;  1OAC A;  3BB9 A;  5CXO A;  2OCT A;  3V98 A;  1E97 A;  1MNL A;  1OHO A;  2CWT A;  3KSE D;  4HM6 B;  2MC8 A;  1DMN A;  3CC7 3;  1JB4 A;  3FF0 A;  3Q2P A;  3LXU X;  3NXJ A;  1JN5 B;  4CCV A;  1KC8 4;  3AMO B;  3UL5 A;  4H61 A;  4FCZ A;  1S72 3;  4WP5 A;  3RGA A;  3WA2 X;  1VQO 3;  1TUH A;  1QVG 2;  1D6U A;  3WMD A;  3G16 A;  2F99 A;  5D82 A;  4KFF A;  1OF5 B;  1OCV A;  4EV2 A;  3F40 A;  3PS8 A;  3OW2 2;  2CC3 A;  3OX9 A;  3IJE B;  1VQ9 3;  2GU3 A;  1EG9 B;  1GYB A;  3HX8 A;  1NJI 4;  4EV5 A;  1HKX A;  1IT8 A;  3EX9 A;  3CCL 3;  2W56 A;  2IA7 A;  2Y74 A;  4MEI A;  2HMK B;  3EB8 A;  5KP3 A;  1OPY A;  1Q40 B;  1TP6 A;  5ELJ A;  1SII A;  3B8L A;  3F7X A;  3KFQ C;  3PXM A;  2W04 A;  3S29 A;  3QK9 A;  4LGQ A;  3G4S 3;  5CLK A;  5FW5 A;  1NWW A;  1SJW A;  2JQ5 A;  4K1V A;  3FLJ A;  3CCQ 3;  3PYJ A;  3OV4 A;  2QGU A;  2V1L A;  3H51 A;  5IW9 A;  2YX9 A;  3NUV A;  4R9L A;  5IEN A;  4KZ1 A;  3V92 A;  3X3Y A;  5IER A;  1AVL A;  3KZT A;  1O7W B;  3ECF A;  2OQE A;  3D9R A;  3JVC A;  3KII A;  4OK0 A;  2LQV A;  2XEP A;  3KE7 A;  1SPU A;  1N8Q A;  2XFS A;  3EJV A;  4H3U A;  1RRL A;  2CWU A;  3T8U A;  3CCR 3;  3GZR A;  1A67 A;  3EBT A;  2OTJ 3;  2CFL A;  3CNX A;  4J9A A;  3I56 3;  3GWR A;  4IT7 A;  2B24 B;  5DRE A;  3NM7 A;  3A76 A;  4FCM A;  1VQL 3;  7STD A;  3MKI A;  2HMM B;  4FMA A;  2W6J H;  2OOV A;  2XH9 A;  1KSI A;  4EBG A;  3LT8 A;  3EE1 A;  1M1X B;  3UNL A;  2XGL A;  1Y4K A;  1NDO B;  3S5C A;  1RJO A;  4HM5 B;  4N6U A;  3DXO A;  2BMQ B;  5BXQ A;  1UUW B;  3F7S A;  4KFD A;  2KCD A;  1NB3 I;  1CEW I;  3RGR A;  2ML5 A;  4HM7 B;  5AI1 A;  2YFI B;  5DRV A;  1YHQ 3;  4K61 A;  1A2K A;  2E2U A;  4XBY A;  1M90 4;  3VSY A;  1D6Z A;  5IG3 A;  3X42 A;  1FGO A;  3BNC A;  1V74 A;  1YIT 3;  1KD1 4;  1S5A A;  5KP4 A;  1RRH A;  1TFK A;  3ALA A;  4RBN A;  2BHM A;  4XDV A;  2LYX A;  1E3V A;  2OQE C;  1W6Y A;  3N9H A;  4WHA A;  1STD A;  4FMD A;  1EQK A;  3LTC A;  1WMN A;  1STF I;  2HML B;  4IIA A;  3MHE A;  2CFD A;  3FCS B;  1E3R A;  3GAX A;  3CCJ 3;  2Z7A A;  3HZP A;  1LXE A;  3ROB A;  3U97 A;  4OVM A;  2GEX A;  4XB5 A;  1AR0 A;  2BNG A;  3FKA A;  4HVN A;  5CF2 A;  1IVW A;  2BMR B;  1EA2 A;  4HM2 B;  5IEO A;  3MG1 A;  1C7H A;  1G96 A;  2OOV C;  1IV7 A;  1DYU A;  1UI7 A;  4LZI A;  2HMJ B;  3GZY B;  5STD A;  5AYS C;  1JKG B;  3EQQ B;  1N9J A;  2C11 A;  2INX A;  1WTH A;  2Z77 A;  5D83 A;  1YJ9 3;  2XR8 B;  4OUQ A;  5AYR B;  3B4O A;  3LTB A;  2FXT A;  1AV4 A;  4LSO A;  4N6N B;  1YJW 3;  2P0X A;  4QWT A;  1LOX A;  1J2B A;  3F8X A;  1IQY A;  1WQL B;  4R1K A;  2B1X B;  2A15 A;  4HM3 B;  5IG0 A;  2BT3 A;  2E2T A;  2MF7 A;  2R4I A;  4NHF A;  3TDG A;  3LML A;  1GS3 A;  1TFO A;  3G0K A;  2L4V A;  1PU4 A;  4PEJ A;  1VQN 3;  3JUN A;  1FGR A;  2W0Q A;  3BNE A;  2D42 A;  4FR9 A;  2BMO B;  8CHO A;  4WYK A;  2XSH B;  3SOA A;  4HM1 B;  5CF1 A;  1BUQ A;  4HM8 B;  3ER7 A;  2SBL A;  4HM4 B;  1NB5 I;  2F86 B;  3JUO A;  2WOF A;  1OGZ A;  3Q1C A;  4KFE A;  3X3X A;  3CPO A;  3JUP A;  4LEH A;  2WGO A;  2Z6B A;  5BVB A;  2CKF B;  2CHC A;  2WO0 A;  4O02 B;  1YJN 3;  1ZO2 A;  2RFR A;  2IMJ A;  3HI7 A;  4HM0 B;  4N6V 0;  1M1K 4;  2RSX A;  4GB5 A;  3CNM A;  2M7O A;  2KRT A;  1YIJ 3;  2JDI H;  1A90 A;  1IVX A;  5AII A;  4WFO A;  2W56 B;  4HKV B;  1U5O A;  4N6L A;  3CCU 3;  1GD4 A;  2ZDJ A;  1GY7 A;  1HU9 A;  3HIG A;  3FGY A;  1IV9 A;  3GZB A;  1QAL A;  4N3V A;  2RGQ A;  4N6M A;  1Z1S A;  5AEU B;  4U13 A;  3K5T A;  2FNQ A;  3LH4 A;  3UB1 A;  2CIU A;  2K54 A;  3UJM A;  3NQZ A;  5IG4 A;  2YFL B;  3NV0 A;  4XM4 A;  3T8N A;  4ORL A;  3SX1 A;  3JUQ A;  1JNQ A;  1W4N A;  4AEQ A;  4EC6 A;  5JBS A;  2KXG A;  3NBR A;  2GXF A;  1F8N A;  1KWI A;  3JUM A;  3G6E 3;  3J7Y d;  3X3Z A;  2CW9 A;  3FG4 A;  1IT7 A;  1VQ5 3;  1W6C A;  1Q86 4;  3CPW 2;  1O7N B;  4BTX A;  3U1W A;  3CC2 3;  2QA4 3;  1O7H B;  3D3L A;  4X2O A;  3S28 A;  2I9W A;  1JB5 A;  1UUV B;  5FGO A;  3M8C A;  3BLZ A;  5G2G A;  4R9K A;  5HGR A;  4BTY A;  5EEO A;  2E2V A;  1FGQ A;  1N5H A;  3QRD A;  4O8S A;  3OWY A;  3NBJ A;  1W00 A;  3F14 A;  5IEP A;  3FH1 A;  1DVD A;  3B4P A;  3K0Z A;  3LOY A;  5JPU A;  1Q7Y 4;  1WNH A;  3IMA B;  3T0U A;  5EVH A;  1VQ4 3;  3LTD A;  5AEW B;  2FGT A;  2GBX B;  4HZ9 B;  4L7K A;  3WOE B;  2W2C A;  3N8B A;  3PZW A;  3IPT A;  1T5Y A;  3EC9 A;  1VQK 3;  1UI8 A;  3S27 A;  2GBW B;  5D81 A;  1ZX2 A;  1US1 A;  3NBB A;  3I0Y A;  5EQL A;  4CDL A;  1EKM A;  2IUJ A;  3O8Y A;  4N6O B;  3Q90 A;  3KN4 A;  4K90 B;  1CYU A;  3V99 A;  1JN5 A;  2CFK A;  3RDE A;  1OHS A;  1W2Z A;  3AMO A;  3HK4 A;  5IG5 A;  1RKY A;  1U8C B;  1K73 4;  2ML6 A;  1JRQ A;  1IVU A;  1SIH A;  4Q53 A;  3LT9 A;  4FMB A;  3OWU A;  4K1U A;  4STD A;  3DGO A;  3H3H A;  4TX4 A;  1OF5 A;  3OXA A;  3DMC A;  3F8H A;  3SXX A;  3CCE 3;  1SQW A;  1O7G B;  3CC4 3;  1Q82 4;  2ZL8 A;  4I4K A;  3PGB A;  3WA3 A;  1GY6 A;  3G8Z A;  1N9E A;  1W02 A;  4MJD A;  3VF1 A;  4AKY A;  5A0O B;  3LYG A;  1OHP A;  4RNZ A;  3MG3 A;  3MPH A;  5LC7 A;  2CFW A;  3FG3 A;  2XF3 A;  3NQY A;  1DMM A;  1Q40 A;  1DMQ A;  4IPB A;  1IK3 A;  1CYV A;  4LMI A;  1ULI B;  2D1W A;  2STD A;  1GY5 A;  1QAK A;  1TIJ A;  1L5G B;  1M9G A;  3SED A;  5TGN A;  1VQM 3;  4MMZ B;  3DZL A;  3G71 3;  1D6Y A;  3MYT A;  5CK6 A;  6STD A;  3KSP A;  3CU3 A;  4GL6 A;  4HYZ A;  2IUK A;  3CD6 3;  4BTW A;  3MG2 A;  3MWZ A;  2P0M A;  5LC6 A;  1FA3 A;  3PCR A;  3FZW A;  2XSO B;  2PNC A;  1OGX A;  5I97 A;  3DY5 A;  3L0R A;  5IF6 A;  2XFT A;  2CG1 A;  2HMO B;  2Y73 A;  1N8R 4;  2CWV A;  1OUN A;  1W01 A;  1LNH A;  4EYC A;  4XDW A;  3PCS A;  1W5Z A;  1NO3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...