3NCBB

A mutant human prolactin receptor antagonist h180a in complex with the extracellular domain of the human prolactin receptor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
206
structure length
206
Chain Sequence
MLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolactin
publication title Two Independent Histidines, One in Human Prolactin and One in Its Receptor, Are Critical for pH-dependent Receptor Recognition and Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/hormone receptor
total genus 37
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2010-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ncbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ncbB01
4Z7UE 1A9EA 4M6OH 4ODVH 4MQXC 4U1LA 1LEKA 4AENB 2F54A 1CFSA 4JFYB 1S7SB 1MELA 5IHBA 3EYUH 4U3XA 3DETD 1IGTA 5GRVK 3KXFE 4U1SA 1U0QA 4CDHA 4K94L 3EYVA 5F7EH 5HYJA 1YY9C 3BPOC 4JFDE 4XP5H 2IEPA 1FIGL 5EZJA 1BQLL 3V4PL 1PZ5B 4RMRA 5B38A 4WTWA 1HWHB 2GTZA 1MH5A 3RY4A 1QNZH 3KXFD 5C0IA 4M62L 4NQVB 3T0BA 1TJHL 1R3IL 5F3BA 3AFLA 4JFDD 2Q7NA 4O2FA 4WHYH 4F33A 4GW1B 1UENA 1JWUB 1U8HB 2Y36H 4KK9D 4OGYL 4XVSL 3OJ2C 5EIIB 4EOWL 5JLZA 3TZVC 3DIFB 4PP1D 5IVZA 5C9KA 3I6GB 2PW1B 2BSED 2DQFB 4QTIL 2FX7L 3CH1A 2X4TA 4G5ZL 1NGZB 4YHZH 4ZUSA 1I8KA 4R26L 4P2RD 4J4PA 4OZGF 5C2UB 4F8QA 4WWKC 1MCKA 5ECJE 3QAZC 4FNLL 5FYKH 2BSTB 3MLZH 3MRKB 4PJGE 5K9JL 1NGPL 1UT9A 1TJIH 1CDGA 5A1AA 4P2OD 2JB6B 5FDWA 3V4UH 4N9OB 1JMZA 3UJIL 3WBDA 5EUOA 4G8IB 3TIEA 3BUYA 2FEDC 4IOSD 1G9NL 3O6LL 3GHBL 3K2UL 3A67H 1UXSB 3FMGH 5FYLL 2Y7QA 4N90E 4WI5A 2Z92A 1T4KA 4NNXA 1UZ8B 1UACH 5LWYL 2IANE 1OB1A 2IPKA 5FCUH 5C6PB 2Z8SA 1VFAA 3SDAB 4KRLB 3QFDB 3S5LB 1AE6H 1R0AH 4NHCH 4N90D 4WI9A 2MCPH 1J0IA 2IAND 2FSEA 3BDYH 4LCUB 4OM0H 2ZUYA 1AKJA 1HWGB 3CX5K 3MRMB 1YN7A 2FHCA 2X7LB 4NO5A 5F71A 5C0GB 5EB9A 4OB5H 2VLKB 4Y4KC 1X5YA 5EC1A 2VDRH 1CN4A 5EO0A 2FJHA 4M5YL 5C2BH 3FAWA 3FO0H 5D7IB 1XIWC 1FV1B 3T0AA 2VDLL 1SJHB 2D4FA 3QJFB 4KKLD 4ZS6D 1CFTB 3MRDB 4PV9A 4JG0H 1G0DA 3VXRB 1P84J 4Z7OF 4WU5B 3FT4A 4KMTL 5I30H 1KCVH 3SKUD 1S3KH 4FQJH 4F37F 4NDMA 4HX1B 5GZNC 3HZKA 4MXVF 3RKPA 4ZO6A 5IIEA 4TVSa 4LHUG 3JV0A 2P7TB 1OQXA 4JFPB 3MV7A 5MEPB 1OWRM 3U83A 4N0CD 1BIIB 4Y1AE 4POZC 3VXPA 3HI1B 4U1KB 3SY0B 1OAKH 3ARRA 3W0WE 2VLJA 3CDGA 3EOBA 3B5TA 2FATH 2XTJD 4GMSL 3ULVL 1WFUA 1G7HB 4KKLC 1I3UA 4Y1AD 5JO5B 1MCNA 4X4ME 2Y06L 4BZYA 3W0WD 4JZNA 3MXVL 4LVOC 2W59A 4HJJH 3OKEB 4DUXA 1Q9LA 3MBXL 4HS6B 5CZXD 1R3IH 1WZ1H 3N1FC 5GSRA 2HFFB 5ANMB 3WFDH 2WK2A 5ENWB 2W0PA 3O2DA 3TYFB 5FM5O 1P4LA 5SX5K 2ED8A 5ADPH 1AP2B 3MBEA 1PG7H 1A3RL 4D0BB 3RGHA 3ARDB 1BQSA 1YC8A 1O5DT 5DVLA 4X6CF 4S1SL 1XR9A 1SJEB 3ZL4L 1FPTL 5GS0L 2WNGA 4X5XB 3ZE2E 3EHBD 2YD7A 4G5ZH 4FA8A 3RL1B 1ZVSB 3QHZH 4MD4B 4NQUA 4XP1L 1SVCP 3QDMA 2H9GA 2XTJC 1UXWA 2LTQB 4RDQG 4LKCB 2G2RA 2FZ3A 2WBJA 1CFQA 4U2YA 2PKDA 2R4RH 5DWUH 5BW7A 4K9EH 2ZG2A 2LVCA 3Q5TA 4FN0A 4YXLH 3RJQB 4M7LT 5BVPL 3FB5B 3HUJF 3CCHB 5K9JH 3TV3L 4JRWA 5BS0B 5CZXC 3RGVB 4S11A 1JN6B 2O5XL 4YDLB 5MP6H 1DBJH 2IQAB 3BIBX 4OD1H 2BFVH 3GHBH 2H41A 4HAFA 4MB3A 5I1HL 1UM6H 4X7SH 2EE3A 4G8EB 4PJXE 3PWUA 1N8ZA 5EUKB 4U0RC 1FNGA 4OCMC 4FHBD 5CEXB 2YA2A 1MJUH 2X1OA 3NPSC 5D5MA 1OTUC 5J8OA 4JFQA 1F45A 1CD1A 1NDGB 4S0SD 5H2BB 5IQ9A 2PETA 2PR4L 4NT6B 4AYFA 3V5KA 4L1HA 1HHKA 5F7WC 3RVUD 5HPMB 4MD0A 5ISZE 1DTUA 3OKOA 1JGUH 2QQNL 2X41A 5DD3L 5FV1L 5F9WC 3S96B 3BP7A 1BD2B 2R15A 3SKJH 2X4UA 5ISZD 4UT7H 3SDYL 2C3VA 1ZHKA 2DDQL 3K4AA 4F7TB 1WEJL 4KV5F 2AEQH 4M5YH 4HEPG 4R4NC 2DI7A 5I66B 4PJHE 2R0WL 4HF5H 4OLUH 1D9KA 4H1LB 1A0QH 1OD9A 4ONFL 5HBBA 2BY1A 2BOCB 2BMKB 5K9QI 3KAAA 1BBDL 2FIRT 4OLWH 1T80A 4M7JH 5IR1A 4R0LC 1SEQL 2GJ6A 3DXAB 4JG1L 1E4WH 3N1PC 5DSCB 1L9NA 2WAHA 3OG4B 4PY8J 2DWDB 4G8FA 3WDJA 2R4SH 4GAGH 5KSVB 4DOHB 3V5DA 4HFUL 3CIQA 4IIQA 1MI5B 3LKNA 3O3EB 3T3MF 3HAEA 4LU5L 4D3CL 3BUTA 1ETZB 1MQKL 1VFBA 4ZOCA 5FCSH 2UUDH 4UILL 3DHJA 5DK0B 4PRDB 2ESVA 3WJLA 1VEOA 4X6DA 1XGPA 5KSUA 3MJ9A 1AFVL 3O41B 1L7TL 4AM0B 2GKIA 1FZMA 4GRLA 1JPFB 3QSKB 1P69B 1OWWA 4Y5YA 5DJCA 3VFUA 4Z7VA 2Y06H 4PJ9A 4XGZA 5HGAB 4RGNE 4TPRL 1B0GA 4YBQD 4MXQD 5E8PA 5IW6B 1DVFA 2PF6A 5KN5A 3I9GL 3S7GA 4PP2A 5EOTB 4LSSL 3TJEH 4RGND 4DQOL 2A83A 3P0YL 1N4XL 2H1PL 4WW1A 2GSGA 1G1CA 3BN9D 5DR5L 4I0CC 5K33A 1KYOJ 3WO4B 5DYOB 3IETB 3WFHB 3NGBB 1FNEA 2K1MA 5DRWB 1QP1A 1IGIH 1K8IB 3ROOB 2DQGH 1TCMA 1C7TA 4I77H 1JPTL 1KENH 5DURB 1LO2L 3V8OA 3GBNL 1OCWH 1UYWH 4P23B 1P5VA 4LCWE 1E27A 2ADFH 2VL5B 3HG1E 3VFGH 4GXUM 3SE8H 1I7UB 1C16B 5I8CB 3TV3H 3BD4A 5BV7B 1HEZB 2P45B 4EUPA 1A02N 3QJHB 3W81A 4ISVA 5E4IA 2PO6D 4OQTL 2MHAA 1OPGL 1NBQA 2DTMH 4ZDHB 4LCWD 4OCWH 4X4XB 3LEYL 1KIPB 3S3SA 5K9KA 3HG1D 3RWCA 2EO1A 3SGDH 3FL7A 3MOAL 3TO4A 4DN4L 2XG5A 4JN1H 1UQSB 4EI6A 3CVIH 3FQXA 3TWCL 1JI1A 1T3FB 1QPPA 3G5VB 4KJQD 5IVXB 1QLEH 4ZG1A 5IOPA 2YPLE 1FYTE 1KCKA 4OZHF 5HHOA 3KPNB 1WBYA 5I75C 1WIOA 1G9MC 1U2CA 5I19H 5ERWB 2X4PA 2WV3A 3MRLB 3SE9H 4KGJA 5GS1B 3SBWA 2YPLD 1FYTD 1JF1B 3X12A 3GJFH 3QI9D 1CU4H 5C07E 2VERN 4PLJC 4ZO8A 4GRMB 2FNBA 5CBEA 1HILB 2AS5M 4HBCL 4OZGA 3RTQB 5F1SA 1IC7H 2QSCH 3KWWB 5ACMA 3U7WH 5CILH 1UB6B 3D5OF 4LPUA 2IBGA 2X10A 2XWJB 3BIKA 3ARXA 4L4TA 3NPZB 5C07D 1R3HB 5IROC 4U1JB 3WMSA 1TXKA 5DUML 1TTUA 2EICA 3LQMA 4R9HA 4IHOA 1WFOA 2GK0B 2IH3B 3QA3B 1DDHB 1QVOB 3HZYB 4XPHH 4OF6A 2V7HB 5C0BA 3D25A 3QR2A 1BVKB 2DQIH 4AEEA 5FF6A 2IALA 2P42B 4CVXB 3D18A 1FL6B 1JWSB 4JG1H 4LCCA 1KC5H 1NC2A 1B0WA 3HNTL 1R24A 4NRYA 4R97B 2I60L 2FYYB 3G6AA 2CIKB 4U6TA 4KUZH 5D8JH 3MSPA 1V05A 3RX5A 2VR4A 2ZCKL 3BWUC 3C5JB 1ZXQA 1ZS8A 1T04B 1EJOL 4IOFD 2X4OB 3OKDA 5SWQB 2R69L 1QFHA 1Y6NR 5DRXB 3HE7C 3O2DH 4PRHA 3WIHA 4UILH 4K23H 4PJCA 2FX8L 4NZJA 2ZUQB 5D9SB 3VDAA 3EIFA 3SHSA 5EOCJ 3V6FA 4BH7A 1A4KB 5FUZH 2IPTH 2FRGP 2UYLA 3A6OA 5JPMB 5EDXA 1A1OB 4QXUH 4WWID 3DJ9A 4K7PY 4XNQA 4FQLL 4EQ3A 4JANB 1XCTA 1GZPB 2FGWH 4M1GH 4KTDH 5LGJA 3SQOL 5DMJB 3I9GH 3UJJH 3FFCE 3RWFA 1GGCH 2VO5A 4LDOB 5E7FA 1QO3A 4LRIC 4C4KT 5KS9B 1XH3B 3D85D 1IKFH 1AC6A 5AZEH 3R0NA 2HKFL 3ALXA 2RQ8A 4XPFH 5MERB 2C4FT 3G08B 1ZT1A 3CNKA 4Q97A 2HTLC 3FFCD 4Y2DC 3LMJL 5GIRB 3QDGA 1E4XL 1LO5A 4WI3A 1N5AA 2R1YA 1OP3K 2W9LA 2ZG1A 2ADIA 3FT3B 3ZKMD 4AT6A 1J8KA 1IT9L 4DUVA 1N64H 1DUYB 3NFSH 3QHFH 1JYXA 3D39B 3VI3F 2LVEA 4XCFL 3T4AA 4P9ML 5E94B 1PSKL 1A6VH 3P0VH 5CJ8A 5DRNB 5DO2C 2JJSC 4PBXA 1Z9OA 4HKJB 5GJTH 25C8L 5CINL 1Q94B 5DJDA 3LSOB 4HXAH 3VXUE 3RZCA 1AH1A 5IW1B 1GJIA 1MPAL 3QEUA 5EZIH 2R2HB 3K1KC 4FZ8L 4UV7L 4LOUC 4XTRD 1MJ7H 4ODWB 1KT2A 4IM8A 3S36L 4X83A 5H37H 3TT3L 3T08A 4P5TD 5IV2A 3R06B 4LKXB 4EN3C 1YEDA 2FX9H 3ARGD 3VXUD 3UCRA 3STZB 1RIUH 5BV7L 3VGAB 3MUZ1 3K2MC 4NSKA 2G5BB 4MHHG 5DRZA 3UC0H 2YZ8A 1L7IL 3ZTJG 4PLNC 2MJWA 1ZSDA 4DWHA 3VXSE 1Y6MR 4OCYL 1X7QB 2CXGA 4HPOL 5F1NA 4QXTB 5FB8B 5E99L 4WHCA 3BHBA 5EBWB 4OF0A 4QF1A 3ILPA 3DV4B 3BD5A 1K8DB 5E2TH 1IFHL 1JJUA 2NW3B 3OX8B 1KFAL 3VXSD 1X4YA 1F8TL 4I1NB 5C0AA 4Y4HD 1YEIL 4H25B 3VW3L 4D9RE 3HNVL 3VFOB 2ZOKA 3WFEH 3DROB 1A1NB 4OCSL 3HMXA 3S98A 1OT2A 2PXYD 1Q9WB 3BPCA 3HAEH 2AI0H 3PGCB 4QY8A 3L3KB 2B4CH 4LCYB 4ONGH 2BVTA 2YPVL 4D9RD 2VABB 1LNUA 5F1KC 3MJ9H 4I0PB 3F6IA 1U91B 1JWMB 1Y0LB 3MFFB 4Y5XB 5GGUA 1T1XA 5IKCA 1INDL 4WDIA 1ZT4B 3K46A 3U0PB 4L9LA 1A64A 15C8L 2EXYC 3VFVB 1U8JA 4BQBA 4BH8B 4X4YB 3O11B 1QSEA 1U3HD 5JXAH 3DSFL 3FO9A 4HUWA 4U49A 3U2SA 1KSRA 2D7MA 2YD2A 2IFGA 3VFRA 3IXTA 3LKQA 2QV2A 3PL6A 5JOFA 3CX5J 4N8PA 2Q1EA 5D1QA 3KPTA 4PJ5A 3OMZA 5I16A 1FFQA 1LO0L 1MHHB 1OARL 3OTTA 3S3JA 3SO3C 4QXGH 1TVHA 3IDGB 2YD8A 2DRUA 3WLBB 1KLGB 4LLWB 5HGBB 3K74B 3MCLH 3WFZA 5FUCE 1C12B 2F8OA 1FH5H 5ACLA 4F7EB 3AREC 1FNLA 3RGVC 4YDLC 5I17B 1F42A 1I7TB 1U2HA 3OKMB 4EUPH 4XBEL 1FZJA 2J6EL 5IB3A 4JRXE 3FN0L 3LEXB 3IDJA 1U3HC 5ICZB 3TN0C 3U0TA 4JFFA 1KXVC 3TVMD 1A22B 1UWXH 1LO3L 1P1ZA 1NBVL 3IGAA 2FECI 2VAAA 1Y6KR 3VG9B 4X80H 4UQ3A 4JRXD 4DGVL 4NNYA 1AHWB 2G9HA 4HT1L 6FABH 4O2CB 4UIMA 1GZQA 3NN8B 3DYPA 4R2GD 2F9BT 2UV3A 5E03A 3V4VL 4L3EA 3W9DB 4ZFGH 5JW4N 2NY1B 1RUAH 1JHTB 3D0LB 5CSGA 3S9DB 3MJ8A 2GT9A 1OOAA 3JZ7A 2X4SB 5HDQL 4K3JH 3LEVL 1F02I 4EXKA 5J1SC 4YDIL 2XWTA 2EDQA 3IB4A 4PJFE 5CINH 1F2XK 4G42B 3REWB 4NYLA 2WIMA 4ZFZB 4F3FA 4D0DB 2OMBA 4LQFH 1WCBA 4N8CH 4W6WB 2C7UA 3CAFA 4RWHA 5DMGD 4JFEB 1RMFH 3NIFE 4Z0XA 1NC4B 4OKDA 2GY7B 4JB9H 4Q2ZA 5DVMA 5F3HB 2CK0L 4I3RH 5C0FB 1EEZA 4L4VA 2Q8AL 3UTTB 5K9OB 3WNNA 5IJVB 2NZ9C 3TYGL 3VGGA 3UPCA 1XCQA 2WQ8A 2GFBA 3VXTB 5D2NE 3D6GA 3H9ZA 4RMWA 1UH2A 3DX9B 3T0EB 1NLDH 2VSDA 4CJ1A 2V2XB 1IGCH 5E99H 5DLML 4JN2A 1HSAA 3C8DA 4IMLA 1XZ0B 1T1YB 3AS1A 1P6AB 2YK1L 3GNMH 1GL4B 3U9PL 1BJMA 5E8NA 5EO9A 5DD1H 4U3CA 3L5HA 4KDTC 5AUMB 3C5ZB 1DQDL 2NY4B 2YD3A 4HGKC 4PG9A 3QCUL 3NCMA 4R4FL 1F00I 2B39A 5FGBA 3RBSA 2HH0L 1RZJC 3RBGA 4J3VA 1C1EL 3G5ZA 3MLRH 4NUJA 3RKDD 3A6BH 3ORJA 4G7VH 2AJSL 3LQZB 5D7LB 3WV0A 3RX7A 3WIHH 4BZ2H 3SGEI 3ZE0F 2HMID 5D2LB 3UXFA 1X5LA 4JO4H 1A6AB 3G5XA 1A14H 5T1MA 3VMPA 3TFKC 4XXCA 1OM3L 1CDBA 4G3YH 4MS8C 4X5LA 1MUJA 1RVFL 4MJ6A 4OZHA 2VDPL 4AG4L 4LEXL 4NBXB 4NM4L 2DMKA 5CEZH 1LE9A 3U4BH 1HXYB 4JAMA 4X99B 5D2NC 2Q8BH 3WN5C 4J3SA 2X40A 1U8MB 1KLFA 3NGBC 1JRHL 4X7DC 3VRJA 3SGKA 1MHCB 1MCQA 3JTSB 3EO9L 4RDQF 1R3LA 5ILTL 1M4KA 2C3XA 2VMFA 2W9DL 5DJ8B 1OAUH 4PGJA 2B5IB 2XWBA 4P23C 3MGTB 2AJZB 4RFEA 4LPCA 1GYAA 1IQWL 4L3CA 3DX7B 5B21A 4UT9H 4M43H 1EZVY 3ROLB 1GH7A 3FRUA 3D3VE 4GMTL 4KQ4L 4WU7B 1NCBL 3S6CA 2X09A 2XQBL 4JHAL 3QNZB 3EYOB 4PJIF 2BNRE 5ID1A 5EOCH 4F9PC 3UTSE 2PTVA 4PJDB 3GM0A 4M03A 3D3VD 3EZJB 4YXKL 2YEZA 3DX8B 3RP1A 1ODAA 4WUUE 4OZIB 1AGEB 5AEAA 2BNRD 3CXDH 4LLMB 4UNTA 4PREB 3UTSD 1ONQB 4KI5C 3DNKA 4YHNA 4MA8L 2YPKB 4FQIL 1UJ3B 4K8RL 1AO7E 4N5EC 5GS1C 43C9A 2JJVA 4ZAKA 1CR9L 1QHOA 4M8QB 4HKZB 4GUPB 1RZ7L 1SY6A 2IBZY 2P24B 1ZHBA 4Q6IC 1CYGA 1REIA 2EKJA 5GRUL 4BUHA 1I1AA 2VE6A 3ULUE 3BE1L 1A6ZA 1AO7D 1N3NA 1KGCE 4HJGA 1I85C 4IRSA 5FA3B 5EU3B 4DGYL 2YRPA 5FO7A 3O3AB 2VDNL 3MLPA 4KROB 1AQKH 3QG6B 3ULUD 1J1OH 2AXJA 3QFJA 3C5SB 2NY3D 4ODUA 2BVEA 3N1MC 4L5FH 2F53A 3GSVB 4OLZL 2J4WL 4YHOL 2W0LA 1CDYA 4MJIE 5DFVC 3ARBC 1D5XA 5J9PB 2J8HA 3FOMA 5JNYA 5ESQB 4KKNA 4R97C 3PP4H 3OJDB 3GGWA 2AK1L 3BP6A 1QBBA 4MJID 2BHUA 4QNPE 4NQTA 3UBXB 2H26B 2F8XC 2XPGB 4MA1B 3HS0B 1BFOA 3RDTC 3X11A 4R7NB 2R1XB 3C6SA 3GSUA 3ZKXC 1JFQL 3ARFA 4LGPB 4BFIA 3D2UB 4LHQB 3BO8B 2Z8RA 1FORH 4LCIL 4AZ8A 1YMMA 4OV5A 5JZ7D 3IVKB 4K7PH 4M7KH 4U1LB 1ZLSL 1OP5H 4QRQA 5DMIH 5C6TH 1CFSB 1CFVL 4P3CH 5GZOD 3RAJL 1I3GH 2AW2A 4HPYL 3V0VA 1IGTB 2YUVA 1RVFH 5CP7A 4CN4A 5L2KE 2ZP0T 1A5FH 3EYVB 4UUJA 1MJ8L 1B4JL 1VFOA 1BF2A 4Y16A 3ABZA 1WT5C 5FO9A 1CF8L 2GTZB 4FFWD 2Z4QA 1MH5B 1YUHA 3IAQA 5I9QC 5C0IB 5L2KD 3LRGA 4Y19A 5K93A 3CLEL 3VH8A 2OTUB 1PKQA 4F33B 2YWYA 1PX4A 3BH8A 5EZLB 3M45A 3QG7L 5GPRA 4KZEL 2RCSH 3OZ9H 2CR6A 1CK0H 1IAKA 5FA4A 4Z7WF 5DMYA 5TDPA 4TULH 5DS8B 5JZ7C 3LS4H 5E5UB 5IVZB 2AK4A 5DK3A 1WIPA 3EFFB 3SE3A 2XQBH 2F5AH 4JCMA 1OAQL 2FGZA 3BQUC 3VDBA 4OLYH 4ZUSB 3TO2A 3SPVB 1A2YA 1U8NA 1ORSB 1JNHB 3RWHA 1QR1A 1Z3GL 1RJLA 1U8OA 5CBAB 5I1CL 4CW1A 1MEXL 4LP4A 2X4NA 4HJ0C 4HC1H 2B1AL 2LFGA 5EUOB 1FO0B 1AR2A 2V5RA 2VOTA 4NP4L 3CK0L 1KPRA 2ED7A 4AH2A 4MA7L 1KULA 1MQ8A 1HHJA 1T5XA 1LQSR 3HFML 2H2PC 4OLXH 1T4KB 4NNXB 2AERT 4BUGA 3RHWK 1KACB 3T0DA 3D0VA 1OB1B 2IPKB 5KSBA 1WBZA 3PIQB 4XCNA 2XKNA 5GSVA 4H20L 2BSSA 1F11B 2XNAB 4LSRH 3JWOC 5C0ND 2WW8A 3ESVF 3MXWH 5T1LD 2ZUTA 4U0QB 4WI2A 5IQ7H 2Z31D 4YHPA 1HE7A 2FSEB 3MV9A 1VEMA 3WEXA 1KEMH 1BAFL 2ZUVA 5I15L 3P73A 3P4NA 5FUOL 5IVOA 5C08A 2RHEA 2A0LC 4MXWL 3CH8A 1KJ2B 2HLAB 3P30H 2DIJA 2VZSA 3TH2T 1A6UL 4Y5XC 3RWEB 4HHAA 5IBUG 4QHNA 3T3PE 2GJZA 5HYSB 5HPOA 3Q2CA 3PGFH 4XPGH 3T09A 2FJHB 4G7YH 4MA3A 1JGLH 4YDVA 5TDNB 1INEH 1NCAL 1X9QA 1JPST 4ZXBA 3LZFH 2R23A 2FWOA 4NQXB 4ZFFA 1FGVH 4KRPD 4OGXH 2AEPH 2ZSWA 4J3OC 2NW2A 2DS4A 3FT4B 4TTDD 4GRWB 3QNYA 3PWJA 1DQQA 4N0YL 4JGUA 4LLDB 4G43A 5I1JL 2X89D 4LMQE 4CU7A 3HZKB 5FYJL 3QIUA 1CGSL 2YA1A 4LNRA 2BVUA 5E2WH 2HA1A 3KPRA 2DIAA 4PPTA 4APQD 3MLXL 5FYKE 1JNLL 1ZOXA 2I9LA 5HDBF 3NFNA 4NO2A 1RUML 3X3GL 3GK8L 4N1CA 1LP9B 3VXPB 5IJKA 3RAJH 2Y72A 5D93C 1TJGH 4NGHH 2VLJB 5HHME 3EOBB 5BXFA 3DBXA 5FYKD 3DX6A 4NQEA 1BEYH 5AAWA 5DJ0B 1CVSC 3L3HA 4NC0B 4JY5H 5B39G 1RUPH 5DJ2A 2EYRA 1CF8H 5JIIA 5HHMD 4XMLL 1KB9K 1NUFA 4JZNB 2DF3A 4UU9A 1CICA 2X9XA 4HIIA 3AM8C 4LHUA 5D1XD 5I73B 4I48B 3NABH 3GHEH 4UOW1 2V2WA 3BZ4B 3FT2A 3MTRA 1AHWC 3Q0HA 4KGLA 5JIPA 1V3KA 4KJPC 4JQIH 4M00A 1J9CT 1CXEA 1I9IL 2NXYD 2XN9B 1FCGA 3MBEB 3BT2H 3MLSL 1S5HB 3H0TB 1K6QL 2VLRE 4AEIH 2XZQL 4P5MA 3SDDD 4DAGH 1T6VN 1UVQB 1I3VA 5IMMA 1SY6H 3KNBA 1KELL 2Q6WB 3FONB 4XC1H 1FRGL 2X4RB 5CEYA 1J0KA 3DMMA 3RWDB 2VLRD 3SGJC 1RJYA 1YJDL 1RULL 3GO1H 5J13C 5L6YL 4HMDA 5TQ0H 5HHQB 1M7XA 1N2RA 3BKCL 3TIDA 1AXIB 4D9LH 1B2WL 3WXVH 2D03H 1F3JA 5I1DA 1LEGB 1E28B 3O4LA 3KYMA 5E4EB 2XIDA 5SV4A 1VKXA 3RUGA 2HWZL 1A7QH 2EE6A 1E6JL 1IC4H 5HVHB 5DQ9B 1OSPL 4NPYA 5D5MB 4PRPA 3V6OC 1QSFE 3ARQA 3L9RA 3T1WA 2Y6SD 2AXHA 3H7BB 5HHXL 5TGBA 3DVGA 3C5ZC 4LDEB 4PD4K 5IQ9B 1FO0L 2VITB 3LD8C 1HHKB 4P4KC 4K7FA 4PGEA 2OM5A 3QUMB 1QSFD 4WUKL 3T77A 1JV5A 3C87A 2WP3T 3OKOB 4Z7UA 5HTSA 4J7RA 3BP7B 5J56B 2FIKA 1QUNA 3VWKB 4NN7B 4Z7NF 2X4UB 1YQ2A 5DK2B 1A6UH 3N9GH 4FG6D 4KTYA 5DD0H 4KK8C 1AGBA 1J0YA 5JHLH 2C3VB 1ZHKB 3KXFA 1X4XA 3CFKB 3HRZA 3BEVA 3OQ3B 2DL2A 2DQJH 3IDXH 3BZEA 3EBAA 5C0RL 1NQBA 4JFDA 2Y5EA 2ZNXA 1D9KB 3OKLA 3MREB 3RHWF 1CBVL 1KJ2L 3BEWA 5IR1B 4JY6A 1GC1L 3SOBH 5I1JH 1GCFA 1YNKH 4PJAE 4E41E 1F4YL 1VADA 3QQ9D 4OCLC 5LGHH 5SX4I 4G8FB 2XKUA 1AXTH 4R4BA 3L5XL 4MZ3A 3UDWA 2BX5A 2P8PA 1JL8A 4P2RA 5FGCE 1H5BB 4KI1A 1E4KA 2VISA 3LKNB 5EFIA 4DKFH 1EGJL 1W0VA 4E41D 2XQYG 4GSDL 4G8GE 4PRIE 2WWKT 3TCXA 3DSNA 1VEPA 5L2JA 4DZ8A 3B83A 5DVNA 3EDFA 1XGPB 2WINA 4P2OA 3O3BA 5E6ID 3VWJB 3QXWA 3DO3A 5FYLE 1BVLB 4G8GD 4YDJA 3VFUB 1TZGL 4Y5YB 4Z7VB 4ELMF 5KG9A 1U8LA 4P2YA 4PJGA 4NWTL 1ES0A 1LDSA 3Q6GL 5IMLB 1GAFL 2N7BA 3B2VH 4LBEA 3GIVA 4O5LH 5E8PB 2DMBA 3MRPA 4PTUA 5GISL 5TDOA 3QUKB 3M17B 1OD7A 4PP2B 5FYLD 4PG2C 2RB8A 5A40E 3EJYC 3GSNB 1FAIH 4N68A 2A83B 4G9DA 2GSGB 2APWA 4WHYG 1NMCB 3MRFB 1EO5A 1NMAH 1M7DA 2JJUA 3WSQH 3PQYE 4HK0A 2HJKB 3MLSH 1U8KB 3GBMH 2IANA 3EZ8A 3VE0B 4LPWA 2JCCB 4OSUL 1FNEB 3PWNB 3WE6A 1URLA 4TNWK 2HFGH 2R2EA 4K9EC 1KELH 2AV1A 4OAWA 3RVVD 3GMMA 4YIQA 5D6DA 3PQYD 3WKML 4HUUB 2EEBA 3QUZD 2E6QA 3EYQC 1H3PL 1CFBA 2W38A 3FRPG 3NAAH 4KHTH 5AWNL 5EPMA 1GOGA 4O9HH 5BQ7A 2ADJA 4ISVB 5B8CB 3FQTA 4XCCH 1F6AB 1B90A 4O58L 3ZMRA 2ZJSL 5J1TC 5EU6D 2VQ1A 3TO4B 1KG0A 1F4WH 3IDNA 2HVJA 5A2LH 4FQ1H 3LDBB 1NAKL 4XWOC 1V7NH 2QSQA 4JY4A 4F57H 5IOPB 4YPGA 2B7DT 5T1KB 4TRPH 3S88H 4R8WH 1FL5B 4BKLA 5HHOB 1C08B 1HHIB 4UI2A 5E1AA 2X4PB 5HHXH 4MA1C 1NGWB 3EDKA 4P2CG 4I18C 3V5HA 2H2SC 3AY4C 5F9JB 1DQMH 1UH3A 4AEHL 4EKXA 3ULVE 1ZGLM 4FP8L 4HGWB 3X12B 2Q7YA 3TH3T 4LSTL 4M48H 3ARZA 4ZQKA 3UPRB 4K71C 1R5IA 4OF7A 1TNMA 2COQA 3BJ91 1BFTA 4OZGB 4Y1AA 1JE6A 1IARB 1RIVL 5LBSH 2CKBB 3ULVD 3W0WA 1QA9A 2WM0A 3EOYG 3SDXF 1QLRB 3WFBL 4YH6A 1GGIL 3VGBA 2F15A 3ZKND 1DFBH 2FD6L 2FO1A 1L0QA 1DQLL 3QUML 4X4MA 2EIEA 1WVZA 2PW2A 5C0BB 5FF6B 4PGDB 4RGOH 2XRAL 4X5WA 4AIZB 3D18B 3NCEB 2AXFA 1JPSL 2KZ1B 3O9WB 4N8VG 3VFTB 5KTEL 4F58L 4NRYB 4LK4A 1YPZE 5FOBA 5BO1H 4ZUWA 5HDOA 2NY6C 4LVHC 1ZS8B 1N5YL 1Y18B 4JREB 3AMKA 4JZJB 3OXRA 4DW2L 1RFDL 2WLYA 5KZCD 1IM9B 4DFHA 4OJFH 1X5HA 3L1OL 1NAMB 4KXZI 1QLFB 3NTCH 5I1IL 3GSOB 4NFDA 1Z0MA 3WD5H 1MCCA 3L3JB 4L8SB 4PRBB 1HNFA 1WWAX 3OR6A 1P4BL 4J4PC 2HRPH 1PGRB 1NEZG 5EU7E 4WFGE 2QSVA 4OCXL 2ATPB 2A6DA 2VDQH 3S36X 5KSAB 4RISH 3Q6GH 2Y5TB 3TNNB 3H9YA 5LGJB 4LSVL 5J12B 2BNQE 3IT8D 4WFGD 5D72H 5A16B 4Q0XL 1QO3B 2R8SL 2XXCB 4L29B 4HCRA 1VGEL 5BZWB 4PJXA 1DN0B 3QIWD 2J2ZA 1SBSL 4ZUUB 1JUFA 3U9UA 3VXOA 5DC0A 3BX7C 1RZGA 2BNQD 1LO5B 5FHBH 4AT6B 2YD9A 2NYYD 3QUYD 5T3XL 2C4XA 2BERA 1B88A 2Z35B 1RZ8A 2BXZA 1EA9C 3GSNL 3T4AB 3BP4A 5ISZA 3GB7A 1UKSA 1IGFH 1MCRA 3DVIA 4LEOA 3SDAD 4PTTA 4ESKA 3MLUH 2O5ZL 3VFPB 1KCSH 2R2CA 3SGEH 1XT5A 5EO1A 4YX2L 3LQAH 4LLYA 3TGXA 3UTZA 5ACZB 1GIGL 4PJHA 3SKOA 1ZV5A 3DGCR 5C70A 3I02A 2F5BH 2GUOB 1YEDB 4NFCA 1LHZA 3DECA 4KAQL 5TE7L 4KHXL 2ZWLT 4XBGA 4TNWF 4WFHE 1JVKA 2QKIB 2VDMH 1ZSDB 2FL5A 2W0KA 1UB5A 4LASL 1R5VB 4JJHA 4P5KA 5HJ3A 5F1NB 3HMWH 1QR4A 1QBMH 2FEEI 4YFLF 4WFHD 1XF1A 5LGKA 1G7IA 5DJ6A 4L8BB 5INCA 3F58L 2C3WA 3PDGA 5C0AB 2E3VA 4QRRE 12E8H 3RPKA 3T0WA 3L3DA 1VFUA 4PJFF 2RJMA 3HUJB 1AQDA 1MFBL 4QY8B 3NACL 4ORZC 4F8TA 3U0WH 4YXHH 4ZTOL 1A4JA 1UWGL 3CUPB 1ZHLB 5E8OA 2WBJD 1CZ8H 4HLZG 4QRRD 1PJ9A 3O6FD 4S1QL 1T03H 4DK3A 1YEJH 3ZKSD 1DANU 1W72B 3WS6A 5MEQA 1T1XB 4WEUD 2CKBL 4WDIB 5I73C 4F58H 2VKXA 5TQ2H 4Z8FL 4YGAB 4QRPE 2LAGB 1U8JB 4C4KO 4HIXL 2FLBT 5IK3B 5GGRY 2LU3A 2ICEB 4XXDB 4PLKC 2HLFD 3FO9B 3E8UH 4HUWB 1WF5A 3P0GB 4X6EA 3VFWA 3MBEC 3CFDA 1RFDH 3MUJA 5DUBA 3V7MA 4QRPD 1S9YA 3VFRB 3LKQB 1SM3L 2MNUA 4NJAL 5FM5M 4CNIA 5IEKA 1MAJA 5JOFB 1A21A 3L1OH 3IXAA 4PJ5B 2VZ3A 1HH6A 5I16B 2ZCLL 1UM4L 5CJOH 3V7AE 2AV7A 2PO6A 3HRPA 5L9DH 3DRQB 3ARDD 1FG2A 4LCWA 2WBJC 3HG1A 4OCXH 5BW7C 1IGYB 3B9DA 4HMCA 1X6NA 3KPSB 5CSZB 1EUTA 5BS0E 4NN6C 4GAYA 1J5OH 2J8UF 4OT1L 3RU8L 1NAML 1MCBA 4FZEH 2R8SH 3TPUA 1FZJB 5IB3B 1J11A 2VJXA 5DJXB 3TT1H 4GJTB 3O0RL 3PNWA 1RU9L 1DBBH 3ZT7A 4UT6L 4TQEH 2JLLA 5BS0D 3U0TB 4YHYC 4KZDH 4PJBF 2YPLA 1FYTA 4NUGL 2Z9TA 3QI9A 3DV6A 5HVHC 1U93A 3A6CH 2VAAB 1FL3A 1BLNB 1QOKA 2IFFL 3I2CH 1P9MA 3ULSA 3KR3L 1ZANH 4MVBC 5T3XH 1KTLB 3IFLL 2G9HB 5DC4B 4LRNL 2A6JB 4UIMB 4G6MH 4K3HA 1HH9A 1FHGA 4YO0A 4NQDB 3BDBA 3UTPE 1FGNH 2WUBL 2P1YA 5C07A 1K4CB 5JA8B 3MJ8B 2ATKB 2GT9B 4ODHH 3MNZB 4F7MB 5JHDE 2DQEH 2KKQA 1VDGA 5C8JA 2XWTB 4B0MM 4R3SA 1BD2E 3H3BC 4QHLA 4HG4K 1KB9J 4F3FB 2EH7H 4K2UL 4Z0BL 3O4OB 3UTPD 2ZCHH 4ZSOB 1Z9MA 4Z0XB 3F8UB 5JHDD 3I75A 8FABB 4Q6YA 2C3HA 2B0SL 4Q2ZB 1D5IL 5GHWL 3FHAA 1D9KC 1NL0L 3W11C 5I6XC 1JNNH 4URTB 3MROA 3PXHA 4KHXH 1JF5A 4LPTA 3NVQA 5B4MD 3OGOE 4I2XB 3C08L 5HI4D 2Y07L 3MC0A 3DXAE 4I3SL 3ZYIA 1A8JH 1BQHA 1FLTX 3PG2A 3T65A 1TVDA 5HYQA 1S7QA 3CGTA 4AQOA 2BCKB 3CFCH 3S37L 3MJ7B 4JN2B 1HSAB 4FXKB 4IMLB 4DOHE 1MFCL 2FJFA 2OI9C 1KPVB 1I1RA 2OL3A 1A7BA 3DXAD 3MRGB 1TETH 1MI5E 4IIQC 5E8NB 4Y4FD 3FQWB 3TBTA 4PUBL 4XNMA 3CLFH 4PG9B 3I50H 5GGSY 1CG9A 3MOBL 3DGGA 4NUJB 1MI5D 5DD6A 2XY1A 3S5LG 1OAZL 4GRLC 4Y5YC 4MDJA 4PJ9C 4XWGL 5TF1H 4N1HB 3D85A 5GRVL 3VRIA 4A6YA 5B4MC 4E9LA 1RZKH 5T1MB 3G5XB 2PTUA 4YQXL 2AJXH 5GGRA 4XP4L 4RMTA 3Q48A 3FFCA 1DVFC 2I26N 3GIZH 3WNOA 5KS9F 2X70A 1MCWW 3HMXL 4PD4J 1KIUA 5IBTL 4OZHB 3AU1A 5F9DC 1NJ9A 3IJHA 4M61A 1YYLL 2AXGB 5E00A 1T22A 3BKML 3RPIA 1MFDH 5A2FA 3WNMA 1W72L 4C55A 3AXLB 3E6HA 1ORQB 2B1HL 4QNPF 2ARWA 1UM4H 5FM4A 3FQRB 2DLIA 2DQTL 3CSGA 1R3LB 3KPMA 5ALBL 4MNHA 4PYHA 4Z77B 4KK5C 1A3QA 3EJZD 3MGOA 2E7BA 2A6IA 1KPUA 2CR3A 2NXZC 5AYUH 4LARH 3H42L 3W2DH 1FVDA 1J88A 4P5TA 5E0QA 3SDXA 3ARGA 3VXUA 1RD6A 5H35A 2OSLB 2VTFA 4L4TD 4P2QE 2WBWB 3PHQA 5EU5A 4CMHC 5F9OL 4DTGL 3TO4C 3E3QC 3WS3A 4OM1H 4XPTL 1MNUL 2YEZB 4H5SA 3LDBC 5I1LA 5IVXE 4XP9L 4NO0D 1YEEH 2CLVB 3THMH 4P2QD 2YKLH 4AMKH 1T0PB 3QUXD 1VACB 2CRYA 3KR3H 3OGCB 5ITFA 5DT1L 4YHNB 2YMXL 3GJEA 4P9HH 3VXSA 3GSXA 3QZWB 4Y4HA 4ZUTA 43C9B 2LQRA 1S7TA 1F3DJ 2WUCH 4XMPH 3SBWC 2BJMH 4WO4D 5HGDA 4HFWB 1Q1JH 3OXSA 4XAWH 4V1DB 2PXYA 4NFBA 1MRDH 3B9KB 2KBGA 4BYHA 1KIQA 1I1AB 1TQCC 1A6ZB 4TSBH 2BOBA 1P4IL 4HJGB 4IRSB 1DE4A 3N06B 2EDLA 1P2CA 5FO7B 1RIHL 2R29L 5DI8B 2Z8WC 4JFZL 1YNTA 1KF9B 1JHLL 4GQPH 5E8EB 3T8XA 3WDIA 3RTQD 4XT1C 5CD5C 3MZGB 2R0KL 2HT2D 2HAZA 4HIJB 5IB1A 2UZIH 3REVB 4ODUB 1T21B 2DI8A 2BY3A 3GFUA 5I18H 2A9NH 4I3SH 3MO1A 4WEMB 4LCCC 2IAMB 1D5XB 3AAZB 1ZT7B 2E7MA 3HTLX 4RWYH 4NM8H 4U4BA 3FOMB 5JNYB 1HHGA 5I8OL 1MREL 4B50A 3P3YA 3GGWB 5DZNA 5BZDA 4K3EL 3QISA 4OFPA 1YN6A 4LF3A 3MRHA 3P11H 4P57B 3DO7A 2CDEB 3D9AH 3FZUD 3OHXB 5DJAA 3KLAB 5GGSA 4DGIH 1LDPH 3CFJA 3O2VL 4R6UA 1I4FB 1NSNL 4FQXD 1BFOB 4O2EB 1U9KA 3X11B 1NCCH 3C6SB 4LMQI 4GG6E 3GSUB 4IOIA 1JIBA 3ARFB 2OJEA 3UJTH 3BDXA 2HT2C 4FFVD 1A7PH 3AGVA 1YMMB 2DTSA 1WAAE 3HAEG 3OKKA 3V6ZA 3Q6FB 4CN1A 4YFEA 7CGTA 4WJ5A 4QRQB 5IB2A 3DUSA 2D31A 2FHBA 5KOVC 3TVMA 3QXUA 1I9EA 3V0VB 1GOFA 5J12C 3RZCD 5HHVL 3QRGH 2CSPA 3KG5A 5FO8A 2EDEA 4JRXA 1I8MB 4U2ZA 4XI5C 3C6LB 1T2JA 3L3IA 1M6OA 2X9WA 5FO9B 1UZ6E 1T7ZA 1YUHB 5ICXA 1AXSA 3R1GH 4MDIA 3IFOA 3O8XD 3ARWA 4FQXC 4Y19B 3VH8B 4YAQB 1EMTL 1NUNB 2IADA 3Q1SH 2I27N 1QBAA 1DL7H 1CIDA 5FA4B 1S7UB 3RVTC 4OFVA 5TDPB 3HC4L 2BVYA 3KPPB 1CXIA 4NKQB 3JWDL 3KPOA 2OXGA 2XG4A 43CAA 4PJFA 3STBA 1TVBA 1AGFA 4J8RA 3CSPA 1YMHB 2BVOB 3RZCC 1G9EA 4DTGH 3TO2B 1A2YB 4RAVA 1MRFH 3M8OH 4NZRL 2BNUA 1CE1H 4KK6C 1H3XA 5F7MC 4M3JA 4TUJB 3RWHB 1QR1B 1U8OB 5CLTA 4XZUA 4RGMB 2OTPA 4CW1B 2D7TH 3NIGE 4D0CB 3QEHA 3U46A 2IC2A 4KUCD 2BC4A 2X4NB 4QOKB 5D2NA 4HWEL 4Z78A 4CN6A 4XAKE 4JKKA 4YK4C 4DN3L 5IB4A 1MCLA 4AH2B 4R96A 5JORA 2GJJA 5EZOH 5SX4H 1HYSC 3GSWB 3AS3A 4HZLA 4PR5B 4XAKD 3QWQB 1AJ7L 3HPJB 4NOBA 5MENB 1WBZB 5IFJA 4PB9L 5GSVB 3GMPA 4ZO9A 3U7AA 4N0FA 4XHJC 1OAYH 4W4NA 1EXUA 3IU4L 3MMEA 4MAUL 4XVJH 2UUDK 3MV9B 3WEXB 5I8KH 3MYJA 3WLWD 2F58L 3MRCA 4BFBD 2I25N 1WSST 3CC5B 1UCBH 3C8HA 1J8HD 2EIZA 2YRZA 3GI8L 5L88H 1KLUA 2YD1A 4PJBA 1RURH 2CLRA 4A6YH 4CBPA 1SJVA 4L9LC 2IMNA 3GRWA 4YDVB 3MLYH 3MJGX 4LVNB 5CSBA 4I0PD 2WLZA 3VMOA 1K3IA 1SEBB 4WCYL 2FWOB 4ZFFB 1JP5A 2EYTA 3GMLA 3ZT6A 2ZSWB 2F74A 2OMNA 1EAPA 2PNDA 3PL6C 3PWJB 1DQQB 3QNYB 2BDNL 1YEHH 5IFAL 3BYTA 5D1QC 4OZFH 4TUOA 2DYPD 2XFXA 1H3GA 4KU1A 3VGEA 1CLOL 4HKBA 5IEHB 3KPRB 4YHLL 1EFXB 4YHKH 1RV6X 1SYVA 2R2BA 2I9LB 4MNQE 1PEZA 4UMGA 3D3VA 3TEUA 3UTQB 4LLUA 4Z7QF 1W2KT 3QQNA 4OTXH 3IU3A 1NGYB 1RK0A 2VXVL 2BNRA 4IRZH 3TP4A 2ZUXA 5CJXA 2L4OA 3TBVA 3UTSA 5BXFB 3DX6B 1D5ZA 4MNQD 5C7XL 4WY7H 1FLRL 5F7YC 3T2PA 5KW9H 1WZLA 4WUUA 5DJ2B 2X4QA 2D2OA 2ARJA 1SMAA 4N5UA 3L3GA 4UU9B 1CICB 1GRWA 1I1YB 2EEAA 3NOIA 4HIIB 1BM3L 4LHUB 3HC0B 5GGVH 3FT2B 3NA9L 2VH5L 3U4EB 1AO7A 3B2UC 1H3WM 4WNQB 3SDCB 4GW5A 1MLBA 3DVFA 4PJEF 3LKRB 5DHVH 1XF3A 1NCWL 4YFDB 1GGBH 3N1QC 5SWSB 3GJFK 4FQQA 3ARTA 4QHKI 5F70A 5DA4A 2NY1D 1MHPH 2Z91A 4HWNA 4D9QE 1HINL 1YQVH 3BN3B 4JFEE 2JB5L 5I2IA 1QRNB 5CEYB 2I5YH 5KVFH 2Z93B 4XPAL 5IFHH 4PB0H 4PRNB 3V0WH 3CVHA 5CGYC 3IFPA 4H8WH 4KWUA 1I9JL 2V5MA 4D9QD 1N2RB 4JFED 1BX2A 3JBG7 2HT4D 1NC4D 4MJIA 3BP5B 3TIDB 1RY7B 1F3JB 2CRMA 3O4LB 4JDVB 4L3AA 4MCYA 4JPKL 4JO2L 4IS6A 3VG0H 2OK0L 4DVRL 4KJWC 1W0WB 1I8IA 2VXUH 3FQNB 4W4OA 1IKNA 2YSSA 3H3KA 4HWBA 4WV1A 4GW4B 4CJ0A 4AY0A 3U30C 4UV4H 4MNGB 4NPYB 3ZDYF 4MJ4A 2D7NA 2DQCH 4U1GC 2NTFA 3TZVB 2OBGA 2ZSVA 5TGBB 1S9WA 4JO1L 3P9WB 1F3DH 5FGBC 5F44A 3DPBA 2EDHA 3E1F1 1A3LL 3DHMA 5D7LE 4FABH 2ENSA 1EJ6A 2H32A 2PUQT 4PJIB 2DN7A 5D2LE 3HC3H 4WIQA 3C8KA 4JLRA 4WWKB 1MCPH 1HNGA 2HT4C 1T2XA 4YJZL 1BREA 3QAZB 5D7LD 1QSZA 4XXCC 1AGBB 2H6PA 2CGRL 3HRZB 3KXFB 1UGNA 5L2KA 2I24N 5K59F 2QSTA 1MCWM 3MNWB 3BZEB 5I1GH 3VXQB 3AMLA 3OKLB 1HHHB 2RAMA 2VXTL 5D6CA 4TUKL 2WZPD 4YHML 1HI6B 5JR1H 3E2HC 3VD7A 2DLFH 4LVEA 1MCIA 2DQHH 4R90L 3QXAB 3ARVA 3SGKC 1C5DA 3DWTA 4UQ2A 1QQDA 5I71C 3MRJA 3WIIH 5J4MA 3GEWB 2PN5A 1T20A 4R4BB 1JGDA 3HZVA 4P2RB 4LNVA 1G6RB 4M9PA 3MACH 2VISB 1W0VB 4X8JA 1UM5L 5C9JA 4HWZA 4GS7C 5T33H 4HULB 2P5WE 3NIDE 4U1IA 4DZ8B 5L2JB 1V3MA 5KAQG 4UTAH 4EJ1C 1PYWA 4JKPL 4KY1H 5BOPA 1S5IL 1FBIH 1FLRH 2YWZA 1JBJA 1XAUA 4YBLB 4YDJB 3HE6A 4MZ2A 4OZIE 4U7SA 5KG9B 3MJ6A 5A3ID 2P5WD 2J88L 2GITA 1XIWB 3EO0A 3KYAA 1TCRA 2WQRA 2BVPA 5EOQL 5GQBA 3KJ6L 3ZE1F 3MRPB 1N7ML 5TDOB 5EUOF 5FKPA 1DCLA 4XC3L 4JFXA 3IFNL 4JRYB 3MOQA 1N59B 1JGVH 1I8LA 1RJZA 2CRIA 4RNRB 4M6MH 4ZAKC 1GHFL 2KQMA 3CPLA 3K0WA 4RBPH 3GSRB 1M7DB 2XA8H 4HK0B 4K55A 1YPZF 3TA3D 5T1LA 5CIPA 4Q9RH 2IANB 2Z31A 4H88L 4KTEL 1I1AC 1HYRC 3WE6B 2ZOLA 4HXBH 1RK1B 4NN5C 1QFOA 2AV1B 4IRSC 4OAWB 4MX7B 3GMMB 5IGXL 4YIQB 4G80A 2R56L 3DLQR 4M1CD 2V17H 1M71A 4X8XA 2XACC 2ZUUA 1CL7H 2WP3O 3GMQB 4NCDA 5FK9A 3RNKA 3T2OA 1R5WA 1IGML 3RA7L 5EPMB 1JYVA 5BQ7B 5JXED 3S34L 2GSIA 5DFTA 1AD9A 1K3ZA 1F4XL 1S9VA 3FQTB 4PJ8D 4KROD 1AR1D 4HUXA 2Y1VA 2VQ1B 3ZYJA 1JGEA 4LVOB 1KG0B 4XBPA 3V52H 1DQJA 4JPKH 2VRAA 3MV8B 1WTLA 2EE2A 1QG3A 3UAJC 4AL8L 4OLVL 5IBLC 5C0EA 2X89A 2MCG1 5K9QG 4YPGB 4ZODA 4RQQB 1C5BH 4YUEL 3CFBA 3BKYL 3FB7A 4P3WA 4PGCA 4KVCL 4APQA 5E1AB 5J3HD 3AC0A 5BVJB 4Z7WB 3EOAA 2R0ZH 3RVWC 3V5HB 4Q9QL 5I1EH 4BSWA 4JHWH 3MODL 5JOEA 5IESH 5I1AA 5HDLA 1HZHL 2QL1A 2VN4A 1A6WL 3BD3A 5CKGA 4NJ9H 3S35L 1F4AA 7FABH 1CFNA 1Q9KA 2XTJB 1S7WA 4MJ5A 3LN4A 3G6DH 1SYSA 3EGSB 4GOSA 1D5BB 3LB6D 4M7ZB 4ETQA 4WHTA 2WWKO 3SGJA 1CXFA 2DD8L 3LHPL 4LQ1A 3W0WB 3WXWH 4KVNL 3G9AB 3PABA 4NCC2 5D1XA 1N0XH 3RNQB 2AABL 3ARSA 3BZFA 2DLHA 5ESAB 3G04A 2VXTH 3ILQC 3QWRA 4Y16C 1X6LA 1NPUA 2PW2B 4YHMH 2QQKH 2QR0B 2UVEA 4S1DD 4HIHA 5EBMA 4WW2A 1IJ9A 1RUKH 1UWXK 1E0OB 2DM3A 2PCPA 3F7YB 3HCVA 2OTWA 3QNXB 3NPSB 3SDDA 2R9HC 4KKAD 5J6HA 3LIZH 5T3ZH 2VIRA 3MLWL 4OD3L 4EI5D 4XMKL 4LSQH 2VLRA 3OXRB 4NBYB 3LRHA 1KYOK 1X5ZA 3SE3C 5CJQL 3ALPA 5F9WB 3QXVA 2A6KA 4IRJD 3FB6A 3RWGA 4ERSL 1IE5A 4K3GA 4JM4H 1KJMB 5J1AB 3OR6B 4MCZB 3ULUH 1H3VA 2FB4H 2BRRH 2QHLA 1G6RL 2EDOA 1F6FB 3MA9L 3P4OA 1MCEA 5EOQH 3RVXC 4BQ8A 2OJZL 2FBJH 3CVHH 1QBLL 2G75A 3MX0A 1X5AA 2DJUA 1OVZA 2EDNA 4ELKA 4Y89A 5DQJA 3GUTB 2W9EL 2FJGA 2KUTA 5F96L 2W65A 2OQJB 4KKCD 2VAJA 1HIMH 1F58H 4O4YL 5L7XL 1IL1B 3QO0A 1RZGB 4H88H 5TPWL 4YHIA 5JPNB 5DFWH 5DHYB 1QSFA 3QEQB 4ZPTB 2VR5A 4DVBB 1YNLH 1N26A 1QEWA 4HGMA 3QWOB 2Y4SA 4OIIH 2R56H 1KB5B 1XEDA 4TSAL 4P46D 4XCYA 1Q72H 4MQ7A 1BIHA 3TNMA 3ZDZE 3CXHJ 4CDGC 3S34H 2OR9L 5DGQA 1F4XH 1L0XA 1G7QA 1YEGH 4S10A 2H32H 1KEGL 3U6RA 1J12A 5JIHA 1FNFA 1IC5L 4LLYB 3UTZB 2FDBP 5I1KL 3LAFA 3UZVB 5HY9A 4UAOC 4GKZB 4PG2A 5EBGA 4OBSA 3CZJA 4ZXBC 3U1SL 2MSPA 3VXME 1D5MB 4FFYL 1FFOB 4BM7A 1IBGH 3UZQA 3F12B 3GMNA 1U6AH 1YDPB 4Q7DA 5GRYA 4GRWE 1NH6A 4PJAA 2PYFA 4E41A 3MODH 4M93C 5CAYB 2SEBA 2YR3A 2ZPKL 3QIUC 4P46C 5HJ3B 4F2MA 3VXMD 3LPWA 1N6VA 4QHKJ 1PEWA 5E6IA 5BRZB 4I9WE 1G7IB 3GKWH 5DJ6B 2DAVA 5INCB 4X7EC 2IG2H 4G8GA 4HQQH 1LP9E 4G9FB 1FG9C 5IJKC 4HLJA 4X6DF 3L3DB 1P7HL 3EYFB 4QRTA 4I9WD 3NZHH 1U8IA 1AQDB 1KN2H 1MCOL 3MRIB 5AZ2H 3LRSB 1G0YR 5E95B 1T0NB 5SWZB 1ZTXH 1A7RH 2DQDH 3QRFM 3BRFA 1E4XI 2DKUA 2QADC 3UYRH 2QTEA 2YC1A 1MSPA 1QFUL 3NCJL 2EH8L 2HKHH 1K5NB 3O6KL 4X9HA 4WI7A 1QYGH 3EYSL 1IAOB 5I75B 2CJUH 5T5FH 3P9LA 3T0XA 5FAAA 1H3UA 1DP0A 3WHE0 2XN9E 1XF5B 4N9GA 3MLWH 3PQYA 4OD3H 4FS0A 4X6EB 3QUZA 4LLQA 3F7VB 1NGXA 4KQ3L 4KJYA 3LH2H 4ODSH 5IEKB 4XCEB 4UB0L 3NZ8A 1MWAH 2XN9D 5CIPH 4Z95L 4UNVA 1YEFL 2PO6B 4M8VA 1ZLWH 4LCWB 2DBLH 3HG1B 3DMMC 5EU6A 3FFDA 4KC3B 5ITBH 2GAZA 1KCRL 5IM7B 5C1MB 4QYOA 3L7FA 3MGAA 1JHKH 3I84A 4U6XA 2F19H 3BOVA 3U36B 5DJZA 5LCVH 2UY6A 2HFEB 4F15C 5J7CC 5D7JD 3TPUB 1KN4L 3MLVL 4MMZC 2ITCA 2E27H 3PNWB 1VENA 5H94A 4RAHA 2DL9A 2O61A 2YPLB 1FYTB 1OTTD 3S37X 5I76A 3QI9B 4ZFOB 5DHXB 3OR7B 3INUL 3GSQA 4M6NH 2XI9A 4ZS7L 3PWVA 4X0KB 1LK3L 1LEIA 2NY5H 1DBAH 1PFCA 3LV3A 1OL0A 2YRLA 3FB8A 5SV3A 3HE7B 1CLYL 2IF7A 4HCRL 3FN3A 2R1WA 3ZHLA 3DETC 1DEEB 5GRJL 3S4SB 1MF2L 2NY7L 3EKCA 4TSCH 5DDHA 3K3QA 2OR7A 5C8JB 2AVGA 3LQAC 4R3SB 1LD9B 4QHLB 4N0UE 4JFYA 1S7SA 3OPZH 3O81A 5DJYA 4DKEL 3W5MA 4ELMB 1LO4H 4XNZB 3QDJE 1OP5K 5I1KH 1DLHB 1KB5L 2MPAH 5T1DL 1DBKH 2OR8A 4I8DA 2R0LH 3VWKD 1PZ5A 2J1KA 4IJ3B 1XF4B 5GJSH 4NZUL 3QQ4B 1HKLH 4TNVK 1XR8B 1QFWM 4ODTL 2JJWA 1R3KB 1ACYL 5TFSH 4EDXB 1V7MH 4KK9C 2B2XL 4HKXA 3QDJD 1X5GA 5CFHA 5BOZG 4EEEA 4Y2DB 4PP1C 4JR9H 1YPZA 4UIKL 3K4DA 3T2NH 2G60L 1QKZL 5IMOA 1CCZA 1HCFX 1S7QB 2W60A 5TH2B 1A1MB 4XNYL 4MAYD 2XA3A 2NPLX 2V5YA 5EIIA 2AGJH 3UDWC 1MFNA 1Q0XL 2OL3B 3DIFA 3OAZH 5F21B 3OL2A 4E5XB 3N85L 4M9OA 5INDA 1E4KC 1I75A 2OXHA 3I6GA 3TBTB 1FNSH 2DLTA 2DQFA 1NCDH 2PW1A 4PJCF 4ETYA 2IGFL 2I07A 2VC2L 4NC1E 1DSFH 1WLHA 5EA0L 4LSPL 2AJ3B 3VRLE 4P2OC 4TN9A 4PBWD 2AJYL 5DD6B 5B3JF 1BGXL 4NQSB 4YBLC 3MRKA 4K7PX 4RZCA 4XNXL 2Q86B 4UNUA 5LXGH 4MQTB 4PS4L 3QIWA 2JB6A 4EN3B 3PWLB 5GGRB 3OG6B 3VWJD 3FFCB 5T3XE 2BNQA 3BPLC 4G8IA 3OKNA 3QUYA 5BMFH 3VA2C 5C6WH 1UXSA 1WISA 3GJFA 3SKMB 2Q20A 3PV6A 4M61B 3IJHB 5GRWA 1UZ8A 3LCYA 5JW4Q 5T3XD 5E00B 4M5ZH 2Q87A 1SJXA 1XGUB 2JCCE 2X1WL 5DZLA 5KVEL 2E9IA 4G6KH 35C8L 4UTBL 3SDAA 3S5LA 1FN4A 2MOVA 4GBXD 1E6OL 2EC9U 3AB0C 3E6HB 4NZTL 3UEZA 5D6DC 4XX1E 4MNHB 3L95B 4QHUB 1G9ML 2OLDA 3MGOB 3ZDXF 2BXYA 1MIML 4AIOA 1KCRH 1BVZA 5DGRA 1FVDB 3MRMA 4K94H 4P5TB 3SDXB 5C0GA 1FIGH 1BQLH 5F6HJ 3ARGB 5DA0B 4ZS6C 3V4PH 5H35B 3HNSL 5KVDL 2P5EE 4YPJA 3MLVH 4M62H 1FV1A 4YBHA 3WS3B 1TJHH 1BP3B 4KMLB 5CZKA 3QJFA 3RZWA 1CFTA 2DQUL 2JELL 3JV6A 5HHPA 4UINL 4X6FB 2P5ED 3C60D 4HBQA 4OGYH 4WU5A 2FH6A 2N4IA 5ITFB 4XVSH 4EOWH 1F13A 3GJEB 2X5PA 4XPBL 4HX1A 4HH9B 1T0MB 3GSXB 4N0CC 4QEGA 4Y4HB 2VZUA 4MD5A 1S7TB 5T1KD 4QTIH 4X7TA 2FX7H 5F97E 3HZMB 1OW0A 4JFPA 4R26H 3WUWG 1PD6A 5MEPA 4HS8L 3SO3B 1KIQB 4ZFOL 5HYEA 5F7UA 4ZTPL 4EDWL 2VYRE 4M7ZC 4U1KA 4FNLH 4QRRA 3SY0A 3OAUL 2BOBB 3NFPB 3O6FA 1NDMB 1T66D 4XH2B 5DXWA 4BK5A 1EBPA 1P7KB 2QEJA 2FR4B 5JDSA 1NGPH 2P48B 2QJDA 1CLCA 3AREB 5C3TA 1YNTB 3W39A 1G7HA 4N0RA 3T8XB 3QIBD 3UJIH 5JO5A 4OI8A 1EO7A 3QULA 4BQCA 4H26A 1T89A 1ITCA 1G9NH 3O6LH 5C0BE 3K2UH 1U3HB 1JRHI 3ZO0A 3OKEA 3TN0B 5FYLH 4HS6A 3MO1B 3MRNB 3ZTNL 1Q9OA 4QRPA 5LWYH 4DK6A 3DRTA 3NIGF 3OJVC 3EHBC 5BZDB 4UDUA 2VLLA 1AP2A 3O9WD 4D0BA 1O7VA 3ARDA 3KLHD 2HTKD 5DJAB 2DBJA 5M7QA 5GGSB 1U8QA 3CFJB 4OQTA 4X5XA 3L3OA 3PDDA 4LDLB 2HRLA 2VC2H 1HOCB 5FOJA 4QGTA 1TZHB 4P59L 1EPFA 3GM8A 5E2UL 1P7QB 4IOIB 5T5NF 1NUGA 1IEAA 1FFPB 3QIBC 1RZKC 3VI4E 4TNVF 2OL3L 4HLZH 4TOYL 4JCLA 3CCHA 4X6BB 4UOJA 1MFAL 3OKKB 3V6ZB 3OB0H 3RFZC 2P4AB 5BS0A 2VDLH 2D31B 1JN6A 2PYEB 1T2QL 3UTOA 4JDTL 4XVTL 1T1ZA 5FO8B 4JRXB 4ZD3L 5KSAD 4KMTH 4Z7OE 4G8EA 5EUKA 5CEXA 3QXDB 1M6OB 4U05A 3RVUC 1N6QL 2C1OA 1AXSB 4MDIB 3IFOB 4L8CA 1NDGA 2P49B 4K3DL 4I0KA 2IADB 3HPLB 5HPMA 3QHTC 5JUEL 3PV7A 4DZBB 3NA4A 1JZ7A 3S96A 5JHDA 2MWCA 4GMSH 43CAB 4PJFB 3ULVH 1TVBB 1VERA 4J8RB 3UO1L 3TBYA 5CD3B 4YZFF 2D4DA 1KBGL 3MUGB 1FZOB 3PHSA 3MXVH 5CJ5A 5I66A 3BSZL 3ELAT 3MBXH 2BNUB 1MCHA 2JELH 2BMKA 1S7VB 4XZUB 1E4JA 1CLZL 1BOYA 1JTTA 1YZZA 3NCBB 3DXAA 3QEHB 3U46B 5DSCA 1A3RH 2BC4B 5D2NB 4XPBH 4Y4FA 4ALAL 3WN5B 2DWDA 2Q76B 4S1SH 1Z0NA 2ILLA 1IGJA 3ZL4H 1FPTH 1CXKA 5DUPL 5GS0H 4X6CE 4HUVB 1ZLVH 4R96B 5KSVA 3GMRA 2ZKHL 4JZOB 4XP1H 3QCVL 1MI5A 5B22A 3SEPA 2A77L 3V79C 3IJSA 5BVPH 3GMPB 4L1DA 4N0FB 4YBQC 3AVEA 5E1HB 3CFIC 3HUJE 3O41A 3P9MB 2DOCA 3MMEB 4MXQC 4XNUL 4AM0A 4BZ1L 3BIAX 2O5XH 1JPFA 1C5CL 1EEQA 3NCFB 2J8UB 4RGNC 4XX1G 1JK8B 1NFDE 5CUSL 1IQDB 4LGSB 4FQCL 5I1HH 3BMVA 3BN9C 3CMOL 4WI6A 1H15B 3WS6C 4J6RL 3LPFA 1AI1L 4S2SA 1KLUB 2ICWB 1OF2B 4OD2A 4PJBB 3U48A 2JTDA 1OGAE 1Q0YL 4RMUA 2JJTA 5ESVA 3DARA 3IS0X 4YDKL 1G7MA 4JEGB 2PR4H 3IETA 3GMOA 3GMLB 3D48R 1QFPA 2F74B 1EAPB 1OGAD 4Q6IB 1ZA3A 4B7IA 3KYOB 5DD3H 2QQNH 3O6ML 1DR9A 4TUOB 3R4DA 2JIXB 5F1OB 2PO6C 4DUWA 3F5WB 3SDYH 1I7UA 3BISA 2DDQH 3BXNB 5IBUB 1SYVB 1WEJH 1EZVX 1WIUA 1VPOL 3D3VB 3KPSE 3DVNA 2R0WH 4KV5E 1T83A 3QJHA 1NFIB 5A43C 4S1RL 3LKPA 4YWGL 3IF1B 4KJQC 4NO0A 4ZDHA 1H8OA 1RK0B 4ONFH 4P2QA 4M1DL 1BBDH 2ED9A 3QUXA 1OSZB 1S8DB 3UTSB 5ETUA 1EX0A 5ALCL 1UQSA 3KPSD 1U95A 1SEQH 3IJYB 3ARBB 1A7NL 5IVXA 2YD5A 5CMAA 2ARJB 1N6QH 1JCKA 3L3GB 1KXQE 4WO4A 3KPNA 4XB8A 3QI9C 5ERWA 4HFUH 1P9MC 4WEBL 4LU5H 4D3CH 1MQKH 4NQDE 4Z76A 1JF1A 2P44B 3RDTB 2IBZX 1BFVL 1H0DB 1XF3B 4NQCE 1GSMA 5HD8D 3ZKXB 1AFVH 1HILA 1L7TH 3RTQA 3UO1H 3KWWA 4LAQL 1YECL 1WJ3A 2VDOL 4FQQB 3WNPA 4NQDD 2EIDA 1AY1L 4POYA 4ZSOE 5B39B 2Z91B 1R3HA 4TPRH 3HB3D 1QFWL 2UZXB 4NQCD 4XNZC 2IH1B 2GK0A 4U33A 3QA3A 5FGRA 1QVOA 3IFPB 4IJ3C 3HZYA 1RZJL 1AD0B 4LSSH 2QQLL 5F7FA 5TE4L 2V7HA 4DQOH 1BVKA 3P0YH 1N4XH 2VUYA 5DC9B 2H1PH 4NNPL 1BWMA 1JTOA 4CVXA 4QTHB 4I2XE 4LSDA 5DR5H 1FL6A 1JWSA 4G6JL 4MJIB 1A7OL 3HI6L 5GRXG 4PV8B 1RSFA 2HJFB 4IOFC 1S7RB 1DUZB 5I9QB 3WCYA 2CIKA 4MCYB 4FQXA 3NBNA 4IS6B 4E0RA 5KJRL 3C5JA 1X5KA 4W6YB 2YSSB 4WV1B 1JPTH 1DBML 5D1ZD 1LO2H 3GBNH 5SWQA 1JZ2A 5KVGL 5C09E 4NWUL 5D70L 3UBXI 1TQBC 4RFOL 5FKAA 2NTFB 1U92B 3MRQA 3QEGL 2ZSVB 4GXUN 3K8MA 4XP6L 3T1FA 4GQ9L 4C83B 3SCMD 4GG6A 1MCSA 3KPLB 3AUVA 4JDZA 1A4KA 3FTGB 4OQTH 5JPMA 5KANI 1OPGH 5C09D 3TBSA 1AGDB 1A1OA 2CMRL 3BQUB 3LEYH 3QCTL 4OFYD 4M7LL 3MOAH 2YXFA 2IQ9L 4JANA 4DN4H 1QACA 5F89B 4MWFA 4OCRL 1D6VL 4W70A 5DMKB 2UWEE 3TWCH 1FJ1B 1WWCA 2EDJA 1WCQA 4L4JA 2APTA 4YC2C 5M95B 3CFEA 2H6PB 4JO3L 1NLBL 5EORL 5L2KB 3O8XA 2IJ0C 1S9XB 1IAII 5E2VL 1XH3A 3ZKMC 5E08L 2I9TB 5E9DE 3TESA 1PZUB 1FE8L 1MRCL 5MERA 5D7SL 3G08A 5D1ZC 3HR6A 5GIRA 5D6CB 2EYSA 5JDJA 3NH7L 4NO3B 3VJ6A 3FT3A 5CHNA 5CZVL 4NRZB 3H2WA 5E9DD 3X3FL 4S0TD 2V2TA 1P53A 3WDHA 4HBCH 1J1PL 2WIIA 3GRWL 1T20B 3DURA 4J3WA 4XTRC 4ODXB 5DUMH 1Q94A 3UP1A 4P5TC 5C9JB 4HWUA 1M05A 3LSOA 1BMGA 1INQB 1K4DA 4BSVB 3ARGC 4U1IB 3FO2B 1JZ3A 5GGTL 1PYWB 1BFSA 5EBLA 4D8PA 4UZGA 1BHGA 3R06A 5E8DL 3HNTH 1AGCA 4Z9KB 4L8DB 2I60H 3STZA 2XY2A 3UZEA 1TZIB 1T5WB 2G5BA 3D69B 2ZCKH 4H1LH 4O02L 4FFZL 1EJOH 1K2DA 4U6VL 1X7QA 2R69H 3ET9F 1SMOA 2YD6A 4Y4HC 1OTSD 1BZ7B 5A2JH 4QXTA 5FB8A 1RJZB 5TE6L 1PLGL 3CPLB 3OSKA 2ORBL 2FX8H 5I8EB 3DV4A 3KGRA 4V1DE 1K8DA 1ZE3C 2PXYC 2A73A 2Z31B 5KSBF 3S35X 4LAJH 5FECA 4H25A 2ZOLB 1FZKA 4PJ7E 3U7YL 5F93C 3DROA 4FQLH 1A1NA 2C3GA 3M07A 4H8WC 1I7RA 4V1DD 3KDMA 1J8HA 3PGCA 4U31A 5EU4A 3B9KD 3SQOH 1M71B 1ADQL 2EEDA 5D93B 4LCYA 3IDUA 2VN7A 2VABA 3DTXB 3SGDI 5CCKL 4I0PA 2AEIT 4PY7A 1U91A 1JWMA 1U58B 1Y0LA 3GZKA 3MFFA 1AD9B 2HKFH 3HI6H 5HHNB 2CO7B 4KRPB 2Q3AA 5F6IC 1ZT4A 4I4WA 4GKNA 3U0PA 3LMJH 1JGEB 1E4XH 4X4YA 3WIFA 4XBPB 1IT9H 4JVPA 4YGVA 4JM2D 3MLTB 1BPVA 5IMKB 2DYPA 4XCFH 2IAMD 4P9MH 4CMMB 1PSKH 4PGBB 3CFBB 3FB7B 3VI3E 4PGCB 4YE4L 4FRWA 4X98B 1BQHG 1S78D 4GQ9H 1MFEL 1MAML 3I3EA 2CIIA 4BSWB 1IAIM 4KH2A 3VGHA 25C8H 1QTYT 4GXVL 1DN2A 3L5WB 3O2WL 4LIQL 3WLBA 3W5NA 5HGBA 1MPAH 1Q9KB 1VHPA 4MNQA 1S7WB 5JQ6L 4HWBL 3BVNB 2E7HA 2ZG3A 4FZ8H 4UV7H 1SYSB 3FAXA 3LKSB 4TVPL 5IG7B 3S36H 3TT3H 5FUCC 3WFCL 1FC2D 2APFA 1V8HA 4WHTB 1PAMA 3C2SA 4JPWL 1I1FA 3TVMC 5J13B 3ZDZF 4HC1A 1UA6L 5IHUL 3VCLB 5L0QB 3PABB 5BV7H 5D1XB 3QPQD 1VGKB 3LKOA 1PY9A 1L7IH 3LEXA 4JM2C 4Y5VA 3BZFB 4UBDD 2ENYA 1B6DA 5CJBA 3G04B 1EFQA 4OCYH 4R2GC 4PRAA 5TF0A 1QRKA 3VD9A 5B3NA 4HPOH 3BW9A 4RAUA 2YUXA 4X9BA 2OZ4L 5D4QA 4RCAA 3UYPA 3F6LA 3H6JA 4OQ1A 2GTWA 3C6LD 1KCUL 1IFHH 4CVUA 3NN8A 1KFAH 3RL2B 3EFDL 1F8TH 3W9DA 5J6HB 1YEIH 3VW3H 1JHTA 3D0LA 2VIRB 3HNVH 2X4SA 3IKCB 5DMGC 4OZFG 3IDMB 4JFOA 4OCSH 5DEZA 3LD8B 1GPOL 3IDIB 4P4KB 3TJHD 3R8BB 4G42A 1EEYA 4HDIB 2YPVH 3EOTL 3GI9L 4QXWA 2A6KB 3LS5L 3FB6B 3RWGB 4JFEA 3SJVB 1D3CA 3BGMA 1NC4A 4Z6AT 3RWJB 4B5EA 3QPQC 2YUWA 1XGYL 2APXA 1WITA 3WO3B 1INDH 3MRRA 5F3HA 4N8VB 3JWOL 15C8H 5MEOA 3JV4B 3P4OB 5K9OA 5IJVA 4ZUVB 2AJVL 1U42A 4POUB 1UC6A 4FTVB 2CLZB 1MJJA 5C3LD 5JIKA 3HLAB 3DSFH 2G75B 4QOKE 3DX9A 2ADGA 3RUGF 5FFLA 2W65B 4JVUA 1XZ0A 4U1MB 1T1YA 3M1BA 2WSKA 5J11C 4QOKD 3QO0B 3RKDC 2APBA 4YHIB 4BFEA 1LO0H 1OARH 1QSFB 2HMIC 5MENE 5AUMA 1FNHA 3I6KA 1NBZA 1NEZB 5DQDL 1II4E 4GO6B 1TITA 1GGYA 5D7LA 3PJSA 3MV9E 1J0HA 1CGVA 3G9VA 4Z7UF 5MEND 4FQ2L 5D2LA 1MVUA 3TNMB 4M6OL 1KTRL 4XBEH 2OCFD 2J6EH 4ODVL 4P4RB 1A6AA 3FN0H 2AKRB 3EYUL 1LO3H 3U6RB 1NBVH 2VZVA 4J3UA 5F7EL 5T3ZE 2PTTB 4DGVH 2E8YA 4HT1H 1U8PA 4WUUD 4X99A 1LK2B 4RA3A 3VD3A 2MQ3A 3V4VH 1U8MA 1QNZL 1W8OA 3Q3GA 4PJEB 1NBYB 4NKMA 5HDQH 3JTSA 5T3ZD 3U82B 4E41B 3LEVH 4YDIH 2QQQA 2AQ3A 1Z5LA 2D9CA 2Y36L 4GH7B 3JVGA 4F2MB 4LIQH 5DJ8A 3B3IA 3KPRE 2W0FA 2AJZA 4U6YA 1MCDA 3DX7A 5FM8A 1RZIB 2CDFA 5E70A 1T1WA 3QNZA 3MNVA 3CJJA 2P5WA 3EYOA 1KGCD 2CK0H 2MQ0A 3ARPA 1EFXD 1I3RA 2Q8AH 4YHZL 5CJXC 1ZMYA 2J5LB 3TYGH 1U36A 4OFKA 3CDFA 3KPQB 5FYKL 9CGTA 4OZIA 4PJGF 1AGEA 3MLZL 3R8QA 4AEFA 3ZKQD 3BH9A 5EULV 4PREA 2C4FU 3IRZA 4QWWD 4HSQA 5DLMH 2YC1B 3TA3A 2GW5A 3V4UL 2YK1H 2D0HA 3U9PH 2NZIA 1UJ3A 3I85A 3P9LB 4QRSA 3BKJL 3A67L 4HKZA 3C9NB 3FMGL 4GUPA 1DQDH 2P24A 4I18B 4PY8I 3QCUH 4N9GB 4R4FH 3PQYB 2HH0H 3QUZB 1UACL 1YY8B 4C54A 1C1EH 2K3TA 1NGXB 1MLCB 2AJSH 5SWSE 5FCUL 3ULUC 3KHOA 1HN1A 1CDCA 3SDCD 4K71B 4NRXB 1AE6L 1F3RB 3ZE0E 5EU3A 1R0AL 5JXEA 4LLVA 4NHCL 1A9EB 2NY3C 1QRNE 4P3DA 3O3AA 1EHLL 4LPYA 1LEKB 3ARYA 4PJ8A 2MCPL 1CQKA 2F54B 1OM3H 3QG6A 5EU6B 5SWSD 3BDYL 4JPIA 4OM0L 2GAZB 3L7FB 1T7VA 4U1SB 4MQXD 4U6XB 2VDPH 4AG4H 1QRND 4LEXH 3GSVA 5HYJB 4OB5L 5E5MA 4NM4H 5DJZB 5EZJB 2E9WA 5J9PA 2VDRL 5B38B 3O4LE 4NIKB 5C2BL 3OJDA 1JRHH 3FO0L 3H9SE 2UY7A 3T4YA 5MI0C 4G6FB 4BFGA 1FVCA 3QO1A 5EIQA 1VCAA 5F3BB 4O2FB 3EO9H 4W4OC 1IKNC 4WV1C 3IDYC 4JG0L 4M3KB 4MNGE 3ZSSA 5ILTH 2NY6B 2W9DH 2H26A 3GSQB 1CQYA 3F7PC 4LVHB 3PWVB 5I30L 3H9SD 1KCVL 1IQWH 2GI7A 2OS7A 5JLZB 1S3KL 2R1XA 1LEIB 4FQJL 3LV3B 4GMTH 2WWMD 4KQ4H 1NCBH 3CH1B 3BFOA 2X4TB 1WFTA 4JHAH 4EQ2A 5GZOC 2R1WB 2AQ2A 4PJIE 3TZVD 1I8KB 5DDHB 3IVKA 1EERB 5JMOC 3ZHDA 4JGMA 3C09C 4YXKH 1IC1A 4ACPA 1MIEL 4XB7A 4OF5A 1OAKL 3KJ4B 5DJYB 4FFWC 2FATL 1BJ1J 4OLEA 5E6YA 4WWKD 1O7SA 5FDWB 4MA8H 4FQIH 1NFKA 4LFHD 3TIEB 3BUYB 4K8RH 2CRZA 3HE6D 1CR9H 5JQHC 4HJJL 4OFDA 4HKXB 1RZ7H 4EI5A 2Y7QB 4C59B 2VDKL 2OTUA 2RFXA 5A2IH 1WZ1L 2Z92B 1C7SA 5KZCB 5GRUH 4Y0GA 2WWMC 1YPZB 2FEDD 3BJLA 5EZLA 3WFDL 3BE1H 5IMOB 2W60B 2EXWD 4IRJA 1VFAB 2HFTA 1K85A 4P2RE 3ES6A 4DGYH 5DS8A 5ADPL 5ICYA 4AQ1B 1PG7L 3G6JE 4Z5RA 5INDB 1U3YA 2VDNH 5ELIA 3ZE2F 1V3LA 3OBAA 3EFFA 5C92A 2I07B 3QHZL 3SN6N 1AKJB 3SPVA 1ORSA 1YN7B 4NO5B 4OLZH 1JNHA 2J4WH 4U6HA 4YHOH 2R4RL 5DWUL 5EC1B 4K9EL 2L7UA 4YXLL 1XFPA 3HE6C 4RZCB 5EO0B 5CBAA 1WZMA 4DKDC 3ESUF 2BVQA 3QIWB 4Y4KD 1CTNA 2AK1H 2KH2B 5MP6L 2BNQB 1DBJL 1FO0A 4PV9B 3OKNB 4OD1L 4JRYE 2BFVL 3BKJH 3QUYB 5LG1A 1CIUA 2EXWC 1XIWD 4PJXF 3GJFB 1UM6L 4X7SL 1I8LC 2X05A 3PV6B 5C0NC 4NDMB 2UVFA 3P77A 4P46A 1JFQH 2H45A 1MJUL 4V2CB 2Z31C 5IIEB 4JRYD 2EE9A 5C0CE 3PIQA 4LCIH 1FYHB 1FN4B 1U3ZA 3B8SA 3OAYH 3MV7B 1F11A 2XNAA 1EHLH 4C57C 5GZND 1ZLSH 2MQCA 2E9BA 5I0DA 1CFVH 3CSYA 4HPYH 1KIRA 5C0CD 3CDGB 1JGUL 4JHZA 1CTOA 1KJ2A 2HLAA 1MJ8H 1B4JH 1EH9A 3SKJL 3H9HA 4POZD 3RWEA 3VI4F 3JV5A 4UT7L 5HYSA 1JPGA 4KRPC 2DKSA 4PJHF 2AEQL 4MSWA 2ERJB 3MV8E 3K1DA 4HF5L 4TTDC 1I1CA 3CLEH 1Q9LB 5TDNA 4OLUL 3ECBA 1A0QL 4NQXA 5GSRB 5HHPB 3JV6B 3LN5A 1EGJA 2LU4A 3P4MA 3VXMA 3QG7H 4KZEH 2NY5C 1IAIL 4OLWL 3QWRD 3D1MC 4M7JL 2YZ1A 4X9FA 5FYJU 3MV8D 4APQC 1P4LB 1E4WL 4LLDA 4Z7WE 5EIVA 1TLKA 4O51A 1XR9B 4MD5B 4X7TB 2R4SL 4GAGL 1OAQH 1HK6A 1DLFL 4ONOA 3SQBA 2XTJE 3QDMB 2H9GB 5IB5A 1UXWB 2DM4A 2G2RB 2FZ3B 2N1KA 2WBJB 1LP9A 1CFQB 1MIEH 4HV8A 4QRRB 3O6FB 1Z3GH 5I74C 2Y23A 4CAGA 2LE9A 5I1CH 5JDSB 5L0QC 5DJ0A 4NN6B 4P48A 2BY2A 2E7CA 5D1XC 3W39B 1MEXH 4JVWA 4MLSA 3KYNA 2B1AH 3QULB 4H26B 4NP4H 3ETBF 3CK0H 5EH1A 4MA7H 2NXYC 4YHYB 2VDKH 3HFMH 3PWUB 4I48A 1N8ZB 1TNNA 1MOEA 3BZ4A 1Q9OB 4WW2C 1FNGB 4QRPB 3WUWA 3TJEL 3DRTB 3SDDC 1ZKAA 2XZCL 4JFQB 2X1PA 4QHMA 2XN9A 4UDUB 4H20H 2VLLB 1CD1B 1S5HA 3H0TA 3K7UA 3V5KB 2VL4A 4MD0B 1OTUD 1U8QB 1CGYA 1IGIL 1UVQA 3L3OB 2DQGL 1BAFH 5DVKA 5I15H 2Q6WA 4JKMA 4I77L 3FONA 5FUOH 5HI5D 1KENL 1Z9LA 2X4RA 3TBWA 1JZ5A 4MXWH 3ZYOA 5KBNC 1OCWL 1IEAB 3RWDA 1UYWL 1YYML 3CMGA 2ADFL 2D0GA 3VFGL 5D7JA 2GHWB 1MHEA 3SE8L 5HHQA 1ITBB 4CVZA 4QRUA 1NCAH 2DTML 4OCWL 4HD9A 1LEGA 1E28A 1NFDF 5I6XB 5ID0A 5GS3A 4GG8A 1T1ZB 4R4ND 2NY2D 4JN1L 1ZWIA 2Y6SC 4LFHG 5FV2A 2GJ6B 3CVIL 4N0YH 3V6BR 2V6HA 1EUUA 1QLEL 3PHOA 5DQ9A 4X9GA 5FYJH 1CGSH 3MCKA 3QEQE 2C1OB 2NX5E 2OI9B 3H7BA 3V5DB 3MLXH 5I19L 3PWPE 4L8CB 1WWWX 1JNLH 2E9JA 3SE9L 4IIQB 5HI5C 1ND0A 1RUMH 2VITA 5HDBE 3IYLW 4C56E 3X3GH 3GK8H 3HAEB 3VFNA 1EO8L 4K94C 1VFBB 4FG6C 3QUMA 3QEQD 1CU4L 1JMXA 2NX5D 4BSJA 4ZOEA 2ESVB 3PWPD 4X6DB 5JHDB 5KSUB 4YNYA 3VWKA 4C56D 1FZMB 1IC7L 2QSCL 4N0UA 3U7WL 3TBYB 5DK2A 5CILL 2HN7A 4RX4D 4GRLB 4OFIA 4PRID 5DJCB 3MV01 4PJ9B 4XGZB 3CFKA 1FNAA 4XMLH 1B0GB 3QDJA 5FEBA 2NY2C 5J89A 1DVFB 5KN5B 3MREA 3T04D 1HKFA 3QQ9C 5C0DA 4XPHL 1T7WA 1IAIH 2DQIL 4MAYA 4RRPG 4WW1B 1I9IH 3LY6A 1HQ4A 3HR5A 1IAMA 5AG8A 1KC5L 4Y4FB 1K6QH 1IZKA 1IGJB 2XZQH 1IM3A 5EC2A 4KUZL 4JKLA 2DJ4A 5D8JL 1DLFH 3GMRB 5JMRA 1H5BA 5BRZE 1FRGH 5E6IC 1J05A 1E27B 4G9FE 3WJJC 3O2DL 1MCFA 3IJSB 4K23L 1YJDH 2NXZB 1RULH 3ARUA 5L6YH 3ZT5A 4Y2OA 4BA8A 4EUPB 5BRZD 1G9NC 2J5LC 3VWJA 4NBZB 5FUZL 2IPTL 3BKCH 1QHPA 2MHAB 1BVLA 1B2WH 5K9KB 4G9FD 4CMHB 4QXUL 3RWCB 5SWZE 2JE8A 3SKNA 2FGWL 1SBBA 4M1GL 5EG6C 4EI6B 2C5DC 5IMLA 4KTDL 2HWZH 3FQXB 4GAFB 4OGAD 3UJJL 5DD5L 2VKWA 3QUKA 1FSKB 3M17A 1E6JH 1GGCL 1BJ1H 2AJUL 4S2SB 1U41A 1ZLUK 4NKOA 1OSPH 3GSNA 4OD2B 5SWZD 1WBYB 2XZCH 4GBXA 3MV11 1IKFL 5ESVB 5AZEL 3MRFA 4XPFL 1CDUA 3BI9X 3RVVC 1FO0H 1G7MB 2HJKA 1U8KA 3GMOB 3VE0A 3QUZC 2VXQL 2JCCA 1ZHNA 2JK5A 3PWNA 2ARJQ 4RBPK 4TYUA 1ZA3B 4WUKH 2EDTA 3HN3A 5D96B 1N64L 1ZVYA 3NFSL 3QHFL 1TQCB 5CBEB 5GGQL 4HUUA 4NKIL 1A6VL 1YYMH 4EZMA 3P0VL 3FQUA 2DJSA 3BIKB 4L4TB 4JQVA 2NY0D 3DI2B 4Z7NE 1A9BA 1J18A 4PLJD 2JKXA 3CZFA 3DVNB 5GJTL 5C0RH 3BGAA 1H8SA 4OGAC 5B8CA 3LKPB 4IHOB 1F6AA 1RI8A 4NO0B 4HXAL 4P2QB 3C60A 2P5EA 1FVEA 1TIUA 3QUXB 5EZIL 1EHNA 5ETUB 3D25B 2UWEF 2IALB 1MJ7L 1CBVH 1KJ2H 1U95B 3V9FA 2E5EA 4ZYKA 4LCCB 1GC1H 1NC2B 1FQ9C 3CSBA 1R24B 1F4YH 4Q9BA 2FX9L 5CMAB 5T1KA 1FL5A 3G6AB 1RIUL 5BCAA