3NBRA

Crystal structure of ketosteroid isomerase d38np39gd99n from pseudomonas testosteroni (tksi) with 4-androstene-3,17-dione bound
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
NTPEHMTAVVQRYVAALNAGDLDGIVALFADDATVENGVGSEPRSGTAAIREFYANSLKLPLAVELTQEVRAVANEAAFAFTVSFEYQGRKTVVAPINHFRFNGAGKVVSMRALFGEKNIHAGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Steroid Delta-isomerase
publication title Crystal Structure of Ketosteroid Isomerase D38NP39GD99N from Pseudomonas Testosteroni (tKSI) with 4-Androstene-3,17-dione Bound
rcsb
source organism Comamonas testosteroni
molecule tags Isomerase
total genus 31
structure length 124
sequence length 124
ec nomenclature ec 5.3.3.1: Steroid Delta-isomerase.
pdb deposition date 2010-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 3nbrA00
1O7HB 2BNGA 3GRDA 3NM2A 3SOAA 1W00A 4CDLA 3KE7A 2BMRB 3JUQA 4FCJA 4STDA 3NBRA 5JPPA 1ZX2A 2B24B 3OV4A 2GEXA 3B7CA 2Z76A 3G8ZA 2PZVA 3GZRA 5CF1A 4XDWA 3FSDA 7STDA 2F99A 2IMJA 3F9SA 1JB4A 5KP3A 5AEUB 1DMNA 3F8HA 4HM3B 1OH0A 2XRXB 2XSHB 6STDA 1ULIB 2YFIB 4H3UA 3E99A 3F7SA 2RFRA 4XDVA 4KVHA 1UUVB 4HM8B 1STDA 5IG5A 3M8CA 5D83A 3EN1B 2I9WA 1GY7A 1EG9B 4XBXA 5BXQA 3NV0A 3JUMA 4HM5B 3KKGA 1U5OA 2YFJB 2HMMB 2GBWB 3DMCA 8CHOA 4HVNA 1QJGA 1UUWB 4L8PA 3FLJA 2RGQA 1ISKA 3DM8A 1O7NB 3KSPA 1K41A 4WWUC 5IEPA 2INXA 2HMNB 1OGXA 5IF6A 4XM4A 5KP4A 1OF5A 3EX9A 3HX8A 2K54A 2HMOB 3VGNA 4RZMA 1W01A 2XR8B 1OF5B 4PEJA 3FF0A 1OHSA 3NHXA 3STDA 3FZWA 1VZZA 1NWWA 3RGAA 4LGQA 2R4IA 2JQ5A 3F14A 3GZYB 3G0KA 3FKAA 3LZAA 3SEDA 1O7MB 3DXOA 4R1KA 3MG3A 3MG1A 5AIFA 2HMLB 1E3RA 3NXJA 3MG2A 4I4KA 1Z1SA 5DREA 1AR0A 2QIYA 5IG4A 4HM6B 4HJLB 4LEHA 1A2KA 4R9LA 3H51A 5G2GA 3T8UA 2YFLB 1ULJB 1OPYA 5AIIA 1Q42A 1Q40B 5STDA 2GXFA 1JB5A 5TGNA 4OVMA 4K1UA 2RCDA 3ER7A 1GS3A 3F40A 3CNXA 5D82A 4HZBB 1OHPA 3VSYA 3ECFA 1S5AA 3FH1A 4HM1B 3EBTA 4X2OA 5CXOA 3S5CA 3H3HA 3BB9A 4HM2B 4XB5A 3LYGA 2A15A 1WQLB 3I0YA 1GYBA 1JKGA 1OHOA 3JUPA 1JKGB 3OWYA 4ORLA 3NUVA 3K7CA 3T8NA 1TUHA 4LMIA 5AIGA 1SJWA 3JUNA 3B8LA 4J9AA 4X2HA 3DZLA 2W2CA 4L8OA 2OWPA 5IEOA 2UX0A 3EJVA 4HM4B 3MYTA 3HK4A 2BMQB 1DMQA 1W02A 5CF2A 3GZXB 1QMAA 5AIHA 1C7HA 5JPUA 1NDOB 5CLKA 5IERA 3D9RA 1GY6A 4L7KA 3BLZA 4XBTA 3F8XA 4K1VA 5IG0A 4HM7B 3K0ZA 3MHEA 3Q90A 4WYKA 3JUOA 3EQQB 1CQSA 5BVBA 1BUQA 4WYKB 2Z77A 3EBYA 4J8TA 3FGYA 3OXAA 2GBXB 3G16A 3F7XA 3CU3A 3IPTA 1DMMA 1Q40A 1W6YA 2BMOB 1JB2A 4HM0B 3UJMA 1ASKA 1ZO2A 4R9KA 5AI1A 5HGRA 4OUQA 3SOYA 1O7PB 1IDPA 2STDA 5CK6A 5IENA 1O7WB 2XSOB 3A76A 2GEYA 2CKFB 3MKIA 3GZBA 3B4OA 4GB5A 3OX9A 5FW5A 4WP5A 1EA2A 1JN5A 3UNLA 3HZPA 1TP6A 3EHCA 1JN5B 2QGUA 4U13A 4HZ9B 1O7GB 5KP1A 3EN8A 3NV0B 2Z7AA 3EC9A 3ROBA 5EVHA 1OUNA 2HMJB 3DUKA 4XBYA 2F98A 4N3VA 3CPOA 3EF8A 5D81A 1E3VA 4IIAA 1OGZA 3CNMA 3FF2A 3GWRA 4FCMA 2B1XB 3MSOA 4HKVB 2CHCA 3OWUA 3OWSA 4Q53A 1HKXA 4MJDA 3WMDA 2F86B 1OCVA 1E97A 1GY5A 2HMKB 1NU3A 5DRVA 5AEWB 3KZTA 5IG3A 3RGRA 3B4PA
chains in the Genus database with same CATH superfamily
3N9HA 4N6TA 2P09A 1BU4A 2MC8A 1ZGXA 1BSBA 1GSPA 4LSOA 1O7HB 1PYLA 4KFDA 2BNGA 1M1K4 3GRDA 1LOWA 3NM2A 5G1KA 3LTAA 1W00A 3SOAA 4CDLA 1VQP3 2GU3A 4BL2A 1RCLA 1YHQ3 1BNJA 2FXTA 3KE7A 4FMDA 2BMRB 3JUQA 4FCJA 4STDA 1R4YA 1QALA 3NBRA 5JPPA 3CCJ3 1IVVA 2Y73A 1ZX2A 1LNHA 4G1MB 2B24B 4JF8A 1VQ93 4BIRA 3OV4A 2GEXA 3B7CA 3CCE3 2GU1A 3ALAA 4FR9A 5EQLA 2Z76A 3G8ZA 2PZVA 3GZRA 1DE3A 5CF1A 3BNBA 3HIGA 1IV7A 2WO0A 4XDWA 1HYFA 3CCR3 2QA43 3FSDA 7STDA 2F99A 2BO9B 2LYXA 2UGIA 2IMJA 2BIRA 1YVBI 2WGOA 1YGWA 4J5GA 3F9SA 1UCIA 1JB4A 3IJEB 2W9QA 1DMNA 5KP3A 5AEUB 3F8HA 4BL3A 1W6CA 1VQ63 4HM3B 1FGTA 1OH0A 1BSDA 5M19A 1QAFA 2XRXB 4LZIA 2XSHB 1IV9A 3DGOA 2OTL3 6STDA 1ULIB 4BTYA 2YFIB 3NM7A 4H3UA 2H0HA 3E99A 3F7SA 1WTHA 3D4AA 3FG1A 2RFRA 2RNTA 2W0QA 4XDVA 1VQ43 4KVHA 5JBSA 3WODG 1AY7A 3CXC2 2BHMA 1UUVB 3BNCA 3LTBA 1STDA 4HM8B 5IG5A 3CMA3 3G713 1FUTA 1RHLA 1EEJA 1RGFA 3M8CA 3SYUA 3KSED 1PFPA 3EN1B 5D83A 1LOXA 2I9WA 1GY7A 3PGBA 3PYJA 1YNVX 3ZFZA 1YJN3 4N6MA 1TFKA 1EG9B 4XBXA 2H0GA 3CCS3 1SIHA 4ILFA 2BT3A 5BXQA 1KD14 3NV0A 1IVXA 1BRHA 4DKIA 1A67A 2KF6A 3JUMA 3AMOA 4MMYB 4HM5B 3KKGA 1U5OA 1RN1A 2Q07A 4NREA 2YFJB 1I8VA 3G6E3 3QK9A 4NPBA 2HMMB 2GBWB 3MWZA 3NBJA 4MMXB 1FUSA 3DMCA 2E2VA 2XH9A 1F8NA 8CHOA 4HVNA 4R80A 3K63A 1QJGA 1UUWB 1L5GB 3FG3A 3HIIA 4L8PA 3X40A 2D42A 3A5EA 3FLJA 1RCKA 3EE1A 2RGQA 1ISKA 3DM8A 2F56A 1O7NB 3KSPA 4N6LA 1D6UA 1K41A 2SARA 3D5GA 5AYSC 1FYSA 4GHOA 1BOXA 5BIRA 4WWUC 1RSNA 5IEPA 2INXA 2LQVA 2HMNB 1T2HA 4NHFA 1UW1A 2ML5A 1D6ZA 5ELJA 1OGXA 4FMAA 5IF6A 1I2FA 2CC3A 4XM4A 2UUGC 3QRDA 1FGRA 1BNGA 4KFFA 5KP4A 4HOHA 1IVUA 1IVWA 1OF5A 2W04A 2WGQA 3EX9A 2K54A 3HX8A 1RMSA 3S27A 2HMOB 3VGNA 4RZMA 1W01A 3DGYA 2KF3A 2IA7A 3LTDA 2ZHXB 2XR8B 1OF5B 2KF5A 3AHSA 2KRTA 1Q824 1MNLA 1MGWA 3X41A 4PEJA 4MEIA 1GMRA 3FF0A 1Q814 1SARA 1YGEA 1OHSA 3J7Yd 1Q9EA 3NHXA 3CC73 3HOHA 3AGNA 1QVG2 3STDA 3FZWA 6RNTA 1BGSA 1I2EA 3HI7A 4FCZA 3LT9A 4HYZA 3CD63 4WFOA 1BRJA 1VZZA 5A0OB 1NWWA 1FA3A 1A90A 3RGAA 4LGQA 1BNFA 1VQ53 8RNTA 2R4IA 1IYYA 1LRAA 1RRHA 9RNTA 1K734 3ZG0A 2JDIH 1BAOA 1WMPA 2JQ5A 2CH9A 3F14A 3G0KA 3GZYB 1FZUA 3FKAA 1UGIA 3LZAA 3PZWA 3SEDA 1VQL3 1B2ZA 2CFLA 1O7MB 4RNYA 2IUKA 3DXOA 1MWSA 1DVCA 2P38A 1BIRA 4R1KA 1N9JA 1SPUA 4KFEA 3PCRA 5RNTA 3IMAB 3D5IA 3MG3A 3MG1A 5AIFA 2HMLB 4R4KA 1EUIC 2HOHA 2O3OA 2CWVA 3SLUA 3RNTA 1K28A 1E3RA 4MMZB 3V99A 1UUGB 3K5TA 3KN4A 3O8YA 1RGCA 4EC6A 3NXJA 1TTOA 1W2ZA 3MG2A 4I4KA 1Z1SA 1CH0A 1JZOA 1JRQA 2GSPA 5DREA 1IT7A 1AR0A 4RNZA 3SVAA 2QIYA 1JBRA 1TJDA 3WOEB 1IQ8A 1BRKA 5IG4A 2M7OA 4HM6B 3V98A 4HJLB 4LEHA 3NQZA 6GSPA 1VQN3 1A2KA 1UI8A 4R9LA 3RDEA 1JZDA 3H51A 1X1XA 2J8XB 3LT8A 1EQKA 1BRNL 1BRGA 3LTCA 1RLSA 2V1LA 5FGOA 1B2MA 1CYUA 5G2GA 1LQMB 2XEPA 3T8UA 2YFLB 3VF1A 1ULJB 1OPYA 1K9M4 3DGNA 2IUJA 1RGHA 3DGLA 2OQEA 2XFSA 5AIIA 3X3YA 1QAKA 1Q42A 1LOVA 1Q40B 1YVSA 5STDA 2GXFA 1X1UA 2O9UX 3U1WA 2CG0A 1JB5A 1Y4KA 4FMBA 1RRLA 3BIRA 2K3DA 5TGNA 1VQ83 3CC23 2XGNA 4OVMA 1BSCA 2RBIA 4K1UA 2WOHA 3BU4A 2RCDA 1W2B2 1RGAA 4BU4A 2PNCA 2CWTA 2RSXA 3ER7A 1GS3A 1EKMA 4CCVA 1JJ22 1SIIA 3F40A 3CNXA 3Q2PA 3S67A 3X3ZA 4AKZA 1SQWA 1RGKA 1V74A 5D82A 4HZBB 4N6NB 3S28A 1GOVA 1KQS2 1TFOA 1OHPA 2Z6BA 5EEOA 3VSYA 1VQK3 3ECFA 1S5AA 3FH1A 1KC84 1IQXA 4HM1B 1FW7A 1NNVA 1RGGA 1B20A 2H0IA 3EBTA 4X2OA 1UGHI 2P05A 2CFDA 3LOYA 5CXOA 2ML6A 1W5ZA 3S5CA 5BU4A 1LQGC 1BNSA 4O02B 2CFWA 4N6UA 1KWIA 1Q864 3LMLA 1BANA 4HAAA 1M1XB 3H3HA 3BB9A 4HM2B 4XB5A 2SBLA 1X1WA 3KIIA 3LH4A 3LYGA 4BTWA 3N8BA 2A15A 1LXEA 1WQLB 1GD3A 3I0YA 5GSPA 1GYBA 1JKGA 1TRQA 1MWTA 1AVKA 1FGMA 1RKYA 1VQ73 4AKYA 1OHOA 3NX0A 2CG1A 2OOVA 1KSIA 1ZS7A 3JUPA 4EV2A 1LOYA 1JKGB 3OWYA 4ORLA 1NJI4 3BNEA 3NUVA 4N6V0 2IY2A 3K7CA 1J2BA 3T8NA 1TUHA 4O8SA 1YJW3 4LMIA 1GMQA 1UCLA 1SJWA 5AIGA 4EXRA 2QEX3 3OW22 2YX9A 1LVNA 2R41A 3JUNA 3B8LA 1U8CB 4J9AA 4X2HA 1G96A 3DZLA 3UB1A 1WMNA 2W03A 2W2CA 2MF7A 2CW9A 2ZDJA 4L8OA 2OWPA 4O2HA 5IEOA 3DH2A 1RNTA 3NBBA 1I0VA 1JV2B 2UX0A 1UDII 3EJVA 5HOHA 2E2UA 4HM4B 4EYCA 1W4NA 3HK4A 3MYTA 4WHAA 1B2SA 2BMQB 1DMQA 1JNQA 1N5HA 1W02A 2ZA4A 3WR2A 1DVDA 3UL5A 5CF2A 3T0UA 2OTJ3 1IU7A 3JVCA 3KFQC 1BNIA 1TIJA 3GZXB 1B2UA 1QMAA 2CX1A 1C7HA 5AIHA 5G1LA 1NDOB 3L0RA 5JPUA 5LC6A 3CCQ3 3K9MC 5AYRB 1C54A 1PY3A 1IT8A 3URPA 1GOYA 1A2VA 3DY5A 5CLKA 4GSPA 5IERA 2E2TA 3D9RA 4EW5A 1GY6A 4L7KA 1RGEA 1S723 1MWUA 1RGLA 2C4BA 2KCDA 3BLZA 3F8XA 4K1VA 4XBTA 3CCM3 2XF3A 5IG0A 3PXMA 1YIJ3 5M18A 1BRIA 1RDSA 4HM7B 1RN4A 2P0XA 3K0ZA 3MHEA 1LNIA 1ROVA 3Q90A 1BSEA 4WYKA 3JUOA 1FUWA 1B3SA 1CEWI 3EQQB 2FNQA 1CQSA 1UI7A 2F5WA 1MOLA 2F5MA 5BVBA 1YIT3 1BUQA 5IW9A 4WYKB 2Z77A 3EBYA 4K61A 4J8TA 4BTXA 3FGYA 4KT3B 1R4CA 2KF4A 3OXAA 1UCJA 2GBXB 3G16A 3F7XA 2KXGA 1DETA 2WOFA 4J5KA 3CU3A 2ZL8A 2XFTA 2F4YA 1DMMA 3IPTA 1AV4A 1Q40A 3CCU3 1G02A 1W6YA 1DYUA 2BMOB 1BUJA 1JB2A 4HM0B 3UJMA 1I3IA 1ASKA 1ZO2A 2CK3H 1G0TA 1US1A 4R9KA 1I0XA 4EBGA 3EB8A 2W9PA 5AI1A 3FG4A 3N54B 3GAXA 3MPHA 1QVF2 1HZ1A 5HGRA 1BSAA 3FCSB 4CPKA 3S29A 1MGRA 3D79A 1BNEA 1CYVA 1A2PA 1I2GA 3NQYA 2Y74A 1GOUA 4OUQA 1AQZA 3SOYA 3CME3 1N8R4 1O7PB 1IDPA 2STDA 2XGLA 1STFI 5CK6A 4I5QA 5IENA 1O7WB 4KZ1A 2XSOB 3A76A 2GEYA 3BNDA 2CKFB 3MKIA 3GZBA 1YJ93 5M1AA 3I563 3B4OA 2OQEC 4QWTA 1FGQA 1N9EA 2W6JH 4GB5A 1N8QA 3OX9A 5FW5A 4CJNA 1YI23 3GSPA 1EA2A 1JN5A 3DGMA 4WP5A 4IPBA 3UNLA 3HZPA 3Q3FA 1TP6A 1TU5A 3EHCA 2AADA 1RN7A 3CCV3 1JN5B 2L1SA 3Q1CA 2W56A 1W7CA 1JBTA 2QGUA 4U13A 4HZ9B 4TX4A 1K8A4 2K0MA 4LYLB 1O7GB 4JRFA 2C10A 2W56B 3TDGA 3AGOA 5KP1A 1Q7HA 3EN8A 5LC7A 2BU4A 1T3BA 2L4VA 3D3LA 3PS8A 3PCSA 3WDGB 4H61A 3NV0B 3SXXA 3U97A 1VQQA 1BRSA 3AMOB 2Z7AA 3X3XA 3EC9A 7RNTA 3ROBA 1IK3A 3CPW2 5EVHA 1OUNA 1FGOA 1I70A 2HMJB 3DUKA 4RBNA 1V58A 3KCHA 4XBYA 2F98A 2IYJA 4N3VA 1MWRA 5I97A 3CPOA 4AEQA 1VQO3 3EF8A 1B27A 3SX1A 1BVIA 2CFGA 1WNHA 1I3FA 4OK0A 1E3VA 5D81A 1AVLA 3V92A 1T2IA 2CWUA 3AHWA 1PU4A 1Q7Y4 3CCL3 1WMOA 1W6GA 2AAEA 4IIAA 1RTUA 1OGZA 1D6YA 1M9GA 3WOFB 4GL6A 3CNMA 3FF2A 4EV5A 1OACA 3GWRA 4FCMA 1B21A 1VQM3 4O3VA 2CX0A 2D1WA 3WA2X 1X1YA 3UL6A 1IQYA 1V57A 1RJOA 1HU9A 2B1XB 1TRPA 2OOVC 1N5PA 3CC43 5ELUA 2C11A 2CIUA 3MSOA 4HKVB 3X42A 4IT7A 7GSPA 2CHCA 3OWUA 1UCKA 3OWSA 4Q53A 1NO3A 2OCTA 4K90B 1RNBA 3LXUX 4ZM8A 1HKXA 2P0MA 1ROAA 2KAAA 4MJDA 1M904 2FGTA 3I553 3WMDA 2F86B 3WHOA 1NB5I 1OCVA 1E97A 1GY5A 2HMKB 1NU3A 1NB3I 5DRVA 4N6OB 3G4S3 4FMCA 3WA3A 1T5YA 2CFKA 3ZG5A 5AEWB 1JBSA 3KZTA 5IG3A 1GD4A 1GMPA 4RNTA 1BNRA 4HBRA 3RGRA 1B2XA 3B4PA
chains in the Genus database with same CATH topology
3N9HA 4N6TA 2P09A 2MC8A 4LSOA 1O7HB 4KFDA 1M1K4 2BNGA 3GRDA 3NM2A 3LTAA 1W00A 3SOAA 4CDLA 1VQP3 2GU3A 1YHQ3 2FXTA 3KE7A 4FMDA 2BMRB 3JUQA 4FCJA 4STDA 1QALA 3NBRA 5JPPA 3CCJ3 1IVVA 2Y73A 1ZX2A 1LNHA 4G1MB 2B24B 4JF8A 1VQ93 3OV4A 2GEXA 3B7CA 3CCE3 2GU1A 3ALAA 4FR9A 5EQLA 2Z76A 3G8ZA 2PZVA 3GZRA 5CF1A 3BNBA 3HIGA 1IV7A 2WO0A 4XDWA 2QA43 3CCR3 3FSDA 7STDA 2F99A 2BO9B 2LYXA 2IMJA 1YVBI 2WGOA 3F9SA 1JB4A 3IJEB 2W9QA 1DMNA 5KP3A 5AEUB 3F8HA 1W6CA 1VQ63 4HM3B 1FGTA 1OH0A 1QAFA 2XRXB 4LZIA 2XSHB 1IV9A 3DGOA 2OTL3 6STDA 1ULIB 4BTYA 2YFIB 3NM7A 4H3UA 3E99A 3F7SA 1WTHA 3FG1A 2RFRA 2W0QA 4XDVA 1VQ43 4KVHA 5JBSA 3WODG 3CXC2 2BHMA 1UUVB 3BNCA 3LTBA 1STDA 4HM8B 5IG5A 3CMA3 3G713 3M8CA 3KSED 1PFPA 3EN1B 5D83A 1LOXA 2I9WA 1GY7A 3PGBA 3PYJA 1YJN3 4N6MA 1TFKA 1EG9B 4XBXA 3CCS3 1SIHA 2BT3A 5BXQA 1KD14 3NV0A 1IVXA 1A67A 3JUMA 3AMOA 4MMYB 4HM5B 3KKGA 1U5OA 2Q07A 4NREA 2YFJB 3G6E3 3QK9A 2HMMB 2GBWB 3MWZA 3NBJA 4MMXB 3DMCA 2E2VA 2XH9A 1F8NA 8CHOA 4HVNA 4R80A 3K63A 1QJGA 1UUWB 1L5GB 3FG3A 3HIIA 4L8PA 3X40A 2D42A 3FLJA 3EE1A 2RGQA 1ISKA 3DM8A 1O7NB 3KSPA 4N6LA 1D6UA 1K41A 5AYSC 4WWUC 5IEPA 2INXA 2LQVA 2HMNB 4NHFA 2ML5A 1UW1A 1D6ZA 5ELJA 1OGXA 4FMAA 5IF6A 2CC3A 4XM4A 5KP4A 3QRDA 1FGRA 4KFFA 1IVUA 1IVWA 1OF5A 2W04A 2WGQA 3EX9A 2K54A 3HX8A 3S27A 2HMOB 3VGNA 4RZMA 1W01A 2IA7A 3LTDA 2XR8B 1OF5B 2KRTA 1Q824 1MNLA 3X41A 4PEJA 4MEIA 3FF0A 1Q814 1YGEA 1OHSA 3J7Yd 3NHXA 3CC73 1QVG2 3STDA 3FZWA 3HI7A 4FCZA 3LT9A 4HYZA 3CD63 4WFOA 1VZZA 5A0OB 1NWWA 1FA3A 1A90A 3RGAA 4LGQA 1VQ53 2R4IA 1RRHA 1K734 2JDIH 1WMPA 2JQ5A 2CH9A 3F14A 3G0KA 3GZYB 3PZWA 3FKAA 3LZAA 3SEDA 1VQL3 2CFLA 1O7MB 4RNYA 2IUKA 3DXOA 1DVCA 2P38A 4R1KA 1N9JA 1SPUA 4KFEA 3PCRA 3IMAB 3MG3A 3MG1A 5AIFA 2HMLB 4R4KA 2O3OA 2CWVA 3SLUA 1K28A 1E3RA 4MMZB 3V99A 3K5TA 3KN4A 3O8YA 4EC6A 3NXJA 1W2ZA 3MG2A 4I4KA 1Z1SA 1JRQA 5DREA 1IT7A 1AR0A 4RNZA 3SVAA 2QIYA 3WOEB 1IQ8A 5IG4A 2M7OA 4HM6B 3V98A 4HJLB 4LEHA 3NQZA 1VQN3 1A2KA 1UI8A 4R9LA 3RDEA 3H51A 3LT8A 1EQKA 3LTCA 2V1LA 5FGOA 1CYUA 5G2GA 2XEPA 3T8UA 2YFLB 3VF1A 1ULJB 1OPYA 1K9M4 3DGNA 2IUJA 3DGLA 2OQEA 2XFSA 5AIIA 3X3YA 1QAKA 1Q42A 1Q40B 5STDA 2GXFA 2O9UX 3U1WA 2CG0A 1JB5A 1Y4KA 4FMBA 1RRLA 5TGNA 1VQ83 3CC23 2XGNA 4OVMA 4K1UA 2WOHA 2RCDA 1W2B2 2PNCA 2CWTA 2RSXA 3ER7A 1GS3A 1EKMA 4CCVA 1JJ22 1SIIA 3F40A 3CNXA 3Q2PA 3S67A 3X3ZA 4AKZA 1SQWA 5D82A 1V74A 4HZBB 4N6NB 3S28A 1KQS2 1TFOA 1OHPA 2Z6BA 5EEOA 3VSYA 1VQK3 3ECFA 1S5AA 3FH1A 1KC84 1IQXA 4HM1B 3EBTA 4X2OA 2P05A 5CXOA 2CFDA 3LOYA 3S5CA 2ML6A 1W5ZA 4O02B 2CFWA 4N6UA 1KWIA 1Q864 3LMLA 1M1XB 3H3HA 3BB9A 4HM2B 4XB5A 2SBLA 3KIIA 3LH4A 3LYGA 4BTWA 3N8BA 2A15A 1LXEA 1WQLB 1GD3A 3I0YA 1GYBA 1JKGA 1AVKA 1FGMA 1RKYA 1VQ73 4AKYA 1OHOA 3NX0A 2CG1A 2OOVA 1KSIA 3JUPA 4EV2A 1JKGB 3OWYA 4ORLA 1NJI4 3BNEA 3NUVA 4N6V0 3K7CA 1J2BA 3T8NA 1TUHA 4O8SA 1YJW3 4LMIA 5AIGA 4EXRA 1SJWA 2QEX3 3OW22 2YX9A 1LVNA 3JUNA 3B8LA 1U8CB 4J9AA 4X2HA 1G96A 3DZLA 3UB1A 1WMNA 2W03A 2W2CA 2MF7A 2CW9A 2ZDJA 4L8OA 2OWPA 4O2HA 5IEOA 3NBBA 1JV2B 2UX0A 3EJVA 2E2UA 4HM4B 4EYCA 1W4NA 3HK4A 3MYTA 4WHAA 2BMQB 1DMQA 1JNQA 1N5HA 1W02A 1DVDA 3UL5A 5CF2A 3T0UA 2OTJ3 1IU7A 3JVCA 3KFQC 1TIJA 3GZXB 1QMAA 5AIHA 1C7HA 5JPUA 1NDOB 3L0RA 5LC6A 3CCQ3 3K9MC 5AYRB 1IT8A 5CLKA 1A2VA 3DY5A 5IERA 2E2TA 3D9RA 1GY6A 4L7KA 1S723 2KCDA 3BLZA 4XBTA 3F8XA 4K1VA 3CCM3 2XF3A 5IG0A 3PXMA 1YIJ3 4HM7B 2P0XA 3K0ZA 3MHEA 1ROVA 3Q90A 4WYKA 3JUOA 1FUWA 1CEWI 3EQQB 2FNQA 1CQSA 1UI7A 1MOLA 5BVBA 1YIT3 1BUQA 5IW9A 4WYKB 2Z77A 3EBYA 4K61A 4J8TA 4BTXA 3FGYA 1R4CA 3OXAA 2GBXB 3G16A 3F7XA 2KXGA 2WOFA 3CU3A 2ZL8A 2XFTA 1DMMA 3IPTA 1AV4A 1Q40A 3CCU3 1W6YA 1DYUA 2BMOB 1JB2A 4HM0B 3UJMA 1ASKA 1ZO2A 2CK3H 1US1A 4R9KA 4EBGA 3EB8A 2W9PA 5AI1A 3FG4A 3N54B 3GAXA 3MPHA 1QVF2 5HGRA 3FCSB 3S29A 1CYVA 3NQYA 2Y74A 4OUQA 3SOYA 3CME3 1N8R4 1O7PB 1IDPA 2STDA 2XGLA 1STFI 5CK6A 5IENA 1O7WB 4KZ1A 2XSOB 3A76A 2GEYA 3BNDA 2CKFB 3MKIA 3GZBA 1YJ93 3I563 3B4OA 2OQEC 4QWTA 1FGQA 1N9EA 2W6JH 4GB5A 1N8QA 3OX9A 5FW5A 1YI23 4WP5A 1EA2A 1JN5A 3DGMA 4IPBA 3UNLA 3HZPA 1TP6A 1TU5A 3EHCA 1RN7A 3CCV3 1JN5B 3Q1CA 2W56A 1W7CA 2QGUA 4U13A 4HZ9B 4TX4A 1K8A4 2K0MA 1O7GB 4JRFA 2C10A 2W56B 3TDGA 5KP1A 3EN8A 5LC7A 2L4VA 3D3LA 3PS8A 3PCSA 3WDGB 4H61A 3NV0B 3SXXA 3U97A 3AMOB 2Z7AA 3X3XA 3EC9A 3ROBA 1IK3A 3CPW2 5EVHA 1OUNA 1FGOA 2HMJB 3DUKA 4RBNA 4XBYA 2F98A 4N3VA 5I97A 3CPOA 4AEQA 1VQO3 3EF8A 3SX1A 2CFGA 1WNHA 5D81A 4OK0A 1E3VA 1PU4A 1AVLA 3V92A 2CWUA 1Q7Y4 3CCL3 1WMOA 1W6GA 4IIAA 1OGZA 1D6YA 1M9GA 3WOFB 4GL6A 3CNMA 3FF2A 4EV5A 1OACA 3GWRA 4FCMA 1VQM3 4O3VA 3WA2X 2D1WA 3UL6A 1IQYA 2B1XB 1RJOA 1HU9A 2OOVC 1N5PA 3CC43 5ELUA 2C11A 2CIUA 3MSOA 4HKVB 3X42A 4IT7A 2CHCA 3OWUA 3OWSA 4Q53A 1NO3A 2OCTA 4K90B 3LXUX 4ZM8A 1HKXA 2P0MA 1ROAA 4MJDA 1M904 2FGTA 3I553 3WMDA 2F86B 1NB5I 1OCVA 1E97A 1GY5A 2HMKB 1NU3A 1NB3I 5DRVA 4N6OB 3G4S3 4FMCA 3WA3A 1T5YA 2CFKA 5AEWB 3KZTA 5IG3A 1GD4A 4HBRA 3RGRA 3B4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7H B;  2BNG A;  3GRD A;  3NM2 A;  3SOA A;  1W00 A;  4CDL A;  3KE7 A;  2BMR B;  3JUQ A;  4FCJ A;  4STD A;  3NBR A;  5JPP A;  1ZX2 A;  2B24 B;  3OV4 A;  2GEX A;  3B7C A;  2Z76 A;  3G8Z A;  2PZV A;  3GZR A;  5CF1 A;  4XDW A;  3FSD A;  7STD A;  2F99 A;  2IMJ A;  3F9S A;  1JB4 A;  5KP3 A;  5AEU B;  1DMN A;  3F8H A;  4HM3 B;  1OH0 A;  2XRX B;  2XSH B;  6STD A;  1ULI B;  2YFI B;  4H3U A;  3E99 A;  3F7S A;  2RFR A;  4XDV A;  4KVH A;  1UUV B;  4HM8 B;  1STD A;  5IG5 A;  3M8C A;  5D83 A;  3EN1 B;  2I9W A;  1GY7 A;  1EG9 B;  4XBX A;  5BXQ A;  3NV0 A;  3JUM A;  4HM5 B;  3KKG A;  1U5O A;  2YFJ B;  2HMM B;  2GBW B;  3DMC A;  8CHO A;  4HVN A;  1QJG A;  1UUW B;  4L8P A;  3FLJ A;  2RGQ A;  1ISK A;  3DM8 A;  1O7N B;  3KSP A;  1K41 A;  4WWU C;  5IEP A;  2INX A;  2HMN B;  1OGX A;  5IF6 A;  4XM4 A;  5KP4 A;  1OF5 A;  3EX9 A;  3HX8 A;  2K54 A;  2HMO B;  3VGN A;  4RZM A;  1W01 A;  2XR8 B;  1OF5 B;  4PEJ A;  3FF0 A;  1OHS A;  3NHX A;  3STD A;  3FZW A;  1VZZ A;  1NWW A;  3RGA A;  4LGQ A;  2R4I A;  2JQ5 A;  3F14 A;  3GZY B;  3G0K A;  3FKA A;  3LZA A;  3SED A;  1O7M B;  3DXO A;  4R1K A;  3MG3 A;  3MG1 A;  5AIF A;  2HML B;  1E3R A;  3NXJ A;  3MG2 A;  4I4K A;  1Z1S A;  5DRE A;  1AR0 A;  2QIY A;  5IG4 A;  4HM6 B;  4HJL B;  4LEH A;  1A2K A;  4R9L A;  3H51 A;  5G2G A;  3T8U A;  2YFL B;  1ULJ B;  1OPY A;  5AII A;  1Q42 A;  1Q40 B;  5STD A;  2GXF A;  1JB5 A;  5TGN A;  4OVM A;  4K1U A;  2RCD A;  3ER7 A;  1GS3 A;  3F40 A;  3CNX A;  5D82 A;  4HZB B;  1OHP A;  3VSY A;  3ECF A;  1S5A A;  3FH1 A;  4HM1 B;  3EBT A;  4X2O A;  5CXO A;  3S5C A;  3H3H A;  3BB9 A;  4HM2 B;  4XB5 A;  3LYG A;  2A15 A;  1WQL B;  3I0Y A;  1GYB A;  1JKG A;  1OHO A;  3JUP A;  1JKG B;  3OWY A;  4ORL A;  3NUV A;  3K7C A;  3T8N A;  1TUH A;  4LMI A;  5AIG A;  1SJW A;  3JUN A;  3B8L A;  4J9A A;  4X2H A;  3DZL A;  2W2C A;  4L8O A;  2OWP A;  5IEO A;  2UX0 A;  3EJV A;  4HM4 B;  3MYT A;  3HK4 A;  2BMQ B;  1DMQ A;  1W02 A;  5CF2 A;  3GZX B;  1QMA A;  5AIH A;  1C7H A;  5JPU A;  1NDO B;  5CLK A;  5IER A;  3D9R A;  1GY6 A;  4L7K A;  3BLZ A;  4XBT A;  3F8X A;  4K1V A;  5IG0 A;  4HM7 B;  3K0Z A;  3MHE A;  3Q90 A;  4WYK A;  3JUO A;  3EQQ B;  1CQS A;  5BVB A;  1BUQ A;  4WYK B;  2Z77 A;  3EBY A;  4J8T A;  3FGY A;  3OXA A;  2GBX B;  3G16 A;  3F7X A;  3CU3 A;  3IPT A;  1DMM A;  1Q40 A;  1W6Y A;  2BMO B;  1JB2 A;  4HM0 B;  3UJM A;  1ASK A;  1ZO2 A;  4R9K A;  5AI1 A;  5HGR A;  4OUQ A;  3SOY A;  1O7P B;  1IDP A;  2STD A;  5CK6 A;  5IEN A;  1O7W B;  2XSO B;  3A76 A;  2GEY A;  2CKF B;  3MKI A;  3GZB A;  3B4O A;  4GB5 A;  3OX9 A;  5FW5 A;  4WP5 A;  1EA2 A;  1JN5 A;  3UNL A;  3HZP A;  1TP6 A;  3EHC A;  1JN5 B;  2QGU A;  4U13 A;  4HZ9 B;  1O7G B;  5KP1 A;  3EN8 A;  3NV0 B;  2Z7A A;  3EC9 A;  3ROB A;  5EVH A;  1OUN A;  2HMJ B;  3DUK A;  4XBY A;  2F98 A;  4N3V A;  3CPO A;  3EF8 A;  5D81 A;  1E3V A;  4IIA A;  1OGZ A;  3CNM A;  3FF2 A;  3GWR A;  4FCM A;  2B1X B;  3MSO A;  4HKV B;  2CHC A;  3OWU A;  3OWS A;  4Q53 A;  1HKX A;  4MJD A;  3WMD A;  2F86 B;  1OCV A;  1E97 A;  1GY5 A;  2HMK B;  1NU3 A;  5DRV A;  5AEW B;  3KZT A;  5IG3 A;  3RGR A;  3B4P A; 
#chains in the Genus database with same CATH topology
 3N9H A;  4N6T A;  2P09 A;  1BU4 A;  2MC8 A;  1ZGX A;  1BSB A;  1GSP A;  4LSO A;  1O7H B;  1PYL A;  4KFD A;  2BNG A;  1M1K 4;  3GRD A;  1LOW A;  3NM2 A;  5G1K A;  3LTA A;  1W00 A;  3SOA A;  4CDL A;  1VQP 3;  2GU3 A;  4BL2 A;  1RCL A;  1YHQ 3;  1BNJ A;  2FXT A;  3KE7 A;  4FMD A;  2BMR B;  3JUQ A;  4FCJ A;  4STD A;  1R4Y A;  1QAL A;  3NBR A;  5JPP A;  3CCJ 3;  1IVV A;  2Y73 A;  1ZX2 A;  1LNH A;  4G1M B;  2B24 B;  4JF8 A;  1VQ9 3;  4BIR A;  3OV4 A;  2GEX A;  3B7C A;  3CCE 3;  2GU1 A;  3ALA A;  4FR9 A;  5EQL A;  2Z76 A;  3G8Z A;  2PZV A;  3GZR A;  1DE3 A;  5CF1 A;  3BNB A;  3HIG A;  1IV7 A;  2WO0 A;  4XDW A;  1HYF A;  3CCR 3;  2QA4 3;  3FSD A;  7STD A;  2F99 A;  2BO9 B;  2LYX A;  2UGI A;  2IMJ A;  2BIR A;  1YVB I;  2WGO A;  1YGW A;  4J5G A;  3F9S A;  1UCI A;  1JB4 A;  3IJE B;  2W9Q A;  1DMN A;  5KP3 A;  5AEU B;  3F8H A;  4BL3 A;  1W6C A;  1VQ6 3;  4HM3 B;  1FGT A;  1OH0 A;  1BSD A;  5M19 A;  1QAF A;  2XRX B;  4LZI A;  2XSH B;  1IV9 A;  3DGO A;  2OTL 3;  6STD A;  1ULI B;  4BTY A;  2YFI B;  3NM7 A;  4H3U A;  2H0H A;  3E99 A;  3F7S A;  1WTH A;  3D4A A;  3FG1 A;  2RFR A;  2RNT A;  2W0Q A;  4XDV A;  1VQ4 3;  4KVH A;  5JBS A;  3WOD G;  1AY7 A;  3CXC 2;  2BHM A;  1UUV B;  3BNC A;  3LTB A;  1STD A;  4HM8 B;  5IG5 A;  3CMA 3;  3G71 3;  1FUT A;  1RHL A;  1EEJ A;  1RGF A;  3M8C A;  3SYU A;  3KSE D;  1PFP A;  3EN1 B;  5D83 A;  1LOX A;  2I9W A;  1GY7 A;  3PGB A;  3PYJ A;  1YNV X;  3ZFZ A;  1YJN 3;  4N6M A;  1TFK A;  1EG9 B;  4XBX A;  2H0G A;  3CCS 3;  1SIH A;  4ILF A;  2BT3 A;  5BXQ A;  1KD1 4;  3NV0 A;  1IVX A;  1BRH A;  4DKI A;  1A67 A;  2KF6 A;  3JUM A;  3AMO A;  4MMY B;  4HM5 B;  3KKG A;  1U5O A;  1RN1 A;  2Q07 A;  4NRE A;  2YFJ B;  1I8V A;  3G6E 3;  3QK9 A;  4NPB A;  2HMM B;  2GBW B;  3MWZ A;  3NBJ A;  4MMX B;  1FUS A;  3DMC A;  2E2V A;  2XH9 A;  1F8N A;  8CHO A;  4HVN A;  4R80 A;  3K63 A;  1QJG A;  1UUW B;  1L5G B;  3FG3 A;  3HII A;  4L8P A;  3X40 A;  2D42 A;  3A5E A;  3FLJ A;  1RCK A;  3EE1 A;  2RGQ A;  1ISK A;  3DM8 A;  2F56 A;  1O7N B;  3KSP A;  4N6L A;  1D6U A;  1K41 A;  2SAR A;  3D5G A;  5AYS C;  1FYS A;  4GHO A;  1BOX A;  5BIR A;  4WWU C;  1RSN A;  5IEP A;  2INX A;  2LQV A;  2HMN B;  1T2H A;  4NHF A;  1UW1 A;  2ML5 A;  1D6Z A;  5ELJ A;  1OGX A;  4FMA A;  5IF6 A;  1I2F A;  2CC3 A;  4XM4 A;  2UUG C;  3QRD A;  1FGR A;  1BNG A;  4KFF A;  5KP4 A;  4HOH A;  1IVU A;  1IVW A;  1OF5 A;  2W04 A;  2WGQ A;  3EX9 A;  2K54 A;  3HX8 A;  1RMS A;  3S27 A;  2HMO B;  3VGN A;  4RZM A;  1W01 A;  3DGY A;  2KF3 A;  2IA7 A;  3LTD A;  2ZHX B;  2XR8 B;  1OF5 B;  2KF5 A;  3AHS A;  2KRT A;  1Q82 4;  1MNL A;  1MGW A;  3X41 A;  4PEJ A;  4MEI A;  1GMR A;  3FF0 A;  1Q81 4;  1SAR A;  1YGE A;  1OHS A;  3J7Y d;  1Q9E A;  3NHX A;  3CC7 3;  3HOH A;  3AGN A;  1QVG 2;  3STD A;  3FZW A;  6RNT A;  1BGS A;  1I2E A;  3HI7 A;  4FCZ A;  3LT9 A;  4HYZ A;  3CD6 3;  4WFO A;  1BRJ A;  1VZZ A;  5A0O B;  1NWW A;  1FA3 A;  1A90 A;  3RGA A;  4LGQ A;  1BNF A;  1VQ5 3;  8RNT A;  2R4I A;  1IYY A;  1LRA A;  1RRH A;  9RNT A;  1K73 4;  3ZG0 A;  2JDI H;  1BAO A;  1WMP A;  2JQ5 A;  2CH9 A;  3F14 A;  3G0K A;  3GZY B;  1FZU A;  3FKA A;  1UGI A;  3LZA A;  3PZW A;  3SED A;  1VQL 3;  1B2Z A;  2CFL A;  1O7M B;  4RNY A;  2IUK A;  3DXO A;  1MWS A;  1DVC A;  2P38 A;  1BIR A;  4R1K A;  1N9J A;  1SPU A;  4KFE A;  3PCR A;  5RNT A;  3IMA B;  3D5I A;  3MG3 A;  3MG1 A;  5AIF A;  2HML B;  4R4K A;  1EUI C;  2HOH A;  2O3O A;  2CWV A;  3SLU A;  3RNT A;  1K28 A;  1E3R A;  4MMZ B;  3V99 A;  1UUG B;  3K5T A;  3KN4 A;  3O8Y A;  1RGC A;  4EC6 A;  3NXJ A;  1TTO A;  1W2Z A;  3MG2 A;  4I4K A;  1Z1S A;  1CH0 A;  1JZO A;  1JRQ A;  2GSP A;  5DRE A;  1IT7 A;  1AR0 A;  4RNZ A;  3SVA A;  2QIY A;  1JBR A;  1TJD A;  3WOE B;  1IQ8 A;  1BRK A;  5IG4 A;  2M7O A;  4HM6 B;  3V98 A;  4HJL B;  4LEH A;  3NQZ A;  6GSP A;  1VQN 3;  1A2K A;  1UI8 A;  4R9L A;  3RDE A;  1JZD A;  3H51 A;  1X1X A;  2J8X B;  3LT8 A;  1EQK A;  1BRN L;  1BRG A;  3LTC A;  1RLS A;  2V1L A;  5FGO A;  1B2M A;  1CYU A;  5G2G A;  1LQM B;  2XEP A;  3T8U A;  2YFL B;  3VF1 A;  1ULJ B;  1OPY A;  1K9M 4;  3DGN A;  2IUJ A;  1RGH A;  3DGL A;  2OQE A;  2XFS A;  5AII A;  3X3Y A;  1QAK A;  1Q42 A;  1LOV A;  1Q40 B;  1YVS A;  5STD A;  2GXF A;  1X1U A;  2O9U X;  3U1W A;  2CG0 A;  1JB5 A;  1Y4K A;  4FMB A;  1RRL A;  3BIR A;  2K3D A;  5TGN A;  1VQ8 3;  3CC2 3;  2XGN A;  4OVM A;  1BSC A;  2RBI A;  4K1U A;  2WOH A;  3BU4 A;  2RCD A;  1W2B 2;  1RGA A;  4BU4 A;  2PNC A;  2CWT A;  2RSX A;  3ER7 A;  1GS3 A;  1EKM A;  4CCV A;  1JJ2 2;  1SII A;  3F40 A;  3CNX A;  3Q2P A;  3S67 A;  3X3Z A;  4AKZ A;  1SQW A;  1RGK A;  1V74 A;  5D82 A;  4HZB B;  4N6N B;  3S28 A;  1GOV A;  1KQS 2;  1TFO A;  1OHP A;  2Z6B A;  5EEO A;  3VSY A;  1VQK 3;  3ECF A;  1S5A A;  3FH1 A;  1KC8 4;  1IQX A;  4HM1 B;  1FW7 A;  1NNV A;  1RGG A;  1B20 A;  2H0I A;  3EBT A;  4X2O A;  1UGH I;  2P05 A;  2CFD A;  3LOY A;  5CXO A;  2ML6 A;  1W5Z A;  3S5C A;  5BU4 A;  1LQG C;  1BNS A;  4O02 B;  2CFW A;  4N6U A;  1KWI A;  1Q86 4;  3LML A;  1BAN A;  4HAA A;  1M1X B;  3H3H A;  3BB9 A;  4HM2 B;  4XB5 A;  2SBL A;  1X1W A;  3KII A;  3LH4 A;  3LYG A;  4BTW A;  3N8B A;  2A15 A;  1LXE A;  1WQL B;  1GD3 A;  3I0Y A;  5GSP A;  1GYB A;  1JKG A;  1TRQ A;  1MWT A;  1AVK A;  1FGM A;  1RKY A;  1VQ7 3;  4AKY A;  1OHO A;  3NX0 A;  2CG1 A;  2OOV A;  1KSI A;  1ZS7 A;  3JUP A;  4EV2 A;  1LOY A;  1JKG B;  3OWY A;  4ORL A;  1NJI 4;  3BNE A;  3NUV A;  4N6V 0;  2IY2 A;  3K7C A;  1J2B A;  3T8N A;  1TUH A;  4O8S A;  1YJW 3;  4LMI A;  1GMQ A;  1UCL A;  1SJW A;  5AIG A;  4EXR A;  2QEX 3;  3OW2 2;  2YX9 A;  1LVN A;  2R41 A;  3JUN A;  3B8L A;  1U8C B;  4J9A A;  4X2H A;  1G96 A;  3DZL A;  3UB1 A;  1WMN A;  2W03 A;  2W2C A;  2MF7 A;  2CW9 A;  2ZDJ A;  4L8O A;  2OWP A;  4O2H A;  5IEO A;  3DH2 A;  1RNT A;  3NBB A;  1I0V A;  1JV2 B;  2UX0 A;  1UDI I;  3EJV A;  5HOH A;  2E2U A;  4HM4 B;  4EYC A;  1W4N A;  3HK4 A;  3MYT A;  4WHA A;  1B2S A;  2BMQ B;  1DMQ A;  1JNQ A;  1N5H A;  1W02 A;  2ZA4 A;  3WR2 A;  1DVD A;  3UL5 A;  5CF2 A;  3T0U A;  2OTJ 3;  1IU7 A;  3JVC A;  3KFQ C;  1BNI A;  1TIJ A;  3GZX B;  1B2U A;  1QMA A;  2CX1 A;  1C7H A;  5AIH A;  5G1L A;  1NDO B;  3L0R A;  5JPU A;  5LC6 A;  3CCQ 3;  3K9M C;  5AYR B;  1C54 A;  1PY3 A;  1IT8 A;  3URP A;  1GOY A;  1A2V A;  3DY5 A;  5CLK A;  4GSP A;  5IER A;  2E2T A;  3D9R A;  4EW5 A;  1GY6 A;  4L7K A;  1RGE A;  1S72 3;  1MWU A;  1RGL A;  2C4B A;  2KCD A;  3BLZ A;  3F8X A;  4K1V A;  4XBT A;  3CCM 3;  2XF3 A;  5IG0 A;  3PXM A;  1YIJ 3;  5M18 A;  1BRI A;  1RDS A;  4HM7 B;  1RN4 A;  2P0X A;  3K0Z A;  3MHE A;  1LNI A;  1ROV A;  3Q90 A;  1BSE A;  4WYK A;  3JUO A;  1FUW A;  1B3S A;  1CEW I;  3EQQ B;  2FNQ A;  1CQS A;  1UI7 A;  2F5W A;  1MOL A;  2F5M A;  5BVB A;  1YIT 3;  1BUQ A;  5IW9 A;  4WYK B;  2Z77 A;  3EBY A;  4K61 A;  4J8T A;  4BTX A;  3FGY A;  4KT3 B;  1R4C A;  2KF4 A;  3OXA A;  1UCJ A;  2GBX B;  3G16 A;  3F7X A;  2KXG A;  1DET A;  2WOF A;  4J5K A;  3CU3 A;  2ZL8 A;  2XFT A;  2F4Y A;  1DMM A;  3IPT A;  1AV4 A;  1Q40 A;  3CCU 3;  1G02 A;  1W6Y A;  1DYU A;  2BMO B;  1BUJ A;  1JB2 A;  4HM0 B;  3UJM A;  1I3I A;  1ASK A;  1ZO2 A;  2CK3 H;  1G0T A;  1US1 A;  4R9K A;  1I0X A;  4EBG A;  3EB8 A;  2W9P A;  5AI1 A;  3FG4 A;  3N54 B;  3GAX A;  3MPH A;  1QVF 2;  1HZ1 A;  5HGR A;  1BSA A;  3FCS B;  4CPK A;  3S29 A;  1MGR A;  3D79 A;  1BNE A;  1CYV A;  1A2P A;  1I2G A;  3NQY A;  2Y74 A;  1GOU A;  4OUQ A;  1AQZ A;  3SOY A;  3CME 3;  1N8R 4;  1O7P B;  1IDP A;  2STD A;  2XGL A;  1STF I;  5CK6 A;  4I5Q A;  5IEN A;  1O7W B;  4KZ1 A;  2XSO B;  3A76 A;  2GEY A;  3BND A;  2CKF B;  3MKI A;  3GZB A;  1YJ9 3;  5M1A A;  3I56 3;  3B4O A;  2OQE C;  4QWT A;  1FGQ A;  1N9E A;  2W6J H;  4GB5 A;  1N8Q A;  3OX9 A;  5FW5 A;  4CJN A;  1YI2 3;  3GSP A;  1EA2 A;  1JN5 A;  3DGM A;  4WP5 A;  4IPB A;  3UNL A;  3HZP A;  3Q3F A;  1TP6 A;  1TU5 A;  3EHC A;  2AAD A;  1RN7 A;  3CCV 3;  1JN5 B;  2L1S A;  3Q1C A;  2W56 A;  1W7C A;  1JBT A;  2QGU A;  4U13 A;  4HZ9 B;  4TX4 A;  1K8A 4;  2K0M A;  4LYL B;  1O7G B;  4JRF A;  2C10 A;  2W56 B;  3TDG A;  3AGO A;  5KP1 A;  1Q7H A;  3EN8 A;  5LC7 A;  2BU4 A;  1T3B A;  2L4V A;  3D3L A;  3PS8 A;  3PCS A;  3WDG B;  4H61 A;  3NV0 B;  3SXX A;  3U97 A;  1VQQ A;  1BRS A;  3AMO B;  2Z7A A;  3X3X A;  3EC9 A;  7RNT A;  3ROB A;  1IK3 A;  3CPW 2;  5EVH A;  1OUN A;  1FGO A;  1I70 A;  2HMJ B;  3DUK A;  4RBN A;  1V58 A;  3KCH A;  4XBY A;  2F98 A;  2IYJ A;  4N3V A;  1MWR A;  5I97 A;  3CPO A;  4AEQ A;  1VQO 3;  3EF8 A;  1B27 A;  3SX1 A;  1BVI A;  2CFG A;  1WNH A;  1I3F A;  4OK0 A;  1E3V A;  5D81 A;  1AVL A;  3V92 A;  1T2I A;  2CWU A;  3AHW A;  1PU4 A;  1Q7Y 4;  3CCL 3;  1WMO A;  1W6G A;  2AAE A;  4IIA A;  1RTU A;  1OGZ A;  1D6Y A;  1M9G A;  3WOF B;  4GL6 A;  3CNM A;  3FF2 A;  4EV5 A;  1OAC A;  3GWR A;  4FCM A;  1B21 A;  1VQM 3;  4O3V A;  2CX0 A;  2D1W A;  3WA2 X;  1X1Y A;  3UL6 A;  1IQY A;  1V57 A;  1RJO A;  1HU9 A;  2B1X B;  1TRP A;  2OOV C;  1N5P A;  3CC4 3;  5ELU A;  2C11 A;  2CIU A;  3MSO A;  4HKV B;  3X42 A;  4IT7 A;  7GSP A;  2CHC A;  3OWU A;  1UCK A;  3OWS A;  4Q53 A;  1NO3 A;  2OCT A;  4K90 B;  1RNB A;  3LXU X;  4ZM8 A;  1HKX A;  2P0M A;  1ROA A;  2KAA A;  4MJD A;  1M90 4;  2FGT A;  3I55 3;  3WMD A;  2F86 B;  3WHO A;  1NB5 I;  1OCV A;  1E97 A;  1GY5 A;  2HMK B;  1NU3 A;  1NB3 I;  5DRV A;  4N6O B;  3G4S 3;  4FMC A;  3WA3 A;  1T5Y A;  2CFK A;  3ZG5 A;  5AEW B;  1JBS A;  3KZT A;  5IG3 A;  1GD4 A;  1GMP A;  4RNT A;  1BNR A;  4HBR A;  3RGR A;  1B2X A;  3B4P A; 
#chains in the Genus database with same CATH homology
 3N9H A;  4N6T A;  2P09 A;  2MC8 A;  4LSO A;  1O7H B;  4KFD A;  1M1K 4;  2BNG A;  3GRD A;  3NM2 A;  3LTA A;  1W00 A;  3SOA A;  4CDL A;  1VQP 3;  2GU3 A;  1YHQ 3;  2FXT A;  3KE7 A;  4FMD A;  2BMR B;  3JUQ A;  4FCJ A;  4STD A;  1QAL A;  3NBR A;  5JPP A;  3CCJ 3;  1IVV A;  2Y73 A;  1ZX2 A;  1LNH A;  4G1M B;  2B24 B;  4JF8 A;  1VQ9 3;  3OV4 A;  2GEX A;  3B7C A;  3CCE 3;  2GU1 A;  3ALA A;  4FR9 A;  5EQL A;  2Z76 A;  3G8Z A;  2PZV A;  3GZR A;  5CF1 A;  3BNB A;  3HIG A;  1IV7 A;  2WO0 A;  4XDW A;  2QA4 3;  3CCR 3;  3FSD A;  7STD A;  2F99 A;  2BO9 B;  2LYX A;  2IMJ A;  1YVB I;  2WGO A;  3F9S A;  1JB4 A;  3IJE B;  2W9Q A;  1DMN A;  5KP3 A;  5AEU B;  3F8H A;  1W6C A;  1VQ6 3;  4HM3 B;  1FGT A;  1OH0 A;  1QAF A;  2XRX B;  4LZI A;  2XSH B;  1IV9 A;  3DGO A;  2OTL 3;  6STD A;  1ULI B;  4BTY A;  2YFI B;  3NM7 A;  4H3U A;  3E99 A;  3F7S A;  1WTH A;  3FG1 A;  2RFR A;  2W0Q A;  4XDV A;  1VQ4 3;  4KVH A;  5JBS A;  3WOD G;  3CXC 2;  2BHM A;  1UUV B;  3BNC A;  3LTB A;  1STD A;  4HM8 B;  5IG5 A;  3CMA 3;  3G71 3;  3M8C A;  3KSE D;  1PFP A;  3EN1 B;  5D83 A;  1LOX A;  2I9W A;  1GY7 A;  3PGB A;  3PYJ A;  1YJN 3;  4N6M A;  1TFK A;  1EG9 B;  4XBX A;  3CCS 3;  1SIH A;  2BT3 A;  5BXQ A;  1KD1 4;  3NV0 A;  1IVX A;  1A67 A;  3JUM A;  3AMO A;  4MMY B;  4HM5 B;  3KKG A;  1U5O A;  2Q07 A;  4NRE A;  2YFJ B;  3G6E 3;  3QK9 A;  2HMM B;  2GBW B;  3MWZ A;  3NBJ A;  4MMX B;  3DMC A;  2E2V A;  2XH9 A;  1F8N A;  8CHO A;  4HVN A;  4R80 A;  3K63 A;  1QJG A;  1UUW B;  1L5G B;  3FG3 A;  3HII A;  4L8P A;  3X40 A;  2D42 A;  3FLJ A;  3EE1 A;  2RGQ A;  1ISK A;  3DM8 A;  1O7N B;  3KSP A;  4N6L A;  1D6U A;  1K41 A;  5AYS C;  4WWU C;  5IEP A;  2INX A;  2LQV A;  2HMN B;  4NHF A;  2ML5 A;  1UW1 A;  1D6Z A;  5ELJ A;  1OGX A;  4FMA A;  5IF6 A;  2CC3 A;  4XM4 A;  5KP4 A;  3QRD A;  1FGR A;  4KFF A;  1IVU A;  1IVW A;  1OF5 A;  2W04 A;  2WGQ A;  3EX9 A;  2K54 A;  3HX8 A;  3S27 A;  2HMO B;  3VGN A;  4RZM A;  1W01 A;  2IA7 A;  3LTD A;  2XR8 B;  1OF5 B;  2KRT A;  1Q82 4;  1MNL A;  3X41 A;  4PEJ A;  4MEI A;  3FF0 A;  1Q81 4;  1YGE A;  1OHS A;  3J7Y d;  3NHX A;  3CC7 3;  1QVG 2;  3STD A;  3FZW A;  3HI7 A;  4FCZ A;  3LT9 A;  4HYZ A;  3CD6 3;  4WFO A;  1VZZ A;  5A0O B;  1NWW A;  1FA3 A;  1A90 A;  3RGA A;  4LGQ A;  1VQ5 3;  2R4I A;  1RRH A;  1K73 4;  2JDI H;  1WMP A;  2JQ5 A;  2CH9 A;  3F14 A;  3G0K A;  3GZY B;  3PZW A;  3FKA A;  3LZA A;  3SED A;  1VQL 3;  2CFL A;  1O7M B;  4RNY A;  2IUK A;  3DXO A;  1DVC A;  2P38 A;  4R1K A;  1N9J A;  1SPU A;  4KFE A;  3PCR A;  3IMA B;  3MG3 A;  3MG1 A;  5AIF A;  2HML B;  4R4K A;  2O3O A;  2CWV A;  3SLU A;  1K28 A;  1E3R A;  4MMZ B;  3V99 A;  3K5T A;  3KN4 A;  3O8Y A;  4EC6 A;  3NXJ A;  1W2Z A;  3MG2 A;  4I4K A;  1Z1S A;  1JRQ A;  5DRE A;  1IT7 A;  1AR0 A;  4RNZ A;  3SVA A;  2QIY A;  3WOE B;  1IQ8 A;  5IG4 A;  2M7O A;  4HM6 B;  3V98 A;  4HJL B;  4LEH A;  3NQZ A;  1VQN 3;  1A2K A;  1UI8 A;  4R9L A;  3RDE A;  3H51 A;  3LT8 A;  1EQK A;  3LTC A;  2V1L A;  5FGO A;  1CYU A;  5G2G A;  2XEP A;  3T8U A;  2YFL B;  3VF1 A;  1ULJ B;  1OPY A;  1K9M 4;  3DGN A;  2IUJ A;  3DGL A;  2OQE A;  2XFS A;  5AII A;  3X3Y A;  1QAK A;  1Q42 A;  1Q40 B;  5STD A;  2GXF A;  2O9U X;  3U1W A;  2CG0 A;  1JB5 A;  1Y4K A;  4FMB A;  1RRL A;  5TGN A;  1VQ8 3;  3CC2 3;  2XGN A;  4OVM A;  4K1U A;  2WOH A;  2RCD A;  1W2B 2;  2PNC A;  2CWT A;  2RSX A;  3ER7 A;  1GS3 A;  1EKM A;  4CCV A;  1JJ2 2;  1SII A;  3F40 A;  3CNX A;  3Q2P A;  3S67 A;  3X3Z A;  4AKZ A;  1SQW A;  5D82 A;  1V74 A;  4HZB B;  4N6N B;  3S28 A;  1KQS 2;  1TFO A;  1OHP A;  2Z6B A;  5EEO A;  3VSY A;  1VQK 3;  3ECF A;  1S5A A;  3FH1 A;  1KC8 4;  1IQX A;  4HM1 B;  3EBT A;  4X2O A;  2P05 A;  5CXO A;  2CFD A;  3LOY A;  3S5C A;  2ML6 A;  1W5Z A;  4O02 B;  2CFW A;  4N6U A;  1KWI A;  1Q86 4;  3LML A;  1M1X B;  3H3H A;  3BB9 A;  4HM2 B;  4XB5 A;  2SBL A;  3KII A;  3LH4 A;  3LYG A;  4BTW A;  3N8B A;  2A15 A;  1LXE A;  1WQL B;  1GD3 A;  3I0Y A;  1GYB A;  1JKG A;  1AVK A;  1FGM A;  1RKY A;  1VQ7 3;  4AKY A;  1OHO A;  3NX0 A;  2CG1 A;  2OOV A;  1KSI A;  3JUP A;  4EV2 A;  1JKG B;  3OWY A;  4ORL A;  1NJI 4;  3BNE A;  3NUV A;  4N6V 0;  3K7C A;  1J2B A;  3T8N A;  1TUH A;  4O8S A;  1YJW 3;  4LMI A;  5AIG A;  4EXR A;  1SJW A;  2QEX 3;  3OW2 2;  2YX9 A;  1LVN A;  3JUN A;  3B8L A;  1U8C B;  4J9A A;  4X2H A;  1G96 A;  3DZL A;  3UB1 A;  1WMN A;  2W03 A;  2W2C A;  2MF7 A;  2CW9 A;  2ZDJ A;  4L8O A;  2OWP A;  4O2H A;  5IEO A;  3NBB A;  1JV2 B;  2UX0 A;  3EJV A;  2E2U A;  4HM4 B;  4EYC A;  1W4N A;  3HK4 A;  3MYT A;  4WHA A;  2BMQ B;  1DMQ A;  1JNQ A;  1N5H A;  1W02 A;  1DVD A;  3UL5 A;  5CF2 A;  3T0U A;  2OTJ 3;  1IU7 A;  3JVC A;  3KFQ C;  1TIJ A;  3GZX B;  1QMA A;  5AIH A;  1C7H A;  5JPU A;  1NDO B;  3L0R A;  5LC6 A;  3CCQ 3;  3K9M C;  5AYR B;  1IT8 A;  5CLK A;  1A2V A;  3DY5 A;  5IER A;  2E2T A;  3D9R A;  1GY6 A;  4L7K A;  1S72 3;  2KCD A;  3BLZ A;  4XBT A;  3F8X A;  4K1V A;  3CCM 3;  2XF3 A;  5IG0 A;  3PXM A;  1YIJ 3;  4HM7 B;  2P0X A;  3K0Z A;  3MHE A;  1ROV A;  3Q90 A;  4WYK A;  3JUO A;  1FUW A;  1CEW I;  3EQQ B;  2FNQ A;  1CQS A;  1UI7 A;  1MOL A;  5BVB A;  1YIT 3;  1BUQ A;  5IW9 A;  4WYK B;  2Z77 A;  3EBY A;  4K61 A;  4J8T A;  4BTX A;  3FGY A;  1R4C A;  3OXA A;  2GBX B;  3G16 A;  3F7X A;  2KXG A;  2WOF A;  3CU3 A;  2ZL8 A;  2XFT A;  1DMM A;  3IPT A;  1AV4 A;  1Q40 A;  3CCU 3;  1W6Y A;  1DYU A;  2BMO B;  1JB2 A;  4HM0 B;  3UJM A;  1ASK A;  1ZO2 A;  2CK3 H;  1US1 A;  4R9K A;  4EBG A;  3EB8 A;  2W9P A;  5AI1 A;  3FG4 A;  3N54 B;  3GAX A;  3MPH A;  1QVF 2;  5HGR A;  3FCS B;  3S29 A;  1CYV A;  3NQY A;  2Y74 A;  4OUQ A;  3SOY A;  3CME 3;  1N8R 4;  1O7P B;  1IDP A;  2STD A;  2XGL A;  1STF I;  5CK6 A;  5IEN A;  1O7W B;  4KZ1 A;  2XSO B;  3A76 A;  2GEY A;  3BND A;  2CKF B;  3MKI A;  3GZB A;  1YJ9 3;  3I56 3;  3B4O A;  2OQE C;  4QWT A;  1FGQ A;  1N9E A;  2W6J H;  4GB5 A;  1N8Q A;  3OX9 A;  5FW5 A;  1YI2 3;  4WP5 A;  1EA2 A;  1JN5 A;  3DGM A;  4IPB A;  3UNL A;  3HZP A;  1TP6 A;  1TU5 A;  3EHC A;  1RN7 A;  3CCV 3;  1JN5 B;  3Q1C A;  2W56 A;  1W7C A;  2QGU A;  4U13 A;  4HZ9 B;  4TX4 A;  1K8A 4;  2K0M A;  1O7G B;  4JRF A;  2C10 A;  2W56 B;  3TDG A;  5KP1 A;  3EN8 A;  5LC7 A;  2L4V A;  3D3L A;  3PS8 A;  3PCS A;  3WDG B;  4H61 A;  3NV0 B;  3SXX A;  3U97 A;  3AMO B;  2Z7A A;  3X3X A;  3EC9 A;  3ROB A;  1IK3 A;  3CPW 2;  5EVH A;  1OUN A;  1FGO A;  2HMJ B;  3DUK A;  4RBN A;  4XBY A;  2F98 A;  4N3V A;  5I97 A;  3CPO A;  4AEQ A;  1VQO 3;  3EF8 A;  3SX1 A;  2CFG A;  1WNH A;  5D81 A;  4OK0 A;  1E3V A;  1PU4 A;  1AVL A;  3V92 A;  2CWU A;  1Q7Y 4;  3CCL 3;  1WMO A;  1W6G A;  4IIA A;  1OGZ A;  1D6Y A;  1M9G A;  3WOF B;  4GL6 A;  3CNM A;  3FF2 A;  4EV5 A;  1OAC A;  3GWR A;  4FCM A;  1VQM 3;  4O3V A;  3WA2 X;  2D1W A;  3UL6 A;  1IQY A;  2B1X B;  1RJO A;  1HU9 A;  2OOV C;  1N5P A;  3CC4 3;  5ELU A;  2C11 A;  2CIU A;  3MSO A;  4HKV B;  3X42 A;  4IT7 A;  2CHC A;  3OWU A;  3OWS A;  4Q53 A;  1NO3 A;  2OCT A;  4K90 B;  3LXU X;  4ZM8 A;  1HKX A;  2P0M A;  1ROA A;  4MJD A;  1M90 4;  2FGT A;  3I55 3;  3WMD A;  2F86 B;  1NB5 I;  1OCV A;  1E97 A;  1GY5 A;  2HMK B;  1NU3 A;  1NB3 I;  5DRV A;  4N6O B;  3G4S 3;  4FMC A;  3WA3 A;  1T5Y A;  2CFK A;  5AEW B;  3KZT A;  5IG3 A;  1GD4 A;  4HBR A;  3RGR A;  3B4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...