3NBRA

Crystal structure of ketosteroid isomerase d38np39gd99n from pseudomonas testosteroni (tksi) with 4-androstene-3,17-dione bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
NTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVENGVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPINHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Ketosteroid Isomerase D38NP39GD99N from Pseudomonas Testosteroni (tKSI) with 4-Androstene-3,17-dione Bound
rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
total genus 31
structure length 124
sequence length 124
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nbrA00
4LEHA 1JB4A 1SJWA 4ORLA 5FW5A 3MSOA 4X2OA 3F8XA 3F40A 3KSPA 3JUPA 2RCDA 4HM2B 4HM3B 4HZ9B 3CNXA 4R9KA 5AI1A 4PEJA 4FCMA 5AIIA 5D81A 2F86B 2HMJB 2K54A 2JQ5A 3FKAA 3OX9A 1IDPA 2R4IA 3GRDA 3EC9A 3DMCA 3HK4A 3M8CA 3F7SA 3MG3A 2YFJB 5IF6A 1UUWB 1OHOA 1E3RA 1Z1SA 4XBXA 5AEUB 3KZTA 4HM5B 1OF5B 1JKGA 1OGXA 4R9LA 5JPUA 3B8LA 5IEOA 5KP1A 5IG0A 3LZAA 1O7HB 2GXFA 1TP6A 4L7KA 4K1VA 2HMOB 3B4PA 3SOYA 1O7PB 3EBYA 3GZRA 3DZLA 1OHPA 3ROBA 1BUQA 3FSDA 3T8UA 5IG5A 5KP4A 3MHEA 4FCJA 2A15A 1JN5B 2UX0A 4IIAA 5D82A 4HJLB 2GEYA 2GEXA 1DMMA 2YFLB 2BNGA 3UJMA 4L8PA 5BXQA 4HM1B 3FH1A 5HGRA 5KP3A 2B24B 1EG9B 2Z7AA 3F7XA 4OVMA 1W00A 2GBXB 5AIGA 3K0ZA 4Q53A 7STDA 5DRVA 3GZBA 1Q40B 3EF8A 4OUQA 3BB9A 3B4OA 4U13A 2INXA 3EQQB 3DM8A 5IERA 3OWYA 4LMIA 1O7MB 4K1UA 1W02A 2BMRB 1GY7A 2QGUA 3EBTA 3F14A 4WWUC 3ECFA 3IPTA 4HM0B 3CU3A 3HX8A 3G16A 3STDA 2QIYA 2W2CA 3F8HA 4HM6B 5AEWB 2XSOB 3OXAA 1GYBA 2HMLB 1O7GB 3FZWA 1EA2A 1OF5A 1OH0A 1U5OA 1NDOB 2CKFB 2F98A 3B7CA 3DUKA 2Z77A 3EN8A 4L8OA 3NBRA 4WP5A 4XM4A 1DMQA 2B1XB 5EVHA 2F99A 2RGQA 1NWWA 3H3HA 4CDLA 4X2HA 1O7NB 3JUQA 4H3UA 5DREA 3MKIA 1STDA 3K7CA 3CPOA 2RFRA 2HMMB 2XRXB 3F9SA 3FF0A 4HM4B 1ASKA 2Z76A 1QMAA 3HZPA 5AIHA 2BMQB 1UUVB 5D83A 6STDA 5IEPA 2STDA 4XBTA 2BMOB 4XB5A 1OHSA 1AR0A 1JB5A 5CF2A 2GBWB 3EN1B 4XBYA 5IG4A 3NHXA 1OPYA 1ZO2A 1A2KA 1OUNA 4HM8B 3JUOA 4HZBB 4J9AA 1S5AA 1NU3A 3GZYB 5TGNA 3UNLA 1CQSA 4XDVA 3GZXB 5STDA 3S5CA 1Q40A 3GWRA 1HKXA 3DXOA 3G0KA 3EHCA 3OWUA 3RGRA 3FLJA 1K41A 3NM2A 3OV4A 5IENA 3Q90A 2XR8B 4MJDA 1C7HA 3FGYA 1ULJB 2PZVA 2XSHB 3G8ZA 4GB5A 3NUVA 4LGQA 2YFIB 5CK6A 1GY5A 3I0YA 4I4KA 2I9WA 5AIFA 4HM7B 5CF1A 4J8TA 3MG1A 1ISKA 2HMKB 3CNMA 5BVBA 3JUMA 3A76A 1JB2A 1Q42A 1TUHA 4HKVB 3D9RA 3VSYA 4R1KA 1OCVA 1ULIB 3MG2A 1O7WB 1QJGA 4RZMA 3H51A 4KVHA 5CLKA 5CXOA 3OWSA 2CHCA 1WQLB 3EX9A 2IMJA 3BLZA 3MYTA 4N3VA 3T8NA 5IG3A 1OGZA 4STDA 4XDWA 5JPPA 1JKGB 4WYKB 3RGAA 3SOAA 1GY6A 1E3VA 1W01A 3EJVA 4WYKA 3ER7A 1VZZA 1W6YA 3WMDA 2HMNB 2OWPA 3KE7A 3KKGA 1DMNA 3JUNA 1E97A 1JN5A 1ZX2A 5G2GA 1GS3A 3NV0B 3E99A 3VGNA 3LYGA 3SEDA 3NXJA 4HVNA 3NV0A 8CHOA 3FF2A
chains in the Genus database with same CATH superfamily
5IW9A 4ORLA 3MSOA 4K61A 4X2OA 2GU3A 3SXXA 4KZ1A 3DGOA 4HZ9B 2RCDA 4HM2B 3AMOB 3CCV3 1A2PA 1BAOA 2GU1A 5ELJA 4FCMA 3S29A 1D6ZA 1IDPA 1RLSA 4NHFA 3F7SA 4ILFA 1Q814 1OHOA 1AVLA 1AQZA 1Z1SA 3HIIA 4XBXA 5AEUB 1Q824 1BRGA 1I0XA 1JKGA 1OGXA 2RBIA 5KP1A 3D3LA 3HI7A 1O7HB 3D79A 1TP6A 4L7KA 1VQK3 2HMOB 5M1AA 4KFEA 3PXMA 1OHPA 1BUQA 1JZOA 3MHEA 1NB3I 2O3OA 4N6NB 2W9PA 1KWIA 1ZS7A 1RRLA 4L8PA 1LRAA 1MWUA 1YGWA 1UCIA 1X1UA 2CFGA 2B24B 5KP3A 1EG9B 1DETA 2Z7AA 3F7XA 4FMDA 1JJ22 3HIGA 3KCHA 1AY7A 3PZWA 1ZGXA 1PY3A 5EQLA 5DRVA 3GZBA 3LOYA 1BUJA 3PCRA 5LC7A 3V99A 3CXC2 3EQQB 1LVNA 3OWYA 4LMIA 2FNQA 1LOVA 4HOHA 1Y4KA 3SOAA 2QGUA 4BU4A 3CME3 3STDA 1QAFA 1DVDA 2Y73A 1RRHA 2XEPA 3D4AA 1I3FA 1X1WA 4G1MB 2XSOB 2HMLB 1IV7A 3RDEA 1RGGA 1EA2A 1KC84 1NDOB 2CKFB 3DUKA 1I0VA 2WGQA 2Z77A 2RNTA 3VF1A 5JPUA 1VQP3 1VQ93 4MMYB 5EVHA 2RGQA 4BTXA 2IA7A 3K7CA 1G0TA 3WOEB 1BSCA 2QA43 1GOVA 4HM4B 4K90B 4O3VA 3HZPA 2R41A 5AIHA 1D6YA 3CCU3 3NX0A 2W0QA 1X1YA 1RGEA 1IQYA 5CF2A 1BGSA 3EN1B 2CW9A 4XBYA 5G1LA 2RSXA 4LZIA 1BRJA 1I2EA 2Q07A 1BOXA 3CCL3 2OOVC 3WA2X 3GZYB 1NU3A 1JNQA 4BL2A 1GD4A 1JV2B 1VQ43 1IU7A 1B20A 5STDA 4EW5A 3TDGA 1T2HA 1HKXA 1LNHA 3G0KA 3NM2A 5I97A 1FUWA 1IVVA 2F56A 4IT7A 2CG0A 2PZVA 3G4S3 1BSAA 1JBSA 1NB5I 3NUVA 4LGQA 2YFIB 1Q864 1RKYA 1GOYA 1UCJA 4RNTA 1SIHA 7RNTA 4J8TA 3MG1A 3CNMA 1Q7HA 1IQ8A 5BVBA 1SIIA 1V58A 4N6V0 2KF6A 4HKVB 2OOVA 3D9RA 2XH9A 3VSYA 3MG2A 1I2GA 2OCTA 3N9HA 1QJGA 3H51A 2L1SA 2CHCA 2FXTA 2H0GA 3BNDA 2IMJA 3EX9A 3OWSA 4N3VA 3T8NA 1FGTA 4EXRA 5IG3A 5JPPA 5JBSA 1NJI4 4WYKB 3NQYA 3RGAA 1A67A 1CYUA 1S723 2OQEA 3ER7A 1VZZA 1FGRA 1TIJA 3WMDA 4EC6A 2OWPA 1BNJA 1DMNA 1GSPA 1E97A 1N8R4 2KRTA 5G2GA 3E99A 3KSED 3SEDA 1IV9A 3LMLA 3NM7A 3NXJA 3FF2A 4BTYA 1BIRA 3CCS3 2SARA 1RNBA 1JB4A 4O2HA 3KSPA 3JUPA 2KCDA 2CFLA 4FCZA 5IEOA 3CC23 2F86B 2HMJB 4FMCA 3OX9A 2R4IA 4U13A 1D6UA 2W04A 2XF3A 3DMCA 3M8CA 1VQO3 4NREA 1HZ1A 3Q2PA 1PFPA 1YGEA 1E3RA 2CWTA 1V57A 1BNFA 2E2TA 1OF5B 3CD63 3D5GA 3B8LA 9RNTA 4LYLB 1GOUA 3NBJA 5IG0A 1W5ZA 2YX9A 1M1XB 2PNCA 1FGQA 1DVCA 4KFDA 1LQMB 1SARA 1RN1A 1LOXA 1EKMA 4IIAA 4RNYA 2HOHA 1G96A 3OW22 5HOHA 2YFLB 2BHMA 2C11A 2CG1A 1YJN3 5M18A 4R4KA 3QK9A 4OVMA 2OQEC 1RCLA 1BNIA 3FG4A 4I5QA 3T0UA 1RNTA 4BIRA 1Q40B 3EF8A 1BNEA 2W03A 3B4OA 3DGYA 2FGTA 1YNVX 2IUJA 3LH4A 3EBTA 1B3SA 3F14A 3ECFA 2XFSA 3CU3A 3DGLA 2QIYA 2W2CA 1LQGC 3IMAB 1O7GB 1M1K4 1OF5A 1B2UA 3SOYA 1DE3A 2JDIH 2F4YA 2MF7A 1W7CA 2LQVA 3N54B 3NBRA 4WP5A 4XM4A 2F99A 2KF4A 4HBRA 2C4BA 4RNZA 8RNTA 4CDLA 4X2HA 2D42A 5DREA 2ZL8A 2RFRA 3L0RA 2HMMB 1U8CB 1UUGB 2XRXB 3F9SA 3KFQC 3X42A 1N5HA 1BSDA 2BMQB 1UUVB 1ROVA 5D83A 4BTWA 5IEPA 2BMOB 5A0OB 1OHSA 1OACA 3S27A 2V1LA 1RMSA 1MNLA 2O9UX 3URPA 1RDSA 1MWTA 1OPYA 1VQ83 2E2UA 1GMRA 2M7OA 4FR9A 4HM8B 1BRNL 3AGOA 4FMAA 4GSPA 1CQSA 3GZXB 3GWRA 1W2ZA 1LOWA 3OWUA 3RGRA 3OV4A 3DGNA 3PCSA 1FYSA 4AKZA 1B27A 2CWVA 2BT3A 1C7HA 4GB5A 1ULJB 3G8ZA 3PGBA 2BIRA 3AHWA 1SPUA 3CPW2 4AKYA 5CK6A 1GY5A 1GD3A 1LXEA 2WOHA 1TJDA 4WHAA 3U97A 2ML6A 2HMKB 1JRQA 3JUMA 1IT7A 2P0MA 3Q3FA 2BU4A 1ULIB 1L5GB 3AHSA 3IJEB 4KVHA 1BU4A 2CFKA 4TX4A 4NPBA 2CH9A 4J5KA 1OGZA 4STDA 4XDWA 1TRQA 1JKGB 3BNCA 1GY6A 1W01A 3EJVA 4JRFA 1Q9EA 1UGHI 3BNEA 3PS8A 2OTL3 3LTAA 1RTUA 4WFOA 3CMA3 4IPBA 3KE7A 3KKGA 2L4VA 2ZDJA 3CC73 1ZX2A 5EEOA 5IERA 1NNVA 1RGAA 3LTCA 1VQN3 1I2FA 2OTJ3 2CFDA 2W56B 5LC6A 3F8XA 1K28A 3F40A 1YI23 5D81A 3CNXA 2F5MA 4JF8A 4R9KA 5AIIA 3EB8A 1WMOA 2K54A 2JQ5A 3DY5A 1LNIA 3MG3A 3GRDA 5D82A 5IF6A 1UUWB 3Q1CA 1KSIA 1YIT3 1RGCA 3KZTA 4O8SA 1CEWI 1MGRA 1IVXA 1W6CA 3MPHA 1QALA 3WR2A 1O7PB 1FZUA 2KF5A 3NBBA 3DZLA 3T8UA 1M9GA 5KP4A 4CJNA 2A15A 1B2ZA 2QEX3 2GEYA 2GEXA 1V74A 3UJMA 1YVSA 3N8BA 5BXQA 5HGRA 1UI7A 4N6MA 1MWSA 1W00A 5AIGA 3WHOA 4N6UA 3K0ZA 4Q53A 5G1KA 4OUQA 1VQ63 3UL6A 2Y74A 3DM8A 3UL5A 2F5WA 1W02A 2KF3A 5ELUA 2BMRB 1GY7A 4EYCA 4WWUC 5AEWB 3G16A 3F8HA 4HM6B 3RNTA 3OXAA 3FZWA 3O8YA 1OH0A 1U5OA 3HK4A 2F98A 4GL6A 3B7CA 3EN8A 4L8OA 2W6JH 1A2VA 2MC8A 3X3XA 1BRKA 1DMQA 1NWWA 3S67A 2K3DA 1STDA 1TTOA 1UW1A 1BSBA 1X1XA 2P0XA 3FCSB 3HOHA 1ROAA 5M19A 3FF0A 3K63A 1ASKA 1QMAA 1LOYA 1T5YA 2STDA 4XB5A 1AR0A 2GBWB 3FG3A 2WOFA 1KQS2 3GSPA 1CYVA 2XGNA 1YIJ3 3LTBA 5TGNA 4J9AA 3X41A 1C54A 2CIUA 1BSEA 4XDVA 3X3ZA 3S5CA 1Q40A 4O02B 1N5PA 3FLJA 1K41A 4ZM8A 1TU5A 1MWRA 3MWZA 4LSOA 4MJDA 3X3YA 1RHLA 3FGYA 1TFKA 2XSHB 1EQKA 2H0HA 2P38A 3I0YA 3GAXA 4I4KA 2I9WA 4HM7B 5CF1A 2P05A 1RJOA 1VQQA 4FMBA 4DKIA 2E2VA 3A76A 1Q42A 1TUHA 2CK3H 2CX0A 2BO9B 1OCVA 3K5TA 4R1KA 4RZMA 5CLKA 5CXOA 4N6OB 6GSPA 4GHOA 3CCJ3 3PYJA 2CWUA 1VQ53 1B2XA 3BLZA 3LXUX 1T2IA 2GSPA 1M904 1BNSA 1E3VA 2ZA4A 3K9MC 4WYKA 1WMNA 3LT8A 2HMNB 3WA3A 3WODG 5RNTA 3ALAA 1JN5A 3SX1A 1GS3A 3NV0B 3VGNA 3LYGA 8CHOA 4HVNA 1BVIA 4KT3B 3SLUA 2CFWA 4LEHA 4EV2A 1YJ93 1SJWA 5FW5A 3FG1A 2W56A 4EBGA 1AVKA 4HM3B 2SBLA 5AI1A 3S28A 1IQXA 4PEJA 1UCLA 3FKAA 3J7Yd 5AYRB 5BU4A 1I70A 3EC9A 4QWTA 1VQM3 3EE1A 1WTHA 2YFJB 3CC43 3KIIA 2WO0A 3SYUA 1TRPA 2UGIA 1IVWA 4RBNA 3LT9A 4HM5B 1IYYA 4R9LA 3UB1A 3LZAA 1T3BA 2GXFA 1NO3A 3B4PA 4K1VA 1MOLA 3EBYA 3GZRA 4MMZB 6RNTA 3ZFZA 1UCKA 4MEIA 3CCE3 3ROBA 4CCVA 3FSDA 1US1A 5IG5A 1VQ73 4N6TA 1W4NA 2D1WA 1JN5B 1UDII 1B2SA 2UX0A 4FCJA 2IUKA 1N9EA 3D5IA 3KN4A 4HJLB 1BANA 1DMMA 7GSPA 2BNGA 1WMPA 4HM1B 3FH1A 3CCQ3 2ZHXB 4J5GA 4AEQA 1UGIA 1PYLA 3DH2A 1RGKA 3G713 3AMOA 2GBXB 1B2MA 1CH0A 1G02A 7STDA 1FGMA 1QVF2 1IVUA 1RN7A 1BNGA 1B21A 3BB9A 2INXA 3X40A 2KXGA 1RN4A 2AAEA 1O7MB 4K1UA 3I563 3LTDA 3CCR3 3JVCA 5AYSC 3DGMA 3IPTA 2WGOA 3HX8A 4HM0B 1GMQA 1ISKA 1QAKA 3V92A 1KD14 1GYBA 2KAAA 5IG4A 5AIFA 1K734 2C10A 1A90A 4R80A 3ZG5A 2B1XB 1YJW3 3H3HA 1RGFA 1RGLA 3SVAA 2J8XB 1O7NB 2P09A 2K0MA 2UUGC 3JUQA 3MKIA 4H3UA 1FA3A 3CPOA 1K8A4 1FUSA 4HAAA 2Z76A 6STDA 1TFOA 3V98A 4BL3A 1IT8A 1STFI 4XBTA 5BIRA 2XGLA 1HU9A 1YVBI 1AV4A 1JB5A 1N8QA 1WNHA 1UI8A 1R4CA 3NHXA 1FUTA 1ZO2A 1A2KA 1W6GA 2AADA 3A5EA 3G6E3 1OUNA 4HZBB 3JUOA 3UNLA 1S5AA 2Z6BA 3BIRA 4HYZA 1Q7Y4 1RGHA 1EEJA 3WDGB 3DXOA 1FGOA 3EHCA 3ZG0A 1IK3A 2CC3A 5IENA 1JBRA 1K9M4 1BRIA 3WOFB 3Q90A 2XR8B 3NQZA 3CCM3 1MGWA 1W2B2 1JZDA 1R4YA 1EUIC 1RSNA 1FW7A 1I3IA 3BNBA 1SQWA 3I553 4H61A 1JBTA 1F8NA 4CPKA 3BU4A 1J2BA 1JB2A 5FGOA 1BRHA 2XFTA 1I8VA 1BNRA 1O7WB 1BRSA 1WQLB 3MYTA 3AGNA 2H0IA 2IY2A 1GMPA 1RCKA 5GSPA 4EV5A 4N6LA 1W6YA 3U1WA 2LYXA 1PU4A 2IYJA 3JUNA 1VQL3 1QVG2 4MMXB 1YHQ3 2ML5A 2W9QA 4KFFA 1HYFA 3QRDA 4OK0A 3NV0A 1N9JA 2CX1A 1DYUA
chains in the Genus database with same CATH topology
5IW9A 4ORLA 3MSOA 4K61A 4X2OA 2GU3A 3SXXA 4KZ1A 3DGOA 4HZ9B 2RCDA 4HM2B 3AMOB 3CCV3 5ELJA 2GU1A 4FCMA 3S29A 1D6ZA 1IDPA 4NHFA 3F7SA 1Q814 1OHOA 1AVLA 1Z1SA 3HIIA 4XBXA 5AEUB 1Q824 1JKGA 1OGXA 5KP1A 3D3LA 3HI7A 1O7HB 1TP6A 4L7KA 1VQK3 2HMOB 4KFEA 3PXMA 1OHPA 1BUQA 3MHEA 1NB3I 2O3OA 4N6NB 2W9PA 1KWIA 1RRLA 4L8PA 5KP3A 2CFGA 2B24B 1EG9B 2Z7AA 3F7XA 4FMDA 1JJ22 3HIGA 3PZWA 5EQLA 5DRVA 3GZBA 3LOYA 3PCRA 5LC7A 3V99A 3CXC2 3EQQB 1LVNA 3OWYA 4LMIA 2FNQA 1Y4KA 3SOAA 2QGUA 3CME3 3STDA 1QAFA 1DVDA 2Y73A 1RRHA 2XEPA 4G1MB 2XSOB 2HMLB 1IV7A 3RDEA 1KC84 1EA2A 1NDOB 2CKFB 3DUKA 3VF1A 2WGQA 2Z77A 1VQP3 5JPUA 1VQ93 4MMYB 5EVHA 2RGQA 4BTXA 2IA7A 3K7CA 3WOEB 2QA43 4HM4B 4K90B 4O3VA 3HZPA 5AIHA 3CCU3 1D6YA 3NX0A 2W0QA 1IQYA 5CF2A 3EN1B 2CW9A 4XBYA 2RSXA 4LZIA 3CCL3 2Q07A 2OOVC 3WA2X 3GZYB 1NU3A 1JNQA 1GD4A 1JV2B 1VQ43 1IU7A 5STDA 3TDGA 1HKXA 1LNHA 3G0KA 3NM2A 5I97A 1FUWA 1IVVA 4IT7A 2CG0A 2PZVA 3G4S3 1NB5I 3NUVA 4LGQA 2YFIB 1Q864 1RKYA 1SIHA 4J8TA 3MG1A 3CNMA 5BVBA 1IQ8A 1SIIA 4N6V0 2OOVA 4HKVB 3D9RA 2XH9A 3VSYA 3MG2A 2OCTA 3N9HA 1QJGA 3H51A 3OWSA 2CHCA 2FXTA 3BNDA 3EX9A 2IMJA 3T8NA 5IG3A 4N3VA 5JPPA 1FGTA 4EXRA 1NJI4 5JBSA 4WYKB 3NQYA 3RGAA 1A67A 1CYUA 1S723 2OQEA 3ER7A 1VZZA 1FGRA 1TIJA 3WMDA 4EC6A 2OWPA 1DMNA 1E97A 1N8R4 2KRTA 5G2GA 3E99A 3KSED 3SEDA 1IV9A 3LMLA 3NM7A 3NXJA 3FF2A 4BTYA 3CCS3 1JB4A 4O2HA 3KSPA 3JUPA 2KCDA 2CFLA 4FCZA 5IEOA 3CC23 2F86B 2HMJB 4FMCA 3OX9A 2R4IA 4U13A 1D6UA 2W04A 2XF3A 3DMCA 3M8CA 1VQO3 4NREA 3Q2PA 1PFPA 1YGEA 1E3RA 2CWTA 2E2TA 1OF5B 3CD63 3B8LA 3NBJA 5IG0A 1W5ZA 2YX9A 1M1XB 2PNCA 1FGQA 1DVCA 4KFDA 1LOXA 1EKMA 4IIAA 4RNYA 1G96A 3OW22 2YFLB 2BHMA 2C11A 2CG1A 1YJN3 4R4KA 3QK9A 4OVMA 2OQEC 3FG4A 3T0UA 1Q40B 3EF8A 2W03A 3B4OA 2FGTA 2IUJA 3LH4A 3EBTA 3F14A 3ECFA 2XFSA 3CU3A 3DGLA 2QIYA 2W2CA 3IMAB 1O7GB 1M1K4 1OF5A 3SOYA 2JDIH 2MF7A 4WP5A 1W7CA 2LQVA 3N54B 3NBRA 4XM4A 2F99A 4HBRA 4RNZA 4CDLA 4X2HA 2D42A 5DREA 2ZL8A 2RFRA 3L0RA 2HMMB 1U8CB 2XRXB 3F9SA 3X42A 3KFQC 1N5HA 2BMQB 1UUVB 1ROVA 5D83A 4BTWA 5IEPA 2BMOB 5A0OB 1OHSA 1OACA 3S27A 2V1LA 1MNLA 2O9UX 1OPYA 1VQ83 2E2UA 2M7OA 4FR9A 4HM8B 4FMAA 1CQSA 3GZXB 3GWRA 1W2ZA 3OWUA 3RGRA 3OV4A 3DGNA 3PCSA 4AKZA 2CWVA 2BT3A 1C7HA 4GB5A 1ULJB 3G8ZA 3PGBA 1SPUA 3CPW2 4AKYA 5CK6A 1GY5A 1GD3A 1LXEA 2WOHA 4WHAA 3U97A 2ML6A 2HMKB 1JRQA 3JUMA 1IT7A 2P0MA 1ULIB 1L5GB 3IJEB 4KVHA 2CFKA 4TX4A 2CH9A 1OGZA 4STDA 4XDWA 1JKGB 3BNCA 1GY6A 1W01A 3EJVA 4JRFA 3BNEA 3PS8A 2OTL3 3LTAA 4WFOA 3CMA3 4IPBA 3KE7A 3KKGA 2L4VA 2ZDJA 3CC73 1ZX2A 5EEOA 5IERA 3LTCA 1VQN3 2OTJ3 2CFDA 2W56B 5LC6A 3F8XA 1K28A 3F40A 1YI23 5D81A 3CNXA 4JF8A 4R9KA 5AIIA 3EB8A 1WMOA 2K54A 2JQ5A 3DY5A 5D82A 3MG3A 3GRDA 5IF6A 1UUWB 3Q1CA 1KSIA 1YIT3 3KZTA 4O8SA 1CEWI 1IVXA 1W6CA 3MPHA 1QALA 1O7PB 3NBBA 3DZLA 3T8UA 1M9GA 5KP4A 2A15A 2QEX3 2GEYA 2GEXA 1V74A 3UJMA 3N8BA 5BXQA 5HGRA 1UI7A 4N6MA 1W00A 5AIGA 4N6UA 3K0ZA 4Q53A 4OUQA 1VQ63 3UL6A 2Y74A 3DM8A 3UL5A 1W02A 5ELUA 2BMRB 1GY7A 4EYCA 4WWUC 5AEWB 3G16A 3F8HA 4HM6B 3OXAA 3FZWA 3O8YA 1OH0A 1U5OA 3HK4A 2F98A 4GL6A 3B7CA 3EN8A 4L8OA 2W6JH 1A2VA 2MC8A 3X3XA 1DMQA 1NWWA 3S67A 1STDA 1UW1A 3FCSB 2P0XA 1ROAA 3FF0A 3K63A 1ASKA 1QMAA 1T5YA 2STDA 4XB5A 1AR0A 2GBWB 3FG3A 2WOFA 1KQS2 1CYVA 2XGNA 1YIJ3 3LTBA 5TGNA 4J9AA 3X41A 2CIUA 4XDVA 3X3ZA 3S5CA 1Q40A 4O02B 1N5PA 3FLJA 1K41A 4ZM8A 1TU5A 3MWZA 4LSOA 4MJDA 3X3YA 3FGYA 1TFKA 2XSHB 1EQKA 2P38A 3I0YA 3GAXA 4I4KA 2I9WA 4HM7B 5CF1A 2P05A 1RJOA 4FMBA 2E2VA 3A76A 1Q42A 1TUHA 2CK3H 4R1KA 2BO9B 1OCVA 3K5TA 4RZMA 5CLKA 5CXOA 1VQ53 4N6OB 3CCJ3 3PYJA 2CWUA 3BLZA 3LXUX 1M904 1E3VA 3K9MC 4WYKA 1WMNA 3LT8A 2HMNB 3WA3A 3WODG 3ALAA 1JN5A 3SX1A 1GS3A 3NV0B 3VGNA 3LYGA 8CHOA 4HVNA 3SLUA 2CFWA 4LEHA 4EV2A 1YJ93 1SJWA 5FW5A 3FG1A 2W56A 4EBGA 1AVKA 4HM3B 2SBLA 5AI1A 3S28A 1IQXA 4PEJA 3FKAA 3J7Yd 5AYRB 1VQM3 3EC9A 3CC43 4QWTA 3EE1A 1WTHA 2YFJB 3KIIA 2WO0A 1IVWA 4RBNA 3LT9A 4HM5B 4R9LA 3UB1A 3LZAA 2GXFA 1NO3A 3B4PA 4K1VA 1MOLA 3EBYA 3GZRA 4MMZB 3CCE3 4MEIA 3ROBA 4CCVA 3FSDA 1US1A 5IG5A 1VQ73 4N6TA 1W4NA 2D1WA 1JN5B 2UX0A 4FCJA 2IUKA 1N9EA 3KN4A 4HJLB 1DMMA 2BNGA 1WMPA 4HM1B 3FH1A 3CCQ3 4AEQA 3G713 3AMOA 2GBXB 7STDA 1FGMA 1QVF2 1IVUA 1RN7A 3BB9A 2INXA 3X40A 2KXGA 1O7MB 4K1UA 3I563 3LTDA 3CCR3 3JVCA 5AYSC 3DGMA 3IPTA 2WGOA 3HX8A 4HM0B 1ISKA 1QAKA 3V92A 1KD14 1GYBA 5IG4A 5AIFA 1K734 2C10A 1A90A 4R80A 2B1XB 1YJW3 3H3HA 3SVAA 1O7NB 2P09A 2K0MA 3JUQA 3MKIA 4H3UA 1FA3A 3CPOA 1K8A4 2Z76A 6STDA 1TFOA 3V98A 1IT8A 1STFI 4XBTA 2XGLA 1HU9A 1YVBI 1AV4A 1JB5A 1N8QA 1WNHA 1UI8A 1R4CA 3NHXA 1ZO2A 1A2KA 1W6GA 3G6E3 1OUNA 4HZBB 3JUOA 3UNLA 1S5AA 2Z6BA 4HYZA 1Q7Y4 3WDGB 3DXOA 1FGOA 3EHCA 1IK3A 2CC3A 5IENA 1K9M4 3WOFB 3Q90A 2XR8B 3NQZA 3CCM3 1W2B2 3BNBA 1SQWA 3I553 4H61A 1F8NA 1J2BA 1JB2A 5FGOA 2XFTA 1O7WB 1WQLB 3MYTA 4EV5A 4N6LA 1W6YA 3U1WA 2LYXA 1PU4A 3JUNA 1VQL3 1QVG2 4MMXB 1YHQ3 2ML5A 2W9QA 4KFFA 3QRDA 4OK0A 3NV0A 1N9JA 1DYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LEH A;  1JB4 A;  1SJW A;  4ORL A;  5FW5 A;  3MSO A;  4X2O A;  3F8X A;  3F40 A;  3KSP A;  3JUP A;  2RCD A;  4HM2 B;  4HM3 B;  4HZ9 B;  3CNX A;  4R9K A;  5AI1 A;  4PEJ A;  4FCM A;  5AII A;  5D81 A;  2F86 B;  2HMJ B;  2K54 A;  2JQ5 A;  3FKA A;  3OX9 A;  1IDP A;  2R4I A;  3GRD A;  3EC9 A;  3DMC A;  3HK4 A;  3M8C A;  3F7S A;  3MG3 A;  2YFJ B;  5IF6 A;  1UUW B;  1OHO A;  1E3R A;  1Z1S A;  4XBX A;  5AEU B;  3KZT A;  4HM5 B;  1OF5 B;  1JKG A;  1OGX A;  4R9L A;  5JPU A;  3B8L A;  5IEO A;  5KP1 A;  5IG0 A;  3LZA A;  1O7H B;  2GXF A;  1TP6 A;  4L7K A;  4K1V A;  2HMO B;  3B4P A;  3SOY A;  1O7P B;  3EBY A;  3GZR A;  3DZL A;  1OHP A;  3ROB A;  1BUQ A;  3FSD A;  3T8U A;  5IG5 A;  5KP4 A;  3MHE A;  4FCJ A;  2A15 A;  1JN5 B;  2UX0 A;  4IIA A;  5D82 A;  4HJL B;  2GEY A;  2GEX A;  1DMM A;  2YFL B;  2BNG A;  3UJM A;  4L8P A;  5BXQ A;  4HM1 B;  3FH1 A;  5HGR A;  5KP3 A;  2B24 B;  1EG9 B;  2Z7A A;  3F7X A;  4OVM A;  1W00 A;  2GBX B;  5AIG A;  3K0Z A;  4Q53 A;  7STD A;  5DRV A;  3GZB A;  1Q40 B;  3EF8 A;  4OUQ A;  3BB9 A;  3B4O A;  4U13 A;  2INX A;  3EQQ B;  3DM8 A;  5IER A;  3OWY A;  4LMI A;  1O7M B;  4K1U A;  1W02 A;  2BMR B;  1GY7 A;  2QGU A;  3EBT A;  3F14 A;  4WWU C;  3ECF A;  3IPT A;  4HM0 B;  3CU3 A;  3HX8 A;  3G16 A;  3STD A;  2QIY A;  2W2C A;  3F8H A;  4HM6 B;  5AEW B;  2XSO B;  3OXA A;  1GYB A;  2HML B;  1O7G B;  3FZW A;  1EA2 A;  1OF5 A;  1OH0 A;  1U5O A;  1NDO B;  2CKF B;  2F98 A;  3B7C A;  3DUK A;  2Z77 A;  3EN8 A;  4L8O A;  3NBR A;  4WP5 A;  4XM4 A;  1DMQ A;  2B1X B;  5EVH A;  2F99 A;  2RGQ A;  1NWW A;  3H3H A;  4CDL A;  4X2H A;  1O7N B;  3JUQ A;  4H3U A;  5DRE A;  3MKI A;  1STD A;  3K7C A;  3CPO A;  2RFR A;  2HMM B;  2XRX B;  3F9S A;  3FF0 A;  4HM4 B;  1ASK A;  2Z76 A;  1QMA A;  3HZP A;  5AIH A;  2BMQ B;  1UUV B;  5D83 A;  6STD A;  5IEP A;  2STD A;  4XBT A;  2BMO B;  4XB5 A;  1OHS A;  1AR0 A;  1JB5 A;  5CF2 A;  2GBW B;  3EN1 B;  4XBY A;  5IG4 A;  3NHX A;  1OPY A;  1ZO2 A;  1A2K A;  1OUN A;  4HM8 B;  3JUO A;  4HZB B;  4J9A A;  1S5A A;  1NU3 A;  3GZY B;  5TGN A;  3UNL A;  1CQS A;  4XDV A;  3GZX B;  5STD A;  3S5C A;  1Q40 A;  3GWR A;  1HKX A;  3DXO A;  3G0K A;  3EHC A;  3OWU A;  3RGR A;  3FLJ A;  1K41 A;  3NM2 A;  3OV4 A;  5IEN A;  3Q90 A;  2XR8 B;  4MJD A;  1C7H A;  3FGY A;  1ULJ B;  2PZV A;  2XSH B;  3G8Z A;  4GB5 A;  3NUV A;  4LGQ A;  2YFI B;  5CK6 A;  1GY5 A;  3I0Y A;  4I4K A;  2I9W A;  5AIF A;  4HM7 B;  5CF1 A;  4J8T A;  3MG1 A;  1ISK A;  2HMK B;  3CNM A;  5BVB A;  3JUM A;  3A76 A;  1JB2 A;  1Q42 A;  1TUH A;  4HKV B;  3D9R A;  3VSY A;  4R1K A;  1OCV A;  1ULI B;  3MG2 A;  1O7W B;  1QJG A;  4RZM A;  3H51 A;  4KVH A;  5CLK A;  5CXO A;  3OWS A;  2CHC A;  1WQL B;  3EX9 A;  2IMJ A;  3BLZ A;  3MYT A;  4N3V A;  3T8N A;  5IG3 A;  1OGZ A;  4STD A;  4XDW A;  5JPP A;  1JKG B;  4WYK B;  3RGA A;  3SOA A;  1GY6 A;  1E3V A;  1W01 A;  3EJV A;  4WYK A;  3ER7 A;  1VZZ A;  1W6Y A;  3WMD A;  2HMN B;  2OWP A;  3KE7 A;  3KKG A;  1DMN A;  3JUN A;  1E97 A;  1JN5 A;  1ZX2 A;  5G2G A;  1GS3 A;  3NV0 B;  3E99 A;  3VGN A;  3LYG A;  3SED A;  3NXJ A;  4HVN A;  3NV0 A;  8CHO A;  3FF2 A; 
#chains in the Genus database with same CATH topology
 5IW9 A;  4ORL A;  3MSO A;  4K61 A;  4X2O A;  2GU3 A;  3SXX A;  4KZ1 A;  3DGO A;  4HZ9 B;  2RCD A;  4HM2 B;  3AMO B;  3CCV 3;  1A2P A;  1BAO A;  2GU1 A;  5ELJ A;  4FCM A;  3S29 A;  1D6Z A;  1IDP A;  1RLS A;  4NHF A;  3F7S A;  4ILF A;  1Q81 4;  1OHO A;  1AVL A;  1AQZ A;  1Z1S A;  3HII A;  4XBX A;  5AEU B;  1Q82 4;  1BRG A;  1I0X A;  1JKG A;  1OGX A;  2RBI A;  5KP1 A;  3D3L A;  3HI7 A;  1O7H B;  3D79 A;  1TP6 A;  4L7K A;  1VQK 3;  2HMO B;  5M1A A;  4KFE A;  3PXM A;  1OHP A;  1BUQ A;  1JZO A;  3MHE A;  1NB3 I;  2O3O A;  4N6N B;  2W9P A;  1KWI A;  1ZS7 A;  1RRL A;  4L8P A;  1LRA A;  1MWU A;  1YGW A;  1UCI A;  1X1U A;  2CFG A;  2B24 B;  5KP3 A;  1EG9 B;  1DET A;  2Z7A A;  3F7X A;  4FMD A;  1JJ2 2;  3HIG A;  3KCH A;  1AY7 A;  3PZW A;  1ZGX A;  1PY3 A;  5EQL A;  5DRV A;  3GZB A;  3LOY A;  1BUJ A;  3PCR A;  5LC7 A;  3V99 A;  3CXC 2;  3EQQ B;  1LVN A;  3OWY A;  4LMI A;  2FNQ A;  1LOV A;  4HOH A;  1Y4K A;  3SOA A;  2QGU A;  4BU4 A;  3CME 3;  3STD A;  1QAF A;  1DVD A;  2Y73 A;  1RRH A;  2XEP A;  3D4A A;  1I3F A;  1X1W A;  4G1M B;  2XSO B;  2HML B;  1IV7 A;  3RDE A;  1RGG A;  1EA2 A;  1KC8 4;  1NDO B;  2CKF B;  3DUK A;  1I0V A;  2WGQ A;  2Z77 A;  2RNT A;  3VF1 A;  5JPU A;  1VQP 3;  1VQ9 3;  4MMY B;  5EVH A;  2RGQ A;  4BTX A;  2IA7 A;  3K7C A;  1G0T A;  3WOE B;  1BSC A;  2QA4 3;  1GOV A;  4HM4 B;  4K90 B;  4O3V A;  3HZP A;  2R41 A;  5AIH A;  1D6Y A;  3CCU 3;  3NX0 A;  2W0Q A;  1X1Y A;  1RGE A;  1IQY A;  5CF2 A;  1BGS A;  3EN1 B;  2CW9 A;  4XBY A;  5G1L A;  2RSX A;  4LZI A;  1BRJ A;  1I2E A;  2Q07 A;  1BOX A;  3CCL 3;  2OOV C;  3WA2 X;  3GZY B;  1NU3 A;  1JNQ A;  4BL2 A;  1GD4 A;  1JV2 B;  1VQ4 3;  1IU7 A;  1B20 A;  5STD A;  4EW5 A;  3TDG A;  1T2H A;  1HKX A;  1LNH A;  3G0K A;  3NM2 A;  5I97 A;  1FUW A;  1IVV A;  2F56 A;  4IT7 A;  2CG0 A;  2PZV A;  3G4S 3;  1BSA A;  1JBS A;  1NB5 I;  3NUV A;  4LGQ A;  2YFI B;  1Q86 4;  1RKY A;  1GOY A;  1UCJ A;  4RNT A;  1SIH A;  7RNT A;  4J8T A;  3MG1 A;  3CNM A;  1Q7H A;  1IQ8 A;  5BVB A;  1SII A;  1V58 A;  4N6V 0;  2KF6 A;  4HKV B;  2OOV A;  3D9R A;  2XH9 A;  3VSY A;  3MG2 A;  1I2G A;  2OCT A;  3N9H A;  1QJG A;  3H51 A;  2L1S A;  2CHC A;  2FXT A;  2H0G A;  3BND A;  2IMJ A;  3EX9 A;  3OWS A;  4N3V A;  3T8N A;  1FGT A;  4EXR A;  5IG3 A;  5JPP A;  5JBS A;  1NJI 4;  4WYK B;  3NQY A;  3RGA A;  1A67 A;  1CYU A;  1S72 3;  2OQE A;  3ER7 A;  1VZZ A;  1FGR A;  1TIJ A;  3WMD A;  4EC6 A;  2OWP A;  1BNJ A;  1DMN A;  1GSP A;  1E97 A;  1N8R 4;  2KRT A;  5G2G A;  3E99 A;  3KSE D;  3SED A;  1IV9 A;  3LML A;  3NM7 A;  3NXJ A;  3FF2 A;  4BTY A;  1BIR A;  3CCS 3;  2SAR A;  1RNB A;  1JB4 A;  4O2H A;  3KSP A;  3JUP A;  2KCD A;  2CFL A;  4FCZ A;  5IEO A;  3CC2 3;  2F86 B;  2HMJ B;  4FMC A;  3OX9 A;  2R4I A;  4U13 A;  1D6U A;  2W04 A;  2XF3 A;  3DMC A;  3M8C A;  1VQO 3;  4NRE A;  1HZ1 A;  3Q2P A;  1PFP A;  1YGE A;  1E3R A;  2CWT A;  1V57 A;  1BNF A;  2E2T A;  1OF5 B;  3CD6 3;  3D5G A;  3B8L A;  9RNT A;  4LYL B;  1GOU A;  3NBJ A;  5IG0 A;  1W5Z A;  2YX9 A;  1M1X B;  2PNC A;  1FGQ A;  1DVC A;  4KFD A;  1LQM B;  1SAR A;  1RN1 A;  1LOX A;  1EKM A;  4IIA A;  4RNY A;  2HOH A;  1G96 A;  3OW2 2;  5HOH A;  2YFL B;  2BHM A;  2C11 A;  2CG1 A;  1YJN 3;  5M18 A;  4R4K A;  3QK9 A;  4OVM A;  2OQE C;  1RCL A;  1BNI A;  3FG4 A;  4I5Q A;  3T0U A;  1RNT A;  4BIR A;  1Q40 B;  3EF8 A;  1BNE A;  2W03 A;  3B4O A;  3DGY A;  2FGT A;  1YNV X;  2IUJ A;  3LH4 A;  3EBT A;  1B3S A;  3F14 A;  3ECF A;  2XFS A;  3CU3 A;  3DGL A;  2QIY A;  2W2C A;  1LQG C;  3IMA B;  1O7G B;  1M1K 4;  1OF5 A;  1B2U A;  3SOY A;  1DE3 A;  2JDI H;  2F4Y A;  2MF7 A;  1W7C A;  2LQV A;  3N54 B;  3NBR A;  4WP5 A;  4XM4 A;  2F99 A;  2KF4 A;  4HBR A;  2C4B A;  4RNZ A;  8RNT A;  4CDL A;  4X2H A;  2D42 A;  5DRE A;  2ZL8 A;  2RFR A;  3L0R A;  2HMM B;  1U8C B;  1UUG B;  2XRX B;  3F9S A;  3KFQ C;  3X42 A;  1N5H A;  1BSD A;  2BMQ B;  1UUV B;  1ROV A;  5D83 A;  4BTW A;  5IEP A;  2BMO B;  5A0O B;  1OHS A;  1OAC A;  3S27 A;  2V1L A;  1RMS A;  1MNL A;  2O9U X;  3URP A;  1RDS A;  1MWT A;  1OPY A;  1VQ8 3;  2E2U A;  1GMR A;  2M7O A;  4FR9 A;  4HM8 B;  1BRN L;  3AGO A;  4FMA A;  4GSP A;  1CQS A;  3GZX B;  3GWR A;  1W2Z A;  1LOW A;  3OWU A;  3RGR A;  3OV4 A;  3DGN A;  3PCS A;  1FYS A;  4AKZ A;  1B27 A;  2CWV A;  2BT3 A;  1C7H A;  4GB5 A;  1ULJ B;  3G8Z A;  3PGB A;  2BIR A;  3AHW A;  1SPU A;  3CPW 2;  4AKY A;  5CK6 A;  1GY5 A;  1GD3 A;  1LXE A;  2WOH A;  1TJD A;  4WHA A;  3U97 A;  2ML6 A;  2HMK B;  1JRQ A;  3JUM A;  1IT7 A;  2P0M A;  3Q3F A;  2BU4 A;  1ULI B;  1L5G B;  3AHS A;  3IJE B;  4KVH A;  1BU4 A;  2CFK A;  4TX4 A;  4NPB A;  2CH9 A;  4J5K A;  1OGZ A;  4STD A;  4XDW A;  1TRQ A;  1JKG B;  3BNC A;  1GY6 A;  1W01 A;  3EJV A;  4JRF A;  1Q9E A;  1UGH I;  3BNE A;  3PS8 A;  2OTL 3;  3LTA A;  1RTU A;  4WFO A;  3CMA 3;  4IPB A;  3KE7 A;  3KKG A;  2L4V A;  2ZDJ A;  3CC7 3;  1ZX2 A;  5EEO A;  5IER A;  1NNV A;  1RGA A;  3LTC A;  1VQN 3;  1I2F A;  2OTJ 3;  2CFD A;  2W56 B;  5LC6 A;  3F8X A;  1K28 A;  3F40 A;  1YI2 3;  5D81 A;  3CNX A;  2F5M A;  4JF8 A;  4R9K A;  5AII A;  3EB8 A;  1WMO A;  2K54 A;  2JQ5 A;  3DY5 A;  1LNI A;  3MG3 A;  3GRD A;  5D82 A;  5IF6 A;  1UUW B;  3Q1C A;  1KSI A;  1YIT 3;  1RGC A;  3KZT A;  4O8S A;  1CEW I;  1MGR A;  1IVX A;  1W6C A;  3MPH A;  1QAL A;  3WR2 A;  1O7P B;  1FZU A;  2KF5 A;  3NBB A;  3DZL A;  3T8U A;  1M9G A;  5KP4 A;  4CJN A;  2A15 A;  1B2Z A;  2QEX 3;  2GEY A;  2GEX A;  1V74 A;  3UJM A;  1YVS A;  3N8B A;  5BXQ A;  5HGR A;  1UI7 A;  4N6M A;  1MWS A;  1W00 A;  5AIG A;  3WHO A;  4N6U A;  3K0Z A;  4Q53 A;  5G1K A;  4OUQ A;  1VQ6 3;  3UL6 A;  2Y74 A;  3DM8 A;  3UL5 A;  2F5W A;  1W02 A;  2KF3 A;  5ELU A;  2BMR B;  1GY7 A;  4EYC A;  4WWU C;  5AEW B;  3G16 A;  3F8H A;  4HM6 B;  3RNT A;  3OXA A;  3FZW A;  3O8Y A;  1OH0 A;  1U5O A;  3HK4 A;  2F98 A;  4GL6 A;  3B7C A;  3EN8 A;  4L8O A;  2W6J H;  1A2V A;  2MC8 A;  3X3X A;  1BRK A;  1DMQ A;  1NWW A;  3S67 A;  2K3D A;  1STD A;  1TTO A;  1UW1 A;  1BSB A;  1X1X A;  2P0X A;  3FCS B;  3HOH A;  1ROA A;  5M19 A;  3FF0 A;  3K63 A;  1ASK A;  1QMA A;  1LOY A;  1T5Y A;  2STD A;  4XB5 A;  1AR0 A;  2GBW B;  3FG3 A;  2WOF A;  1KQS 2;  3GSP A;  1CYV A;  2XGN A;  1YIJ 3;  3LTB A;  5TGN A;  4J9A A;  3X41 A;  1C54 A;  2CIU A;  1BSE A;  4XDV A;  3X3Z A;  3S5C A;  1Q40 A;  4O02 B;  1N5P A;  3FLJ A;  1K41 A;  4ZM8 A;  1TU5 A;  1MWR A;  3MWZ A;  4LSO A;  4MJD A;  3X3Y A;  1RHL A;  3FGY A;  1TFK A;  2XSH B;  1EQK A;  2H0H A;  2P38 A;  3I0Y A;  3GAX A;  4I4K A;  2I9W A;  4HM7 B;  5CF1 A;  2P05 A;  1RJO A;  1VQQ A;  4FMB A;  4DKI A;  2E2V A;  3A76 A;  1Q42 A;  1TUH A;  2CK3 H;  2CX0 A;  2BO9 B;  1OCV A;  3K5T A;  4R1K A;  4RZM A;  5CLK A;  5CXO A;  4N6O B;  6GSP A;  4GHO A;  3CCJ 3;  3PYJ A;  2CWU A;  1VQ5 3;  1B2X A;  3BLZ A;  3LXU X;  1T2I A;  2GSP A;  1M90 4;  1BNS A;  1E3V A;  2ZA4 A;  3K9M C;  4WYK A;  1WMN A;  3LT8 A;  2HMN B;  3WA3 A;  3WOD G;  5RNT A;  3ALA A;  1JN5 A;  3SX1 A;  1GS3 A;  3NV0 B;  3VGN A;  3LYG A;  8CHO A;  4HVN A;  1BVI A;  4KT3 B;  3SLU A;  2CFW A;  4LEH A;  4EV2 A;  1YJ9 3;  1SJW A;  5FW5 A;  3FG1 A;  2W56 A;  4EBG A;  1AVK A;  4HM3 B;  2SBL A;  5AI1 A;  3S28 A;  1IQX A;  4PEJ A;  1UCL A;  3FKA A;  3J7Y d;  5AYR B;  5BU4 A;  1I70 A;  3EC9 A;  4QWT A;  1VQM 3;  3EE1 A;  1WTH A;  2YFJ B;  3CC4 3;  3KII A;  2WO0 A;  3SYU A;  1TRP A;  2UGI A;  1IVW A;  4RBN A;  3LT9 A;  4HM5 B;  1IYY A;  4R9L A;  3UB1 A;  3LZA A;  1T3B A;  2GXF A;  1NO3 A;  3B4P A;  4K1V A;  1MOL A;  3EBY A;  3GZR A;  4MMZ B;  6RNT A;  3ZFZ A;  1UCK A;  4MEI A;  3CCE 3;  3ROB A;  4CCV A;  3FSD A;  1US1 A;  5IG5 A;  1VQ7 3;  4N6T A;  1W4N A;  2D1W A;  1JN5 B;  1UDI I;  1B2S A;  2UX0 A;  4FCJ A;  2IUK A;  1N9E A;  3D5I A;  3KN4 A;  4HJL B;  1BAN A;  1DMM A;  7GSP A;  2BNG A;  1WMP A;  4HM1 B;  3FH1 A;  3CCQ 3;  2ZHX B;  4J5G A;  4AEQ A;  1UGI A;  1PYL A;  3DH2 A;  1RGK A;  3G71 3;  3AMO A;  2GBX B;  1B2M A;  1CH0 A;  1G02 A;  7STD A;  1FGM A;  1QVF 2;  1IVU A;  1RN7 A;  1BNG A;  1B21 A;  3BB9 A;  2INX A;  3X40 A;  2KXG A;  1RN4 A;  2AAE A;  1O7M B;  4K1U A;  3I56 3;  3LTD A;  3CCR 3;  3JVC A;  5AYS C;  3DGM A;  3IPT A;  2WGO A;  3HX8 A;  4HM0 B;  1GMQ A;  1ISK A;  1QAK A;  3V92 A;  1KD1 4;  1GYB A;  2KAA A;  5IG4 A;  5AIF A;  1K73 4;  2C10 A;  1A90 A;  4R80 A;  3ZG5 A;  2B1X B;  1YJW 3;  3H3H A;  1RGF A;  1RGL A;  3SVA A;  2J8X B;  1O7N B;  2P09 A;  2K0M A;  2UUG C;  3JUQ A;  3MKI A;  4H3U A;  1FA3 A;  3CPO A;  1K8A 4;  1FUS A;  4HAA A;  2Z76 A;  6STD A;  1TFO A;  3V98 A;  4BL3 A;  1IT8 A;  1STF I;  4XBT A;  5BIR A;  2XGL A;  1HU9 A;  1YVB I;  1AV4 A;  1JB5 A;  1N8Q A;  1WNH A;  1UI8 A;  1R4C A;  3NHX A;  1FUT A;  1ZO2 A;  1A2K A;  1W6G A;  2AAD A;  3A5E A;  3G6E 3;  1OUN A;  4HZB B;  3JUO A;  3UNL A;  1S5A A;  2Z6B A;  3BIR A;  4HYZ A;  1Q7Y 4;  1RGH A;  1EEJ A;  3WDG B;  3DXO A;  1FGO A;  3EHC A;  3ZG0 A;  1IK3 A;  2CC3 A;  5IEN A;  1JBR A;  1K9M 4;  1BRI A;  3WOF B;  3Q90 A;  2XR8 B;  3NQZ A;  3CCM 3;  1MGW A;  1W2B 2;  1JZD A;  1R4Y A;  1EUI C;  1RSN A;  1FW7 A;  1I3I A;  3BNB A;  1SQW A;  3I55 3;  4H61 A;  1JBT A;  1F8N A;  4CPK A;  3BU4 A;  1J2B A;  1JB2 A;  5FGO A;  1BRH A;  2XFT A;  1I8V A;  1BNR A;  1O7W B;  1BRS A;  1WQL B;  3MYT A;  3AGN A;  2H0I A;  2IY2 A;  1GMP A;  1RCK A;  5GSP A;  4EV5 A;  4N6L A;  1W6Y A;  3U1W A;  2LYX A;  1PU4 A;  2IYJ A;  3JUN A;  1VQL 3;  1QVG 2;  4MMX B;  1YHQ 3;  2ML5 A;  2W9Q A;  4KFF A;  1HYF A;  3QRD A;  4OK0 A;  3NV0 A;  1N9J A;  2CX1 A;  1DYU A; 
#chains in the Genus database with same CATH homology
 5IW9 A;  4ORL A;  3MSO A;  4K61 A;  4X2O A;  2GU3 A;  3SXX A;  4KZ1 A;  3DGO A;  4HZ9 B;  2RCD A;  4HM2 B;  3AMO B;  3CCV 3;  5ELJ A;  2GU1 A;  4FCM A;  3S29 A;  1D6Z A;  1IDP A;  4NHF A;  3F7S A;  1Q81 4;  1OHO A;  1AVL A;  1Z1S A;  3HII A;  4XBX A;  5AEU B;  1Q82 4;  1JKG A;  1OGX A;  5KP1 A;  3D3L A;  3HI7 A;  1O7H B;  1TP6 A;  4L7K A;  1VQK 3;  2HMO B;  4KFE A;  3PXM A;  1OHP A;  1BUQ A;  3MHE A;  1NB3 I;  2O3O A;  4N6N B;  2W9P A;  1KWI A;  1RRL A;  4L8P A;  5KP3 A;  2CFG A;  2B24 B;  1EG9 B;  2Z7A A;  3F7X A;  4FMD A;  1JJ2 2;  3HIG A;  3PZW A;  5EQL A;  5DRV A;  3GZB A;  3LOY A;  3PCR A;  5LC7 A;  3V99 A;  3CXC 2;  3EQQ B;  1LVN A;  3OWY A;  4LMI A;  2FNQ A;  1Y4K A;  3SOA A;  2QGU A;  3CME 3;  3STD A;  1QAF A;  1DVD A;  2Y73 A;  1RRH A;  2XEP A;  4G1M B;  2XSO B;  2HML B;  1IV7 A;  3RDE A;  1KC8 4;  1EA2 A;  1NDO B;  2CKF B;  3DUK A;  3VF1 A;  2WGQ A;  2Z77 A;  1VQP 3;  5JPU A;  1VQ9 3;  4MMY B;  5EVH A;  2RGQ A;  4BTX A;  2IA7 A;  3K7C A;  3WOE B;  2QA4 3;  4HM4 B;  4K90 B;  4O3V A;  3HZP A;  5AIH A;  3CCU 3;  1D6Y A;  3NX0 A;  2W0Q A;  1IQY A;  5CF2 A;  3EN1 B;  2CW9 A;  4XBY A;  2RSX A;  4LZI A;  3CCL 3;  2Q07 A;  2OOV C;  3WA2 X;  3GZY B;  1NU3 A;  1JNQ A;  1GD4 A;  1JV2 B;  1VQ4 3;  1IU7 A;  5STD A;  3TDG A;  1HKX A;  1LNH A;  3G0K A;  3NM2 A;  5I97 A;  1FUW A;  1IVV A;  4IT7 A;  2CG0 A;  2PZV A;  3G4S 3;  1NB5 I;  3NUV A;  4LGQ A;  2YFI B;  1Q86 4;  1RKY A;  1SIH A;  4J8T A;  3MG1 A;  3CNM A;  5BVB A;  1IQ8 A;  1SII A;  4N6V 0;  2OOV A;  4HKV B;  3D9R A;  2XH9 A;  3VSY A;  3MG2 A;  2OCT A;  3N9H A;  1QJG A;  3H51 A;  3OWS A;  2CHC A;  2FXT A;  3BND A;  3EX9 A;  2IMJ A;  3T8N A;  5IG3 A;  4N3V A;  5JPP A;  1FGT A;  4EXR A;  1NJI 4;  5JBS A;  4WYK B;  3NQY A;  3RGA A;  1A67 A;  1CYU A;  1S72 3;  2OQE A;  3ER7 A;  1VZZ A;  1FGR A;  1TIJ A;  3WMD A;  4EC6 A;  2OWP A;  1DMN A;  1E97 A;  1N8R 4;  2KRT A;  5G2G A;  3E99 A;  3KSE D;  3SED A;  1IV9 A;  3LML A;  3NM7 A;  3NXJ A;  3FF2 A;  4BTY A;  3CCS 3;  1JB4 A;  4O2H A;  3KSP A;  3JUP A;  2KCD A;  2CFL A;  4FCZ A;  5IEO A;  3CC2 3;  2F86 B;  2HMJ B;  4FMC A;  3OX9 A;  2R4I A;  4U13 A;  1D6U A;  2W04 A;  2XF3 A;  3DMC A;  3M8C A;  1VQO 3;  4NRE A;  3Q2P A;  1PFP A;  1YGE A;  1E3R A;  2CWT A;  2E2T A;  1OF5 B;  3CD6 3;  3B8L A;  3NBJ A;  5IG0 A;  1W5Z A;  2YX9 A;  1M1X B;  2PNC A;  1FGQ A;  1DVC A;  4KFD A;  1LOX A;  1EKM A;  4IIA A;  4RNY A;  1G96 A;  3OW2 2;  2YFL B;  2BHM A;  2C11 A;  2CG1 A;  1YJN 3;  4R4K A;  3QK9 A;  4OVM A;  2OQE C;  3FG4 A;  3T0U A;  1Q40 B;  3EF8 A;  2W03 A;  3B4O A;  2FGT A;  2IUJ A;  3LH4 A;  3EBT A;  3F14 A;  3ECF A;  2XFS A;  3CU3 A;  3DGL A;  2QIY A;  2W2C A;  3IMA B;  1O7G B;  1M1K 4;  1OF5 A;  3SOY A;  2JDI H;  2MF7 A;  4WP5 A;  1W7C A;  2LQV A;  3N54 B;  3NBR A;  4XM4 A;  2F99 A;  4HBR A;  4RNZ A;  4CDL A;  4X2H A;  2D42 A;  5DRE A;  2ZL8 A;  2RFR A;  3L0R A;  2HMM B;  1U8C B;  2XRX B;  3F9S A;  3X42 A;  3KFQ C;  1N5H A;  2BMQ B;  1UUV B;  1ROV A;  5D83 A;  4BTW A;  5IEP A;  2BMO B;  5A0O B;  1OHS A;  1OAC A;  3S27 A;  2V1L A;  1MNL A;  2O9U X;  1OPY A;  1VQ8 3;  2E2U A;  2M7O A;  4FR9 A;  4HM8 B;  4FMA A;  1CQS A;  3GZX B;  3GWR A;  1W2Z A;  3OWU A;  3RGR A;  3OV4 A;  3DGN A;  3PCS A;  4AKZ A;  2CWV A;  2BT3 A;  1C7H A;  4GB5 A;  1ULJ B;  3G8Z A;  3PGB A;  1SPU A;  3CPW 2;  4AKY A;  5CK6 A;  1GY5 A;  1GD3 A;  1LXE A;  2WOH A;  4WHA A;  3U97 A;  2ML6 A;  2HMK B;  1JRQ A;  3JUM A;  1IT7 A;  2P0M A;  1ULI B;  1L5G B;  3IJE B;  4KVH A;  2CFK A;  4TX4 A;  2CH9 A;  1OGZ A;  4STD A;  4XDW A;  1JKG B;  3BNC A;  1GY6 A;  1W01 A;  3EJV A;  4JRF A;  3BNE A;  3PS8 A;  2OTL 3;  3LTA A;  4WFO A;  3CMA 3;  4IPB A;  3KE7 A;  3KKG A;  2L4V A;  2ZDJ A;  3CC7 3;  1ZX2 A;  5EEO A;  5IER A;  3LTC A;  1VQN 3;  2OTJ 3;  2CFD A;  2W56 B;  5LC6 A;  3F8X A;  1K28 A;  3F40 A;  1YI2 3;  5D81 A;  3CNX A;  4JF8 A;  4R9K A;  5AII A;  3EB8 A;  1WMO A;  2K54 A;  2JQ5 A;  3DY5 A;  5D82 A;  3MG3 A;  3GRD A;  5IF6 A;  1UUW B;  3Q1C A;  1KSI A;  1YIT 3;  3KZT A;  4O8S A;  1CEW I;  1IVX A;  1W6C A;  3MPH A;  1QAL A;  1O7P B;  3NBB A;  3DZL A;  3T8U A;  1M9G A;  5KP4 A;  2A15 A;  2QEX 3;  2GEY A;  2GEX A;  1V74 A;  3UJM A;  3N8B A;  5BXQ A;  5HGR A;  1UI7 A;  4N6M A;  1W00 A;  5AIG A;  4N6U A;  3K0Z A;  4Q53 A;  4OUQ A;  1VQ6 3;  3UL6 A;  2Y74 A;  3DM8 A;  3UL5 A;  1W02 A;  5ELU A;  2BMR B;  1GY7 A;  4EYC A;  4WWU C;  5AEW B;  3G16 A;  3F8H A;  4HM6 B;  3OXA A;  3FZW A;  3O8Y A;  1OH0 A;  1U5O A;  3HK4 A;  2F98 A;  4GL6 A;  3B7C A;  3EN8 A;  4L8O A;  2W6J H;  1A2V A;  2MC8 A;  3X3X A;  1DMQ A;  1NWW A;  3S67 A;  1STD A;  1UW1 A;  3FCS B;  2P0X A;  1ROA A;  3FF0 A;  3K63 A;  1ASK A;  1QMA A;  1T5Y A;  2STD A;  4XB5 A;  1AR0 A;  2GBW B;  3FG3 A;  2WOF A;  1KQS 2;  1CYV A;  2XGN A;  1YIJ 3;  3LTB A;  5TGN A;  4J9A A;  3X41 A;  2CIU A;  4XDV A;  3X3Z A;  3S5C A;  1Q40 A;  4O02 B;  1N5P A;  3FLJ A;  1K41 A;  4ZM8 A;  1TU5 A;  3MWZ A;  4LSO A;  4MJD A;  3X3Y A;  3FGY A;  1TFK A;  2XSH B;  1EQK A;  2P38 A;  3I0Y A;  3GAX A;  4I4K A;  2I9W A;  4HM7 B;  5CF1 A;  2P05 A;  1RJO A;  4FMB A;  2E2V A;  3A76 A;  1Q42 A;  1TUH A;  2CK3 H;  4R1K A;  2BO9 B;  1OCV A;  3K5T A;  4RZM A;  5CLK A;  5CXO A;  1VQ5 3;  4N6O B;  3CCJ 3;  3PYJ A;  2CWU A;  3BLZ A;  3LXU X;  1M90 4;  1E3V A;  3K9M C;  4WYK A;  1WMN A;  3LT8 A;  2HMN B;  3WA3 A;  3WOD G;  3ALA A;  1JN5 A;  3SX1 A;  1GS3 A;  3NV0 B;  3VGN A;  3LYG A;  8CHO A;  4HVN A;  3SLU A;  2CFW A;  4LEH A;  4EV2 A;  1YJ9 3;  1SJW A;  5FW5 A;  3FG1 A;  2W56 A;  4EBG A;  1AVK A;  4HM3 B;  2SBL A;  5AI1 A;  3S28 A;  1IQX A;  4PEJ A;  3FKA A;  3J7Y d;  5AYR B;  1VQM 3;  3EC9 A;  3CC4 3;  4QWT A;  3EE1 A;  1WTH A;  2YFJ B;  3KII A;  2WO0 A;  1IVW A;  4RBN A;  3LT9 A;  4HM5 B;  4R9L A;  3UB1 A;  3LZA A;  2GXF A;  1NO3 A;  3B4P A;  4K1V A;  1MOL A;  3EBY A;  3GZR A;  4MMZ B;  3CCE 3;  4MEI A;  3ROB A;  4CCV A;  3FSD A;  1US1 A;  5IG5 A;  1VQ7 3;  4N6T A;  1W4N A;  2D1W A;  1JN5 B;  2UX0 A;  4FCJ A;  2IUK A;  1N9E A;  3KN4 A;  4HJL B;  1DMM A;  2BNG A;  1WMP A;  4HM1 B;  3FH1 A;  3CCQ 3;  4AEQ A;  3G71 3;  3AMO A;  2GBX B;  7STD A;  1FGM A;  1QVF 2;  1IVU A;  1RN7 A;  3BB9 A;  2INX A;  3X40 A;  2KXG A;  1O7M B;  4K1U A;  3I56 3;  3LTD A;  3CCR 3;  3JVC A;  5AYS C;  3DGM A;  3IPT A;  2WGO A;  3HX8 A;  4HM0 B;  1ISK A;  1QAK A;  3V92 A;  1KD1 4;  1GYB A;  5IG4 A;  5AIF A;  1K73 4;  2C10 A;  1A90 A;  4R80 A;  2B1X B;  1YJW 3;  3H3H A;  3SVA A;  1O7N B;  2P09 A;  2K0M A;  3JUQ A;  3MKI A;  4H3U A;  1FA3 A;  3CPO A;  1K8A 4;  2Z76 A;  6STD A;  1TFO A;  3V98 A;  1IT8 A;  1STF I;  4XBT A;  2XGL A;  1HU9 A;  1YVB I;  1AV4 A;  1JB5 A;  1N8Q A;  1WNH A;  1UI8 A;  1R4C A;  3NHX A;  1ZO2 A;  1A2K A;  1W6G A;  3G6E 3;  1OUN A;  4HZB B;  3JUO A;  3UNL A;  1S5A A;  2Z6B A;  4HYZ A;  1Q7Y 4;  3WDG B;  3DXO A;  1FGO A;  3EHC A;  1IK3 A;  2CC3 A;  5IEN A;  1K9M 4;  3WOF B;  3Q90 A;  2XR8 B;  3NQZ A;  3CCM 3;  1W2B 2;  3BNB A;  1SQW A;  3I55 3;  4H61 A;  1F8N A;  1J2B A;  1JB2 A;  5FGO A;  2XFT A;  1O7W B;  1WQL B;  3MYT A;  4EV5 A;  4N6L A;  1W6Y A;  3U1W A;  2LYX A;  1PU4 A;  3JUN A;  1VQL 3;  1QVG 2;  4MMX B;  1YHQ 3;  2ML5 A;  2W9Q A;  4KFF A;  3QRD A;  4OK0 A;  3NV0 A;  1N9J A;  1DYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...