3NCBB

A mutant human prolactin receptor antagonist h180a in complex with the extracellular domain of the human prolactin receptor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
206
structure length
206
Chain Sequence
MLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two Independent Histidines, One in Human Prolactin and One in Its Receptor, Are Critical for pH-dependent Receptor Recognition and Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/hormone receptor
molecule keywords Prolactin
total genus 37
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2010-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ncbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ncbB01
3QWRA 3EFFA 3OB8A 1DSFH 4FQCL 4I18B 4QRPB 1NAMA 3VXRB 3HAEA 3FQXB 4NO2B 3V0WH 1T20B 3I75A 1ORQA 1CE6B 1NCBH 1PD6A 5C2BH 3QXUA 3VXME 5K9QG 3PDGA 1GHFH 1CD1A 3D3VE 2I5YL 4PTTA 5IBTH 5F7MC 5FYJL 2Y36L 4JM4L 5F7HA 3SOBH 4JO3H 4JDTH 4DOHE 5KSAA 4I9WD 1TJIH 2CDFA 5TF1L 3A6BH 2AJSH 1T03L 4FQ1H 1E28B 4IRJC 3GSNL 4C56B 5I16A 2BMKB 1HDMA 3RAJL 3QEQE 5FYJE 4GRMB 1UYWL 4J3OC 4M5YL 3MLTB 1HHHA 2BHZA 1OAUH 4NFDA 4QRTA 1EEYB 4LVHC 3BP7A 4JPVH 3BH9B 1F4HA 1F3JA 3M17A 4U3HA 1X5FA 3IFPB 3OB0K 4LLQB 5DO2D 4PB9L 5I71B 2QADD 1PJ9A 4OZIE 2K7QA 1RV6X 4P3DB 4L5FL 4OLYL 2OS7A 1J1OH 3MX0A 3Q3GA 3VWJC 4JN1H 4WEBH 1I85C 4NQUA 1N7ML 3TN0C 5ICZA 2WBJD 4NZRL 1MHEB 1UGNA 3QEUB 1LP9A 1UWGL 3KPQB 3L5HA 1PBYA 4Y5YC 2C26A 4WI8A 2VRAA 1VFAB 4GSDH 3DSNA 4O02H 3PGCB 3IDNB 4CRPA 3K74B 5D7LB 1YN6B 4M43H 5IMOB 3BE1L 1OAZL 1OWWA 2IMMA 2AABH 3CFJB 2A6JA 4P46D 4MLIA 5SWZE 1N5AA 2QHRH 3C60C 3QA3B 5CILL 3U1SH 3WEXA 1GZQB 4F80A 3LS4H 1EEUA 5MEOA 4KK8C 3MRJB 1KELH 4TNWK 5KVDH 3UJIH 4PJCB 2BOCB 3GSWB 4PGZA 1Z5LA 4L29A 5EWIH 2Q8AH 1FLRH 1UH3A 4AEFA 2DIAA 4GKSB 1LK2A 5B3JE 4UAOC 2VAAB 5JUEH 3GBNH 1JF1A 4X6EB 2GY7B 3CFKA 3SDYL 3BPNB 4FMFA 25C8L 4YXHH 4YHOH 5D93C 5DUBA 4I0PC 1MAML 4K71B 3OF6D 2F54A 5ICXA 3TP4A 1S9KC 5C9KA 3BIBX 5CD3A 5E6IC 4KI5C 3QEHA 1MIEL 3D85B 5LGHH 4NQCE 1T3FA 3RU8L 2MWCA 3WFEH 3QUKA 4ZSOB 3FJTA 5F89B 4FQXD 3IB4A 4XAKE 1J1XL 4U05A 2EDFA 1AQDA 3STLB 3G5ZB 1MLCB 1MFAL 1XF4A 3ARTA 4ONGL 1PKQE 3B6SB 4HUXA 2QV2A 3OBAA 3FO2B 4G9FE 2CKBA 2PW2A 3TBTB 2IPUG 4Z0BH 1EJOL 2EIDA 4HXBL 3G6JA 5ADPH 1UVQA 4YHZH 1BX2B 1A0QH 4YQXH 5I1DA 1EFQA 2RBLA 4YK4B 3QPQC 3IFLH 1OARL 3W39A 5T1KB 3H42L 4XWGL 4DUVA 2VLME 2PCPB 4PJAA 3N9GL 3TM6A 4JFZH 4AG4L 5HYQB 4HT1H 1FAIH 1FO0A 3CLEH 5AD0A 3WLWD 1MCWM 2XZCL 4OF3A 2V7NA 1XIWA 5GGUB 2WUCL 4KKCD 5IJKC 5CLWA 5JORA 3CVHH 4M7LT 1SVCP 3SO5A 3JTSB 1KB5L 5D2LF 1YEGL 3S35H 2HYMA 3ARVA 5CSGA 3JV4A 4JPKH 1B0GB 1QZ1A 5I76A 4LCCB 4U6XA 4XC3H 2EE2A 2PCPA 4RX4A 3BW9A 4ZO7A 2I07A 5FM5M 3X11B 1Q1JL 2FJGA 3QAZB 4DCQB 5F96L 5L9DH 3BWAA 3WXWH 5DQJB 3LKPB 1VB9A 3QDGD 3O6LL 5GGTH 5C0EA 4WI9A 2A77L 2EIZB 3L5WA 1A4KB 3LVEA 4LLMA 4PY7B 1MCSA 4NDMA 1MCJA 4MNGE 2A9NL 4DKFL 4ONHA 4ELKA 3T1WA 4LCIH 2DM4A 4MNHA 3HPLA 1NGYB 5CP3H 3REVA 5TFSL 3MRHB 3FOMB 3BIAX 1RVFH 5SWQA 5DD1L 4JO2L 4MXWL 1YMME 2YPVH 1MFBL 3CX2A 5FYKD 1NUFA 1PZUB 4PP1D 4YDIL 3BKML 3UTQB 2RFXB 4EDWL 2R2CA 4JKLA 5E8NB 2DKSA 5F3HB 2B1HH 3MCG1 5JZ7D 2VDPH 3ROOA 4WHCA 5I15H 1K8IB 4GAJL 1RZIA 3MO1B 4HIXH 3LEVH 1P7QA 3GI8H 4FFVD 1MWAH 1UG9A 3MV8E 1FBIH 1I7UA 4XHQA 2YPKA 5JHDD 4M6ML 1CDHA 2GTWB 4LVNC 2E9IA 1G6VK 3VFVB 5EPMA 3MLRL 5FV2A 5IFJA 3QUXA 4NUGH 1I1AB 3BOVA 4N1CA 5DD6B 3CK0H 2A1WL 4Q6YA 1C08B 5EN2B 2GSIA 2X4NB 3K4AA 5FOBA 5L7XL 4IHOA 4WFFD 4R3SB 4GG6B 3PL6C 3STLA 4IOIB 1HSBA 1IGYA 1MCLA 4M1DL 5IEHB 2Q3ZA 4HMDA 3HRZB 2ADFH 5D5ME 1LO5B 3SPVB 1IARB 3MTRA 1NUGA 4DWHA 4HIEB 3GRWL 5DURB 3OJDA 1Q9OB 4I4WA 2A38A 1E6OL 1DDHB 5ERWA 3O3AB 3DI3B 4OLYH 2HFGH 4WU7A 5GGQL 1F4XH 2AJYH 1UM5L 2ESVB 4KPHL 4G5ZH 4QRPE 4X0KA 1YEKL 2YBRB 4L4VE 1MFEH 3VD5A 1IZKA 1LK2B 6CGTA 2OL3L 4LLQA 4ONGH 3SJVD 1ZA6B 1FIGH 2I5YH 1MCKA 5IBTL 3SE9L 5D5MB 3BH9A 3NMEA 2VR9A 1FV1B 1EEYA 2BOCA 4U1MA 4IS6B 1HHHB 4WGWB 5SWSD 4J3TA 2C4FT 3GMMA 4C56A 5I16B 3GSNH 1E28A 1H15A 2AAVA 5TH2A 1P69B 2J12B 1QVOA 5GS1C 4XPTL 2VQ1B 2B7DT 2XA3A 2BSTA 4QNPE 2P44B 3OX8B 4LHUB 3PGCA 4R7NB 4CJ1A 1U8LB 1L4IA 1N59B 3VDBA 2Q3AA 1LWRA 2NTFB 3MLWH 3LMJL 1CE6A 2YXMA 1K4CB 4YHYC 3RKDC 1N6VA 2FIRT 2E6PA 2JK5A 4NN6B 1ES0A 4YHZL 1N4XL 3B9KD 2ARJA 1V7NL 4OSUH 3UTTD 3RUGF 2F58L 1NQBA 1CGWA 3V8OA 1H8NA 2R1YB 3IS1X 3O4OC 4N8CH 3GBLA 2ZNXA 4HKZA 1M7IB 1AY1H 5DEFB 3LKQA 3RI5K 3GMRB 3LPGA 5E6YA 3C09C 5ANME 5EU7C 4BYHA 2AK4B 3CAFA 4IDJH 3R0MA 1PG7L 1UENA 3HN3A 4U0RB 1DUYA 4U1SA 3QQNA 4BZ2L 3WJLC 4OCSL 1FZKB 1WEJH 4PRDA 1QUNA 3BZFB 3CUPA 3L6FA 1VFBA 1EBPA 4LIQE 3IXTB 5DFWH 3PJSA 4YXKL 3GB7B 1Q1JH 5JOPE 3MNWA 5E24E 3VGGA 3MODH 2CDFB 1MCQA 2GQHA 5FKAB 4WI7A 4QT5A 3ZE0E 5DMKB 2IFGA 1IGFH 2CJUL 4KK6D 4R96B 3SKJH 4G9DB 1QSEE 5BS0A 1LP9F 4P23C 4KTYA 5IB5B 5GGRA 1AFVL 4NQDB 4QHKI 4P48A 5FM5O 4ETQA 4XX1G 4PRIA 5D7IA 1NAMB 4GBXD 2WIIB 4O2CB 4Q97A 3MREB 3O2WH 1KB9K 4G80A 4H1LB 4HIIB 2WANA 4EN3A 1HHJA 3VI4E 2A74A 3VG0H 5L2KA 5KSVB 4LP4A 4XNUH 2Z31B 1OAKH 4JZNA 4XBPA 1BMGA 4AM0A 2R8SL 3P3YA 4G5ZL 2XKSA 3OKEB 3KPRB 4RGMB 5FUZH 4NC2B 4NO3A 4LPVA 4MJIB 4PJEF 4HLZH 4NOFA 5AYUL 1V05A 3TC9A 5EBWA 1VEMA 3HNSH 2PN5A 3I9GL 3K8MA 4L3EB 4NQEA 4TRPL 1IGML 5KZCB 4KJWC 3D25A 4LLVA 5HY9A 2ZSWA 4MAYB 5IOPA 4U7SA 4DK3A 1T6WA 3PWNA 3WD5L 1F45A 2BNRA 2DIBA 5F7WC 4AQOA 4QTIH 2RQ8A 2ZCLL 1CXLA 4HH9A 3NCFB 3U82B 4X9GA 5CMAB 4NP4L 3DX7A 1NGZB 3Q0HA 4WGVB 2P5WB 1G6RL 4A6YA 5LVEA 2CUMA 1B2WH 5DWUL 4OFPA 5DD3H 4K8RH 4ZS6D 3W81A 5LGHL 3L3HA 3PDOA 5ABDE 5E8OA 4F33A 3LRSB 2JLLA 3RZWA 2XIDA 2W0FB 4QHLB 4YXLH 4KI5E 1KB5B 4C56E 5CJ5A 3HZMA 1S7QB 3WIHL 1LQSR 3BZEA 4CDGC 4DFIA 3I6KB 3K8LA 1BQHG 1AXSB 2YRLA 5DHVH 1BQHA 3GGWA 4H25A 1B6UA 1FYTB 3U0TB 3QEGH 4GMTL 3UEZA 1CFVH 5T33L 2Y5TA 3MLXL 1MRDH 3MLZL 3RQ3A 3ZHLA 3GMQA 1WTLA 3I6KA 1AD0A 1NMAH 4X7TA 1ZKAA 4DN4L 4LHJB 2YD5A 4JG1L 3QQ9C 1U58A 3I3BA 3UJTH 5IVXF 1DQJA 4QHUA 4DK6A 1C12B 3GHBH 2GIYA 3LPFA 5EORH 4G7YL 4D9LH 4OTXL 3QFDA 3QG7L 1KB9J 4OAWA 2JB5L 4OCXH 3WDJA 2C3VA 1CDUA 5BS0E 1LEKA 1RULH 3LQMA 1P4BH 1RI8A 1PY9A 4M7JL 2DLFL 4AIXA 4GXUM 1IKFH 1F90L 1P7HL 1LD9B 3TGXA 2IQ9H 1E4WL 2X4OA 4W4OA 4UNVA 4YDJA 5FDYA 1J5OL 5IOPB 5HDBF 2IWGA 1TTFA 3TF7C 1XF1A 3BMWA 2GAZA 3FRUB 1JGVL 1A6TA 2CRMA 4S0SD 4GW5A 1U8NA 3PV6B 4D0BA 4HMCA 4NO3B 1YYMH 32C2A 5DT1H 1L9MA 3SE4C 3DPBA 4KQ4H 3HE6D 5D4QA 3VGAB 5TFSH 4YXKH 3PL6D 4XB7A 1CGXA 1UCBL 1FYTE 3SKOB 2EXWC 4RBPK 3IJYB 4MD0B 4JPIA 1EXUA 2IAMB 2X7LB 2XPGB 4QRRD 1N2RA 5D7IB 5F9OL 4RMWA 2BOBA 2D9QB 4L8SA 5ITBH 4YDIH 5F1NA 1J0JA 2FBOJ 5IW6B 1EFXD 3KXFB 1KFAL 1E6JH 1KTDB 5IKCB 4YBQC 2JE8A 3U46A 1GZPB 3QQ9D 1HHKB 1AO7D 2PW1A 1DE4B 3P0VH 4N0FA 5GZOC 4UZGA 3H7LA 4OD2A 2J5LB 3ZMRA 3ZDXE 2DQDH 4S1RL 5IR1A 1MFAH 2DM7A 4EDXA 4GW4B 4BH8B 3CUPB 2IALA 3S8WA 2D0GA 1LGVA 3CDFA 4OZFG 2D3VA 2VAJA 4K7FA 1DVFB 3MRLA 2CMRH 3QNXB 2IGFH 5HYJB 1NBYB 3QNZB 4TUOA 4KROC 3VGHA 4LK4A 2OK0H 2E7HA 4HKZB 2Y9RT 4JB9H 1NDMB 3K3QA 3SDXB 1JGUH 5M7QA 2P46B 4PJBF 5FB8B 1I3UA 2WZPD 1KGCE 2VDLH 2XQYG 4LF3B 5I18H 5F7DA 1ES0B 2GW5A 1HHGA 1X3DA 3PF2A 4K94H 2V9RA 1UC6A 1FAIL 3CLEL 4M00A 3SQOL 3FB8A 1V3MA 3UC0L 5DHXB 5KOVC 1UWEH 4CMMA 3DO7A 2VQ1A 1D5MA 4HWBA 1RJCA 3IDJB 4R4NC 1GGYA 4ZS7H 3TIDA 4K3EH 4LFHG 1H15B 3BXNA 3RZCA 4J4PC 1MEXH 1IQDA 1KPRB 3CMOL 5F70A 1C5BH 3BSZH 1QSFD 3OKLA 4W6YB 4JAMA 1ZHKA 5I1KH 2YOCA 4HUWA 4RWYH 4PJIA 5BQ7A 2FGZA 4BFEA 5JOEA 3HE6B 3FT3B 1J05A 1UJ3A 4K3JH 1EBAA 1I7TA 5J1AA 1CE1H 2Y1VA 4PJ7A 5T5FL 4Q9QL 2B4CC 1YNKH 3R06A 5FDWA 1SM3L 1HEZA 4X0KB 1GZPA 4JR9L 4CU8A 3MBEA 5E8EB 2MQ0A 1DBBL 4PJIE 1DDHA 1U3JA 4LLWA 1BJ1H 4DN4H 4O4YL 5F8RC 5AG8A 3NZHL 3AU1A 4L8SB 4WFGD 2NW3B 4HF5L 3IJYA 3MRDA 1CFQA 1BOGB 4XC1H 1VGKA 4YWGH 1XGPA 3LB6D 1WUNT 4GAGH 5I17B 4LVOB 1SYSA 2AGJL 4R90H 2WSKA 1MEXL 2AJXH 4EQ3A 3IXAB 5GHWL 3WLBA 4HIJB 1QFWM 3L3DB 4LFHD 4PJ8D 1QBBA 3N1PC 4S11A 3EOBB 1ZT1B 3T08A 1RIVH 4D0BB 1CFBA 4LSRH 3QUXB 5GGTL 3D39E 5I8KH 3KWWA 5EPMB 5FEBA 1U9KA 3MLWL 1QBLL 4WWKD 1JPFB 4A2LA 1T1XB 1MFDH 3EYSL 1D9KB 1R3IH 4WEBL 1T1WA 1LD9A 5D71H 2CIIB 4ZFGL 1H5BC 1CLOL 3S5LG 1ZA3A 3QEQA 5CJBA 3TFKC 4R4FH 5TQ0L 1A3RH 1AIFA 1FCGA 3DMMB 1LE9A 4V1DD 4YIQA 1V5JA 2R69L 1I9IL 1KUMA 1QLFB 2CIKA 5F93C 3BH8A 1FH5L 3P9WB 1C7SA 3QEQD 3O8XB 3IETA 4XCNB 1HXMA 3BP4B 1DANU 5DA4A 3WFHA 4OUUA 5IHZA 4M4RA 4MA8L 4LKXB 3MUJA 5JQ6L 2D7TL 4FFZH 1OPGL 1TQCC 3B8SA 3FKUS 2DJUA 1GVIA 3GBML 3NAAL 3NFNB 5IW1B 1R5IB 1XH3A 3HTLX 4M8QB 6FABH 3E8UH 1ETZA 4YFLF 4G6JH 2VMFA 4R6UA 4KXZI 4DZBB 1HH9B 4I77H 2VH5H 1E6OH 1EGJL 2DN7A 2KL6A 1HWHB 1T5XB 2CLRA 2FECI 3G08A 4G7VL 4E41D 4KMTH 1FYTA 3U0TA 2EZ0C 3KLHD 3WS3A 5DJ8B 3FQUB 5IIEA 1AXSA 2HKHH 4NUGL 5CKAA 1X5IA 3BPOB 3FN0L 4HGWA 4Y8DC 1S7QA 2FJHA 2M1KA 4QTHA 4MAYD 3MRQB 2OX5A 5ETUA 3VFNB 1QO3B 5D2LE 1KFAH 4Y4HA 2DKMA 1OM3L 2V5TA 4Y5XA 3VJ6A 1OARH 3I3DA 2HMIC 1EO8H 2WLZA 5MP6H 1ERNA 5T1LD 1PX4A 3DV4A 2ZOLB 3W5MA 3FT4A 4GXVL 3PQYE 2R4SL 4KTDL 4MNQA 3VGEA 5GGUA 3BVNA 3QUZB 3WFCL 3L5IA 2JCCF 2BNQA 2ADGB 4GAFB 5D1QD 5FHBL 4NFBA 2CXGA 3D69B 4XCYA 4KVCL 4S1SH 4KZEH 2P43B 5DJCB 5JMOC 1DEEB 3FHQA 4R0LB 5JXEA 4NN5B 1T04A 1D6VL 4HKXB 4ZOAA 3PWNB 3VXNA 5JO5A 4W70A 1LO3H 5EBMA 3NBNA 2H32A 4GJTB 5C08D 4IRSA 3RVXC 2JIXB 2OYPA 5EDXA 4HQQH 3P73B 2N4IA 5DUPH 4I8DA 5JR1L 4GSDL 4M61B 4NN5C 1HOCB 4MJ4A 1VFUA 5I1DB 5HPMB 2VDRL 1WWWX 2V2XB 3LN9A 2C3GA 2BCKA 3SGEI 4LMQE 4AM0B 4MYWB 4MCZA 2V2TA 1AHWC 1JWSB 2XZCH 2P8PB 2YS4A 2UUDK 2YA1A 5F97E 1CXEA 4Z18A 3MV8B 1U8QB 3ARBD 4X9HA 4Y7MA 5DI8B 3IF1B 2G9HB 4ZSOA 1A2YB 2EDKA 3U4BH 2EDQA 4OCYH 1CDGA 3I2CL 5I8CB 4XNXH 3CMOH 2O5YH 4MX7B 5KOMC 4WO4A 3ULSB 2A6DB 3WCYA 1IEBA 4P23D 4GKZB 3B9KB 4QT5B 1UWXH 4NO0A 3BFOA 1O7VA 5KN5A 3U0WL 2PYED 5EB9A 1X5AA 1MI5E 1FFNA 4YPJA 1HSAA 3HMXA 1LO2H 3SJVA 1B6DA 4RGMC 2SEBB 1HI6A 2D7NA 2EKJA 2NY0D 1DUYB 2IH1A 1R3KB 1AGDA 4G6AC 3T4YB 4BZYA 2YD2A 1RUMH 2B4CL 3VFWB 1U8IB 5I8KL 2PUQT 1NCWH 5IK3A 2FYYB 1DSFL 3UTZA 4LSSH 3KS0H 2BY3A 4ZUVA 5TE4H 3MJ8A 4HXBH 1ZWIB 2P5WE 3TJEL 5JMRA 1IT9H 3OG4B 3EDJA 4DFHA 3HAEG 1N3NA 2G60L 5D7LA 4HUKB 3LSOA 3UAJC 5HVFB 5DJ6B 3IDNA 4ZTPL 4U6YB 3SO3C 2JK5B 3T04D 5C0JB 4JM4H 3C5ZC 4Y4KD 1A1MB 1HILA 2AEWA 5GS0C 1FFOA 3X17A 4HV8A 3U4EB 5BCAA 1OCWL 4JQVA 3QQ4B 4CL7A 3V0AC 3ARBB 4W81A 1GPOL 5E03A 1YNTA 5DHVB 3ESUF 3Q3GB 1LO2L 4AT6B 4KVNH 4P5KB 4NO5B 4Z7QF 1UEMA 3FZUD 5FHAL 3B3IB 1JUFA 4UQ2A 4ZQKB 1BF8A 4I0CC 3JTTA 1CN4A 5IMKB 1CLYH 1RIUL 5IB2A 2B1AL 1U8IA 4K7PX 5ISZE 3L7FA 3QUYD 4YE4L 1QBMH 1XEDA 2HVJB 3ARFC 4XC1L 1JF5A 5D5MA 4X98B 1V7MH 4PJ8A 3PWUA 3DRQB 3GIZH 3L7FB 5FGSA 4EUPB 1NFDF 2J3SA 5LJYH 1AE6H 3RWJA 1UACH 2OTWA 3FCTB 4M1DH 5BZWB 2I27N 3AY4A 3OR6B 1HDMB 1M05B 4N90D 2ESVA 3DYOA 4PV9A 5E6ZA 3VWKD 1VKXA 1NMCB 4HWEL 4JO2H 3QUZC 4KDVA 3LOWA 3CFIC 2J8HA 2A6IA 3SDYH 4WWKA 2J8UE 3MYZA 3QQ4A 5KSAC 5C9JB 4E9LA 4UBDD 1ZLSH 2X9WA 5T3ZE 2I9TB 4EJ1C 4TSCH 4WW2B 4P46A 3OGCB 3LS5H 9CGTA 1ZEAH 3O6FB 1U3HD 1KTRL 3EO9H 4D9LL 4U1IB 4HHAB 4IMKC 4CUCA 2Y23A 3MV8A 3O2DL 1LDPL 3UTOA 3S35X 5D1ZB 1TQBC 4GG6A 3EYOA 3P11L 2P8PA 4JPWH 5KVGL 1DLFL 4MCZB 4MZ3A 4JM2F 5CZVH 1QSFA 1JHKH 3BHBA 4L3EE 2BCKB 5JXAH 3A0OA 3BPCA 2DQHL 2JCCA 1FAKT 1WISA 2AS5M 5GGVL 2GTWA 1UACL 1XGUB 4HW6A 3TBSB 1MCBA 2FZ3A 2OJZL 2OQJA 4Y8AA 1MFNA 1CXKA 5CINH 1I9JH 4N8VB 4O51A 3PWVA 5CUSH 5KN5B 1Z9SA 4EUPH 5DJCA 2Q20A 1FRGL 4MXQC 4PJGA 1FYHB 5GSVB 2N1KA 4WO4B 1KEMH 2WIMA 4MX7A 4HC1H 3JSSA 3VXUE 4XNYH 2WP3O 5DGQA 1A21A 1E4KA 4ZPTB 3S37H 1NCDL 3TZVD 4FQIL 2G9HA 2VZUA 2ZOLA 4HG4K 3MV7E 2MCG1 2HT2D 2XQBH 1II4E 3MLVH 4Y5XB 1CG9A 4KAQH 4AEIL 3B9AA 4OCRH 3T77B 2F5BL 1VCAA 4EXKA 4PYGA 3KPMA 2OI9C 4IM8A 2MPAL 2R29L 4X99A 1YEDB 2HA1A 4ZFOB 1XGRA 2EYRB 5TDOA 3QFJB 4M61A 1OPGH 4PGBA 5D1XA 1KJ3H 2V5MA 3LKPA 5CZXD 5DJ8A 3WS3B 2CKNA 2ERJB 4J3XA 5I1AA 2LE9A 4LEOB 4NJAL 4IRSB 5C0RH 4PJ9D 2XYCA 4EVNB 1DBKL 1T66C 4P2OD 1AI1H 4RGNB 2CLRB 2ITCB 4U6XB 4PGDA 4LBEB 5C0CD 5GZNC 3JWOC 1KTKE 3HC0B 4DGVH 2O5XL 4M8QA 3H3PL 5J56B 4KHXL 5EOCH 2BNQB 3IYLW 2R56L 1T4KB 3RP1A 2VE6A 4NUJA 2AQ2A 1IM9B 5JA9A 1NBVH 3BGMB 4DZ8A 3FT4B 4AEHH 5TJWK 5DMIL 2R9HC 1IL1A 3MRGB 2DQUH 2OR8A 5C3TA 3ROLB 5GS0D 5L6YL 3S9DB 4M3KB 1E4XH 5HYQA 1QLFA 4KXZH 4OT1L 4S2SA 1SBSH 1IL1B 2XI9A 3MRGA 1LILA 1LDSA 4GG6F 5ITFB 4CVZB 2EO9A 3C2AL 4Q9BA 1JE6A 2Q87A 3ULUC 3D85D 3WFDH 2F53B 3BIKA 4HIXL 4CMHB 4Y5YA 1EK3A 5ILTL 1JV5B 5DMJB 2RJMA 4UTBL 2AQ3A 3RWHA 3OKDA 4PS4H 1ADQH 1C7TA 4O5LL 3MFFB 4XPFL 1T5XA 3OL2A 4XBEL 3ZKNC 2XWBA 4YE4H 4WJ5A 4OGAD 4FRWA 4NN7C 3Q5OA 1PQZA 3BRDA 3PWPD 5TQ2H 4F3FA 1I1YA 5C0ND 1J10A 1XF4B 5CS7A 2FGWH 1WICA 1AQDB 3MBXL 3CD4A 3MMEB 4G6FD 2E27H 2Z8RA 1YNKL 1RIHL 4XVTH 1IRAY 4G8IB 2B1HL 4DKFH 4NNPH 3HUJB 5HVWA 1ZHBB 1R5VB 1RK1B 3DOSA 3P0YL 3VXUB 2X44D 2Z8VC 2QQLH 2UWEE 4TUJB 3O41B 2BSRA 3K0WA 3U48A 2WP3T 3D18A 4JRXB 1MHHA 2HKHL 2JJVA 4YIQB 2KQNA 4JHBA 5SWZA 5EIVA 4NQXA 5CJXA 1A1OB 2IJ0C 2CK0H 5C0AD 1G9ML 1OP3H 1BQLH 5HGAA 3ILPB 1J1PL 2GHWB 4H1LH 4PJGB 3GJFA 4JG0H 1UXSA 4Z9KB 5IV2B 2FX8L 1YPZF 5HYJD 2GJ6D 1DVFD 1KENH 3BO8A 3X14A 1JPFA 5GRJH 1J05B 3EFDL 1DQDH 3CDYA 3HMXL 3T0DA 3GSWA 5TDPA 1UQSB 3MOQA 5A2KH 1GRWA 3MRBB 3GMPA 3QIBD 1NLBL 4O2EA 1BJ8A 3C5SB 3QJFA 2LV4A 1ZT1A 3SKNB 1XGUA 2YK1L 4L3CB 4HG4J 4J8RB 5F7UA 3TIDB 3C6SB 1JWUA 3DO7B 4NC0B 4NQVA 3M1BB 1HHIA 4NQCB 2MMXA 1CFQB 4NM4L 1KIPB 3L5XL 3HE7A 1PZ5A 2X6MA 1RUPH 5F9WB 2NXZB 3T1FA 1HHGB 4TRPH 4CU7A 3TYFB 4PRPE 4G3YL 1I9IH 3T8XB 4FXGA 4HWBL 4B7IA 5JTWA 1T89C 3WNLA 4K23H 4NWUH 1VGEH 4OI7A 5DJDA 2MTPA 3OGCA 2CGRL 2FJFB 3BRGC 3L3KA 4WW2A 1HEZB 4XAKD 1RIVL 1Z3GL 4KC3B 4XWGH 1NAMH 4X9FA 4QRUA 5J3HD 5LBSH 1MI5B 2HFFB 3CX5K 3QUYA 3QIUA 2YD8A 4L1DA 4XP9H 4HX1B 4OBRA 1S8DA 2KQMA 4K8RC 4OZ4B 1OW0C 1MCOL 4BH8A 3QCTH 4JO1L 4UV4L 2QQLL 3VH8G 4XNYL 2IEPA 5J6GA 5TQ0H 2GTZB 4KUZH 4OLVH 4KY1L 5CHNB 1HHKA 5K9JL 3HI6H 3V6ZA 1W0YT 2EE3A 4K9EH 1TCRB 1D5BB 4JDVB 4QHMB 3RVUC 4P5KA 4K94C 5JXEC 1A6UL 1QNZL 2OJZH 5KAQG 5JIKA 3W9DA 2GCYA 1T20A 3JV0A 2BOBB 1IC4L 4ZTOH 2X9XA 4XPAH 4ZO9A 5A1AA 4JPIB 3FN3A 2D7QA 2WINB 4QXGH 4CW1B 3QDGE 5HHOA 1U8MA 3G6AB 3MA9L 4KTDH 3VFTA 1FRGH 3TVMB 3CSPA 4U6YA 1E4WH 3PWLB 1YN7A 4BH7B 1PAMA 4PRAB 5GGTA 3CFCL 1H8OA 4IRZH 4NRYB 2FHBA 4D0DB 3GMOA 3SDXF 3ZT7A 1LP9E 3PV6A 2FIKB 5EU7E 3RY6C 4EI5A 3PHQB 3ECBB 1MUJA 1J11A 3V52L 5BV7C 1CTNA 4NQSB 1TPXB 3QDME 3SE3A 2ILLA 4YDJB 2NY6B 1NAKH 4J2XA 4Y4FD 2SEBA 2ICWI 2PW1B 4Q6IC 1JGLL 2JB6A 4EI5D 1GC1C 1PDKA 3KPSA 1D5ZA 5BOZG 3QDJE 5BS0D 4J4PD 1AO7E 4U3XA 1C16A 4XGZA 1KCKA 4FTVB 1GAFL 3ISWA 4PR5A 3BMVA 3PNWA 1I8MA 3GIVA 4TULH 3V8CA 3MYJA 2Y72A 3QG7H 3QFDB 3RGVD 3VFGH 1WAAF 5I8CA 3EYVB 3QXVA 3E2HB 4P99A 3TN0A 3O9WA 5GS2H 4L4VD 4XWOC 3SQBA 3LD8C 3VXMA 3GMNB 1OP3K 4XHJC 2KZWA 5E6IB 3EJYD 5L7XH 5D96B 2F8OA 1LE5A 3K4DA 4ZSOE 1BIIB 3KR3L 1HKLL 3C2SA 1A6TB 3MCLL 4HLJA 4NGHL 4MD5A 4P5TA 3IDIA 1A9BB 4JRYD 3TBYB 3CIQA 1BQHB 1HOCA 5F6HI 3OQ3B 2NW2A 4MJID 1OTUD 5FGRA 3BZEB 5TPWH 2OK0L 2V7HA 3P0VL 3UTSA 1MNUH 3QI9C 5F9DC 2B8OT 1JPSH 3OAZH 4P9HL 4XX1E 3MZGB 1LEKB 4HJ0D 1ZK9A 3HB3C 4K3GA 4EBQH 4WTZA 4YC2B 2J2ZA 2OI9B 4J23A 4NT6B 5IESL 2F5AH 2W9EH 2VXUH 2HN7A 4JFHD 3QIBC 4LPUA 4ZTPH 1Y18A 1WJ3A 3FFCE 1RJLB 4RZCB 4UT9L 3NCJH 2IANE 4QWWD 1CLZL 1UB6B 3QIWB 1FL5A 1KCSH 3LAFA 3HPJB 1I8IB 1DQTA 2UVEA 1L6XA 1BVKB 1HH6A 5FYLL 3VI3F 3CVIL 1MELA 4S1DD 3GUTA 3S88H 4DVBA 5B39B 4X4YA 4LCYB 3KPLA 4K3JL 4TTDC 3RWFA 3ZO0A 1V3LA 2VXTL 1MRFH 1XGYH 4OIIH 4OZGB 4L1HA 2ADJB 3FFDA 4H0HB 1YEIH 4UTAL 4JREC 2EDLA 1H0DB 3FB6B 4Z78A 4UTBH 4FZ8L 2Z31A 3VD7A 4JM2C 4KJQC 2XTJD 3CXHK 4HS3B 3DBXB 4HUMB 3LRSA 4F9PC 2VNCA 2VDQH 4H1LG 3ZHKA 2NY3D 4WFED 4UT6L 4JY4A 1JHTA 1EHLL 4Y5VC 1P4BL 3F8UB 1YEEL 3I84A 2R0LH 4O58H 5DHYA 4AEHL 5A3ID 3UO1L 5GS0L 4WV1A 2VWEC 5IB5A 5I18L 4ZXBC 1PG7H 1YNLH 2P24A 3H8NA 3KPSB 1QTYT 3HG1D 3CSYB 3KDMA 4G7YH 4G8EB 5CJOH 3V4UL 2WW8A 2E7LA 1B0RA 2KZ1B 4PJAF 2YR3A 5J12C 3TV3L 5D2NA 2NCMA 2DBLH 5BO1H 2VXTH 2CIIA 4FABH 1G7IA 5EBWB 4Z95L 3RL2B 3U30B 2R0KL 1QRNE 1VEPA 3BPNC 5L2KE 2UZXB 2XWTB 4B7LA 4G42A 3BRFA 5LWYH 5GRXG 1Y6NR 5T1DL 3D2UB 3UTTE 1CLZH 4HPYL 1QSEB 3X12A 3WIIL 1I3VA 5HHOB 3E0GA 3EOBA 3MRPB 5DVOA 5GS2D 4S10A 3L3DA 5MEQB 5E0QA 4X8JA 4WI4A 3TJHD 3C60B 4WIQA 5DURD 3MR9B 5KJRH 5HXMA 4W4OC 3RVVC 4G6KH 3LKRB 3TO4D 2Q7YA 4Y16D 1UCTA 4ZFZB 4HH8A 5CGYC 4JFEB 5CHNA 5DMKA 4WDIB 4GQ9L 4OZFA 5LGKA 3DV6B 2GTZA 4Z0BL 4F37K 2FB4H 4XCEB 4D0CB 5I30H 3HC4L 4P2RB 4YO0A 1X5XA 2CK0L 1KLGA 3SDDD 1T7ZA 3SO3B 4YK4C 3QIUD 4G6MH 4I2XE 1T89A 5IJVA 1FZKA 4AIOA 3ES6B 2XG4A 1JWMA 2CRYA 3HE6A 4YHNA 3FTGA 3THMH 3RX7A 1HKLH 2QQKL 5HHVL 1LNUA 3ARFA 1M71A 4U7KA 2A9MH 1MQKH 1U8OB 5IJVB 1BFOB 1IAIM 4WY7L 3WJJA 2HLAB 4V2BA 3ZT5A 1M4KA 4JQIH 1FGVH 1MAJA 3DV6A 4MQ7B 1ZS8A 5E9DE 4LP5A 5HDBE 5EO1A 3HE7B 4WWKC 3HMXH 1YEEH 4R8WH 5GRZA 3K2UH 3AUVA 3B9KC 3DRTA 4QGYA 1HHIB 2KPNA 4WFGE 5EO1B 2BSTB 1KPVB 1D6EA 4YGAB 1WZMA 3V5HA 2P42B 4X7SH 4RGNC 2D0HA 5B21A 5CEZH 4LAQH 5GHWH 2AABL 1AGEA 4L4JA 2GSIB 2X2YA 2X4NA 1OF2A 2DQIL 1Y0LB 2MJWA 4O2EB 4YFLI 2FBJL 1I1RA 2DIJA 2X4UB 2BNUB 1GGCL 2W65B 3ARGC 1KIRA 4UU9A 2IC2A 2I26N 1AKJD 4YHKH 1WZLA 3Q2CA 1DUZB 4DAGL 1FQ9C 2ZUVA 1WAAE 2K3TA 1JZ5A 1YDPA 4C55A 5IV2A 1H9VA 2CO7B 3ZTJH 5HGAB 5IESH 1WVZA 2NX5D 4D9QE 4U49A 1FG2A 2MSPA 3TYGH 1K8DA 5HGHB 4KHXH 1IQWL 5EOCL 4WTXA 1DTUA 2X1PA 4KI1A 1N6QH 3INUH 2FB4L 5TE7L 2OSLB 4K3HA 4PRHE 4YFDB 2ZUSA 5C6PB 1KOAA 5IFHH 1KEGL 3CSYA 1RUKH 3VXUA 2RFXA 3HLAA 5LXGL 3H3KA 2L0DA 3LKRA 1D5XA 4YHLH 3L95A 1LO5A 3UTQA 5ACZB 4B50A 5CSBA 1L0YA 1YMHB 3HRZA 3IDGA 4ODXB 1DBBH 5DD0H 2XPGA 2VJXA 2X7LA 5D2NC 3WHE0 4JY4B 5EC1B 4IHOB 3NVQA 1MF2L 5DD6A 1OTSC 1FVCB 2X4TB 4HS3A 3L3OB 1G7LA 2HFGL 3MXWH 1ZMYA 4NPYB 4NDMB 4LOUC 1S5IH 1TTGA 5GRWA 2O5YL 4G9FA 3CH1B 1EEZB 1I7UB 1IGMH 4FABL 4DVBB 3U4AA 5B39A 5FGBC 4ZDHB 4MAUL 4MD4A 2HG5A 2R69H 2DDQH 2OCFD 1B0GA 1RZIB 3QCUH 1TETH 3R8BB 3ZSSA 4FQQA 2H6PB 4OD1H 2DMBA 3SDXE 4OQTL 4Z7NE 4J12A 3HPJA 5C6TH 2YSSB 1R3IL 2P24B 4X7CC 1QEWA 5JORB 5GS1A 1G7PA 1JK8B 1NSNL 1T0MB 2XFXB 5I1HH 4QRRE 5IQ7L 2EDTA 3GO1H 4TPRL 4I9WE 1EHAA 5E8PB 4RIRB 4TNVF 4RAVB 1CBVH 3HHRB 5EU6D 3T65B 2AJYL 4KPHH 1DQLH 3MRHA 4UQ3A 3B9VA 3RY4A 2XN9D 4X5WA 5GZOD 2E6QA 3GDBA 5A2FA 2DQCL 1A6WL 4ONHB 4PJAB 4ELKB 1GOHA 1ZGLP 1LO4L 5CBEA 2MNUA 2Y07H 3WSQL 3FFDB 5C0EB 1OB1B 3F6LA 2MCPL 5DRWA 5GS0H 4LSVH 3ZL4H 3RWFB 4PGBB 3QFJA 3EYUH 5CJXC 5J9PA 1NC2D 2I07B 3KGRA 2HT4C 3QXTA 3RTQD 1BEYH 4P5TB 4XVUC 4PYHA 4WHYH 3ARBC 2CDGB 4HD9A 4ZFGH 4KDWA 1INDH 5HHPA 1CLYL 5IUSA 5HHQA 4BK4A 3ZTNL 3VXMB 3MV01 2Y7QA 3HG1B 3OPZH 4JFPA 3BGFB 4R4BA 5HPOA 5F89A 4JLRB 3DNKA 1ITCA 1FLRL 1N4XH 1KF9B 5E8OB 1X9QA 5LXGH 2JTDA 5AD0B 5KVFH 1Q94B 2PTTA 3GI9L 4LVOC 5F6HJ 4E5XB 4MSWA 3C5ZA 5I1KL 4X7DC 4PGEB 1MCIA 3VXTA 1LO3L 4QRQB 1MJUL 4XGZB 5KVGH 4YFEA 1Y6KR 1RQ5A 2X1QA 3NIGF 2VL5A 1N8ZB 2H1PL 2OQJB 1BBJB 2V7HB 2YC1A 4Q6IA 4NJ9H 1EVTC 2FZ3B 4P2QB 3BQUA 3G6JF 3MOAH 4UT7H 3RY5A 5I6XC 1IGJB 4IRJB 4HDIA 1FFQA 4NQSA 12E8L 5DUML 4QCIB 1F4WH 1UVQB 2FBJH 3M07A 2C4XA 1FGVL 5CSZB 2D4DA 3UBXI 2FRGP 1ZVSB 5HVHB 5E6IA 1CL7H 4PJHA 3CJJA 5FA4A 3CFJA 5GIRA 3CZFB 4FA8A 3N85L 1YEKH 3ARSA 3LY6A 1U92B 2F54E 5DEGA 1OD7A 2HVKB 4OCLC 5FO7A 1HHJB 2GITA 3KPQA 4RAUA 5D7JB 3LHPH 1JZ4A 5CBAB 2X05A 4NZUH 1UWGH 1F42A 1LP9B 2FX7H 4M93C 35C8L 3D48R 1FN4A 1OTTC 2Z93B 1U8PB 1JGUL 2IBZY 4TSAH 5D1ZC 1T7WA 1IAOA 3W9DB 4GS7B 5IB3A 3WBDA 1UB5A 2FCBA 2YD3A 5FECB 5C09D 4JO4H 3QDMB 4H0GA 1ONQA 4R4ND 5B4MD 5SWSA 3OR6A 2A6KA 4FZEH 5T3ZL 4DKDC 2BSSB 1GC1H 4YJZL 5I74B 1NCAL 5FKAA 4BFIB 4JGMA 5KS9E 4LU5H 4XB8A 3S36H 2NXYB 3ME0A 3CH8A 5ALBL 3VXOA 4DUXA 4BUGA 4Z8FL 1C5CH 1IT9L 3WEXB 5JOPD 4OIAA 4HX1A 1QA9A 3OKKB 3O6KL 4CJ0A 4FNLH 1BJ1J 1J8HB 1QLRA 3EJJX 4NN6C 3P2TA 3RIFF 3ULUD 3DURB 3UJJH 3TLRA 5DEFA 2HFTA 5DD0L 5B4MC 2XZQL 1MIML 4IJ3C 4HV8B 3U4EA 1RUML 2YWZA 4ENED 1H3UA 4YDKL 2F9BT 1YUHB 1MQ8A 3I75B 1WBZA 1QHOA 5DJ6A 43C9B 1H5BB 5ICZB 2YPLE 4FTVD 4OGYH 3L3GA 5DSCB 1JF6A 2VZ3A 4OFVA 3R4DA 1KELL 1N59A 4WWID 5DD1H 3EW3B 5TE7H 1RVFL 4OCMC 1HZHH 3ARGB 4LHUA 3VCLB 1TJGL 2FLRT 4BSWA 1QFPA 3M17B 4XAWL 4YBQD 2R0ZL 4M62H 2Y06L 1Z0NA 4MLSA 3QDJA 1Q8MA 1QLRB 3NCBB 3OKKA 4MMZC 4GT7A 1QFUH 1KIQB 4O5LH 4EDWH 5C86A 3DUUB 2R2EB 4OT1H 3ARGD 5J7CC 4ZS6C 3P30H 5EBGA 2BNRD 1VESA 4AH2B 2APVA 1TPXC 2BVOB 4F9LA 4EIGB 1WF5A 3NPZB 4JY6A 2MQ3A 4M1CD 1IEBB 3GJFB 2P8LB 3U9PL 4QOKB 1YEIL 3L3KB 3P4OA 2NQCA 5FKPA 1UB5B 1XMWA 3RWGB 1SJEB 2W9DL 1UFUA 1G7QA 3OJ2C 1NGWB 2WWMD 4WUUE 2WUCH 2X1WL 4I18A 1U8QA 4QRPA 4UNUA 4PJCF 5AUMB 1I1AC 1O0VA 5F71A 5GZND 3G9VA 5LBSL 3JWNC 2HVKA 1JPTL 4PRIE 4G8IA 4FFYH 4PJFA 5GGSY 1INQB 2EYTB 4PJ5B 3HA0A 1CS6A 4YC2C 4IOIA 1HINH 4U1HB 3HC3L 3AXLA 2ZCKH 5K33A 1PQZB 3GO1L 4ELMA 4JFHE 3GMPB 2NY1D 5E9DD 4U3CA 3KLHC 5EBMB 1R24A 4XP5H 1I3RA 3TCLB 1T04B 3D0LB 2EXYC 3X14B 3RWHB 1AR2A 1VFMA 1RK0A 4P5TC 3EDKA 1CFSA 3TH4T 4HEPG 3KHOA 3D69A 1WBXB 1NPUA 5D7JD 3O8XC 4LNRB 2NMSA 3ARRA 5I1GH 1XCTA 1Z0MA 2EDJA 2KH2B 1DQQB 1UM4L 1I8LA 3MLVL 5CINL 2QSTA 4PRHB 1MHHB 4JRXA 2LQRA 4PRNA 3RKPA 4E5XA 2EECA 4HUNB 3O45A 1OAXL 1F58H 2O61A 2HRPL 1MVUA 1WTGT 3L7EA 2XWJA 4UT7L 1KEML 4JZJC 4Y4HB 4WU5B 5FA3A 4QGTA 2A0LC 2BSED 3JWOH 3TV3H 1TZIB 5HHQB 2V17H 2HRLA 2WAHA 3HC0A 3INUL 3WYRA 2VXQH 1I3GH 2DQFA 4JHAL 1UJTA 3OHXB 1QFWH 4MA7H 2WBWB 5CZXC 1NEZB 1AXTH 1TDQA 1TNNA 3MFFA 4X6DF 8FABB 1CIDA 4PY7A 1NCAH 3HZKB 5EO0B 5F9AC 2HT4D 3HI5H 2EE6A 4O00A 1OB1A 1JV5A 2HT3C 2EYRA 3CDGB 5TDOB 3QT2A 4YXHL 1ZLWH 4X99B 1WT5A 3H9YA 5IW1A 3VDAA 2Q8BL 1IKFL 5CD5C 3DIFA 3WV0A 4TSAL 4M43L 2UY6A 5SV3A 3RGHA 4AIZB 4CVZA 2VXVH 1QRND 2H41A 2MKWA 4OUUB 4HUVA 4PB0L 5B8CC 2VDRH 3T77A 1SBSL 4IOSD 1MVUB 3MGOA 1U8JB 4ZO6A 3SQOH 4GKOA 5E8PA 2EDOA 1J0ZA 2NLJB 3SCMB 3JTSA 4LDLB 4Z7VA 1BD2A 1A7RH 1DP0A 3F58H 4ZD3L 4Z7WA 4X5XA 1ZLUH 3U83A 5ILTH 3MV9B 5MI0C 5AYQA 3SY0A 5BVJA 3U9UB 4JHAH 3DHMA 2J4WH 5E99H 2E7MA 2XT1B 3V4VH 4OFDA 2Q7NA 4GAGL 3FQNA 1UH2A 1NUNB 5HD8C 3O4LA 3HUJE 1QSVA 4O51B 1FC2D 1FNFA 2NR6D 1I9RL 3QPXL 4LLYA 1NMAL 1NCUA 1U3ZA 1AGBA 2C7UB 4JJHA 3S34H 3TT3H 1QR1A 1OAXH 1PEZA 2D2OA 4ODHH 2LVEA 1IILE 2IMNA 3CZJA 1YEDA 3BPCB 1BLNA 3L3OA 5IVOA 3C8HA 2R2HB 1YA5A 2E6JA 4J3WA 2PW2B 1NDGB 1QFOA 3F7PC 5D6CA 4ERSH 3OGOE 1J88A 1PLGL 2AP2A 1CK0L 4R2GD 3ZYOA 3RBSA 4Z7QE 5EC2A 1YZZA 3QUKB 5ITBL 4Y16A 4TTDD 3GNML 4HGMA 1CICC 1IM9D 4KRLB 1G7QB 1K9TA 4X6DE 4I5BA 2UWEB 4FFWD 2W9LA 5J13C 5KAQF 2P8LA 4NFCA 1EZVX 3ULUH 1P84J 3L5JA 1YEHL 5DUBB 4PJFF 3RIFK 5C0CB 1BF2A 2N7BA 3RWCB 4N8VG 2J5LC 4A6YH 4LRNL 4K8RL 3O6LH 4KWUA 1JF1B 1CU4H 4X6EA 3KS0J 3BDXA 4G6AD 2R2EA 4EUPA 4X4XA 2XACC 3NA9H 3FB5A 1E0OB 1KIQA 1KC5H 2IG2L 4OCNC 3PP4L 2ESVE 2W65A 2X4UA 5EIQA 3BHBB 3C8KB 1ZTXL 4NQDE 3V5DA 4MB5A 3VCLA 3DSFH 5MEOB 3ARGA 3JTTB 4Y5VB 5D7JC 2J4WL 5E99L 1A4JA 4HJGB 1JGLH 2L7JA 3PGDB 1LHZA 3D3VD 1YNLL 3L3GB 3ZE2E 3CXDH 1X4XA 3PXJA 1OAYH 5DHVA 2OR7A 3GBNL 2YZ8A 2DB8A 1WZ1H 4LF3A 5E5RB 3O6FA 4Z7VE 3RZCD 4JFFD 4KJYA 1W0WB 1YEHH 2V5SA 4DVRH 4KGJA 5C0JA 3P9MB 1KYOK 5DMYA 2R23A 3FZUC 1CVSC 1S7UA 1ODAA 3LQAH 1AKJB 4PRID 1OSPL 3C87A 3MRLB 4X80H 5DZLA 1U8KA 1U93A 5J6HB 1BIHA 4PUBL 4NIKB 3I85A 3MJ9L 5D9SA 3W0WD 4WCYL 3JBG7 4TUKH 4HGKC 3GJEA 2F74B 4OGZA 3MLRH 1C1EL 2VZVA 5A3IC 1NL0H 1NMCC 1JWMB 2X1XR 1KN2H 2ORBL 3IKCB 3VU2A 3VRLF 1I1FA 1HI6B 1F11B 4GXUN 4OFKA 4GRMA 5IMKA 2BSSA 1JN6A 3SGDI 2A6KB 5DYOB 1HYSD 2X89A 3BEVB 2H26A 2AJVL 3QQ3B 5EUKA 3S3JA 1EAJA 3HG1E 5IW6A 3UX9B 3SDDC 5ACLA 5I15L 3O3BB 1YEJH 5D1ZD 3BDYL 4AQ1B 1MCHA 1U8PA 4WDIA 3KHQA 5IBUB 4OFYA 4MA1B 4KTEL 1B3JA 5CBAA 1CD1B 1FFOB 4HC1A 1RFDL 4ZPVB 4ODVL 5DWUH 3CFCH 3WDHA 5DEGB 2F5AL 4NO2A 7FABH 5D1QA 3F7YA 1CF8H 4GUPB 4Y2DC 3FO0L 1J0KA 5H2BA 4MAYC 1PSKH 5FCUH 4I2XA 3RY6A 2NTSP 1MFEL 2VLKB 1FHGA 4MXVE 4F2MA 4JKWA 5EOTA 4U2ZA 5TE6L 5IK3B 1JWSA 4JQVC 1MJJB 3SE3C 2GAZB 3FRUA 4H5SA 4P2RD 2VLRE 4CADB 5BV7H 4J4PA 2VIRA 2IH1B 4NGHH 2VXVL 2D31B 3GKWH 4XVJL 4QXUL 4D9RE 1NCTA 4GH7B 4P2QA 2AXJA 4Y4FA 3BP5B 4HT1L 2DLEA 1HINL 4FS0A 4C4KT 5IROA 4DVRL 3GSQA 3RGVA 5CWSA 3SHSA 4WW2F 3BUYB 3T4AA 4NO0B 4LNVA 2EE9A 4XP1L 5IG7A 4Y16C 5CEXB 3ARZA 5SWSE 3WD5H 3MBEC 3S96A 5HHXH 1IAKA 5B38A 1KLUA 2CDEB 2YA0A 4KMTL 4I3SH 3ZTJG 3S7GA 3BVNB 3QUZA 2EYSB 1A7BA 4JLRA 5EU6A 3HC4H 5IMLA 3DX6A 3NABH 1N0LA 3N9GH 4L8CA 2ICEB 3DBXA 3JWDC 1BBDH 4UILL 3SDCB 1MFDL 5DZNA 1F58L 3VFNA 3AMLA 1CFTB 5INDB 12E8H 2Y6SC 5DUMH 5C6TL 1JNLH 4E41E 1OGTB 4ZFFA 3I6GA 5D8JH 5KANI 4KTEH 5IIEB 5EZIL 3TA3B 2HLFC 3GUTB 1VERA 4Y2DD 5I30L 4UAOB 2H32B 3G08B 5E4EC 1QHPA 2OTUB 2ZCLH 5JO5B 3VXNB 4C57C 1AGFA 2IBGA 3GNMH 4KHTL 4NC1C 4OM1H 5DVNA 4P23B 3WFBL 5DJZA 5IVZB 4ZXBD 3VI3E 1F6LL 2VC2H 3BPLC 1XH3B 1I9EA 1SJHB 2XTJB 5IWLC 1RJLA 4RZCA 1T0MA 1JK8A 2HN7B 1MCRA 3O3DA 2Z92B 1HXMB 4BZ2H 1MIEH 5L0QC 1IAKB 4LCWD 5B38B 2V5YA 3CFDA 3MV8D 3W9EB 5BRZD 1RIHH 5CEXA 1DR9A 4RDQF 1LE9B 1QO3A 1WFOA 1RJYB 2FJHB 4QTHB 4BK5A 1EEZA 2ICES 1D9KA 4DAGH 3BKMH 3GJFH 1RZ8A 4JVUA 2X70A 4MJ6B 4U1GC 5IM7B 1CFTA 1INEH 5EUOF 5C08B 4JZNB 4PJXB 2OL3H 4JFEE 3G9AB 5JOFA 5H37H 3UJTL 5IJKA 1K6QH 5TF0A 4XNMB 3EO0A 4XBGA 4FOMA 5H2BB 1FL3A 5D1QB 5D6DC 3P4NB 4NQDA 4YNYA 4L9DA 4LKXA 5GRVL 5IHZB 2OMBA 4ZPVA 3HI1A 1D5XB 4XCFL 3EOTH 2BXYA 3ARYA 3E2HC 3LKSB 2DYPA 2KKQA 1LO0L 1PYWB 2DI8A 4ZUSB 1XR9B 5ID1B 3NH7H 4PLJC 4JJ5B 1HZHL 2IBZX 5IVNA 2AK4E 2HTLC 4LEXH 4MVBC 3DMMA 4OLWL 3PDDA 4JZOB 3A6BL 5FM4A 5JZ7C 5EUKB 3ARDD 1NEUA 4RQQB 3L6FB 3UPRB 1OTTD 3BZFA 2VDML 3EHBC 1NC4A 3IDMA 3T0VA 3FQRB 1Z9OA 1I1FB 2CMRL 2PYEA 8CGTA 1JVKA 3MLXH 1KJ2A 2CH8A 5I75B 3S88L 3VFOA 5KS9A 3SDDA 2CO6B 4M02A 4XT1C 4PJIB 3KWWB 1I8LC 2WBJC 5JDJA 1MCCA 2AQ1A 2APTA 3EDFA 5E2TH 1B88A 1AC0A 3F62A 3RHWF 1AI1L 1OGAA 3L9RB 1AKJA 2XNAB 3DHJA 2ARJB 3FO0H 3QULA 1YJDC 2ENYA 2LAAA 1IQWH 4OM0L 5E5MA 5BMFH 1S7XB 1CZ8H 1W0WA 3ULVF 3MRDB 3BN3B 3QDHA 1JMZA 4OZHE 5IFHL 4JFXA 4F7EA 3AM8A 5JPMB 5HYSG 4Q0XH 2LU4A 2P7TB 3AU1B 2FEEI 3IDXL 3ZDYF 4H8WH 2VUYA 3Q5YA 2HLAA 4V1DB 3SCMC 5HGGS 5IFAL 2Q86A 1MJ7H 3VH8B 4XMKL 1ACYL 2H26B 2P5EA 3QQ3A 3GMMB 5DYOA 1T80A 5SX4H 5C6WH 2F8VA 2B4CH 2BC4A 3U79A 3VG9B 4V1DE 5L88H 3G6DH 4JE4B 5HDOA 1JGVH 1WSST 2CK2A 3WNMA 4K8RD 4YHNB 1RZGA 1CQYA 5BQ7B 4OZIF 3RWIA 2BRRL 1KPUA 4YHKL 3MUZ1 3HZYA 1MPAL 1YECH 2DQGH 4JAMB 4OV6F 1RD6A 5FOJA 4BZ1H 1P9MA 3LH2L 1FVEA 3QISA 1KV3A 1XAUA 3ZTNH 1EHXA 4UIMB 1A6WH 3GSVA 5DK2B 3P11H 2X42A 1PFCA 4N0FB 3TIEB 4J7RA 3LN5B 3O2WL 4CMMB 1YMMD 4OBSA 4OGAC 1U36A 4LSQL 3GSOA 1OQOA 3X3FL 2IANB 1KXVC 4EOWL 1NGPH 5EC2B 1WZ1L 3MR9A 2AEQL 5ALCH 4XNZB 4AMKL 4WI2A 5DJ0A 1AXIB 5MEND 2HJKA 2ZKHH 15C8L 4Y5VA 2VDOH 3RFZC 4OIIL 3B43A 5HHMD 3SGDH 2EDXA 3UBXG 4UTAH 4LSPH 1SYVB 4ODBD 5D1XD 5DK0B 4PJIF 5IT2H 3U6RA 1AXTL 4KKAD 4MDJB 4NBYB 4Y19E 3T0WA 1G9NC 4F8QA 5CFHA 4NZRH 5J89A 2DF3A 1HXYB 2NY2B 1IGIL 4FQ1L 1BM3H 3MO1A 4OD2B 1TCMA 3RVTD 1T7YA 3RAJH 1MJ7L 3QCUL 4FMKA 4QYOA 1GCFA 4ZNEE 1A1OA 4I5BB 4WO4C 5IKCA 3UZQA 2APFA 4OM0H 5CEYA 5FYJH 5F1NB 3S37L 1EV2E 3H9SA 3VE0B 1P4IL 5I66A 4OAWB 3RVXD 3RVWD 2HH0H 2P1YA 3TJEH 2AEIT 3P9LA 3FB6A 4FXKB 2IAMC 1OP5K 2K7PA 4HS6B 2D7OA 4OQ1A 4NSKA 1I9JL 3EYFB 2YRZA 4YZFF 4XVSL 1EMTH 2CLVB 2DWDA 4BA8A 5IQ9B 4U7MA 5HBBA 1P7KA 1HQRA 1OVZA 4N5EC 1EX0A 5I76B 3OHXA 3R1GL 1J5OH 1CICB 3D39B 3LS4L 3AS2A 4Y5YB 4M1GL 3MRMB 4UOW0 3VXUD 4M03A 4OJFH 3PHOB 5BVJB 1JRHI 3BUTA 3IU4L 4I18C 1JI1A 1ZV5A 3AM8C 4AL8H 1A9EA 2HTKD 4WU5A 3ZDZE 4OZGF 4UOJA 1P7QD 1XIWB 4DKEL 3ZKMD 2GJZA 4OZFH 4F33B 3VXPB 2FWOA 4RX4D 1YY8A 3X3FH 4C54A 3KLDA 3O45B 1T7VA 3W2DH 3WJJC 4NT6A 2H2PC 5C09E 4ZXBB 1BD2D 2LAGB 4HUVB 2EC9U 5ACMA 5HDQH 3ELAT 1T83C 4HWUA 1NGZA 3T3PF 2E5EA 3K80A 4P49A 4LIQH 2DLIA 1TVDA 4WY7H 3TA3D 2XTJE 1EHNA 1L6ZA 1K5NB 4RRPA 3GMQB 3V6OE 4KZDL 1TNMA 2F53D 1GGTA 1P84K 4F9PA 5FK9B 4NNPL 5HY9B 1GH7A 4OLXL 4NNXA 1FIEA 1UXWA 2BK8A 1ZHLA 4YDVA 4NQEB 4WUUD 3NZHH 5EO9B 1BIIA 2HKFH 5FF6B 2YUZA 4ODSH 4K9EL 4MZ2A 5IHBA 4AENA 3KPRA 1MH5B 4PRPB 5B38G 2W07A 2C3HA 4H8WL 4MMXC 5DVMA 2HWZH 4P3CH 3IDXH 3TN0B 1T3FB 5IFAH 1NLDL 1GIGL 4LL9A 1B90A 1F2XK 3MREA 2DJ4A 1I8MB 3MJ7B 3ARED 2EH7L 2GFBA 3EHBD 4PGCB 3KPOB 1MCPH 1SJEA 3RWGA 4C59B 4PJ9B 2FATH 3BQUC 5GJSH 5J8OA 5KW9H 2VQUA 3DX7B 1SEQH 5A16B 5FO8A 4QOKA 2ENSA 4RMUA 2VAAA 1MVFA 2VOTA 5BW7C 3OAZK 4XBEH 2YHGA 4ZOBA 2EDBA 3D0LA 2WM0A 4JO3L 3F12A 2VZTA 1Z5LB 4CNIB 4ETYA 1FO0H 1R24B 5EIIB 2VC2L 2B0SH 1K4DA 2P5ED 5M95B 3VFRB 3PHQA 3KR3H 3TBSA 5JIHA 4Z7UA 3C6LD 4QRSA 3LV3A 2G60H 3LRHA 4JZJB 4KRMB 4PJDA 1SQ2N 2AK4A 1HCVA 4JFZL 3CFBB 1MJ8H 3LKQB 5I6XB 4J3UA 1IZJA 3DROB 3ZSTA 3TVMA 4N0RA 2GUOA 4MCYB 3WDIA 6FABL 3N1FC 1CFNA 4R7DA 2R1YA 3VRIB 1OTUC 3MNVA 4NCC1 2V5RA 2YWYA 3QEUA 2ED7A 5DA0B 5C0DA 4N0UB 2F54D 3VFGL 1KCVL 3QHZH 4KDTC 2YUVA 4OCYL 3TPUB 1MHEA 2R0KH 43C9A 2GK0A 4U6VH 5HHXL 4Z5RA 2C3WA 3N85H 1IM3B 5IT2L 4P3DA 2ED8A 2P5WD 1I8KA 2O5XH 3ULUF 5F7KC 1EFXA 2QSCL 2PNDA 4LLUB 2XZAL 1CT8A 4JY5H 2K1MA 1YEFH 3NCMA 5A2JH 3FO9A 2PKDA 3DURA 3IFPA 3MROA 2PYFA 3BZDA 4JPWL 5HI3C 4G8FA 3VFUA 35C8H 4IIQA 2YEZA 1J8HA 5JHLL 2N56A 1MHPH 1P1ZA 3KG5A 4H88L 3DGGB 4XVJH 1VFBB 3MLTA 4J6RL 1D7FA 3V5KA 5HVHC 1S8DB 3VFUB 1YJDH 1E4KC 1VDGA 5F72S 4LASH 5CAYB 5H35B 1YQVL 3B9DA 3RVWC 4NKQB 3GMRA 3ALXA 3E6HB 3O6FD 1FBIL 1MFBH 1M7IA 3ULVE 3Q1SH 5DRNA 3KVQA 5HYFA 1ONQB 1SEBA 1IM3A 3LKNB 4KQ4L 5EU4A 4C58B 4KZEL 1MWAA 2HJLA 2VYRE 1HIMH 5IEKB 5DJDB 5I73B 5IB3B 2GK0B 3NACH 1MPAH 1YECL 2WQ8A 4FXGB 3T8XA 5GQBA 1FL6B 4D2NA 1XZ0B 1H5BA 4AEEA 3HAEB 4I4WB 5JLZB 1EERB 1C1EH 3QO1A 1K2DB 4NNYB 3VRIA 3D3VB 4K2UL 4LSVL 5AZ2L 3ZL4L 5JW3H 4XAWH 2W0LA 2FGWL 2PXYC 2DL2A 4LSUL 2FX9H 5GISL 2DS4A 1SM3H 3LSOB 4W6XB 5IEHA 1CIUA 1U2HA 4JZJA 1HSBB 4XMKH 5GIRB 1DBMH 4ZUVB 1QA9B 3HKFA 3UTSE 4Z7UB 3P0YH 2FYYA 3TPKA 4NHUA 3ARDA 4NRZB 3C9NB 2GJ6E 5JW4Q 5EZIH 4LCWE 4QCIA 3F12B 3S36X 1CDJA 3CVHL 5CJQH 4IRJA 4X80L 3LKOA 4CKVX 5GRUL 5LQBL 4G8GB 5E94B 3AREB 5HSFA 3V4VL 1SY6A 4J1UA 1I4FA 5EU6E 1N8ZA 3I3EA 3K1KC 3KPOA 2XY1A 3N1MC 5ADOH 3FFCB 1WBYA 4CN6A 2VXSL 3IDYB 4PGCA 1P2CA 4NZDA 4PJBA 2Z93A 3VXTB 2EDNA 3IJSA 4S1DC 5GGVY 3D18B 2VZ1A 5L9DL 1L0XA 1FFRA 1LEIB 4FQ2H 1ZHBA 3B5TA 5DQ9B 4EXPX 2VSCA 4KJPD 3MLPA 4PRPA 4G43B 3U7AA 2BHUA 3IF1A 5HJ3A 1GGIL 1S7SA 2AXFA 1J8KA 3ZZ1A 2W60B 4ZUUB 5DF0A 3NIFF 5KVEL 1GGUA 2VR5A 1S9XB 5T1MA 1EAPA 3FOMA 4N5ED 4PB9H 2CUHA 5I0DA 1TENA 3ZDZF 5EN2A 2AJUL 5IVXE 5KW9L 1V7ML 5FK9A 5DJAA 4NNXB 2V2XA 3EJZC 1QFWL 4MA7L 2DTMH 1G7JB 2HFEA 4KI5F 3KPTA 4PJ9C 2NY7H 3MXVH 1JNHA 4RSVA 2WK2A 3BWAB 4RFOH 1M7DB 4NQED 3T2NL 3OKNA 2YPKB 2ZUQC 4LSTH 1BBJA 1BZ7B 1ED3B 4JFQB 4OKVB 1RMFH 1KNOB 4P2OA 4UDTB 3GI8L 2LU3A 1P7QB 4PD4J 2DMKA 3OZ9L 1UZ8B 3MRFA 1K8IA 2FATL 2NY4B 2HRPH 4QRQA 5GJSL 3WUWG 1CU4L 4XCYB 3VXPA 1IVLA 1K85A 1Q38A 1YY8B 1FSKC 4FQIH 1TMCB 4L4TB 4ERSL 3TH3T 1BFTA 1MCDA 1H3XA 3MUGB 4RMRA 1G7PB 1QRNB 2IH3B 1OOAA 3IS0X 3S3PA 3MRMA 4DEPB 4YEFA 2I9LA 1J7VR 3VJ6B 3ZHDA 1CICA 3D39A 1XIWD 3QUMH 1PVHA 4ORZC 2OP4L 1EUTA 5I1JH 1U0QA 2YKLH 4ODUA 1P7KB 3V6FA 3FHAA 5IQ9A 2GEEA 2DWDB 3O0RL 3L5WB 2EIZA 1CICD 3D39D 1HCFX 3DX9B 4QO1A 3ULVH 4KROB 2FJGB 3P9LB 4FXKA 4PJCE 4NPYA 4OTXH 3BW9B 4ZNEA 3LRGA 5J06A 3QUZD 2ATKB 1BQSA 3G6JB 3WJLA 3O2DH 5CJOL 4M1GH 4ZFOL 3PXHA 2V2WA 4Y4HD 3BAEL 3F7VA 3K2UL 4X6DA 3KJ4B 3BJLA 3NFNA 3P40A 2R0LL 5CEYB 4POYA 3K7UA 5JXAL 1X4YA 3WNPA 2RAMA 3EYQD 3RBGA 3WFHB 1DVFC 3JV6B 1MHPL 1TLKA 4DQOH 2YSSA 3IFNL 3B5HA 5L0QB 4XCCH 2QADC 3FO1A 3QEHB 1CDBA 5F8QC 4M5YH 1UYWH 5GSVA 4ISVB 3UYRL 4NM8L 1UZ6F 1DLHB 4UIKL 3D9AL 4GLRH 5AZEH 4QNPF 3FOLB 3O0RH 3E8UL 2HG5B 3LDBC 4O02L 2OZ4H 4RDQG 3CFKB 4U33A 5FM8A 2I24N 1R3HA 3BYTA 4U0QB 5ESVA 4MDJA 1CL7I 3ETBF 3CNKA 5GGSB 4Z7OE 1DANT 2FEDD 5IW3A 4WNQB 4Z77B 4JFFE 4OM1L 5DK0A 3RUGE 1NCDH 1BX2A 3DI2B 2B5IB 4B0MM 4LLDA 5HGDA 1JPGB 3TCXA 3FONB 2KUTA 1E4JA 1TJIL 4N8CL 3TBTA 3V6OC 2AJSL 1T03H 4OCRL 4HUXB 3B6SA 3GHEH 2J6EA 2PXYA 4KRPD 4CVXB 2IF7A 4RMSA 3BT2H 3WS6A 1KPVA 3DMMD 3GSOB 1YMHA 1EDQA 1VGKB 4JN2B 5EZOL 5H8DA 3TNNA 3HLAB 5EZLB 1IFHH 3HNVH 3HRPA 1NAML 4Q9CA 3RL1B 4HWNA 1PEWA 1WV7T 1F8TL 1KG0A 1PLGH 4UB0L 3HE7C 4WWKB 1QYGL 3DARA 1OT2A 4F7PB 2IAND 5L8JB 4WEUD 4M9OA 4XP5L 5JPNB 1OAKL 2B2XL 1X6LA 1VACA 5ELIA 3SE4A 4CN1A 2YN3A 5I74C 5ESQB 4WVRA 5BZWA 1LO0H 4QHKJ 2Z4QA 3RWIB 1A7PL 4I0PB 5DFVD 2R1WA 5J57B 1BP3B 3E3QE 4M7KL 4PJAE 4PJ8B 3IJHA 1A6VH 1KIRB 5E2WL 2NX5A 4LARH 1A5FL 3VWKA 3SGJA 2BC4B 1JHKL 1NGXB 4LOUD 4FQJL 3UPCA 4MDIA 3G5VA 1XR8B 2DQHH 3WKMH 3VH8A 4Q74A 3DXAA 5AEAA 5DJYB 3T0BA 1Q0XH 2W38A 3X13A 4DGIL 3G6JE 1AR1D 2E3VA 4PV8B 2VISB 5HDLA 4PG2C 5FYKE 1D6EB 4B41A 5E8DH 1A6PA 2ARJQ 2Q7YB 1MRFL 1XGYL 1ZGLB 5EWIL 3PV7A 4WFEE 1CR9L 3DJ9A 4KK5C 3M45A 2H8PA 2F19H 3TNMA 4X8JB 3VXRA 1Q9WA 1T1ZA 2APXA 5JW5B 1A7OL 3L9RA 4TVPE 3HAEH 3UDWC 1L0QA 3QNYB 3LCYA 3LQZA 1AQKL 4BSJA 4LARL 4L9LA 1Q9LB 3NFPB 2ZP0T 1QFUL 1ZT7B 1NANI 4L8DA 4PB0H 5CGTA 4NJ9L 5GRYA 1OAUL 4GW1A 1A3LH 4KKLC 1G7IB 3JWDH 4EDXB 3CVHA 2AXGB 1EEQA 4JZOA 3MUY1 4KY1H 1FGNL 3LB6C 5C0BD 1XGTA 2ZPKL 3ARUA 4GKZA 1DE4A 4PJFE 4JFEA 4WTWA 5FGCB 3HI1B 4LCCC 3UTSD 1TVBA 4BSVA 4F7TA 4PJ7F 4PTTB 2EIBA 4LCUA 1DBAL 4R2GC 2NZ9D 2XA8H 3KXFA 5JW4M 2YD1A 3PGFH 3EOYG 1U91A 3WFBH 4YNYB 5K59E 5HI3D 4QF1A 2VLKE 2VXUL 1A1NA 3MV7A 3QHFH 3WUWB 3BWUC 1MFCL 2YPVL 2NPLX 1G6RH 2WBJB 3EUUA 3EO0B 4XI5D 4NKIH 2OR9L 3OR7B 4GMSL 2A83A 3X12B 5C08A 4UINH 3FMGH 4XXDB 5DRZA 4KROD 4JRYE 1E4XL 3U36A 2MKLC 2ZSVA 32C2B 4G6KL 2X70B 4MJ6A 5MP6L 1LMKA 1NH6A 1Q9KB 1U8NB 5MI0B 1AO7B 5E00A 1U8HA 3P73A 2D4FA 1IAII 1CK0H 5F1OB 3NZ8B 3R8QA 2JIXA 1RJYA 1HWGB 2C1PB 3KXFD 4K3EL 4KKAC 4JB9L 1ZLVK 4C56D 4HKXA 5HI4C 3ZE1E 2CGRH 3OF6A 3O3DB 4P4KC 3CFDB 4ELMF 1XF3A 1TITA 4HWZB 3KPSE 3U0PA 5EOCJ 3CFEB 1OP5H 4IDLA 5DR5H 3PL6B 3NFSH 1GAFH 4PJDF 4OF7A 3SBWC 4HKJB 5ECJE 2CR3A 3DYMA 4MNQB 5IVZA 3WFZA 4Y2DB 2NY4D 3VXRD 4JO4L 4QRPD 4XP1H 3NCCB 4NBZB 3RVTC 1CVRA 1A14H 4X9IA 3VA2C 2OTUA 3PP4H 3V0VA 1KXQE 1BFVH 4MWFB 1U58B 3MRQA 1NKOA 2W91A 4CMHC 4U1JB 4X7TB 1A7RL 1OGTA 4ZFFB 5E1AB 5J12B 3U4BL 4P5MB 4LCYA 4OGXL 3WIHA 2X1OA 4Y4HC 4MWFA 2R4RH 4MJ5A 4XNZC 1NKRA 2J8OA 4J3SA 4Y5XC 3GGWB 4F7MB 4HPOH 3SDCA 1FNLA 4H20H 4HFWA 2ICEA 1G7MA 1DZBA 4GO6B 4PTUA 3DX6B 4KU1A 2WBJA 5KG9A 1J1XH 1TIUA 1FL5B 4D3CL 5EU6B 2G2RB 5LGJA 1CQKA 1R5IA 4MXVF 4BJLA 2Z0BA 2NNAA 5JXED 3HR5A 3T3PE 2HT3D 4KVCH 1ORSB 2NY0C 2DLHA 3KYNB 2EYSA 4LCUB 1QQDB 4OFIA 4N1HB 4HIHB 3L3HB 3MYJB 1QG3A 4J3VA 2Z31C 4N90E 1JZ3A 2VLLB 2IFFH 1FFPB 1IKNA 5BMFL 2J8UA 3ARDC 4LRIA 4FTVA 3FFCD 3DTXA 2MQCA 5HYIA 2Y07L 3WSQH 15C8H 5I1LA 3DUSB 4PBXA 3SBWA 1MJUH 5LAXB 5CWSB 4M6NH 2DQJL 2ORBH 2GJ6A 4ZS7L 3WKNA 4G8GD 1FNSH 2BJML 4WEMB 3VG9C 3CU7A 1U8HB 2H2PD 5B8CB 4GW1B 1I7ZB 2JB6B 4JPKL 1T5WB 4JFDA 3SN6N 2A0LD 1S5HB 1D5IH 1NGPL 3O3EA 2R4RL 1TJHH 2BVUA 3TO2B 4XNQB 4APQD 4MAYA 3TBYA 1YEJL 1J18A 1MUJB 3UAJD 5CJ8A 3WNNA 2LTQC 3IU4H 2FIKA 1JPSL 5FO9B 1T1ZB 5D7KE 3GSXA 2A9NH 3ESVF 4Y4KA 1A1NB 3MV7B 3O9WB 1YN7B 5I17A 3HMWL 5KSVA 3GK8H 3MBED 4NCDA 5F1IA 4M7KH 3TJHC 1TVBB 3KJ6H 1ZGLA 5C09A 4LPYA 4APQC 2WIIA 3UTPE 3RWDB 3MLSH 2VISA 2AI0L 5J13B 3MCLH 2FX7L 5FAAA 5ID0B 3X13B 2AJ3B 1AD9B 3QG6A 5JNYB 1FSKB 3MGAA 1NFIA 4I3RH 1MCWW 3GZKA 4BKLB 4OD1L 3G5VB 1D5ZB 4HFUL 4I1NB 1JIBA 3RPKA 1NGXA 1G9MC 3O6ML 3ZE2F 4MHHI 3WL9A 4L8DB 3BEWB 4O2FA 2H2SC 2NX5B 3QDJD 5J1AB 1BVZA 4LDEB 2R1WB 3O4LD 4LRNH 3H0TB 4NKOB 4TQEL 2P8MB 1QBLH 5D9SB 3KPNB 1EJOH 4PRDB 3QRFM 3N1QC 5JW5A 4JFFB 3RZCB 2C5DC 4GBXB 2BRQA 4QRUB 1CLOH 2H8PB 1MFCH 3EYQC 5HHNA 3QHFL 4M6NL 2D9CA 5BZDB 4NKIL 4KJYB 3ZDXF 4XMLH 3LEVL 2VKWA 4CW1A 1KGCD 1KEGH 3PG2A 3OTTA 1JYWA 3VGAC 3ARPA 3V6BR 4CVXA 4XVTL 4M6MH 5DJYA 3UCRA 3UYOD 1TZGH 3BX7C 3VFPB 1K4CA 5F1SA 3KLAA 1I85A 5I8OH 2NY5H 5FB8A 3BDYH 4KK6C 1DN2A 1JPGA 1NDMA 3SDXA 4LIQL 3WE6A 5K9JH 2W92A 1MLBA 3IDYC 1RZKL 5FGBA 1OSPH 3C6LB 3QNZA 4TUOB 5C0AE 5GGSA 2QKIB 2XA8L 5J6GB 3QFJE 4JM2A 3DYPA 4X4XB 4K7FB 4FQLL 4TNWF 3TZVC 4EEEA 3W2DL 4JFYB 4OZ4A 2VLJA 1UCBH 2ZUUA 3S4SA 2YPLB 3HCVB 4PJHF 1UQSA 4JCMA 4GW4A 3RWCA 4K7PL 3SDAA 3QIUB 4JEGB 4L8BA 4X6CB 3AC0A 1N0XH 2NR6C 4ISVA 1KCLA 3RUGA 1A6AA 2BVQA 4ODHL 4R2GB 3FO1B 3S34L 3RDTD 3STZA 3GSNB 4JN2A 4M6AA 3TNNB 4JQXA 4WU7B 1YMMA 4Y16B 2E7LC 2CUIA 3MRRB 2EDHA 4K71C 4K94L 3F7VB 2PXYB 1HN1A 4PREB 5DVKA 5JIPA 3T1FB 4M3JA 1DN0A 3TN0D 4PY8J 4PRPD 4PJ8C 1JGDA 5HHOD 1RZJL 4NQVB 4FQJH 1OQXA 3LEXA 4N0CD 3MMEA 4RFEA 1AE6L 3C6SA 3AVEA 5EH1A 3DUHA 1MRDL 3SDCC 3O9WC 4WUUB 1JTTA 3NIFE 1I1CA 1P6AB 4MAUH 1HQ4B 3QRGL 2ESVD 1TQBB 1RHHA 5BV7L 3FOLA 1CI5A 4LLYB 3MGTA 5HGBA 5HD8D 4KKBC 4OQTH 3TZVA 4ONFL 2ZCHH 3E1F1 3VA6A 2I9LB 4ZNCD 4K7PY 3KNBA 5FXCH 2NY5L 2X4OB 3ILPA 1DQML 5KANG 2ERJC 3IGAA 4F9LC 2IG2H 5KSBF 2XXMB 1BD2B 4X5XB 4L4TA 4KAQL 3CK0L 1MREH 3ROOB 3O11B 2VN7A 1IGTB 1CDYA 2ZG3A 3E6FB 4G6ML 3CC5A 1R5VA 1RK1A 2C3VB 3MCKB 2R29H 3BT2L 1TJHL 5ESAA 1D5IL 2NY3B 5IGXH 1IM9A 3RNKA 2WQRA 1U6AH 3RJQB 3RTQA 4M93B 1T4KA 5AZEL 1OTSD 5AWNH 1DQJB 4QHUB 2JCCE 3B2VH 5F6IC 1JI2A 4XVUD 4WV1C 3VG0L 4IJ3B 1AJ7L 4LBEA 3MC0A 3RRQA 3HPLB 2DKUA 4MNHB 2DRUA 3RU8H 3VWJB 4FG6C 1ADQL 1NEZA 4HULB 1AP2A 5CZKA 4HS8L 3SGKC 4GRWF 3OKMA 4JDZA 4I13B 2Q6WB 3L3JB 1CLCA 1M1SA 2Z91A 3OXRB 4ZMAT 4YHOL 1IJ9A 1A7NL 1TZIA 2DBJA 5CZVL 1JFQL 3Q5TA 4PRHD 2YD4A 4ODSL 3FL7A 4NYLA 4X7SL 4QHLA 1JGEA 5ITFA 1WCBA 4P9MH 3MNZA 1FORH 1CG9B 3PDOB 5SV4A 1CGYA 1DBJH 3MRKB 4D9QD 1DQQA 4LCWA 1P2CB 3FFCA 5F96H 4NN7B 4YX2L 4A6YB 1DLFH 4LNRA 3DVGB 4PJEB 5DRXB 3RIAK 1I4FB 3FAWA 3GEWB 2HTLD 4HK3J 2NY1B 4DN3H 5HHME 4IEFB 2DQGL 2F19L 5DJXA 2YMXL 2BVTA 3GI9H 1KYOJ 3LDBB 2EH8L 2VKXA 4M1CC 5C0AA 3D25B 4LLVB 3RKDD 2G75B 4ODWA 4ZAKC 4NHUB 2EKSA 4XVSH 3L3IA 1RURL 2X4PA 3LIZH 5D1XB 3QEGL 2DQJH 5HHMB 4YR6B 1IEAB 4RFEB 5EU5A 3CLFH 1S7SB 2AXFB 3D5OF 4Z7VF 5E9DB 1J87A 5ENWB 4XBPB 1JGDB 4L4VB 5MENB 1INQA 2EYTA 3CPLB 4PJ5A 1YQVH 3I6LD 3MUHL 4PP2A 3FO2A 1LEIA 5BXFB 4EN3B 3UP1A 7CGTA 4H0IA 5AUMA 5HYSB 4OLUH 4DUWA 5KBNC 1QOKA 4NZTH 1YMMB 4WFHD 4XPGH 4DTGL 3AMKA 3AB0C 5L2KD 2OL3A 5EU4B 4Q9RL 4JHWH 4OLEA 5BS0B 1J8HE 3RUGB 1ZXQA 3AREA 1KT2A 4KUZL 5ICXB 4HPYH 3LKOB 2QSCH 4N1EA 2YD9A 1VSCA 2A6IB 2J6EH 1WCQA 1I7RB 1IGIH 3WNOA 2EXYD 3HCVA 1N64H 3QZWG 3C9NA 4QOKD 4Z8FH 2H9GA 2A77H 2VLJB 1M05A 2LVCA 4GRWB 4JFYA 4RGOL 4P4RB 4XI5C 2EDDA 3DGGA 1BQUA 2DJSA 1IGCL 1RU9H 4EIZC 5D2NE 3CCHA 1KJVB 4LKCB 1JL8A 5KVEH 3WE6B 4ZAKA 4FQXB 4M7ZC 1NBQA 4RMVA 2ZPKH 5IB2B 1YPZA 1IC7H 2VLJD 1GZQA 1UKQA 3EYOB 1S9VB 3TEUA 4Z5RB 3I50H 2VLRD 1J12A 3PQYB 2A6JB 2BY1A 5JLZA 5L2JB 3EYSH 3FT2B 3QI9D 1HKFA 3I2CH 4XCCL 1QP1A 2AK1L 3ARQA 5L2JA 1FNGB 1MWAB 2HJLB 3V52H 1S9VA 4PG2A 1FZJB 5GRJL 5BZDA 5DRNB 1XF2A 1U8LA 1A1MA 3WLWC 4AZ8A 1ZLSL 2I9TA 3A6OA 4GMSH 3E6HA 4FQXA 5FUOH 1RZ7L 3OX8A 5GS3A 1NAKL 3NN8B 4XNUL 4Y1AE 5H35A 3IAGC 1JPTH 1QRKA 2NXYD 1ZWIA 1KJVA 4WI3A 3V5KB 3ZKND 4QRSB 3MJ8B 3VGBA 3Q6FB 4GAYB 4OCWH 1RUQL 2R2BA 1JBJA 2BVPB 4KH2A 4LSDA 3F7RA 3QDMD 4IS6A 4OLUL 1UM6H 3DRQA 3PWUB 4Z6AT 4R8WL 4G8FB 3RGVC 1AGDB 3VXSD 5DC0A 3BP7B 2DQTH 4U2YA 5ADPL 2E9WA 3FO9B 1MI5D 2QBWA 4OI9A 2XKUA 3LMJH 1G84A 1HIML 1I8KB 2YBRA 4ZQKA 3FAXA 3V4PL 1PSKL 1KIUA 4OF6A 4PIRF 3KPRE 2F58H 3O3AA 4HPOL 1EA9C 2BVEA 3KAAA 1IC1A 3P30L 5DEZA 1IAOB 3H7BA 4KKLD 4N0UA 2AXHA 4PJXE 3ZKMC 3QJHA 5D7JA 3EOAB 5E4IA 5C09B 4HIEA 4XZUB 2NXZD 1HILB 1A3QA 5CP3A 4HK3N 1A2YA 5DI8A 1FE8L 4AENB 3TYGL 1JHLH 4PJHB 4ZO8A 3EO1B 4RA0C 4KKBD 4R3SA 1BVLA 2X4PB 3NIDF 5CSZA 3T0EE 2L7UA 1I1AA 1CBVL 5EIIA 4MQXD 2J88L 4K23L 4NCC2 4NWUL 4HWBH 3K8KA 5J1SC 1R3KA 5DJXB 1SJVA 1UA6H 2DD8L 3BQUB 4MA8H 5DQDL 3T3MF 3GFUA 1I7ZA 3P4MA 1G6RA 4LVEA 2GJ6B 3HC3H 4HAFA 5H94B 1Y6MR 5F9JA 1VADB 2P47B 5C8JB 5DDHB 4IRJD 3C2AH 5LG1A 3DUSA 4U6TA 1ZANH 4F37F 4MA3B 4LGRB 2A9ML 5AAWA 4PFEA 1Q72L 4LCWB 4MSWB 2DL9A 2A6DA 5F88A 2RIKA 3MRKA 2RB8A 2WNGA 3VXMD 1UKTA 3QP3A 2PTTB 2QQNL 2MHAA 5C0GB 4W4NA 1VA9A 4I3SL 5E2VL 3GRWH 4PLOB 3HG1A 1FO0L 4R4BB 3KJ6L 3RHWK 5I1EL 3I6LE 2Y6SD 3DSFL 2Z91B 3L3JA 1ZLVH 2YXFA 4QEGA 4BFGA 3O81A 2PR4H 5KVMC 3LEYH 3PWPB 1OHQA 4Y1AB 1UA6L 2DD8H 2NY4C 4NHCL 1TVHA 2AV7A 3MFGB 1ZSDB 2NY1C 1OSZA 1H3GA 2PETA 4KMQA 5E5UB 1QBAA 1A4KA 2Z8WC 5DRWB 5EBLA 4GRLB 4O58L 4HJ0C 4YHPA 5K93A 1VPOH 4F15C 3RVUD 3SDCD 3X11A 4P5TD 4PJDE 4PY8I 3RTQB 4P57A 3V79C 1IAMA 2FEEL 1KTLA 1UT9A 4UQ3B 4LCCA 1FE8H 4DTGH 1KLFA 4NZTL 3QDGA 5HHOE 3T65A 1JHLL 3V4PH 4RNRA 5DS8B 1JTPA 1F4AA 2X41A 3RDTA 2GJZB 4AY0A 4RIRA 3KYOB 4XPAL 2XN9B 3VXSE 1KN2L 2XFXA 1S7VB 5DUPL 4QXGL 3JVGA 4YBLB 1JYXA 4NKMB 3PHOA 4QYOB 4XHJD 1FG9C 4P2RE 3IETB 4NO0D 3BN9D 3KNBB 2BNQD 3CVIH 3SEPA 3O2VH 2NYYC 2UWEF 5C0IA 1KXTB 1OM3H 5T1DH 1S78D 4FQQB 4H20L 1R3JB 1G0YR 3VGDA 4CAGA 5KSBE 5T5NG 5A40E 1ZA3B 4ZDHA 1RZ7H 4HGWB 4KKNA 2R15A 1T2QL 1CR9H 4KV5E 4KQ3H 3RVVD 3HZVA 1KB5H 1KACB 3FQUA 3AS0A 4UNTA 1XFPA 1MCOH 4DN3L 4XH2A 2F53E 4PJGF 1N7MH 1C5BL 2Z9TA 2GJJA 1FVCA 2HKFL 2X4TA 2HJKB 3VXQB 1HH9A 3CU1A 4RGNE 1BREA 1Z3GH 5FUOL 4QF1B 1S9YA 3IXAA 2XY2A 1T6VN 1J9CT 5MEPA 1BZ9B 1BD2E 4P9ML 3MLZH 1P6FA 2F8XC 1ULVA 5JW4N 1ZT4B 1OAYL 2IPKA 5BW7A 5ACZA 4W6WB 3A67H 1QLEL 2YZ1A 4OCWL 3STZB 2JJSA 3GSUB 3QIWC 3QUMB 3U1SL 4FQHA 1A6AB 1KJ3L 2BVQB 5I71C 2B1AH 2NW3A 2CIKB 4JG1H 1M6OA 4WO4D 1S7RB 1IBGH 3MA7B 3L5XH 5CLTA 3WIHH 1JPST 5IB4B 3FMGL 1IMHC 4UB0H 5GJTL 4P4KB 3HZYB 3S4SB 1VGEL 4NWTH 4GMTH 1ITBB 2AV1A 4Q9RH 4GKSA 4JM2B 5E4EB 1UJ3B 5EZJB</