3NBRA

Crystal structure of ketosteroid isomerase d38np39gd99n from pseudomonas testosteroni (tksi) with 4-androstene-3,17-dione bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
NTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVENGVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPINHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Ketosteroid Isomerase D38NP39GD99N from Pseudomonas Testosteroni (tKSI) with 4-Androstene-3,17-dione Bound
rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
molecule keywords Steroid Delta-isomerase
total genus 31
structure length 124
sequence length 124
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nbrA00
4U13A 5CLKA 5IG0A 3EBTA 1DMMA 1STDA 3UNLA 3A76A 3GZXB 2INXA 3M8CA 4N3VA 3E99A 4HM3B 3KZTA 3EX9A 5AEUB 2HMOB 3F8XA 1O7NB 3IPTA 3F9SA 3OX9A 3STDA 4J8TA 4K1VA 1GY5A 1GYBA 2RFRA 1JB5A 4L7KA 2QIYA 3NM2A 5IEOA 3EF8A 1TUHA 1BUQA 4Q53A 4XBXA 5IG3A 1JB4A 1S5AA 3NV0A 4X2OA 5STDA 5TGNA 2GBWB 5IENA 5AIHA 4OVMA 2F86B 5EVHA 3NV0B 1NU3A 1U5OA 2Z76A 4L8PA 5CK6A 5BVBA 1O7WB 1Z1SA 2PZVA 3GZBA 2IMJA 3DM8A 5IERA 3UJMA 1GS3A 3EC9A 1ULJB 1OHPA 3GZRA 1NWWA 2UX0A 3F8HA 1O7GB 4HZBB 5AI1A 1DMNA 2A15A 2W2CA 5IF6A 1ZO2A 3EN1B 3G0KA 1OUNA 3JUNA 1ISKA 1K41A 4LGQA 1WQLB 2XRXB 3FH1A 4RZMA 1O7MB 3F7SA 1OGZA 2GXFA 2JQ5A 2YFIB 3CNMA 5D82A 4HM1B 3JUMA 1OHSA 1QJGA 3NXJA 4HM5B 5D81A 4L8OA 2STDA 1O7PB 1W02A 1Q40B 4HM6B 2CHCA 3H3HA 4STDA 3ER7A 4FCMA 1JKGB 3GRDA 2XSHB 3FSDA 3KE7A 3OWYA 5KP3A 4IIAA 3S5CA 3F14A 1UUVB 3EQQB 1GY7A 3JUPA 3LZAA 4I4KA 1ZX2A 3EBYA 4HJLB 3I0YA 1DMQA 8CHOA 2B24B 2HMJB 4LEHA 5CXOA 4WYKB 5KP1A 2I9WA 4HVNA 4R9LA 2HMLB 2YFJB 2HMKB 3EN8A 3KSPA 3CNXA 1W01A 2R4IA 1A2KA 4K1UA 2XSOB 1E3VA 4XBTA 5HGRA 1EA2A 2BMRB 1EG9B 3B4PA 4XM4A 4HM0B 3WMDA 1OF5B 4R1KA 3VGNA 4FCJA 3NUVA 4KVHA 3SOYA 2RGQA 3SEDA 2BMQB 3CU3A 3FGYA 3JUQA 4WWUC 2GEYA 4WP5A 4LMIA 3F40A 3NBRA 4XDWA 3DZLA 3G8ZA 1AR0A 5JPPA 3BLZA 1HKXA 3ECFA 3MYTA 4OUQA 1OGXA 1W00A 4HZ9B 3OXAA 1CQSA 2HMMB 3NHXA 1IDPA 4J9AA 2GBXB 3EHCA 4X2HA 3DXOA 3ROBA 4MJDA 7STDA 3DMCA 5KP4A 2Z7AA 2RCDA 3B8LA 5DRVA 1JB2A 1O7HB 2GEXA 3F7XA 3HX8A 2HMNB 3JUOA 1OH0A 3DUKA 4PEJA 3T8UA 5BXQA 4R9KA 5IEPA 4GB5A 3MG3A 4H3UA 5JPUA 2B1XB 6STDA 5FW5A 3G16A 5IG4A 2OWPA 4HM7B 2XR8B 4XBYA 1E3RA 1OPYA 2K54A 4HM2B 5CF1A 3FKAA 3K0ZA 3FZWA 1QMAA 2CKFB 1OHOA 3B4OA 2YFLB 3GWRA 3MHEA 4HM8B 5AIIA 5AIFA 1Q40A 3KKGA 5AIGA 1W6YA 3FLJA 3RGAA 5CF2A 3VSYA 1C7HA 1OCVA 1SJWA 2QGUA 1Q42A 1JN5A 2Z77A 3K7CA 3OV4A 4ORLA 3RGRA 1NDOB 1JN5B 2BNGA 4HM4B 4XDVA 3OWUA 3MG2A 1GY6A 3Q90A 3LYGA 3MKIA 4HKVB 4WYKA 2BMOB 2F98A 5AEWB 1TP6A 3B7CA 1ASKA 1VZZA 1UUWB 3HK4A 5D83A 5IG5A 1OF5A 3HZPA 3BB9A 3CPOA 1ULIB 3MG1A 5DREA 1E97A 5G2GA 1JKGA 3EJVA 3FF2A 3H51A 3OWSA 3GZYB 3D9RA 3FF0A 3SOAA 3MSOA 2F99A 3T8NA 4XB5A 4CDLA
chains in the Genus database with same CATH superfamily
1I2GA 1DMMA 3GZXB 3WOEB 1EKMA 4N6OB 3KZTA 1SIIA 3X40A 2KAAA 4O02B 3WDGB 1HZ1A 2Q07A 3OX9A 4BL3A 3IJEB 1DE3A 1YJW3 1OACA 4K1VA 3LH4A 1FGMA 1TTOA 2ZDJA 4NHFA 1Q814 2OCTA 4Q53A 2GU3A 2GSPA 3NV0A 5IENA 1RNBA 3NM7A 4OVMA 1K9M4 1Q7HA 1MGWA 4L8PA 1Q864 2L4VA 5BVBA 1Z1SA 2PZVA 2UGIA 3PYJA 3D3LA 3NBBA 3DM8A 1FA3A 4HBRA 1OHPA 3CCU3 2UX0A 1GOUA 5AI1A 2F56A 1C54A 2ML6A 2XEPA 1IT8A 4OK0A 2XRXB 2J8XB 1MNLA 4RZMA 2F4YA 1X1YA 3F7SA 1OGZA 1YNVX 2JQ5A 3CCM3 1OHSA 2STDA 1W02A 4MMYB 3H3HA 4AKYA 1GD3A 2P05A 4FCMA 3PGBA 4MMZB 3SXXA 4DKIA 1BSCA 3S5CA 1DVCA 2W0QA 1RHLA 1GY7A 1M9GA 2RNTA 1X1XA 1M904 2W04A 4HJLB 1YJ93 1A2VA 1DMQA 3I0YA 8CHOA 5CXOA 3KN4A 2I9WA 5KP1A 2HMLB 2OTL3 3EN8A 3CNXA 1W01A 1VQ83 2H0IA 4FMDA 1VQ53 1ZS7A 2BT3A 3SOYA 1RGHA 2BU4A 4FMAA 2RGQA 1BUJA 4WWUC 1N5HA 1LQMB 1B2ZA 4LMIA 1RDSA 4MMXB 3NBRA 3DZLA 1YVSA 2OQEC 5JPPA 3NX0A 1UCLA 1HKXA 1YI23 1GOVA 3ECFA 4OUQA 1KD14 1W00A 1IVVA 1TRPA 1AVLA 4HZ9B 1CQSA 2XFSA 2KF3A 5KP4A 3EHCA 3DXOA 3B8LA 4PEJA 2GEXA 3F7XA 1JBTA 1D6ZA 1LQGC 1MWRA 1W4NA 3SX1A 1B2UA 5IEPA 4CPKA 4O2HA 3DGNA 1BRJA 5IG4A 2OWPA 4AEQA 1YGEA 1OPYA 4HM2B 1W7CA 3K63A 3FKAA 3B4OA 5AIFA 1OHOA 3PCSA 2YFLB 3MHEA 5LC6A 5BU4A 1B2MA 3FG4A 1RGLA 1DETA 3K7CA 1I8VA 2Z77A 1Q42A 1JN5A 4ORLA 3V92A 3LTBA 1Y4KA 3N9HA 1VQ93 1BOXA 2SARA 1JN5B 1JV2B 3K9MC 4GSPA 2BNGA 4XDVA 1S723 1YHQ3 5M18A 3MG2A 3RDEA 2Z6BA 2WGOA 1BNJA 1VZZA 1WNHA 1CEWI 3KCHA 1UDII 1OF5A 4LZIA 4RNTA 4BL2A 1MWSA 1ULIB 2BO9B 2JDIH 3OWSA 2KRTA 1FGOA 3D9RA 3LTAA 3SOAA 1I2FA 1US1A 3T8NA 4CDLA 3AHWA 3UNLA 1YIT3 3EBTA 1STDA 3AMOA 2INXA 3E99A 3DGLA 3EX9A 1RMSA 1BIRA 2P09A 2IUJA 3F9SA 2KXGA 1D6YA 3STDA 3V98A 2RFRA 4O8SA 1JB5A 1WMOA 2QIYA 2ZHXB 4FCZA 2OOVA 1UW1A 4EYCA 1JNQA 1JB4A 1S5AA 5STDA 1IQXA 2O9UX 5AIHA 1IVUA 1IVXA 1LOWA 1FYSA 1NU3A 1U5OA 2Z76A 1NB3I 5CK6A 1O7WB 1BNIA 3GZBA 3QRDA 2OTJ3 4BTWA 1GS3A 1YGWA 3EC9A 3CME3 1N8R4 1WMPA 2QEX3 1NWWA 2C10A 1V58A 5IF6A 3VF1A 3JUNA 3G0KA 1ISKA 1BSAA 1WQLB 1QVG2 2YFIB 2GXFA 1TFKA 1UGIA 3DGMA 2P38A 3PZWA 4BIRA 4HM5B 2C11A 4STDA 1Q40B 2CHCA 2XFTA 3LTDA 1JKGB 1VQN3 1GOYA 3GRDA 3FSDA 2PNCA 1IV9A 4IIAA 1VQ63 3SYUA 2BIRA 1ROVA 3LZAA 1MOLA 3ZG5A 1BRNL 3PCRA 2B24B 2HMJB 3A5EA 4LEHA 2KF5A 3LOYA 4WYKB 4KZ1A 4R9LA 2YFJB 2HMKB 5IW9A 3KSPA 5HGRA 1I0XA 1QAFA 3X42A 2E2UA 1EA2A 3B4PA 2SBLA 4HM0B 4JRFA 3WOFB 3T0UA 1V57A 4FCJA 3LT8A 3NUVA 5JBSA 3SEDA 3FGYA 3JUQA 4RNYA 2GEYA 1M1K4 4I5QA 4XDWA 2ZL8A 1T5YA 2CG0A 1W6GA 1AR0A 5HOHA 1FGRA 1RGKA 3AMOB 1MWTA 3ZFZA 1TRQA 2CH9A 3CC43 3NQZA 3V99A 1B21A 3OXAA 4NREA 2HMMB 3G6E3 1W5ZA 1TU5A 1IT7A 1ROAA 2W9PA 3DMCA 2RCDA 5DRVA 1O7HB 1FGQA 1IVWA 3JUOA 8RNTA 4GL6A 2FXTA 4J5KA 1N8QA 4R9KA 1DYUA 3MG3A 1BRKA 2B1XB 1RRLA 6STDA 1J2BA 3MPHA 2XR8B 1E3RA 2AAEA 1BSBA 4J8TA 1D6UA 2W03A 1GMQA 3RGAA 3UL5A 1A67A 1RGCA 5AIGA 5CF2A 1OCVA 1FGTA 1SJWA 3LXUX 4FMBA 3RGRA 4K90B 2YX9A 3BIRA 3UB1A 1AVKA 3D5IA 2IUKA 4HM4B 1BU4A 1HU9A 3CC23 1IQ8A 2CK3H 1GY6A 2CX1A 1RLSA 1RSNA 2AADA 3K5TA 3S29A 2H0HA 5GSPA 5AEWB 3B7CA 1RGAA 1BRGA 5M19A 2MF7A 3BNDA 3HK4A 2K0MA 3X3XA 1RCKA 5G2GA 5AYSC 3MG1A 2XH9A 1JKGA 1BRHA 1N9JA 3BU4A 2F99A 2OQEA 1G96A 5CLKA 5IG0A 1LVNA 1BNRA 3A76A 4N3VA 1N9EA 2KF6A 1AV4A 4HM3B 1SQWA 2HMOB 3FCSB 1A2PA 3IPTA 2WOFA 3ALAA 1JZDA 5RNTA 3CPW2 1YJN3 1N5PA 1YVBI 3O8YA 1FW7A 3I563 1I3FA 1MGRA 1GY5A 1GYBA 5G1LA 1RNTA 5IEOA 1BUQA 1FUSA 3EF8A 4LYLB 4XBXA 1RN1A 5BIRA 1VQL3 3ZG0A 4X2OA 1VQ73 2GBWB 3G4S3 2CX0A 1EEJA 5EVHA 3PXMA 2L1SA 1R4YA 2CW9A 1JRQA 1JJ22 1G02A 1LOXA 1W6CA 3CCE3 3UJMA 5FGOA 3AGOA 1RN4A 1STFI 1RRHA 1ULJB 2O3OA 4HZBB 1KQS2 1O7GB 1GSPA 1T3BA 2A15A 2CFKA 2W2CA 2QA43 3CMA3 1ZO2A 1W2ZA 3WR2A 1OUNA 1K41A 2E2VA 1SARA 4N6V0 3GSPA 1K734 1BRSA 3FH1A 4HYZA 2FNQA 4KFDA 3CNMA 3AGNA 4EC6A 1BNEA 1GMPA 3JUMA 4HM1B 5D81A 2LQVA 5I97A 4IT7A 4N6NB 1I0VA 6RNTA 4FMCA 1PU4A 1CH0A 3IMAB 3JUPA 7RNTA 1BVIA 1ZX2A 3EBYA 1EQKA 1VQQA 1LXEA 2CFLA 4HVNA 5EQLA 1TIJA 4XBTA 4K1UA 2R4IA 1A2KA 3X3ZA 3WMDA 1EG9B 2BMRB 3Q3FA 1OF5B 4R1KA 5G1KA 1PYLA 4EBGA 4EXRA 2ZA4A 3CU3A 4CJNA 2E2TA 4O3VA 3F40A 1B2SA 4EV5A 3G8ZA 3BLZA 3Q1CA 3HIGA 2M7OA 4R80A 2CWTA 1IDPA 4MEIA 1BNFA 1UUGB 2GBXB 7STDA 4MJDA 2Z7AA 2FGTA 4EV2A 1JB2A 2UUGC 3T8UA 1LNIA 3DUKA 3CCQ3 1BGSA 1MWUA 4GB5A 1A90A 1VQO3 3SLUA 4NPBA 1EUIC 3X41A 3G16A 4BU4A 1T2HA 4HM7B 4RBNA 4XBYA 2K54A 1RTUA 1RJOA 3HIIA 5CF1A 3KIIA 2CFDA 1QMAA 2CKFB 3FZWA 3GWRA 4GHOA 5AIIA 3NBJA 4HM8B 3KKGA 2V1LA 4KFFA 3VSYA 3OV4A 3UL6A 2XF3A 1QVF2 1I2EA 2D42A 2CFWA 2Y74A 3KFQC 4H61A 2CG1A 1VQK3 2IYJA 1IV7A 3OWUA 1X1UA 2H0GA 2MC8A 3FG3A 1CYVA 3Q90A 7GSPA 3MKIA 3OW22 3X3YA 2BMOB 2F98A 3LTCA 4KFEA 4LSOA 1LNHA 1QALA 3SVAA 3U97A 1FUTA 5IG5A 3S67A 5EEOA 3AHSA 5M1AA 1BSEA 1BNSA 1RGEA 2WO0A 3BB9A 3CPOA 2GU1A 1K8A4 1E97A 1L5GB 3EJVA 3H51A 3CC73 3FG1A 3GZYB 1IK3A 3FF0A 3CCS3 4XB5A 1KC84 1LRAA 1RGFA 4U13A 4JF8A 1X1WA 3CCR3 3M8CA 3WA2X 1SPUA 4N6MA 1BANA 5AEUB 1R4CA 3F8XA 1O7NB 4R4KA 4HOHA 3N54B 3L0RA 2F5MA 1Q9EA 1BSDA 3NQYA 1BNGA 1Q7Y4 2W56A 2BHMA 1RN7A 4L7KA 1RGGA 1UGHI 2W56B 3NM2A 1TUHA 3PS8A 2HOHA 3D5GA 2XGLA 5IG3A 1TJDA 5TGNA 3CD63 2IA7A 1PY3A 5LC7A 3D79A 3EB8A 2F86B 3WA3A 3DGOA 3NV0B 1RKYA 3S28A 3CCV3 1IU7A 1FZUA 1UCKA 2IMJA 4HAAA 5IERA 2RSXA 1B20A 1U8CB 4J5GA 2KCDA 3GZRA 3F8HA 2D1WA 2KF4A 1DMNA 3CCJ3 1TFOA 4EW5A 3EN1B 1YIJ3 4LGQA 1HYFA 4IPBA 2CWVA 1Q824 1O7MB 2CWUA 1JBSA 5D82A 2P0MA 1QAKA 3NXJA 1QJGA 3BNEA 4L8OA 1T2IA 2ML5A 1O7PB 4HM6B 1I70A 3WODG 1NJI4 3ER7A 1JBRA 2R41A 2CFGA 1ZGXA 1I3IA 2XGNA 2XSHB 3KE7A 1JZOA 3OWYA 5KP3A 3RNTA 3F14A 3URPA 2P0XA 1UUVB 3EQQB 4I4KA 3S27A 1LOVA 1AQZA 4N6TA 1UCIA 2W6JH 1BRIA 1SIHA 4FR9A 1VQP3 2RBIA 1CYUA 2XSOB 1E3VA 4G1MB 3J7Yd 4XM4A 3DGYA 1BAOA 2WGQA 3VGNA 1VQM3 2W9QA 4KVHA 2K3DA 3JVCA 2BMQB 1GMRA 1V74A 2OOVC 3GAXA 4WP5A 4AKZA 3TDGA 1NB5I 3BNBA 1GD4A 1KWIA 4CCVA 1WTHA 3I553 1DVDA 3N8BA 3MYTA 4RNZA 1FUWA 1OGXA 4N6UA 2LYXA 6GSPA 3D4AA 3WHOA 4X2HA 1K28A 1B2XA 3NHXA 4J9AA 5ELJA 1M1XB 4ZM8A 3ROBA 4BTXA 1W2B2 1NO3A 3HX8A 5BXQA 2HMNB 1OH0A 5AYRB 1IYYA 2F5WA 4H3UA 2CIUA 1UI7A 3DY5A 4WHAA 5A0OB 5JPUA 3EE1A 5FW5A 5ELUA 3BNCA 1UI8A 3MWZA 3HI7A 1F8NA 3K0ZA 1PFPA 1KSIA 4KT3B 1Q40A 1W6YA 3FLJA 9RNTA 1B3SA 4WFOA 1C7HA 2QGUA 1G0TA 1IQYA 3Q2PA 1VQ43 3HOHA 2Y73A 3LT9A 2CC3A 2C4BA 1NDOB 4BTYA 2IY2A 1LOYA 4HKVB 3LYGA 3DH2A 4QWTA 4WYKA 1B27A 3KSED 3QK9A 1TP6A 1ASKA 3CXC2 1UUWB 1WMNA 3CCL3 4ILFA 1UCJA 5D83A 4K61A 3HZPA 4TX4A 5DREA 1AY7A 3LMLA 1RCLA 1NNVA 3G713 3FF2A 3MSOA 4N6LA 3U1WA 2WOHA
chains in the Genus database with same CATH topology
1DMMA 3GZXB 3WOEB 1EKMA 4N6OB 3KZTA 1SIIA 3X40A 3WDGB 4O02B 2Q07A 3OX9A 3IJEB 1YJW3 1OACA 4K1VA 3LH4A 1FGMA 2ZDJA 4NHFA 1Q814 2OCTA 4Q53A 2GU3A 5IENA 3NV0A 3NM7A 4OVMA 1K9M4 4L8PA 1Q864 2L4VA 5BVBA 1Z1SA 2PZVA 3PYJA 3D3LA 3NBBA 3DM8A 1FA3A 4HBRA 1OHPA 3CCU3 2UX0A 5AI1A 2ML6A 2XEPA 1IT8A 4OK0A 2XRXB 1MNLA 4RZMA 3F7SA 1OGZA 2JQ5A 3CCM3 1OHSA 2STDA 1W02A 4MMYB 3H3HA 4AKYA 1GD3A 2P05A 4FCMA 3PGBA 4MMZB 3SXXA 3S5CA 1DVCA 2W0QA 1GY7A 1M9GA 1M904 2W04A 4HJLB 1YJ93 1A2VA 1DMQA 3I0YA 8CHOA 5CXOA 3KN4A 2I9WA 5KP1A 2HMLB 2OTL3 3EN8A 3CNXA 1W01A 1VQ83 4FMDA 1VQ53 2BT3A 3SOYA 4FMAA 2RGQA 4WWUC 1N5HA 4LMIA 4MMXB 3NBRA 3DZLA 2OQEC 5JPPA 3NX0A 1HKXA 1YI23 3ECFA 4OUQA 1KD14 1W00A 1IVVA 1AVLA 4HZ9B 1CQSA 2XFSA 5KP4A 3EHCA 3DXOA 3B8LA 4PEJA 2GEXA 3F7XA 1D6ZA 1W4NA 3SX1A 5IEPA 4O2HA 3DGNA 5IG4A 2OWPA 4AEQA 1YGEA 1OPYA 4HM2B 1W7CA 3K63A 3FKAA 3B4OA 5AIFA 1OHOA 3PCSA 2YFLB 3MHEA 5LC6A 3FG4A 3K7CA 3V92A 2Z77A 1Q42A 1JN5A 4ORLA 3LTBA 1Y4KA 3N9HA 1VQ93 1JN5B 1JV2B 3K9MC 1S723 2BNGA 4XDVA 1YHQ3 3MG2A 3RDEA 2Z6BA 2WGOA 1VZZA 1WNHA 1CEWI 4LZIA 1OF5A 1ULIB 2BO9B 2JDIH 3OWSA 2KRTA 1FGOA 3D9RA 3LTAA 3SOAA 1US1A 3T8NA 4CDLA 3UNLA 1YIT3 3EBTA 1STDA 3AMOA 2INXA 3E99A 3DGLA 3EX9A 2P09A 2IUJA 3F9SA 2KXGA 1D6YA 3STDA 3V98A 2RFRA 4O8SA 1JB5A 1WMOA 2QIYA 4FCZA 2OOVA 1UW1A 4EYCA 1JNQA 1JB4A 1S5AA 5STDA 1IQXA 2O9UX 5AIHA 1IVUA 1IVXA 1NU3A 1U5OA 2Z76A 1NB3I 5CK6A 1O7WB 2OTJ3 3GZBA 3QRDA 4BTWA 1GS3A 3EC9A 3CME3 1N8R4 1WMPA 2QEX3 1NWWA 2C10A 5IF6A 3VF1A 3JUNA 3G0KA 1ISKA 1WQLB 1QVG2 2YFIB 2GXFA 1TFKA 3DGMA 2P38A 3PZWA 4HM5B 2C11A 4STDA 1Q40B 2CHCA 2XFTA 3LTDA 1JKGB 1VQN3 3GRDA 3FSDA 2PNCA 1IV9A 4IIAA 1VQ63 1ROVA 3LZAA 1MOLA 3PCRA 2B24B 2HMJB 4LEHA 4WYKB 3LOYA 4KZ1A 4R9LA 2YFJB 2HMKB 5IW9A 3KSPA 5HGRA 1QAFA 3X42A 2E2UA 1EA2A 3B4PA 2SBLA 4HM0B 4JRFA 3WOFB 3T0UA 4FCJA 3LT8A 3NUVA 5JBSA 3SEDA 3FGYA 3JUQA 4RNYA 2GEYA 1M1K4 4XDWA 2ZL8A 1T5YA 2CG0A 1W6GA 1AR0A 1FGRA 3AMOB 2CH9A 3CC43 3NQZA 3V99A 3OXAA 4NREA 2HMMB 3G6E3 1W5ZA 1TU5A 1IT7A 3DMCA 1ROAA 2W9PA 2RCDA 5DRVA 1O7HB 1FGQA 1IVWA 3JUOA 4GL6A 2FXTA 1N8QA 4R9KA 1DYUA 3MG3A 2B1XB 1RRLA 6STDA 1J2BA 3MPHA 2XR8B 1E3RA 4J8TA 1D6UA 2W03A 3RGAA 3UL5A 1A67A 5AIGA 5CF2A 1OCVA 1FGTA 1SJWA 3LXUX 4FMBA 3RGRA 4K90B 2YX9A 3UB1A 1AVKA 2IUKA 4HM4B 1HU9A 3CC23 1IQ8A 2CK3H 1GY6A 3K5TA 3S29A 5AEWB 3B7CA 2MF7A 3BNDA 3HK4A 2K0MA 3X3XA 5G2GA 5AYSC 3MG1A 2XH9A 1JKGA 1N9JA 2F99A 2OQEA 1G96A 5CLKA 5IG0A 1LVNA 3A76A 4N3VA 1N9EA 4HM3B 1AV4A 1SQWA 2HMOB 3FCSB 3IPTA 2WOFA 3ALAA 3CPW2 1YJN3 1N5PA 1YVBI 3O8YA 3I563 1GY5A 1GYBA 5IEOA 1BUQA 3EF8A 4XBXA 1VQL3 4X2OA 1VQ73 2GBWB 3G4S3 5EVHA 3PXMA 2CW9A 1JRQA 1JJ22 1LOXA 1W6CA 3CCE3 3UJMA 5FGOA 1STFI 1ULJB 1RRHA 4HZBB 2O3OA 1KQS2 1O7GB 2A15A 2CFKA 2W2CA 2QA43 3CMA3 1ZO2A 1W2ZA 1OUNA 1K41A 2E2VA 4N6V0 1K734 3FH1A 4HYZA 2FNQA 4KFDA 3CNMA 4EC6A 4HM1B 3JUMA 5D81A 2LQVA 5I97A 4IT7A 4N6NB 4FMCA 1PU4A 3IMAB 3JUPA 1ZX2A 3EBYA 1EQKA 1LXEA 2CFLA 4HVNA 5EQLA 1TIJA 4XBTA 4K1UA 2R4IA 1A2KA 3X3ZA 3WMDA 1EG9B 2BMRB 1OF5B 4R1KA 4EBGA 4EXRA 3CU3A 2E2TA 4O3VA 3F40A 4EV5A 3G8ZA 3BLZA 3Q1CA 3HIGA 2M7OA 4R80A 2CWTA 1IDPA 4MEIA 2GBXB 7STDA 4MJDA 2Z7AA 2FGTA 4EV2A 1JB2A 3T8UA 3DUKA 3CCQ3 4GB5A 1A90A 1VQO3 3SLUA 3X41A 3G16A 4HM7B 4RBNA 4XBYA 2K54A 1RJOA 3HIIA 5CF1A 3KIIA 2CFDA 1QMAA 2CKFB 3FZWA 3GWRA 5AIIA 3NBJA 4HM8B 3KKGA 2V1LA 4KFFA 3VSYA 3OV4A 3UL6A 2XF3A 1QVF2 2D42A 2CFWA 2Y74A 3KFQC 4H61A 2CG1A 1VQK3 1IV7A 3OWUA 2MC8A 3OW22 3FG3A 1CYVA 3Q90A 3MKIA 3X3YA 2BMOB 2F98A 3LTCA 4KFEA 4LSOA 1LNHA 1QALA 3SVAA 3U97A 5IG5A 3S67A 5EEOA 1K8A4 2WO0A 3BB9A 3CPOA 2GU1A 1E97A 1L5GB 3EJVA 3H51A 3CC73 3FG1A 3GZYB 1IK3A 3FF0A 3CCS3 4XB5A 1KC84 4U13A 4JF8A 3CCR3 3M8CA 3WA2X 1SPUA 4N6MA 5AEUB 1R4CA 3F8XA 1O7NB 4R4KA 3N54B 3L0RA 3NQYA 1Q7Y4 2W56A 2BHMA 1RN7A 4L7KA 2W56B 3NM2A 1TUHA 3PS8A 2XGLA 5IG3A 5TGNA 3CD63 2IA7A 5LC7A 3EB8A 3WA3A 2F86B 3DGOA 3NV0B 1RKYA 3S28A 3CCV3 1IU7A 2IMJA 5IERA 2RSXA 1U8CB 2KCDA 3GZRA 3F8HA 2D1WA 3CCJ3 1DMNA 1TFOA 3EN1B 1YIJ3 4LGQA 4IPBA 2CWVA 1Q824 1O7MB 2CWUA 5D82A 2P0MA 1QAKA 3NXJA 1QJGA 3BNEA 4L8OA 2ML5A 1O7PB 4HM6B 3WODG 1NJI4 3ER7A 2CFGA 2XSHB 2XGNA 3KE7A 3OWYA 5KP3A 3F14A 2P0XA 1UUVB 3EQQB 4I4KA 3S27A 4N6TA 2W6JH 1SIHA 4FR9A 1VQP3 1CYUA 2XSOB 1E3VA 4G1MB 3J7Yd 4XM4A 2WGQA 3VGNA 1VQM3 2W9QA 4KVHA 3JVCA 2BMQB 1V74A 2OOVC 3GAXA 4WP5A 4AKZA 3TDGA 1NB5I 3BNBA 1GD4A 1KWIA 4CCVA 1WTHA 3I553 1DVDA 3N8BA 3MYTA 4RNZA 1FUWA 1OGXA 4N6UA 2LYXA 4X2HA 1K28A 3NHXA 4J9AA 5ELJA 1M1XB 4ZM8A 3ROBA 4BTXA 1W2B2 1NO3A 3HX8A 5BXQA 2HMNB 1OH0A 5AYRB 4H3UA 2CIUA 1UI7A 3DY5A 4WHAA 5A0OB 5JPUA 3EE1A 5FW5A 5ELUA 3BNCA 1UI8A 3MWZA 3HI7A 1F8NA 3K0ZA 1PFPA 1KSIA 1Q40A 1W6YA 3FLJA 4WFOA 1C7HA 2QGUA 1IQYA 3Q2PA 1VQ43 2Y73A 3LT9A 2CC3A 1NDOB 4BTYA 4HKVB 3LYGA 4QWTA 4WYKA 3KSED 3QK9A 1TP6A 1ASKA 3CXC2 1UUWB 1WMNA 3CCL3 5D83A 4K61A 3HZPA 4TX4A 5DREA 3LMLA 3G713 3FF2A 3MSOA 4N6LA 3U1WA 2WOHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U13 A;  5CLK A;  5IG0 A;  3EBT A;  1DMM A;  1STD A;  3UNL A;  3A76 A;  3GZX B;  2INX A;  3M8C A;  4N3V A;  3E99 A;  4HM3 B;  3KZT A;  3EX9 A;  5AEU B;  2HMO B;  3F8X A;  1O7N B;  3IPT A;  3F9S A;  3OX9 A;  3STD A;  4J8T A;  4K1V A;  1GY5 A;  1GYB A;  2RFR A;  1JB5 A;  4L7K A;  2QIY A;  3NM2 A;  5IEO A;  3EF8 A;  1TUH A;  1BUQ A;  4Q53 A;  4XBX A;  5IG3 A;  1JB4 A;  1S5A A;  3NV0 A;  4X2O A;  5STD A;  5TGN A;  2GBW B;  5IEN A;  5AIH A;  4OVM A;  2F86 B;  5EVH A;  3NV0 B;  1NU3 A;  1U5O A;  2Z76 A;  4L8P A;  5CK6 A;  5BVB A;  1O7W B;  1Z1S A;  2PZV A;  3GZB A;  2IMJ A;  3DM8 A;  5IER A;  3UJM A;  1GS3 A;  3EC9 A;  1ULJ B;  1OHP A;  3GZR A;  1NWW A;  2UX0 A;  3F8H A;  1O7G B;  4HZB B;  5AI1 A;  1DMN A;  2A15 A;  2W2C A;  5IF6 A;  1ZO2 A;  3EN1 B;  3G0K A;  1OUN A;  3JUN A;  1ISK A;  1K41 A;  4LGQ A;  1WQL B;  2XRX B;  3FH1 A;  4RZM A;  1O7M B;  3F7S A;  1OGZ A;  2GXF A;  2JQ5 A;  2YFI B;  3CNM A;  5D82 A;  4HM1 B;  3JUM A;  1OHS A;  1QJG A;  3NXJ A;  4HM5 B;  5D81 A;  4L8O A;  2STD A;  1O7P B;  1W02 A;  1Q40 B;  4HM6 B;  2CHC A;  3H3H A;  4STD A;  3ER7 A;  4FCM A;  1JKG B;  3GRD A;  2XSH B;  3FSD A;  3KE7 A;  3OWY A;  5KP3 A;  4IIA A;  3S5C A;  3F14 A;  1UUV B;  3EQQ B;  1GY7 A;  3JUP A;  3LZA A;  4I4K A;  1ZX2 A;  3EBY A;  4HJL B;  3I0Y A;  1DMQ A;  8CHO A;  2B24 B;  2HMJ B;  4LEH A;  5CXO A;  4WYK B;  5KP1 A;  2I9W A;  4HVN A;  4R9L A;  2HML B;  2YFJ B;  2HMK B;  3EN8 A;  3KSP A;  3CNX A;  1W01 A;  2R4I A;  1A2K A;  4K1U A;  2XSO B;  1E3V A;  4XBT A;  5HGR A;  1EA2 A;  2BMR B;  1EG9 B;  3B4P A;  4XM4 A;  4HM0 B;  3WMD A;  1OF5 B;  4R1K A;  3VGN A;  4FCJ A;  3NUV A;  4KVH A;  3SOY A;  2RGQ A;  3SED A;  2BMQ B;  3CU3 A;  3FGY A;  3JUQ A;  4WWU C;  2GEY A;  4WP5 A;  4LMI A;  3F40 A;  3NBR A;  4XDW A;  3DZL A;  3G8Z A;  1AR0 A;  5JPP A;  3BLZ A;  1HKX A;  3ECF A;  3MYT A;  4OUQ A;  1OGX A;  1W00 A;  4HZ9 B;  3OXA A;  1CQS A;  2HMM B;  3NHX A;  1IDP A;  4J9A A;  2GBX B;  3EHC A;  4X2H A;  3DXO A;  3ROB A;  4MJD A;  7STD A;  3DMC A;  5KP4 A;  2Z7A A;  2RCD A;  3B8L A;  5DRV A;  1JB2 A;  1O7H B;  2GEX A;  3F7X A;  3HX8 A;  2HMN B;  3JUO A;  1OH0 A;  3DUK A;  4PEJ A;  3T8U A;  5BXQ A;  4R9K A;  5IEP A;  4GB5 A;  3MG3 A;  4H3U A;  5JPU A;  2B1X B;  6STD A;  5FW5 A;  3G16 A;  5IG4 A;  2OWP A;  4HM7 B;  2XR8 B;  4XBY A;  1E3R A;  1OPY A;  2K54 A;  4HM2 B;  5CF1 A;  3FKA A;  3K0Z A;  3FZW A;  1QMA A;  2CKF B;  1OHO A;  3B4O A;  2YFL B;  3GWR A;  3MHE A;  4HM8 B;  5AII A;  5AIF A;  1Q40 A;  3KKG A;  5AIG A;  1W6Y A;  3FLJ A;  3RGA A;  5CF2 A;  3VSY A;  1C7H A;  1OCV A;  1SJW A;  2QGU A;  1Q42 A;  1JN5 A;  2Z77 A;  3K7C A;  3OV4 A;  4ORL A;  3RGR A;  1NDO B;  1JN5 B;  2BNG A;  4HM4 B;  4XDV A;  3OWU A;  3MG2 A;  1GY6 A;  3Q90 A;  3LYG A;  3MKI A;  4HKV B;  4WYK A;  2BMO B;  2F98 A;  5AEW B;  1TP6 A;  3B7C A;  1ASK A;  1VZZ A;  1UUW B;  3HK4 A;  5D83 A;  5IG5 A;  1OF5 A;  3HZP A;  3BB9 A;  3CPO A;  1ULI B;  3MG1 A;  5DRE A;  1E97 A;  5G2G A;  1JKG A;  3EJV A;  3FF2 A;  3H51 A;  3OWS A;  3GZY B;  3D9R A;  3FF0 A;  3SOA A;  3MSO A;  2F99 A;  3T8N A;  4XB5 A;  4CDL A; 
#chains in the Genus database with same CATH topology
 1I2G A;  1DMM A;  3GZX B;  3WOE B;  1EKM A;  4N6O B;  3KZT A;  1SII A;  3X40 A;  2KAA A;  4O02 B;  3WDG B;  1HZ1 A;  2Q07 A;  3OX9 A;  4BL3 A;  3IJE B;  1DE3 A;  1YJW 3;  1OAC A;  4K1V A;  3LH4 A;  1FGM A;  1TTO A;  2ZDJ A;  4NHF A;  1Q81 4;  2OCT A;  4Q53 A;  2GU3 A;  2GSP A;  3NV0 A;  5IEN A;  1RNB A;  3NM7 A;  4OVM A;  1K9M 4;  1Q7H A;  1MGW A;  4L8P A;  1Q86 4;  2L4V A;  5BVB A;  1Z1S A;  2PZV A;  2UGI A;  3PYJ A;  3D3L A;  3NBB A;  3DM8 A;  1FA3 A;  4HBR A;  1OHP A;  3CCU 3;  2UX0 A;  1GOU A;  5AI1 A;  2F56 A;  1C54 A;  2ML6 A;  2XEP A;  1IT8 A;  4OK0 A;  2XRX B;  2J8X B;  1MNL A;  4RZM A;  2F4Y A;  1X1Y A;  3F7S A;  1OGZ A;  1YNV X;  2JQ5 A;  3CCM 3;  1OHS A;  2STD A;  1W02 A;  4MMY B;  3H3H A;  4AKY A;  1GD3 A;  2P05 A;  4FCM A;  3PGB A;  4MMZ B;  3SXX A;  4DKI A;  1BSC A;  3S5C A;  1DVC A;  2W0Q A;  1RHL A;  1GY7 A;  1M9G A;  2RNT A;  1X1X A;  1M90 4;  2W04 A;  4HJL B;  1YJ9 3;  1A2V A;  1DMQ A;  3I0Y A;  8CHO A;  5CXO A;  3KN4 A;  2I9W A;  5KP1 A;  2HML B;  2OTL 3;  3EN8 A;  3CNX A;  1W01 A;  1VQ8 3;  2H0I A;  4FMD A;  1VQ5 3;  1ZS7 A;  2BT3 A;  3SOY A;  1RGH A;  2BU4 A;  4FMA A;  2RGQ A;  1BUJ A;  4WWU C;  1N5H A;  1LQM B;  1B2Z A;  4LMI A;  1RDS A;  4MMX B;  3NBR A;  3DZL A;  1YVS A;  2OQE C;  5JPP A;  3NX0 A;  1UCL A;  1HKX A;  1YI2 3;  1GOV A;  3ECF A;  4OUQ A;  1KD1 4;  1W00 A;  1IVV A;  1TRP A;  1AVL A;  4HZ9 B;  1CQS A;  2XFS A;  2KF3 A;  5KP4 A;  3EHC A;  3DXO A;  3B8L A;  4PEJ A;  2GEX A;  3F7X A;  1JBT A;  1D6Z A;  1LQG C;  1MWR A;  1W4N A;  3SX1 A;  1B2U A;  5IEP A;  4CPK A;  4O2H A;  3DGN A;  1BRJ A;  5IG4 A;  2OWP A;  4AEQ A;  1YGE A;  1OPY A;  4HM2 B;  1W7C A;  3K63 A;  3FKA A;  3B4O A;  5AIF A;  1OHO A;  3PCS A;  2YFL B;  3MHE A;  5LC6 A;  5BU4 A;  1B2M A;  3FG4 A;  1RGL A;  1DET A;  3K7C A;  1I8V A;  2Z77 A;  1Q42 A;  1JN5 A;  4ORL A;  3V92 A;  3LTB A;  1Y4K A;  3N9H A;  1VQ9 3;  1BOX A;  2SAR A;  1JN5 B;  1JV2 B;  3K9M C;  4GSP A;  2BNG A;  4XDV A;  1S72 3;  1YHQ 3;  5M18 A;  3MG2 A;  3RDE A;  2Z6B A;  2WGO A;  1BNJ A;  1VZZ A;  1WNH A;  1CEW I;  3KCH A;  1UDI I;  1OF5 A;  4LZI A;  4RNT A;  4BL2 A;  1MWS A;  1ULI B;  2BO9 B;  2JDI H;  3OWS A;  2KRT A;  1FGO A;  3D9R A;  3LTA A;  3SOA A;  1I2F A;  1US1 A;  3T8N A;  4CDL A;  3AHW A;  3UNL A;  1YIT 3;  3EBT A;  1STD A;  3AMO A;  2INX A;  3E99 A;  3DGL A;  3EX9 A;  1RMS A;  1BIR A;  2P09 A;  2IUJ A;  3F9S A;  2KXG A;  1D6Y A;  3STD A;  3V98 A;  2RFR A;  4O8S A;  1JB5 A;  1WMO A;  2QIY A;  2ZHX B;  4FCZ A;  2OOV A;  1UW1 A;  4EYC A;  1JNQ A;  1JB4 A;  1S5A A;  5STD A;  1IQX A;  2O9U X;  5AIH A;  1IVU A;  1IVX A;  1LOW A;  1FYS A;  1NU3 A;  1U5O A;  2Z76 A;  1NB3 I;  5CK6 A;  1O7W B;  1BNI A;  3GZB A;  3QRD A;  2OTJ 3;  4BTW A;  1GS3 A;  1YGW A;  3EC9 A;  3CME 3;  1N8R 4;  1WMP A;  2QEX 3;  1NWW A;  2C10 A;  1V58 A;  5IF6 A;  3VF1 A;  3JUN A;  3G0K A;  1ISK A;  1BSA A;  1WQL B;  1QVG 2;  2YFI B;  2GXF A;  1TFK A;  1UGI A;  3DGM A;  2P38 A;  3PZW A;  4BIR A;  4HM5 B;  2C11 A;  4STD A;  1Q40 B;  2CHC A;  2XFT A;  3LTD A;  1JKG B;  1VQN 3;  1GOY A;  3GRD A;  3FSD A;  2PNC A;  1IV9 A;  4IIA A;  1VQ6 3;  3SYU A;  2BIR A;  1ROV A;  3LZA A;  1MOL A;  3ZG5 A;  1BRN L;  3PCR A;  2B24 B;  2HMJ B;  3A5E A;  4LEH A;  2KF5 A;  3LOY A;  4WYK B;  4KZ1 A;  4R9L A;  2YFJ B;  2HMK B;  5IW9 A;  3KSP A;  5HGR A;  1I0X A;  1QAF A;  3X42 A;  2E2U A;  1EA2 A;  3B4P A;  2SBL A;  4HM0 B;  4JRF A;  3WOF B;  3T0U A;  1V57 A;  4FCJ A;  3LT8 A;  3NUV A;  5JBS A;  3SED A;  3FGY A;  3JUQ A;  4RNY A;  2GEY A;  1M1K 4;  4I5Q A;  4XDW A;  2ZL8 A;  1T5Y A;  2CG0 A;  1W6G A;  1AR0 A;  5HOH A;  1FGR A;  1RGK A;  3AMO B;  1MWT A;  3ZFZ A;  1TRQ A;  2CH9 A;  3CC4 3;  3NQZ A;  3V99 A;  1B21 A;  3OXA A;  4NRE A;  2HMM B;  3G6E 3;  1W5Z A;  1TU5 A;  1IT7 A;  1ROA A;  2W9P A;  3DMC A;  2RCD A;  5DRV A;  1O7H B;  1FGQ A;  1IVW A;  3JUO A;  8RNT A;  4GL6 A;  2FXT A;  4J5K A;  1N8Q A;  4R9K A;  1DYU A;  3MG3 A;  1BRK A;  2B1X B;  1RRL A;  6STD A;  1J2B A;  3MPH A;  2XR8 B;  1E3R A;  2AAE A;  1BSB A;  4J8T A;  1D6U A;  2W03 A;  1GMQ A;  3RGA A;  3UL5 A;  1A67 A;  1RGC A;  5AIG A;  5CF2 A;  1OCV A;  1FGT A;  1SJW A;  3LXU X;  4FMB A;  3RGR A;  4K90 B;  2YX9 A;  3BIR A;  3UB1 A;  1AVK A;  3D5I A;  2IUK A;  4HM4 B;  1BU4 A;  1HU9 A;  3CC2 3;  1IQ8 A;  2CK3 H;  1GY6 A;  2CX1 A;  1RLS A;  1RSN A;  2AAD A;  3K5T A;  3S29 A;  2H0H A;  5GSP A;  5AEW B;  3B7C A;  1RGA A;  1BRG A;  5M19 A;  2MF7 A;  3BND A;  3HK4 A;  2K0M A;  3X3X A;  1RCK A;  5G2G A;  5AYS C;  3MG1 A;  2XH9 A;  1JKG A;  1BRH A;  1N9J A;  3BU4 A;  2F99 A;  2OQE A;  1G96 A;  5CLK A;  5IG0 A;  1LVN A;  1BNR A;  3A76 A;  4N3V A;  1N9E A;  2KF6 A;  1AV4 A;  4HM3 B;  1SQW A;  2HMO B;  3FCS B;  1A2P A;  3IPT A;  2WOF A;  3ALA A;  1JZD A;  5RNT A;  3CPW 2;  1YJN 3;  1N5P A;  1YVB I;  3O8Y A;  1FW7 A;  3I56 3;  1I3F A;  1MGR A;  1GY5 A;  1GYB A;  5G1L A;  1RNT A;  5IEO A;  1BUQ A;  1FUS A;  3EF8 A;  4LYL B;  4XBX A;  1RN1 A;  5BIR A;  1VQL 3;  3ZG0 A;  4X2O A;  1VQ7 3;  2GBW B;  3G4S 3;  2CX0 A;  1EEJ A;  5EVH A;  3PXM A;  2L1S A;  1R4Y A;  2CW9 A;  1JRQ A;  1JJ2 2;  1G02 A;  1LOX A;  1W6C A;  3CCE 3;  3UJM A;  5FGO A;  3AGO A;  1RN4 A;  1STF I;  1RRH A;  1ULJ B;  2O3O A;  4HZB B;  1KQS 2;  1O7G B;  1GSP A;  1T3B A;  2A15 A;  2CFK A;  2W2C A;  2QA4 3;  3CMA 3;  1ZO2 A;  1W2Z A;  3WR2 A;  1OUN A;  1K41 A;  2E2V A;  1SAR A;  4N6V 0;  3GSP A;  1K73 4;  1BRS A;  3FH1 A;  4HYZ A;  2FNQ A;  4KFD A;  3CNM A;  3AGN A;  4EC6 A;  1BNE A;  1GMP A;  3JUM A;  4HM1 B;  5D81 A;  2LQV A;  5I97 A;  4IT7 A;  4N6N B;  1I0V A;  6RNT A;  4FMC A;  1PU4 A;  1CH0 A;  3IMA B;  3JUP A;  7RNT A;  1BVI A;  1ZX2 A;  3EBY A;  1EQK A;  1VQQ A;  1LXE A;  2CFL A;  4HVN A;  5EQL A;  1TIJ A;  4XBT A;  4K1U A;  2R4I A;  1A2K A;  3X3Z A;  3WMD A;  1EG9 B;  2BMR B;  3Q3F A;  1OF5 B;  4R1K A;  5G1K A;  1PYL A;  4EBG A;  4EXR A;  2ZA4 A;  3CU3 A;  4CJN A;  2E2T A;  4O3V A;  3F40 A;  1B2S A;  4EV5 A;  3G8Z A;  3BLZ A;  3Q1C A;  3HIG A;  2M7O A;  4R80 A;  2CWT A;  1IDP A;  4MEI A;  1BNF A;  1UUG B;  2GBX B;  7STD A;  4MJD A;  2Z7A A;  2FGT A;  4EV2 A;  1JB2 A;  2UUG C;  3T8U A;  1LNI A;  3DUK A;  3CCQ 3;  1BGS A;  1MWU A;  4GB5 A;  1A90 A;  1VQO 3;  3SLU A;  4NPB A;  1EUI C;  3X41 A;  3G16 A;  4BU4 A;  1T2H A;  4HM7 B;  4RBN A;  4XBY A;  2K54 A;  1RTU A;  1RJO A;  3HII A;  5CF1 A;  3KII A;  2CFD A;  1QMA A;  2CKF B;  3FZW A;  3GWR A;  4GHO A;  5AII A;  3NBJ A;  4HM8 B;  3KKG A;  2V1L A;  4KFF A;  3VSY A;  3OV4 A;  3UL6 A;  2XF3 A;  1QVF 2;  1I2E A;  2D42 A;  2CFW A;  2Y74 A;  3KFQ C;  4H61 A;  2CG1 A;  1VQK 3;  2IYJ A;  1IV7 A;  3OWU A;  1X1U A;  2H0G A;  2MC8 A;  3FG3 A;  1CYV A;  3Q90 A;  7GSP A;  3MKI A;  3OW2 2;  3X3Y A;  2BMO B;  2F98 A;  3LTC A;  4KFE A;  4LSO A;  1LNH A;  1QAL A;  3SVA A;  3U97 A;  1FUT A;  5IG5 A;  3S67 A;  5EEO A;  3AHS A;  5M1A A;  1BSE A;  1BNS A;  1RGE A;  2WO0 A;  3BB9 A;  3CPO A;  2GU1 A;  1K8A 4;  1E97 A;  1L5G B;  3EJV A;  3H51 A;  3CC7 3;  3FG1 A;  3GZY B;  1IK3 A;  3FF0 A;  3CCS 3;  4XB5 A;  1KC8 4;  1LRA A;  1RGF A;  4U13 A;  4JF8 A;  1X1W A;  3CCR 3;  3M8C A;  3WA2 X;  1SPU A;  4N6M A;  1BAN A;  5AEU B;  1R4C A;  3F8X A;  1O7N B;  4R4K A;  4HOH A;  3N54 B;  3L0R A;  2F5M A;  1Q9E A;  1BSD A;  3NQY A;  1BNG A;  1Q7Y 4;  2W56 A;  2BHM A;  1RN7 A;  4L7K A;  1RGG A;  1UGH I;  2W56 B;  3NM2 A;  1TUH A;  3PS8 A;  2HOH A;  3D5G A;  2XGL A;  5IG3 A;  1TJD A;  5TGN A;  3CD6 3;  2IA7 A;  1PY3 A;  5LC7 A;  3D79 A;  3EB8 A;  2F86 B;  3WA3 A;  3DGO A;  3NV0 B;  1RKY A;  3S28 A;  3CCV 3;  1IU7 A;  1FZU A;  1UCK A;  2IMJ A;  4HAA A;  5IER A;  2RSX A;  1B20 A;  1U8C B;  4J5G A;  2KCD A;  3GZR A;  3F8H A;  2D1W A;  2KF4 A;  1DMN A;  3CCJ 3;  1TFO A;  4EW5 A;  3EN1 B;  1YIJ 3;  4LGQ A;  1HYF A;  4IPB A;  2CWV A;  1Q82 4;  1O7M B;  2CWU A;  1JBS A;  5D82 A;  2P0M A;  1QAK A;  3NXJ A;  1QJG A;  3BNE A;  4L8O A;  1T2I A;  2ML5 A;  1O7P B;  4HM6 B;  1I70 A;  3WOD G;  1NJI 4;  3ER7 A;  1JBR A;  2R41 A;  2CFG A;  1ZGX A;  1I3I A;  2XGN A;  2XSH B;  3KE7 A;  1JZO A;  3OWY A;  5KP3 A;  3RNT A;  3F14 A;  3URP A;  2P0X A;  1UUV B;  3EQQ B;  4I4K A;  3S27 A;  1LOV A;  1AQZ A;  4N6T A;  1UCI A;  2W6J H;  1BRI A;  1SIH A;  4FR9 A;  1VQP 3;  2RBI A;  1CYU A;  2XSO B;  1E3V A;  4G1M B;  3J7Y d;  4XM4 A;  3DGY A;  1BAO A;  2WGQ A;  3VGN A;  1VQM 3;  2W9Q A;  4KVH A;  2K3D A;  3JVC A;  2BMQ B;  1GMR A;  1V74 A;  2OOV C;  3GAX A;  4WP5 A;  4AKZ A;  3TDG A;  1NB5 I;  3BNB A;  1GD4 A;  1KWI A;  4CCV A;  1WTH A;  3I55 3;  1DVD A;  3N8B A;  3MYT A;  4RNZ A;  1FUW A;  1OGX A;  4N6U A;  2LYX A;  6GSP A;  3D4A A;  3WHO A;  4X2H A;  1K28 A;  1B2X A;  3NHX A;  4J9A A;  5ELJ A;  1M1X B;  4ZM8 A;  3ROB A;  4BTX A;  1W2B 2;  1NO3 A;  3HX8 A;  5BXQ A;  2HMN B;  1OH0 A;  5AYR B;  1IYY A;  2F5W A;  4H3U A;  2CIU A;  1UI7 A;  3DY5 A;  4WHA A;  5A0O B;  5JPU A;  3EE1 A;  5FW5 A;  5ELU A;  3BNC A;  1UI8 A;  3MWZ A;  3HI7 A;  1F8N A;  3K0Z A;  1PFP A;  1KSI A;  4KT3 B;  1Q40 A;  1W6Y A;  3FLJ A;  9RNT A;  1B3S A;  4WFO A;  1C7H A;  2QGU A;  1G0T A;  1IQY A;  3Q2P A;  1VQ4 3;  3HOH A;  2Y73 A;  3LT9 A;  2CC3 A;  2C4B A;  1NDO B;  4BTY A;  2IY2 A;  1LOY A;  4HKV B;  3LYG A;  3DH2 A;  4QWT A;  4WYK A;  1B27 A;  3KSE D;  3QK9 A;  1TP6 A;  1ASK A;  3CXC 2;  1UUW B;  1WMN A;  3CCL 3;  4ILF A;  1UCJ A;  5D83 A;  4K61 A;  3HZP A;  4TX4 A;  5DRE A;  1AY7 A;  3LML A;  1RCL A;  1NNV A;  3G71 3;  3FF2 A;  3MSO A;  4N6L A;  3U1W A;  2WOH A; 
#chains in the Genus database with same CATH homology
 1DMM A;  3GZX B;  3WOE B;  1EKM A;  4N6O B;  3KZT A;  1SII A;  3X40 A;  3WDG B;  4O02 B;  2Q07 A;  3OX9 A;  3IJE B;  1YJW 3;  1OAC A;  4K1V A;  3LH4 A;  1FGM A;  2ZDJ A;  4NHF A;  1Q81 4;  2OCT A;  4Q53 A;  2GU3 A;  5IEN A;  3NV0 A;  3NM7 A;  4OVM A;  1K9M 4;  4L8P A;  1Q86 4;  2L4V A;  5BVB A;  1Z1S A;  2PZV A;  3PYJ A;  3D3L A;  3NBB A;  3DM8 A;  1FA3 A;  4HBR A;  1OHP A;  3CCU 3;  2UX0 A;  5AI1 A;  2ML6 A;  2XEP A;  1IT8 A;  4OK0 A;  2XRX B;  1MNL A;  4RZM A;  3F7S A;  1OGZ A;  2JQ5 A;  3CCM 3;  1OHS A;  2STD A;  1W02 A;  4MMY B;  3H3H A;  4AKY A;  1GD3 A;  2P05 A;  4FCM A;  3PGB A;  4MMZ B;  3SXX A;  3S5C A;  1DVC A;  2W0Q A;  1GY7 A;  1M9G A;  1M90 4;  2W04 A;  4HJL B;  1YJ9 3;  1A2V A;  1DMQ A;  3I0Y A;  8CHO A;  5CXO A;  3KN4 A;  2I9W A;  5KP1 A;  2HML B;  2OTL 3;  3EN8 A;  3CNX A;  1W01 A;  1VQ8 3;  4FMD A;  1VQ5 3;  2BT3 A;  3SOY A;  4FMA A;  2RGQ A;  4WWU C;  1N5H A;  4LMI A;  4MMX B;  3NBR A;  3DZL A;  2OQE C;  5JPP A;  3NX0 A;  1HKX A;  1YI2 3;  3ECF A;  4OUQ A;  1KD1 4;  1W00 A;  1IVV A;  1AVL A;  4HZ9 B;  1CQS A;  2XFS A;  5KP4 A;  3EHC A;  3DXO A;  3B8L A;  4PEJ A;  2GEX A;  3F7X A;  1D6Z A;  1W4N A;  3SX1 A;  5IEP A;  4O2H A;  3DGN A;  5IG4 A;  2OWP A;  4AEQ A;  1YGE A;  1OPY A;  4HM2 B;  1W7C A;  3K63 A;  3FKA A;  3B4O A;  5AIF A;  1OHO A;  3PCS A;  2YFL B;  3MHE A;  5LC6 A;  3FG4 A;  3K7C A;  3V92 A;  2Z77 A;  1Q42 A;  1JN5 A;  4ORL A;  3LTB A;  1Y4K A;  3N9H A;  1VQ9 3;  1JN5 B;  1JV2 B;  3K9M C;  1S72 3;  2BNG A;  4XDV A;  1YHQ 3;  3MG2 A;  3RDE A;  2Z6B A;  2WGO A;  1VZZ A;  1WNH A;  1CEW I;  4LZI A;  1OF5 A;  1ULI B;  2BO9 B;  2JDI H;  3OWS A;  2KRT A;  1FGO A;  3D9R A;  3LTA A;  3SOA A;  1US1 A;  3T8N A;  4CDL A;  3UNL A;  1YIT 3;  3EBT A;  1STD A;  3AMO A;  2INX A;  3E99 A;  3DGL A;  3EX9 A;  2P09 A;  2IUJ A;  3F9S A;  2KXG A;  1D6Y A;  3STD A;  3V98 A;  2RFR A;  4O8S A;  1JB5 A;  1WMO A;  2QIY A;  4FCZ A;  2OOV A;  1UW1 A;  4EYC A;  1JNQ A;  1JB4 A;  1S5A A;  5STD A;  1IQX A;  2O9U X;  5AIH A;  1IVU A;  1IVX A;  1NU3 A;  1U5O A;  2Z76 A;  1NB3 I;  5CK6 A;  1O7W B;  2OTJ 3;  3GZB A;  3QRD A;  4BTW A;  1GS3 A;  3EC9 A;  3CME 3;  1N8R 4;  1WMP A;  2QEX 3;  1NWW A;  2C10 A;  5IF6 A;  3VF1 A;  3JUN A;  3G0K A;  1ISK A;  1WQL B;  1QVG 2;  2YFI B;  2GXF A;  1TFK A;  3DGM A;  2P38 A;  3PZW A;  4HM5 B;  2C11 A;  4STD A;  1Q40 B;  2CHC A;  2XFT A;  3LTD A;  1JKG B;  1VQN 3;  3GRD A;  3FSD A;  2PNC A;  1IV9 A;  4IIA A;  1VQ6 3;  1ROV A;  3LZA A;  1MOL A;  3PCR A;  2B24 B;  2HMJ B;  4LEH A;  4WYK B;  3LOY A;  4KZ1 A;  4R9L A;  2YFJ B;  2HMK B;  5IW9 A;  3KSP A;  5HGR A;  1QAF A;  3X42 A;  2E2U A;  1EA2 A;  3B4P A;  2SBL A;  4HM0 B;  4JRF A;  3WOF B;  3T0U A;  4FCJ A;  3LT8 A;  3NUV A;  5JBS A;  3SED A;  3FGY A;  3JUQ A;  4RNY A;  2GEY A;  1M1K 4;  4XDW A;  2ZL8 A;  1T5Y A;  2CG0 A;  1W6G A;  1AR0 A;  1FGR A;  3AMO B;  2CH9 A;  3CC4 3;  3NQZ A;  3V99 A;  3OXA A;  4NRE A;  2HMM B;  3G6E 3;  1W5Z A;  1TU5 A;  1IT7 A;  3DMC A;  1ROA A;  2W9P A;  2RCD A;  5DRV A;  1O7H B;  1FGQ A;  1IVW A;  3JUO A;  4GL6 A;  2FXT A;  1N8Q A;  4R9K A;  1DYU A;  3MG3 A;  2B1X B;  1RRL A;  6STD A;  1J2B A;  3MPH A;  2XR8 B;  1E3R A;  4J8T A;  1D6U A;  2W03 A;  3RGA A;  3UL5 A;  1A67 A;  5AIG A;  5CF2 A;  1OCV A;  1FGT A;  1SJW A;  3LXU X;  4FMB A;  3RGR A;  4K90 B;  2YX9 A;  3UB1 A;  1AVK A;  2IUK A;  4HM4 B;  1HU9 A;  3CC2 3;  1IQ8 A;  2CK3 H;  1GY6 A;  3K5T A;  3S29 A;  5AEW B;  3B7C A;  2MF7 A;  3BND A;  3HK4 A;  2K0M A;  3X3X A;  5G2G A;  5AYS C;  3MG1 A;  2XH9 A;  1JKG A;  1N9J A;  2F99 A;  2OQE A;  1G96 A;  5CLK A;  5IG0 A;  1LVN A;  3A76 A;  4N3V A;  1N9E A;  4HM3 B;  1AV4 A;  1SQW A;  2HMO B;  3FCS B;  3IPT A;  2WOF A;  3ALA A;  3CPW 2;  1YJN 3;  1N5P A;  1YVB I;  3O8Y A;  3I56 3;  1GY5 A;  1GYB A;  5IEO A;  1BUQ A;  3EF8 A;  4XBX A;  1VQL 3;  4X2O A;  1VQ7 3;  2GBW B;  3G4S 3;  5EVH A;  3PXM A;  2CW9 A;  1JRQ A;  1JJ2 2;  1LOX A;  1W6C A;  3CCE 3;  3UJM A;  5FGO A;  1STF I;  1ULJ B;  1RRH A;  4HZB B;  2O3O A;  1KQS 2;  1O7G B;  2A15 A;  2CFK A;  2W2C A;  2QA4 3;  3CMA 3;  1ZO2 A;  1W2Z A;  1OUN A;  1K41 A;  2E2V A;  4N6V 0;  1K73 4;  3FH1 A;  4HYZ A;  2FNQ A;  4KFD A;  3CNM A;  4EC6 A;  4HM1 B;  3JUM A;  5D81 A;  2LQV A;  5I97 A;  4IT7 A;  4N6N B;  4FMC A;  1PU4 A;  3IMA B;  3JUP A;  1ZX2 A;  3EBY A;  1EQK A;  1LXE A;  2CFL A;  4HVN A;  5EQL A;  1TIJ A;  4XBT A;  4K1U A;  2R4I A;  1A2K A;  3X3Z A;  3WMD A;  1EG9 B;  2BMR B;  1OF5 B;  4R1K A;  4EBG A;  4EXR A;  3CU3 A;  2E2T A;  4O3V A;  3F40 A;  4EV5 A;  3G8Z A;  3BLZ A;  3Q1C A;  3HIG A;  2M7O A;  4R80 A;  2CWT A;  1IDP A;  4MEI A;  2GBX B;  7STD A;  4MJD A;  2Z7A A;  2FGT A;  4EV2 A;  1JB2 A;  3T8U A;  3DUK A;  3CCQ 3;  4GB5 A;  1A90 A;  1VQO 3;  3SLU A;  3X41 A;  3G16 A;  4HM7 B;  4RBN A;  4XBY A;  2K54 A;  1RJO A;  3HII A;  5CF1 A;  3KII A;  2CFD A;  1QMA A;  2CKF B;  3FZW A;  3GWR A;  5AII A;  3NBJ A;  4HM8 B;  3KKG A;  2V1L A;  4KFF A;  3VSY A;  3OV4 A;  3UL6 A;  2XF3 A;  1QVF 2;  2D42 A;  2CFW A;  2Y74 A;  3KFQ C;  4H61 A;  2CG1 A;  1VQK 3;  1IV7 A;  3OWU A;  2MC8 A;  3OW2 2;  3FG3 A;  1CYV A;  3Q90 A;  3MKI A;  3X3Y A;  2BMO B;  2F98 A;  3LTC A;  4KFE A;  4LSO A;  1LNH A;  1QAL A;  3SVA A;  3U97 A;  5IG5 A;  3S67 A;  5EEO A;  1K8A 4;  2WO0 A;  3BB9 A;  3CPO A;  2GU1 A;  1E97 A;  1L5G B;  3EJV A;  3H51 A;  3CC7 3;  3FG1 A;  3GZY B;  1IK3 A;  3FF0 A;  3CCS 3;  4XB5 A;  1KC8 4;  4U13 A;  4JF8 A;  3CCR 3;  3M8C A;  3WA2 X;  1SPU A;  4N6M A;  5AEU B;  1R4C A;  3F8X A;  1O7N B;  4R4K A;  3N54 B;  3L0R A;  3NQY A;  1Q7Y 4;  2W56 A;  2BHM A;  1RN7 A;  4L7K A;  2W56 B;  3NM2 A;  1TUH A;  3PS8 A;  2XGL A;  5IG3 A;  5TGN A;  3CD6 3;  2IA7 A;  5LC7 A;  3EB8 A;  3WA3 A;  2F86 B;  3DGO A;  3NV0 B;  1RKY A;  3S28 A;  3CCV 3;  1IU7 A;  2IMJ A;  5IER A;  2RSX A;  1U8C B;  2KCD A;  3GZR A;  3F8H A;  2D1W A;  3CCJ 3;  1DMN A;  1TFO A;  3EN1 B;  1YIJ 3;  4LGQ A;  4IPB A;  2CWV A;  1Q82 4;  1O7M B;  2CWU A;  5D82 A;  2P0M A;  1QAK A;  3NXJ A;  1QJG A;  3BNE A;  4L8O A;  2ML5 A;  1O7P B;  4HM6 B;  3WOD G;  1NJI 4;  3ER7 A;  2CFG A;  2XSH B;  2XGN A;  3KE7 A;  3OWY A;  5KP3 A;  3F14 A;  2P0X A;  1UUV B;  3EQQ B;  4I4K A;  3S27 A;  4N6T A;  2W6J H;  1SIH A;  4FR9 A;  1VQP 3;  1CYU A;  2XSO B;  1E3V A;  4G1M B;  3J7Y d;  4XM4 A;  2WGQ A;  3VGN A;  1VQM 3;  2W9Q A;  4KVH A;  3JVC A;  2BMQ B;  1V74 A;  2OOV C;  3GAX A;  4WP5 A;  4AKZ A;  3TDG A;  1NB5 I;  3BNB A;  1GD4 A;  1KWI A;  4CCV A;  1WTH A;  3I55 3;  1DVD A;  3N8B A;  3MYT A;  4RNZ A;  1FUW A;  1OGX A;  4N6U A;  2LYX A;  4X2H A;  1K28 A;  3NHX A;  4J9A A;  5ELJ A;  1M1X B;  4ZM8 A;  3ROB A;  4BTX A;  1W2B 2;  1NO3 A;  3HX8 A;  5BXQ A;  2HMN B;  1OH0 A;  5AYR B;  4H3U A;  2CIU A;  1UI7 A;  3DY5 A;  4WHA A;  5A0O B;  5JPU A;  3EE1 A;  5FW5 A;  5ELU A;  3BNC A;  1UI8 A;  3MWZ A;  3HI7 A;  1F8N A;  3K0Z A;  1PFP A;  1KSI A;  1Q40 A;  1W6Y A;  3FLJ A;  4WFO A;  1C7H A;  2QGU A;  1IQY A;  3Q2P A;  1VQ4 3;  2Y73 A;  3LT9 A;  2CC3 A;  1NDO B;  4BTY A;  4HKV B;  3LYG A;  4QWT A;  4WYK A;  3KSE D;  3QK9 A;  1TP6 A;  1ASK A;  3CXC 2;  1UUW B;  1WMN A;  3CCL 3;  5D83 A;  4K61 A;  3HZP A;  4TX4 A;  5DRE A;  3LML A;  3G71 3;  3FF2 A;  3MSO A;  4N6L A;  3U1W A;  2WOH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...