3NCBB

A mutant human prolactin receptor antagonist h180a in complex with the extracellular domain of the human prolactin receptor
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
206
structure length
206
Chain Sequence
b'MLPPGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolactin
publication title Two Independent Histidines, One in Human Prolactin and One in Its Receptor, Are Critical for pH-dependent Receptor Recognition and Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/hormone receptor
total genus 37
structure length 206
sequence length 206
ec nomenclature
pdb deposition date 2010-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ncbB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ncbB01
3VD9A 2X4NB 5BO1H 3CXDL 3GUTB 4K7FA 1BP3B 4DJMA 1RUQL 3DETC 3VFSB 4DKAA 4PJ8D 3F7YA 3PXJA 4K3JH 2ZUQB 1RUQH 5JOFA 1QQDA 3GHBH 5C3TA 3QFJB 4M1CD 5CIPB 3FB8B 4GRWH 3QUYA 2JJWA 2HWZL 5AYQA 1DFBH 3UYPA 1M05B 3MUJA 2HWZH 3IDMB 4F57H 1A5FL 2O93L 1OTTD 2IAMC 4KDTA 5SX4I 1D5ZA 4ZOCA 3T65A 1MHHA 3FRPG 2ORBH 4HPOH 3E6FB 4GKSA 3JTTB 2G75B 2R23A 3D18B 2Z9TA 3HPLA 4S1RL 3QAZB 4HDIB 2C7UA 4JFFB 3G9AB 1GGIL 2D0HA 4FQLL 2YUWA 4J1UB 1DLFL 5BRZD 1JWMB 3MC0A 2NMSA 2EDEA 4XNXH 3KPLA 4PJ5A 1KJ2L 2EDFA 3IETB 3LD8B 1ZMYA 3TBTA 1EA9C 1TJGL 3REVB 5FUZH 4PD4J 5A2LH 1EK3A 1JJUA 1S5HA 4N0UE 5HYJE 1MIEL 1P9MA 5ILTH 1P7QD 2WUCL 1C5DB 4QXGL 5C9JB 3LRSA 2ED8A 3D25A 2EICA 3LQAH 3RZCD 4DAGL 3O6ML 4QRSB 3BZEB 4L8CB 1BFSA 3UZQA 1UKQA 5HPMB 4DAGH 1G7MA 4KKAC 3O6MH 3VH8A 2ARJQ 1N59B 1J0IA 5ID1B 3SCMD 3AMKA 2EIZB 1UT9A 1MRCL 5DQJA 1ZK9A 3MOBL 1UADC 3CFCL 3S34H 3GKWH 4Z5RB 1KF9B 2DB8A 3DURA 2VZ1A 5E4IA 4K55A 5IEKA 4Z7NE 5F89B 4ZDHB 2HLFD 3JWOC 2WQRA 4HPYH 1B0WA 4U1IB 1UVQB 1NFDB 3I9GL 1U0QA 1BAFH 4I4WA 2P7TA 4BKLB 4XCFH 1T2JA 3B9KC 3I9GH 3PNWA 2GQHA 1R3JB 3IDYC 2AJUH 4GW1B 4DOHE 3N9GH 2PR4L 3HCVB 4M6OH 3UX9B 1HDMA 3PHOB 3VU2A 3I6KA 3BDBA 2FYYA 4LCCA 2FJGA 2KKQA 3SGEH 5BS0B 4O5LH 5HHXL 5CGYD 4NZUH 5IGXL 5D7IB 3RWCB 7FABL 1CFNA 1B0RB 3OGOE 1FVDA 4BM7A 2FEEI 4FZEH 1WT5A 1G7JA 4XI5D 2X41A 4R7NB 2EDXA 4KJQC 3HB3D 4HC1H 4R90L 1HKLL 4R6UA 4F7CB 5HHPA 3UO1H 5C09B 4P4KC 2OI9C 1H8SA 1JZ4A 3CZFA 3B3IA 2P44B 2OL3A 3S98A 2PTUA 1I9RL 4IMLB 3ZE0E 35C8H 3IS1X 5A40E 5D1XB 1I9RH 1U8HA 3UTOA 5TE4L 4FFYH 5A16B 5CGTA 2H2PD 3OXSB 5TE4H 3P0VL 3HG1E 3MJ9L 3WFDH 4ALAL 2E6QA 3P0VH 3SDAD 5ABDE 4ALAH 1AR1C 1J1XH 4G43A 1K3IA 5DYOB 3NCYS 1IC5L 2Q86A 3ZE2F 1IGFH 4Q9CA 2CDFB 4HIIA 1OTUD 4OBRA 3GBNH 3PWVA 2HJLA 4ZPTA 4KK9D 4BSVA 2EEDA 3C08H 1QA9A 3O11A 5DSCA 5T3XL 2FH6A 3D3VE 3D39D 4NJAH 4RGMC 4MNQB 5T3XH 3ESVF 3L3JB 5JW4R 2FX7H 2AV7B 3LEYH 5IR1A 5C86A 3IDYB 2V9RA 4OZIB 3GMRB 5JOPD 1ETZB 2Z8SA 5EO0B 6FABH 3FO1A 4N68A 4ZFOL 4ZPVB 1AXIB 4P4RA 5EUOF 3L5JA 2R2CA 2V2TA 4R97B 2FHCA 4K71B 1T66D 5D93B 4XP4L 3HMXH 3QCVL 4WGVB 2R15A 2R69L 3LKSA 4MLSA 2A6JB 1O7VA 2OTUB 5EC1A 1NEZA 2R69H 4HS3B 5I1HH 2A77L 1U8MB 4M7JH 5TE6L 3QUMH 3MRGB 5FA4A 5E9DB 3S3PA 3CVIL 4TRPL 2JJSC 5SX5H 4MJIA 5TE6H 4TRPH 2BSSA 1KCRH 4NNXB 4PJ8C 1ULVA 2VSCA 4QOKA 43C9A 2DQIH 4YR6B 4M1CC 1DQLL 1FG2A 1G9NC 3V6ZB 4LCYA 2FIKA 4AEEA 4P2RA 3L1OL 4QHLA 2OTWB 3QUZA 4LLDA 4WENB 1OTTC 2VC2L 5F97E 2WINB 5JHDE 3NIDE 3MNVB 1MCBA 4I48B 3GSOA 4RISL 1QACA 1KB9J 1DN2A 4XXDA 5H94B 3RX7A 2R1WA 5KBNC 3QO0B 4Y1AD 3QNYB 3TA3A 1WICA 3NH7L 1CDYA 2MPAL 1JRHL 3BESR 3NH7H 2MPAH 3LQZB 1FYTD 4OFYA 1TLKA 3MV8E 2WBWB 3EZJB 2FECL 5J7CC 2Y06L 5J12B 5MEND 1BBJA 1MI5B 1QFWI 3G04B 2R4RL 3QRFM 1BVKA 3X14A 1I9JH 1TDQA 2J6EL 3JWDC 4YXHL 4MA1C 4AENA 1FRGL 5FGBC 1P4BH 1FN4A 4PGJA 5CJXC 2HKFH 1NUDA 1QSFB 4DK3A 4HBCL 5I1KH 4LEOA 3RZCC 3MA9L 5JDJA 4NCC1 2E9WA 4MA7L 2PW1A 3ARPA 4LASH 4U6HA 4AIOA 1OAZH 4Y4KB 1YMME 4FQJH 1VA9A 3U36A 3SCMC 5GSRA 4OD2A 4OSUL 4P9ML 2XQBL 2X9WA 1JWSB 1VGEL 3Q1SH 5EU6A 3VGGA 4RDQF 1IAKA 2PCPB 3MJGX 3J7HA 2HLFC 4LCWA 4CW1B 1NCBL 3FO0H 2WBKA 5MP6H 3HNSL 1CDBA 5BVJB 3BH8A 5EZIL 1SYSA 3UPRA 4MCZA 3NAAH 2FGZA 4PJ8B 4UT6H 2XWBB 4BQCA 1F4YL 3RX8A 3AGVA 3RUGF 2RCSH 5I1EL 1S7UA 5L88H 4DZBB 4XPAH 8CGTA 4PRAA 4XNUL 1JGVH 3L5XH 1QG3A 2WM0A 3EO0A 3U0PA 4BH7A 4UNVA 1B4JL 1MRDL 4GLRI 1J87A 5ESQA 1E27A 1I8IB 5C0CE 3MR9A 2AABH 3WD5H 2GAZB 2RBLA 2CJUL 5CGYC 3MXVL 1CFQA 4ELKA 1AO7D 3KPPA 5F6IC 4YHOH 4Z7UB 3PL6A 4G9DA 5KS9F 1SJEA 4ISVA 5GIRB 2ERJC 3EJYD 1CVSC 4XI5C 4PRPB 2ZPKL 3WHXA 2VL4A 1U3HA 4KWUA 4ODSL 1D7FA 4UDTA 3HB3C 3NZ8B 3WIHL 5BRZB 2JB6B 3CFIC 5DRWA 4X9HA 4JPIB 1OD7A 3HMXA 3FMGL 1IEBB 1WF5A 3FMGH 2QHRH 1OAQH 1JYVA 3IDNB 3QIUD 1TQBB 1YY8B 1RMFH 1RUML 4JRXE 1R5VB 3SQBA 1MQKH 3MLWH 5CHNB 1RUMH 3MBED 3GSUA 2JKXA 1NCAL 1FE8H 2OM5A 1U8NB 3HZKA 2H2PC 2JIXD 4OD3H 1PZ5B 2DQDH 4EUPA 1M7DB 1SQ2N 4YNYA 4UIKL 3HLAB 3RHWF 3RZCB 2VZTA 3TV3H 4CN6A 1YEHH 4LLWB 4X8XA 1GJIA 1XGYL 2NXZD 4HS6A 4RWYL 1M7IA 5D8JL 2BHZA 4J4PA 4I0PD 3HZMB 4WTXA 2FH8A 5BW7C 1OTUC 1X4XA 4G6FB 4AM0B 1TJHH 2GK2A 3M07A 4HF5H 1VFOA 4HJ0D 4QRTB 4KK9C 3DXAE 4HQQH 3RGVA 3C6SA 1YDPB 4OT1L 4KRNA 4PJCB 2OR7A 4MWFB 4OT1H 3BI9X 1A2YB 5K9KA 3WNMA 3T77B 3CSYA 1JGDA 1U93A 2A0LD 3JWOH 2VL5B 3F62A 2YPLA 1J9CT 1MUJB 1X5IA 4OZGB 3EO1A 2P5WE 2GUOB 5IB3B 4KKBD 1EEQA 4ZNEA 4MSWB 3KPMB 3CDGA 4U1NB 5C1MB 5J9PB 4JB9H 4G42A 4RMSA 1L6XA 3VXQA 2LU4A 2AW2A 3LZFH 4YZFF 2YA2A 3R8BB 2P43B 3VI3E 1T66C 2C3XA 3OPZL 8FABA 4WO4D 3HA0A 3BUYB 4QF1A 1BFOA 3PGFL 1X5AA 3D2UA 4KXZH 4HK3J 2ZCKL 4Y5VB 5T3XE 2X10A 3M1BA 3BXNB 1T1WA 2ZCKH 1DBBL 1FL3A 3ZDXF 4EVNA 4HUNB 1DUZB 1ZVSA 5FECA 4P99A 4WNQA 3WFHA 2QADB 3KPRB 3DIFA 3PWPD 3SHSA 3BIBX 3W0WA 3MRLA 4E41D 1UEMA 4YBQD 2C3HA 3OKEA 1WTGT 3IFLL 3RPIA 1ZGLB 2HFEB 1MCPL 4YO0A 3LEXB 4M03A 4U6YA 3WO3B 2AJVH 1HXMB 3UTSB 4QYOA 5DXWA 5HHOB 5JPNA 1MAMH 3LIZH 2XKNB 3ULVF 5MEPB 3MLVL 3SDAB 4L4TE 2CUHA 3N0PB 5DJ8A 5ISZA 4WFEE 3C60A 3BGFC 2HT4D 5IHUL 1HNGA 1OAYL 2HFFA 4UILH 1H5BB 1P1ZA 3FT3B 2BNRD 3QQNA 1TPXC 2WZPD 3VFMB 2YXMA 3TO4B 1EAJA 1IM3B 3BAEH 4H5SB 4IRSA 3VWJB 1RJYA 2VLKA 4LU5H 2WMPA 4V2CB 3OSKA 4MDIA 4ZAKB 4HUUB 5HTSA 2NY4B 2W59A 3FT2A 4RGNB 4DK6A 2JE8A 1A21A 2DTML 1JBJA 3WXWH 5D7JA 1YEFL 2DTMH 3B6SA 4KMTL 4MLIA 5F1NA 3AS1A 2D03H 2OK0H 3MNWB 1IMHC 1T4KA 3DX8A 5HI3D 3HUJF 1Q9WB 2AJXH 3KNBA 3HAEA 1RULH 5EBMB 4MJ6B 4OI7A 4XWGL 3KS0H 3GSVB 2K3TA 1D3CA 3AROA 1DBAH 5GGVH 2E7LC 3G5YB 2ICEB 5IMMA 1IAIL 2BVEA 2QTEA 2XTJD 1J8KA 5MHSD 4Y8DC 1KTKE 5CJBA 4DFHA 1LVEA 4G5ZL 3T0WA 2VDRH 5JMOC 5D1ZA 4JKPL 1CDGA 3UJIH 2ZUTA 3MA7A 3RWEB 1BBDH 1I8KA 1QVOB 4M1DH 4GAFB 2V7NA 1IQDB 3QG6A 3IJYB 4WFGD 1JHTB 2HG5B 2IQAB 3PGCA 1IAMA 3LKQA 2OX5A 2GT9B 5KS9A 3QUXA 2W65A 1HHGA 5F8RC 4FP8L 1LO0H 1B2WH 1G9NH 3LPFA 3K2UH 1BVLA 1RZ7L 3KHQA 1JHLH 2Q3ZA 5DC9B 1RZ7H 2R29L 2ATKA 4A6YL 3EJYC 4OV5B 1DQML 2F53E 2R29H 4HUXA 3ZO0A 3E8UH 2BHUA 1FYTB 2Q8BL 2YRLA 2ZSVA 4J8RB 3PWJB 2EKJA 3OXRB 2VO5A 1EEYA 3TBYB 3U30C 3QIUC 5DJ6A 4CMMA 1DL7H 1G6RH 1J86A 4BQ6A 4K94C 5TH2A 3QJHB 4ODUA 3MBEC 5JLZB 1KBGL 1ORQB 1M6OB 4NQDB 4WEBH 1XGUA 1J8HA 1F4WH 5GHWH 5LWYL 2IMMA 4NRXB 4JZNB 5AUMA 3K0WA 1FO0H 3JWDH 5ANME 1HIMH 1OAXH 3P11H 4GJTB 5C8JB 4XNQA 1B88A 5BS0E 4DCQA 1Q94A 3BZFA 2NXZC 1EO8H 1BX2A 3L6FA 4QTHA 3VD4A 4Z77A 1UM6L 3RTQB 4LLVA 3KYMA 43CAA 4I0PC 3ULUD 2VTFA 4JAMB 3W9EB 4MJ5A 1DBML 1XCTA 1MVUA 4H8WH 1IBGL 4HJ0C 3D69A 3QWOB 1BJ1H 1JMXA 3TYFB 5BZWA 4Q9RH 1IBGH 1MIMH 2QKIB 4EDWL 5GRVL 1CTNA 4M4PA 4C56A 3NFNB 1MOEA 4XPFH 1Y6KR 5GS1B 1K4DB 2W07A 4OCXL 2A0LC 2BY0A 3QNZB 4FXGA 1LO2H 1RK1B 3VXRA 2VABA 2P8LB 1U95B 4FTVA 5IT2H 4KKBC 2ZCLH 4J3UA 1MAJA 1JUFA 3TC9A 1CGUA 1T80A 2BRQA 4PTUB 2OR9L 4YHPB 3TN0B 5DHVH 4PV8A 1CL7H 3VXPA 1MPAH 1CLOL 1FAKT 3I02B 3RVXD 4WI7A 4OLXH 4WO4C 1RY7B 5I18H 1DSFL 3EO9L 3NA9L 4CU6A 5SWZE 2VAAB 4M7LH 3EO9H 1YQVH 4JY4B 2YPVL 4M6MH 1UM4L 4IJ3C 2YPVH 3IKCB 4BZYA 4EQ3A 5B4MD 2WWMD 3BKJH 2VXSH 2JCCA 3CU1A 3KAAA 1JPGA 3BZ4B 2ESVB 1H3VA 4Q6YA 1TTGA 4F8TA 1D5MB 3R06A 4YHZH 1HK6A 1BWMA 1RZJC 2LE9A 3RWFA 5KSUB 2JIXB 1DANU 4JO2L 4XAKD 2ICES 2W0FA 4JE4B 2FATH 3WFBL 1NAMB 1LD9B 1I8LA 2DD8H 5I1AA 3GIVA 5E5UB 3SE8L 2NXZB 3P30L 2AAVA 2XRAL 4X6DE 5E56A 5EU3A 4M43H 1T7ZA 1WZ1H 2HT4C 3BW9A 5FHBH 1FCGA 3F58L 2F54B 1CCZA 1F6LL 5E8EB 2BDNL 1FVEB 1GAFH 3D85A 3FQRB 3BP6A 4PREB 3RVWD 4YDLC 5FO9B 1UACH 3ROOA 1UJ3A 1KCLA 5E8DH 1HNFA 1NMBH 3HUJA 4HS8L 3TT1L 1A4JB 2E8ZA 4JANA 4JFDA 1PYWA 3NPSC 3QI9B 4JFOA 3VXUA 2NY3B 3LH2L 4O2CB 4PRID 3TYGL 1ZLUH 5D5ME 5D7LA 3PHQA 4M1GH 4D2NA 5I1JL 5HI3C 1FVCA 4XP5H 4PRNB 4PRHD 4MZ2A 5I1JH 4PJFB 2QV2A 2BVPA 1U42A 1FO0A 1Z0NA 2MQ0A 6CGTA 1D9KA 1YEGL 2VE6A 5FYJL 1AJ7L 3FB6B 2B4CC 5JXAL 1KGCD 3RQ3A 2PYED 2XTJC 1AJ7H 5HGAA 4NKOA 4XBPB 4G6JL 3R4DA 3FZUD 3OB8A 4HXBH 3AS0A 1S9KC 4Z7NF 3CLFH 1INEH 1MI5E 2DLHA 1FV1A 3BKCH 3GMPA 4NT6A 3U48A 3N85L 1W0WA 3B5GA 3QEQD 4K3EH 4LARL 1QLFA 3CZJA 4QHUB 5E5RB 3DI3B 4LARH 5F7EH 2VYRE 3U7AA 1QSZA 3L7EA 1TNNA 5DUPH 1YPZE 4RFEB 1UKSA 4W4OA 4O4YL 1GGUA 1HH6A 1BQSA 5FUOL 5HD8D 3S36L 1RZFL 1KTLB 4WHYG 2EC9U 5EU7C 3VH8G 2VDPL 3PP4H 1IGYB 5EOQH 5F9OL 1T2QH 3DX9B 3SGDH 5INDB 3OF6A 5I74B 3U46A 2Q8AL 1CIUA 2XFXB 3RY4A 1QRND 1VDGA 3MRBA 2ED7A 3TJHD 3V5KB 2BNRB 1NC4A 3BPCA 1UXSA 4KPHL 5TPWH 3MJ7B 3VGAC 4HX1B 4KPHH 5T1KA 5FF6A 3ALPA 4F9PA 1WBZA 1Q0YL 1BREA 4L3CA 3VWKA 1GPOL 1J11A 1TFHA 4Y19D 2IAND 4H25A 1U8LB 3QO1B 4YBLC 5IVZA 5E4EC 3RWGA 4JG1H 3QP3A 3ZE0F 1FSKB 4RAUA 4V1DA 2V5RA 5E6IA 5F7DB 4E5XB 3O3AA 2YUZA 3QQ4B 4HCRA 1P7KB 1VESA 3H2WA 1V7MH 1IZKA 4FHBD 2VQTA 3A0OA 4NM4H 3VW3L 2EYSB 3S5LB 3ZDYE 4J3VA 3ULUC 1RSFA 1EXUA 3VW3H 1TZGL 2XOTA 1T1ZA 3S8WA 3H7LA 5E94A 3ZL4L 5BRZE 1QD0A 4NWTL 2G5BB 4XCEA 5I6XB 1AGDA 1K8DA 3ZL4H 2ICWI 4R9HA 4TUOA 1Y0LB 4WRLA 4WDIB 2G9HB 3EJZD 1IAIM 5JTWA 4WU7A 3GK8H 2X1QA 4LHUA 4U3HA 4M3KB 5EZJA 3BN9D 3EFDH 4O2EB 3MRMA 4YHLH 5ESVB 2KQMA 1E6JH 3CC5B 1XGPB 5I1LB 1TVHB 4JFXB 2YBRA 5D70H 3VFWA 2EKSB 3SE4A 1RHFA 1F97A 2VLMD 1E4KA 4K3HA 1KXTB 3TVMA 3ARDB 4X0KB 4OFIA 4NDMA 3TO2B 4D0BB 3RVXC 2BJML 1NLDL 5ALCL 1G7LA 4I3SL 3KYKH 5J89A 1NLDH 3BGMA 5DVOA 1MSPA 5HYQA 2YRZA 1UFUA 2W38A 2AP2A 3H9YA 5I76B 4L5FL 3C6LA 4MD4A 3GSNH 5CP3A 5CEZD 1M71B 1ZLVH 2DLTA 2H45A 4L5FH 5FEBA 4YHNB 4XMLL 3RP1A 1N0XL 5HY9B 5GRXG 5B4MC 2WWMC 4XMKL 4XMLH 3V9FA 4GSDL 1F6FB 1KENL 2Y72A 3BPNB 3KWWA 4GG8B 1E4XL 4JZOB 4XMKH 3P0YL 4HLJA 1YN7B 5DA4A 1E4XH 4RFOL 3KVQA 4BSJA 2IADB 4OZGE 1KCSL 4HLZH 5I2IA 1CS6A 3PQYA 3QG7H 4RFOH 2DBJA 4MB4A 2PF6A 1R5WB 5GISH 2V6HA 1DLHA 2FGWL 1AFVL 1CVRA 4K94L 3GSQA 2J5LC 1AFVH 1TQCC 4L4VB 4HKXA 4U1GC 3KDMB 3VFUB 3NIDF 4M93B 1JWUA 3BSZH 1NEZG 1FNEA 1MVFA 4J3SA 1HI6B 2DM7A 2VXQL 3MCKB 4LLMB 3RVWC 4P2QB 1HOCB 1QOKA 4TVPD 3EYFA 2VZOA 2X1OA 3SO5A 1XF2B 5E5MB 4YPJA 3PV6A 2HN7B 3BKML 4AG4L 2XZQL 3KXFB 3SKNB 3BKMH 4JRYD 3O3DA 5LGKA 4OLZH 1CD0A 4GH7B 4JGMA 3H9HA 1JPTL 1CXFA 2X7LA 4KJYA 3HRZA 3H9ZA 1HEZA 3VDCA 5J1TC 1OAUL 4RX4D 4HV8B 3ES6B 3MUGA 3ARUA 4M7KL 2DQGH 1QKZL 2D31A 2NLJB 4KRMB 4H26B 3UXFA 1IKFL 4M7KH 5IK3A 3QH3B 1DZBA 1U8OA 1A7BA 2AK4D 4BUGA 1F58L 1JRHI 4FA8A 4HKBB 3IF1B 2OP4L 2BSRA 5DEFA 3FZUC 1A6TA 1KLUA 4KVNH 1AQKH 3NA4A 2OP4H 1S78D 2FECI 2VMFA 4NGHL 4ONHB 4DN4L 3FKUS 4GS7B 1EFXA 4ENED 3D39E 1AI1L 4M5YL 4RGNE 2VSDA 4DN4H 4NGHH 1HQ4A 5HGHA 1FFRA 3SDDB 4GRLD 3V4PH 1GOFA 3GBML 1FPTL 5FK9B 1SJHB 4JO3L 4F7MB 5JOPE 1ZHKB 2XA3A 1RPQA 5F9DC 4OI9A 4OLEA 4LSPL 1FGNH 5HD8C 5TDPA 3BP4B 3D5OF 1IGJB 4NZTH 5HYSA 4LSPH 4FQXD 1RZJL 4PJGB 1JPST 1K4CB 4MAYD 2FL5A 1RZJH 3MV7B 1RIUH 3VXMD 1UG9A 4PYHA 1AR2A 5E00A 4ZYKB 5KAQG 4DKEL 3DX6A 3TJHC 3VFOA 5M7QA 2X6MA 3G6JE 5CSZA 3L5HA 2PW2B 1T22A 5C2BH 5DI8B 4OIBA 4ZOAA 4E42A 4OTXL 5I19L 1EHNA 4R2GB 1MHEB 4NHCL 3PIQA 4UDUA 1Q38A 5CJOH 5I19H 4DWHA 2UZYB 1FGVL 3UTTD 1WBYB 5CJQH 1MCJA 3F7RA 5IMKA 1JN6B 2F5AH 5IJVA 5JNYA 3VA6A 4GKZA 1S7TA 2UZXB 1LO4H 1BJ8A 4G80B 1ZWIA 3RHWK 1XGRA 5D7SH 4XAWL 3BN3B 4G8FB 5ID0A 4LNRA 1RZ8B 4Y1AE 2A1WH 5C0DB 2R0LH 5I1CH 4O02L 3D3VA 4KFZC 4PJHE 1FYTE 2BVQB 4PG2A 3S4SB 3FJTA 2FBJH 3VD7A 1KB5B 2IFFL 3RAJL 2FSEB 4NQSB 4KH2A 3LKPA 3MUHL 5MENE 3TF7C 3GSRB 2CLZA 3EJZC 3DX7B 2B4CH 4WU5B 5F8QC 5ACZB 4YEEA 5KVFH 1NCWL 5B38B 3BN9C 5FDWB 3WUWB 4P3CL 4LKCB 1NMCC 5AYUH 4PD4K 3KS0J 4EUPG 1S3KL 5FM4A 1H3TA 2PYFA 2FJHB 4JFQA 1KN4L 3CSBA 4MHHI 4TYUA 1HHHB 1MRFH 4LRNH 4D0CB 5D1QB 3VGEA 4OGZA 2BNUB 5F3BA 4NHUA 1LO3H 1P2CA 3VI3F 3AAZB 1A9BB 4K9EL 2Z92A 3ABZA 2OYPA 3GRWA 3VFNB 5AAWA 4NO3A 4R26H 3DBXB 4D8PB 2Y07L 1U8KB 5BV7H 3OAZK 4QY8B 4GT7A 1T0NA 1VADB 3X11B 1FNGB 4PG9B 1L4IA 1UZ6E 4MQ7A 3FFCA 5EU5A 2E7BA 2BNQD 3W9DA 4JO4L 4OI8A 3KPNB 1IC7H 4L8SC 3JVGC 4JO4H 2W9EL 1MJ7L 4X80L 4Z7VA 1TCRB 3D9AL 1A6PA 4O2FB 1NDGA 3NMEA 5L6YH 3MV11 1N8ZA 5D71L 3ILPB 1YMHB 3L5IA 1Z9LA 1ZE3C 1XIWA 1SEQH 5C0BD 4AL8L 5T5NG 1IVLA 1GGCH 2GTZB 3H9SB 1HHKB 1UB5B 4OF3A 2QBWA 1OP5K 1KPUB 2VDNH 4JM2A 1JV5A 1KV3A 3SKOB 4Y4FD 3VFGH 5C6TH 4NP4H 3QDGB 3ROLA 1HWHB 4P5TB 3ARBB 1AO7E 3MLUL 2CXGA 3H3KA 1NBZA 4X5XA 3UROR 1E28B 4PRBA 4AEHH 4QRQB 4NFCA 1JFQH 1FP5A 3CK0H 1MJUH 3ULUL 1YY9D 1WITA 3VGBA 2G60L 2NX5D 5DS8A 5F96H 4OLWH 3ULUH 3DRQB 1S8DA 3SY0B 2G60H 4XNYL 4XGZA 3W5NA 2ESVE 1PKQE 4XNYH 3W81A 1KJMB 2MCPH 4TNVF 1QSVA 4G9FD 1YEIL 2VOTA 1RHHA 4QT5B 1S7QA 3BD5A 5EB9A 1YMMA 4CN1A 5F88A 1QR1A 4L4JA 4U1MA 2CXKA 1I9EA 1LK2B 3JZ7A 3HR5B 2NTFA 1EMTH 1H3GA 1HHIA 1BJ1J 1LE5A 1KJ2A 5E8OB 1MY7A 4Y8AA 3MZTA 3MV9B 3VRJA 3U1SH 1K5NA 2G2RA 4UOW0 1ZANL 5JO5A 1NMAL 1MNUH 5IP4A 3GSXB 1ND0B 5FO8B 5BOZG 2IGFH 5BVPH 3IJHA 3N50A 2X2YA 5FIEA 1IC4H 3KPTA 1S78C 1VB9A 4J3TA 4HWBA 4Y5XC 4ENEC 1CZ8L 4GAJH 5IB5A 1WJ3A 2R1YB 3HMWL 4GRLC 2J7LA 1NGYA 5H8DA 3HMWH 4Y2DB 1BGXL 3HAEG 3VG9C 1I9IH 3L95B 4R4BA 5J0BA 1JIBA 4GBXA 1Y6NR 3QIWB 1VEMA 2UY6A 5DJXB 3MRHA 5TF1H 1PG7H 4FQXC 4ZXBB 4OJFL 1MCEA 1TZHB 4MAYC 2I25N 1BJMA 2M2DA 3CXHJ 4CMHC 4IBLT 4HFUL 4WHTB 4ZO6A 1JNJA 4D0DB 3A67L 1PZUB 2D9QB 2K7QA 1FFOB 1IAII 3MSPA 4GOSA 4EI6B 4MXVE 2COQA 4K7PY 3V0VB 4JRXA 5EIQA 4QHNA 1EGJL 4G3YH 2HMID 3FTGB 5DC4B 5L7XH 4OFPA 1S7XA 1D6VL 4B53A 3H7BB 4F33B 4OKVA 3OKOB 4YUEL 4ZUTB 3AM8A 2ATPB 3PWPE 4YDIH 4PJ9B 3UTZA 3OHXA 4XH2B 5IEHA 5D6CA 3SDCA 3RDTB 2OJZL 1BM3L 3V2AR 2Y6SD 4RFNC 2CUMA 5MEQA 1BM3H 2X4PA 2VR4A 1YEKH 5JDSB 2Z8RA 2CIKB 1ERNA 2ICWA 1SBSH 2P24A 1BZ7A 1KB9K 5E2TH 4Z95H 3DUUA 4PGCB 1KEML 2EDBA 4NO2A 2X1PA 1J05B 1JNLL 4XCYB 3JV6B 5FYKD 2OBGA 2E6PA 4ELMA 3DGCR 2BNRE 2DKMA 1JYXA 3FFDB 3TNMB 1RK0B 4LGRB 1T3FA 4LKXA 5T5FH 5C0RH 1S5IL 3IFNL 3KLAA 2OQJA 3V0WL 4NOBA 2I27N 1KB5L 4WV1A 4F8QA 1CICA 3MFFA 4Y5XB 3TPKA 5K9QI 1AD9B 5EO9B 4F15B 1V7NL 4X6CB 4Z7WA 4ZTOH 4U6VH 3IDXL 2Y36H 1DEEA 1YYLL 2VERN 4OQTA 5SV3A 3MJ6A 3Q3GB 4BFBD 4O9HL 2CLVB 2A6KB 3TT3L 2XPGA 2R2BB 2VLLA 3NGBC 1QTYT 4KQ3H 2CDGB 3PWNB 4PY7A 1CDIA 1ZHNB 1OW0C 4HG4J 3QDJB 4QTIH 3QDHA 3F8UB 3PGDA 3QNXA 4TSBL 4APQD 1LWRA 2XTJE 5MHSE 4KTEL 4CDHA 4ERSL 4L8BB 3NCEB 1N6QL 4JGUA 1I3RB 2AJYL 1N64L 4OCWL 1FAIH 4FQIH 4WJ5A 4D3CH 5GS0H 5IUSA 2HVJA 1WCBB 5DMJB 4OCWH 3CPLB 2O26U 2CKBA 4UQ2B 4KHXH 4PJIE 1S7WA 3I6GB 3IVKA 1AGFB 3BVNB 2EDNA 4N0FB 4JQVC 5HHNB 4WFGE 4WTWA 3U0TA 4M00A 1JZ8A 1HINL 4OGXL 3ZKXC 3V8CA 5H35B 2R4SH 1OGAD 5CMAA 5EU7E 4HXAH 1E6OH 1L7TH 4AQ1B 4P5MB 1KNOA 4LVEA 4Y4FC 1A3LL 2J4WH 4XVSH 1E4JA 2X4NA 3GUTA 5SWSB 4I2XE 5GS2D 3WJLC 4I8DA 1MY5A 2BFVL 3VFSA 2NY7L 4UTBH 4OZHB 3QFJA 5EZOH 2BFVH 5I71B 5CIPA 1FZKB 1YY9C 3FB8A 4OB5H 5IOPB 2YC1B 3DSFH 2JB5L 3GMQB 3B9VA 1A6UH 1M05A 1Q72L 3IDMA 1DE4B 1Q72H 4ZTPL 5A2KH 4TSCH 5E2JA 1CQKA 4OF5A 4AIXA 4WFHD 3O9WB 5IMLB 4WI6A 3E6FA 3HZYB 3QCTH 3JTTA 4X6FB 5MI0C 2G75A 1FH5L 4ZUUB 3D18A 5ICZB 2PO6B 4L4VE 5D5MF 4HDIA 1AY1L 4JFFA 3C8DA 4J1UA 3O8XD 4LP4A 1JWMA 5H37G 1MJ8L 4Q6IC 1MJ8H 1RFDH 2X1WL 1WUNT 3ULUE 3CX2A 4BZ1L 3IETA 5C0JB 4BFEA 3IDJB 5CINL 3REVA 3WS3B 1D5IL 3OKKB 3JTSB 4QCIB 4MXWH 4ZFFB 1PVHA 2QQLL 1D5IH 3WN5C 3T4AB 4EIZC 2NY0D 3RNQB 1NAKL 1C5DA 5GGTL 5C9JA 2AXFB 5CEZH 1AHWB 4BA8A 5M95B 3C5JB 3BZEA 4QRSA 4L8CA 4E0RB 4JHZA 5HPMA 4PBWD 3LKRB 3CU7A 1N59A 1NCUA 1LDPL 4ZUSB 5ID1A 1YPZF 4G7YH 2EIZA 4YGAB 4PB0H 5K9JL 4HT1H 2HJKB 3ZTJH 2H26B 1FLRL 4Z5RA 3T08A 5IW6B 1CXKA 2LTQC 1MHPH 1A7OH 3FHAA 5F89A 4ZDHA 5HVHC 4BQ8A 4U1IA 2DDQL 1UVQA 1NFDA 2EDLA 1WIPA 2W9LA 4HSQA 4BKLA 3MRJA 1R3JA 4GW1A 4IRZL 4Q2ZB 4HMDA 5KVEL 2HMIC 5J6HB 2XKSA 3HCVA 4F9LA 3KYAA 1T1XB 5KVEH 2NX5B 5IVNA 3PHOA 4NJ9L 4XHJD 4JHBA 5I8KL 4YXKL 2GJ6D 1KSRA 3CFKB 2ZKHH 3RZWA 4TVPL 5I8KH 1TENA 4YXKH 5DQDL 3UCRA 5BS0A 2B2XL 2WIIB 2EDWA 4TVPH 5JW3L 3ECBB 4I18B 2Y6SC 4HGKC 4ZUVB 5DK2B 5MI0B 5D7IA 3RWCA 4LRIA 1B0RA 2C3GA 3WIHA 4JZJB 4M8QB 1OP3H 3MCLL 4U1LB 1KLFA 2GJJA 5FM8A 3ULSB 4YHKH 2QSQA 4R7NA 3CH8A 3OJ2C 3RKDD 3BWUC 2X89A 3O2VH 4P57B 4F7CA 4R4FH 2WBJB 2YXFA 5C09A 1U6AL 5IB1B 1FZMB 5T1DH 1WISA 3ZDYF 4FQ2L 4UI2A 1P53A 3JV5A 3ZMRA 2F5BH 4IMLA 5DF0A 1CXLA 5D1XA 5E99L 5A16A 2CO6B 3OXSA 2RAMA 4AT6B 2AKRB 3UDWA 1YJDL 5BZDB 2DQUH 4I9WD 3BDXA 1UB6B 1EJOH 1QFUL 1Z3GL 1F6AB 5DYOA 4PRIE 4JQXA 5EO1B 5IW1B 3WL9B 4G6KH 2AV1B 4KC3B 2ITCB 1I1FB 3CH1B 3OKNB 5GS3A 5TGBB 4PRHE 3O3EB 2CDFA 1AGBB 5JHLH 3F12B 2GSGB 4YIQB 3M45A 3GI9H 3ZTNL 2XNAB 4JDVB 2AK1L 3S96B 2DM4A 4APQC 2AK1H 1KGCE 4MNQA 2PYEE 1H9VA 4U7SA 1ORSB 2XA8H 3L3JA 2AV7A 1DVFB 3ZKQD 5FV2A 5FYLL 4PJBE 5EUOB 3OJDB 2R0ZH 1FORL 4PS4L 5GGSB 3UEZA 5DD0H 3WFCL 1JF1B 4OZIA 3GMRA 1F4HA 4JHAL 4LHUG 1ETZA 1FORH 2P5EA 4P59H 5EO0A 1KCVL 3QEQE 4ZPVA 3I50L 3NACL 1Q1JL 1ITBB 2YEZB 4WY7H 1H3UA 1Q1JH 2W9DL 4OZGF 4IRJD 3WSQH 4JN2A 1EO5A 1AXTL 3F7VB 1JTPA 4L3ED 5DRNB 1RJLB 3MLXH 1YC8A 4J2XA 3IDUA 4NRZB 3SGJC 5CKGA 2A6JA 2K9UA 1XF4B 2OTUA 3QEHB 4GW5B 1KIUA 1U8MA 3MRGA 5E9DA 4ZS7L 4F3FB 1FBIH 4MMXC 4P5KA 1QRNE 2FIRT 4NNXA 3V6OA 3AB0B 1L0QA 2VDMH 4L9LB 3EYSL 4JG0L 5F7MC 4AMKL 4YR6A 1Y18B 2NY6B 5CS7A 1T04B 4ZO8A 3MLRH 1YEJL 3V6ZA 4XC1L 5E08H 4OCRH 1U58B 1BQUA 1OY3B 3EFFB 1BOGB 2NNAB 2OTWA 4JFED 1E4XI 4X9BA 1WBXB 2WINA 5DLMH 4LHQB 4YH6A 3MNVA 4Y19E 4I48A 2IANE 2F9BT 2OS7A 3BIKB 2ZWLT 3GHEH 5H94A 1J5OL 4XPTH 3QO0A 3FQTB 3QNYA 4YXLH 1X6LA 1MFDL 2O5XL 1DQTA 3LQZA 4XPBL 2YD3A 4EI5B 2O5XH 4PPTA 3O8XC 4NSKB 1N3NB 4CVWA 3X12B 4KHTH 4WHDA 2R8SH 4O51B 2FB4L 2FD6L 1L0YA 1MI5A 3U2SA 3G04A 5IJKA 4DGIH 1NDMA 3O4OB 1ZLSL 1K6QL 1R3HB 5CUSL 4JFYB 1QSFA 1UWXH 3UBXI 1AC0A 3OKLB 4UAOC 4Y4KA 2Y1VA 4JPWL 3ESUF 1JWSA 1PFCA 4JPWH 2VLME 3J8F7 5DD1H 2DQHH 3B2VH 3RUGB 4M7LT 4XNZB 5GRUH 2PCPA 4O00A 3IAPA 3RWJB 3T0XA 4CW1A 3NN8B 3GMOB 2A9MH 4YHIB 2VLRB 1T7YA 1I1AD 4LPTA 1Z9OA 5BVJA 5LQBH 3L5WB 4CVXB 5BOPA 4RRPA 3T1WA 3LKNB 4PJ8A 3TP4A 2XWBA 5CEZE 3R0NA 4NPYB 1BF2A 2UWEE 1J1OL 3G6JF 4N8PA 5D6DA 4DZBA 3STZB 4EBQL 2EC9T 1KOAA 1VSCA 3IDIB 3NFPB 4PV9B 4XHJC 1C16B 3S97C 5E1HB 3WKMH 1WAAE 1Q9LB 2B1HL 1ZVHA 1I8IA 1R3KB 4BELD 5C70A 1BEYL 2UYLB 3WNKA 1B9ZA 2GAZA 5HYSG 1BEYH 4QRUB 3RBSA 4Z7UA 1C08A 5GIRA 2DAVA 1R3IH 4PRPA 3H42L 4UB0H 1BPVA 3RKDC 4HGMA 3NZ8A 3O8XB 2JB6A 4AJ0A 4OD1L 4YK4C 1IEBA 1F42A 5FAAA 3V4UL 2ARJB 3O2WH 1OP9A 3OAUL 4U31A 1YY8A 1R5VA 4PJHF 3O6FD 5CHNA 5E8PB 1BD2D 3R1GL 5LCVH 4TVPE 1IGCL 3RU8L 2NY0B 1U8NA 1BWWA 2MCG1 1PZ5A 4WW1B 1M7DA 3QDMB 4JRYE 4OBSA 3ARXA 3HLAA 3RZCA 4NN7B 1NL0H 4LLWA 5HVFB 4QRRD 2ENSA 1WQVT 1JMZA 1RUAL 4IS6B 3HI1B 4P2OD 4CRPA 3IFOB 3X13B 3X3FH 3HZMA 4EXPX 1MCHA 4NKIL 1QPPA 4AM0A 4DW2H 1A7QH 4QRTA 2BRRL 2QQQA 5KZCD 1YDPA 2CR3A 4PJCA 2NY2B 4QXUH 2L7JA 3NABH 3QZWB 4MWFA 1P4IL 1A2YA 2AK4E 1QSED 12E8H 2YS4A 3T77A 1IGIH 2DWDB 3MACH 3MBXH 1ZT7B 4JPKL 4N5UA 3SE9L 1JI2A 5DGRA 2VL5A 3GBLA 1MUJA 4OZGA 3ARQA 3Q6FB 5IQ7L 2A73B 3PDDA 5EC2B 3FN0H 2GUOA 1UZ6F 3D0VB 5HHMB 5IB3A 4MSWA 3KPMA 2KZWA 2WUBH 3DUSB 5KVDH 4S1SH 4U1NA 5J9PA 1GSMA 1X7QB 5ADPH 4DKFH 3BQUB 3L3HB 4IRJC 4XVUD 5EU4B 2C3VB 2FEDD 2A38A 1JI1A 3SKJL 3BUYA 1MWAH 4Y5VA 1IFHL 4WUKL 4RMVA 4P23D 3BXNA 1SY6L 3KPQB 3ARFB 1DUZA 5C7XH 2VH5L 3HR6A 3SO3C 5C0AB 1IM9B 3VMOA 5SX5K 3KPRA 4QGYA 3E2HC 1CLYH 1K9TA 1V5JA 1IARB 1N4XH 3EYUH 5ICYB 1ZGLA 2HFEA 2JJTA 3LEXA 5C0FB 4IIQC 5FYKH 3QUYD 1K85A 1HXMA 3UTTE 4IM8A 3UTSA 3MGTB 5HHOA 5CJ8A 1RV6X 4TNVK 1I85C 2XKNA 1JCKA 2ZUVA 5MEPA 3SDAA 3EDEA 3D6GA 2XKUA 1T7XA 3SDYL 4F58H 4GKNA 2V5YA 1H5BA 4F2MB 3FT3A 1QBML 1ZHLB 1CT8B 3VFMA 3TO4A 3T2PA 1IM3A 3NVQA 4BFGA 4H5SA 4C54A 3PE9A 3PWLB 3VWJA 4K3DH 4JFHD 5JXEA 2GITB 3QUKB 1MELA 1PSKH 4HUUA 4H20L 4ZAKA 4M62L 4OZHE 4PJ5D 3BKYL 3UPCA 3V6FB 2X40A 5I30H 32C2B 2PTVA 2V5TA 1A6WL 1T1YB 3MNWA 1A7RL 3NIFE 1VPOL 1ZSDB 1Q9WA 2R2EB 1F5WA 5EBMA 4MJ6A 1CFVH 2D0FA 4NRYB 1JL8A 4HIJB 4NQEB 3GSVA 1EX0A 2PN5A 1RZKL 4KROB 3CCHB 4MA3B 4WIQA 4ODXA 5EBGA 2B1AL 4PUBH 1YNKL 3UTPD 4P9HH 3G5YA 2ICEA 5D96C 1T21B 1L9NA 5CEYB 4BYHA 4HULB 5EBWB 5L2KB 1I1AC 1PBYA 3RWEA 4YFEA 3SO3B 1QVOA 4P49A 4U1KB 5JQ6H 1DBJL 4M5ZL 5KVMC 2IPUG 4R0LC 5I75C 4DTGH 1IQDA 3T0EB 1NAMH 4MXVF 1G7IB 4FNLH 3IJYA 5JR1H 2BNQE 2HG5A 2IQAA 3AC0A 4NWUL 2F8XC 1QO3B 2OCFD 3AY4C 5BQ7B 1JGLL 1MCOL 3STLB 4MB5A 4WWKB 2ADGB 1MCOH 4GKOA 5FYKU 5TQ0L 2P49B 1EVTC 1CGYA 3LDBB 1I75A 2FHFA 1VCAA 4OV5A 3O0RH 2NW3B 3MXWL 2ADFL 5E6ZA 2VDQL 1FYTA 4KTDH 1SVCP 5LXGH 2R0WL 2Z31D 2VDQH 2X09A 2PTTA 1RIHL 3PWJA 2NW2B 5H2BB 3OXRA 3ARWA 4N8CL 1P5VA 3ET9F 3E0GA 3TBYA 3D1MC 3L3GB 4UTAH 3MRFB 3BE1L 3O6FC 3QJHA 1F8TL 3HE7B 4OM0H 5JLZA 4PR5B 2NX5E 3O2DH 1ORQA 1M6OA 2FX8L 4NQDA 5I8OH 1NANH 1Y6MR 3OZ9H 1IEAB 1QBLL 4QXTB 3UAJD 4NRXA 2E7CA 3C9NB 4LBEA 1T83C 5C8JA 2OZ4H 3HHRB 3ZYJA 1NFKA 1P6AB 1RI8A 4P2OC 3RTQA 1CR9L 4QHKI 2ZSWB 5DEGB 2BY2A 4JAMA 2C4XA 3W9EA 4ODTH 1CR9H 4DFIA 2YN5A 2FO4B 4J23A 3QWOA 2LAGB 5TFSL 1CBVL 1CLZH 3TYFA 3VDBA 4Z8FL 2QKIA 2YMXL 3FRUB 3UYOD 3WDJA 3EW3B 1W72B 3NFNA 3DVNB 1XCQB 3RY6C 4K7PH 5GS1A 1ZTXL 4ZFZB 1K4DA 4X6EA 2ZCHH 5F6HJ 3QNZA 4CVZA 2XQYK 2IQ9H 1LP9E 5FGCB 3W11D 4YQXH 4GQPH 5HDQL 1RK1A 2VLJD 2P8LA 4J3WA 1U95A 4U7MA 1RURH 3ZT5A 3S88H 4PTUA 4YHPA 3TN0A 1FHGA 4LSVL 4PJIF 4NZRL 3I02A 4RA0C 4XVUC 5C08B 5KSAA 5IBLD 2FEDC 4NCDA 4MQXD 1JF6A 4MGXA 5INCB 4JKWA 1P7HL 2VAAA 3RWDB 1YNTB 4P23C 4JY4A 4WI4A 1WK0A 1WC7A 2YZ1A 3P4OB 2BVOB 3E3QE 1EHLL 3IKCA 4C83B 1A0QL 2MNUA 2ZOLB 4MJID 4LPWA 2BSTB 1A0QH 3IKKA 3BZ4A 2ESVA 1U8QB 1MLCB 4OQ1A 4QOKD 5DVNA 1D5MA 1HSAB 4M48H 3TZVB 2HKHH 4X4XB 5KSVB 3ULVL 3QUYC 3WE6B 3R0MA 5KSUA 3CVHB 3EYQD 5F1SA 4P2RD 3MLZH 3QUZD 3ARGB 1NAMA 1LD9A 1MFAL 4KDTC 3VJ6B 2IEPA 3BISA 2DQTH 3EUUA 4KVCL 5DO2D 3U4BH 4L1DA 4AH2B 4TULH 5KSBE 2MHAB 5I15H 2VDKL 1PAMA 4U1JB 4UZGA 3TA3D 2VDKH 2XTLA 2F54A 5E8EA 2D9CA 1FVEA 5DK0B 3FQRA 1TZIB 3LOWA 4PREA 1VFAB 2DOCA 2IBBA 4LVNC 3T4YB 3RL1B 3K4DA 4OFYD 5FO9A 5AAMA 3QWRA 5HYJB 4LSDA 1KJ3H 4OLYH 5FYKE 4JDTL 3ULUF 2EDKA 1A4JA 1T03L 3VXTB 3QI9A 1FL5B 2ADJB 2H6PB 2EYTB 3DTXB 2BVUA 2AJZB 4O2CA 1GC1L 3P40A 1P9MC 4PRNA 4ZO9A 4G6AC 5HSFA 4PJFA 4LQFL 5KTEH 3K1KC 4LQFH 1F90H 3UYRL 2EEBA 2EH7L 3FB6A 2NXYD 1G9MC 3UYRH 5T33L 4YJZL 2FX9L 4YAQB 4AQOA 4XPHH 4Z0XB 2D3VA 4DOHB 2FX9H 5AWNL 5EU6D 4NNPL 4Y16B 5DJDB 4LCWD 1ADQL 1CGSL 1JGUL 4QHUA 1M4KA 3WUZA 3TH3T 2H32H 3QWQB 4LVHC 4LP5A 3TIEB 3LHPL 4RFEA 4FS0A 3BEWB 3WJJA 3T0AA 2P1YA 1RU9L 3C09C 1KTLA 2DI7A 2QSCL 4U33A 1XGTB 2Q7NA 1IGYA 2QSCH 3QRGL 4Z76B 4TQEH 4LCCC 5I9QB 5K59E 4PJ7E 2CK0L 4M9OA 4Y5YB 2EIDA 3DX9A 1NUNB 4MNGE 1IGMH 5F3HB 4HZAA 2NZIA 5INDA 1OGAE 1YEDB 3QHZH 3V5KA 1XF1A 3PL6D 2BNRA 1WT5C 3MRQB 3MJ7A 2VLRE 3O6KL 4LVNB 4HX1A 5E6YA 5L9DH 1I1CA 4PGEB 1YEEL 3MLYL 4HUWB 4BFIB 4GG6E 2PXYB 3HG1B 1S9VB 1YEEH 1RZGB 3C5ZD 3MLYH 5HBBA 3FO9B 4RWHA 1UCTA 4YFDB 5E2WL 3MNZB 3QO1A 5CBAB 4O58L 1FNFA 1IRAY 3TNNB 1KN2H 2JTDA 3KJ4B 1SHMA 4EN3B 3UAJC 1REIA 1S7SB 3TCLA 3HFML 4HW6A 4M6NL 4Y4HB 3N1GC 1E4WL 4WFHE 2I60H 5F7DA 3U7WH 4DZ8B 4E5XA 3QQ4A 4M6NH 1P7KA 3ARZA 1E4WH 2CO7B 1F4XL 3INUH 1R6VA 4YE4L 2EYSA 4ONGH 3S5LA 3N06B 4WEUD 4YE4H 4F37K 4URTB 2AQ2A 1YYML 4LL9A 4J4PD 4YWGL 2DBLH 5IVXB 2G5BA 5JOEA 5F9JB 1Y0LA 1AP2B 1JHKL 3RGVD 4WDIA 5B8CB 2G9HA 1OLZA 2AEQH 4NKDB 2EH8H 2MOVA 5GRVK 5FOBB 3WLBB 1F4AA 1TXKA 4O2EA 3W11C 4PJBF 3O41B 5ESVA 3H3PL 3ZYZA 2YPLD 3CC5A 3NOIA 5GJTL 1XGPA 5CBEB 2X4TB 1TVHA 4JFXA 3OKYA 1VKXB 4JFZH 2EKSA 4HH8A 3VCLB 5ECJE 3WFZA 3ARDA 4X0KA 3TO2A 1FNHA 4XC3H 4GRMB 4JQIH 3GMNB 4D0BA 5DK3A 3HNVH 3FQUB 2VXTL 4MQXC 2Y25A 1CE1H 4X8JB 3SOBL 4ODHL 4PJXE 1X44A 3V7AG 5I76A 1D6EB 4U0RC 3LQAC 5JUEL 1A4KB 4NZDA 1M71A 1NGPL 4S1DD 4YHNA 3D2UD 3CXHK 2CLRB 3BPLB 5HY9A 2Z31B 3S35H 4GG8A 4JZOA 2HFGL 4X7SL 1YN7A 4WI9A 5JHDB 2CRYA 5DHYB 2HFGH 2ICCA 2IADA 3FOMB 4R8WH 4ZODA 3V52H 3ZE1E 5CLWA 5KW9L 2D7QA 3BD4A 3W0WD 5EOCH 2AVGA 2X44D 5HHME 1R5WA 2NTSP 2AJSL 2CRMA 2GJ6E 3CDFA 3WNPA 3VRLE 4L4VA 1TVBB 2DQFB 3QUZC 4PB9L 2H32A 3KDMA 1JNHB 4IMKA 3VFUA 4I3RL 5HVWA 4NKMB 5DMGD 5DO2C 3MV8B 3MO1B 4GRWB 4NOFA 1X6NA 4KZDL 1QUNA 5ISZD 3TA3C 2LABA 3C60D 3LY6A 3GMLB 3MCKA 3ZTJG 2I9LB 4LLMA 4MAUL 2DQCH 4P2QA 1HOCA 4Z7QE 5T1LD 5KVGH 5DUMH 1TTUA 4LVOC 4RGOH 4HFWB 1XF2A 4IDLA 5E5MA 2APVA 2HN7A 1QA9B 3KXFA 4IRSD 1VACB 4TPRH 3VXOB 2VZ3A 3EHBD 5CAYB 5JPMB 3I85A 1KTRL 1GIGH 5EDXA 1JNNH 4PGDB 2VLJB 4JHWL 5EH1A 2Y5TB 3EOBB 5D7JD 1A6VL 4ZS6D 1XGQB 5KG9B 1DQDL 1ZLUK 3MODH 3T3PE 4ZSOE 1X9QA 3ES6A 4FMFA 5I1GH 4I9WE 4KGLA 2NLJA 3FO1B 4H26A 1KCUL 1A7PL 1QNZH 1A6AB 3QH3A 4UINL 3GKZA 4JO1L 4UINH 4N0CD 2NXYC 1A22B 2NY1B 1WSST 2AQ3A 4HKBA 4PJAE 3IF1A 3PP3H 1WEJH 4WVRA 5J11B 3U4EB 3IRPX 3MUY1 3WFEL 4ONHA 3HE6B 4HG4K 1FJ1B 3U7YL 4ESKA 3QIBB 1UWEL 5D1ZD 4WFFD 3SDDA 1EFQA 1QBBA 1KFAL 1UWEH 2CGRH 3I2CL 4KUCD 4W6WB 3QEUB 5C0CB 5FK9A 1SJHA 2UWEF 4F7MA 1CU4L 1ZHKA 4LLQB 2YKLH 3UJJH 1TCMA 3CFDB 5GRWA 4LHJB 4LSUL 3BP4A 1I1YB 1IGJA 3RI5F 5GRJL 4PJGA 1Q9OB 1S7RB 5J13B 1K4CA 2A6IB 3CX5J 1WAAF 3QUXD 4OM1H 3GNML 3MV7A 4HBQA 5IWLA 4GMSL 2BCKB 4KRPB 4L3EE 3VD5A 3ZHLA 4ZYKA 3OR7B 4TVSa 3B9KD 1M1SA 2HRLA 1U8JB 3PL6C 2PW2A 2VDOL 3LPWA 2AQ1A 5DI8A 4MD0B 1U3HC 1NC2B 3DWTA 4RRPG 4FN0A 2ZUWA 1MHEA 3DNKA 4NC2B 3S37H 5FM5O 2AEPH 3SKUD 3UZEA 1WBYA 3B8YA 3T0EE 3QXDB 1JN6A 3C8HA 5FB8B 3EOTH 4JFEE 1FNSH 2L4OA 4OCYH 3WXVH 1Z9SA 4LPCA 2HTKD 5CILH 5DMIH 1EHAA 1J8HD 1S9YB 4G80A 1U3JA 1JPFB 2YD4A 4FQQB 4LF3B 2Y7QB 4G8FA 5E8NB 4HWNA 3DXAB 3DROB 5IIEB 2J8UE 1RZ8A 3K4AA 5CD3B 1C12B 1NFIB 5C0DA 1VEOA 4J4PC 1FZJB 2BVQA 1O0VA 4PJEE 3S4SA 3ZHDA 1IT9H 1KB5A 4X98B 2FSEA 4NQSA 4WHYH 5EULV 3RGVC 3GSRA 2P5WB 3DX7A 1TNMA 1G9MH 4WU5A 5ACZA 1PW3A 5HVGB 2UUDK 4C56D 5B38A 1EEZB 5FDWA 3WUWA 3A6BL 4RIRB 4LKCA 4KKCD 5A2JH 1PX3A 4CN4A 2FJHA 5DT1H 1J1PH 3VXRD 1MQ8A 4FTVD 2YK1L 1HHHA 4PRAB 4D0CA 5D1QA 5HYIA 2YK1H 4WUUB 2BNUA 5I73B 1FDLH 1TTFA 5EG6C 3C8KB 4FFZL 5GSVB 1A9BA 4N8VB 4UV7L 1V3JA 2E9BA 3VFNA 1I3UA 2ED9A 3DBXA 4D8PA 2HVKB 4N90D 1HZHL 4S1DC 1U8KA 3TH4T 4QY8A 4G8IB 5LKNA 1VADA 3X11A 1FNGA 3V8OA 1ZLVK 2VXUL 4XP6L 4PG9A 1IKNA 4J6RH 3NFSL 1YZZA 1F00I 4XXCA 4DEPB 1KT2B 3G6AB 4D9LH 1TCRA 3C5ZB 4O2FA 5D4QA 5ESAB 3ILPA 4L4TB 1YMHA 3QUMB 5IESL 4OLUL 1ITCA 1CD9B 4LSQH 3FO2B 3T2QA 2OL3L 3Q5OA 2GTZA 3H9SA 4OLUH 1HHKA 3KLHD 1UB5A 2NPLX 3LEVL 1KPUA 2DQJH 2DM3A 3FB7B 1BFVH 5DMGC 4C55A 3SKOA 3QDGA 4P5TA 3ARBA 4K3JL 3GHBL 1ZOXA 3WYRA 1UH3A 3C60C 4MZ3A 1E28A 4QRQA 3U9PL 1DFBL 1JF5A 1PG7X 4EXKA 4F57L 3TBWB 3U9PH 3P4MB 3UTQB 3MRKB 3DRQA 1LNUB 3SY0A 3S3JA 2ORBL 5TQ2H 4HWEH 2DKSA 4IRSC 4JY5H 4HPOL 1OWWA 3EHBC 4OZHF 1KJMA 2HAZA 3IU3B 3RX5A 1JE6A 1ACZA 5IB4B 2EE3A 4X4ZA 3H0TB 2DN7A 4JFDD 4QT5A 4LDOB 1OAKL 3O4LB 5D7JC 4ZS6C 1II4E 2N1KA 1FZOB 4RMQA 1OAKH 2YHGA 3VXUD 3EO1B 1LK2A 3L3KB 3NIFF 5D7LD 2GJZB 3HR5A 1OOAA 2I5YH 3DOSA 4XNXL 1BQLL 4QRRE 5E03A 4KGJA 3CDGB 5E8OA 1BQLH 1OARH 2GIYA 3VFVB 3MV9A 4Q9BA 1VGKB 5FUZL 4N0CC 1QZ1A 1ND0A 2O5YL 1D9KD 5FO8A 5HDLA 3AMLA 1PY9A 5ILTL 1U3ZA 2O5YH 5GGTA 5D2NA 1A47A 3LQAL 3QFDB 1QSEE 2X4SB 4JEGB 3B8SA 5D1ZC 5DEZA 3K1DA 2R1YA 1FG9C 4NUJA 5FECB 2FNBA 3WFHB 1ZVYA 5F70A 2FR4B 4Y2DA 3QHFL 2H9GB 1U8PB 3S34L 3EDDA 3L95A 3QHFH 2OLDA 4KK6D 3GKWL 4OF6A 4P46B 5DJZB 3RJQB 3QIWA 4GAGH 5DJXA 4FABH 1LEKB 4ZXBA 2F53B 1TZHA 2OXHA 3QUXC 2DYPB 4HPYL 1KYOJ 1QRKA 1BAFL 4ZFGH 5E95B 4XCFL 4WHTA 2H8PB 4D0DA 2AJUL 4KI1A 3N9GL 3QCUL 1L6ZA 3BP5B 1FFOA 5KN5B 3OF6D 4M6OL 4EI6A 4M3JA 4LPXA 3FB5B 3V0VA 3QCUH 4H88H 3FTGA 3DVIA 2Z91B 4PGBB 5GGQL 1UA6H 3FOLB 4Y0GA 4XVJH 5T1LB 1NC4D 4ZMAT 3H7BA 4F33A 5GGQH 5JW4Q 3OKOA 4ZUTA 2ATPA 2GFBA 1HQRB 4XT1C 4O5LL 5ANMB 2IAMB 4PJ9A 5T1KD 4XH2A 1T7VA 4NZUL 3RDTA 2AJ3B 1MEXL 3VWKD 4FZEL 1RVFH 2HTKC 1MEXH 2OJEB 5D7JB 1N7MH 5JDSA 5GGRY 2ZUSA 5F7HA 2CIKA 4HC1L 4V1DD 2IH1B 1F45A 2R9HD 1C8PA 5GPRA 3UO1L 2NR6D 5TE7H 4PGCA 5B22A 5HHQB 3TM6A 1J05A 4XCYA 5DHXB 3T0VA 3JV6A 5IBTH 35C8L 3LQMA 5L0QC 3FFDA 1NLBH 5E1AB 3TNMA 1RK0A 4FFYL 4JLRA 2X70B 3WFDL 4JFHE 3VGDA 3BP7B 4HEME 2V9QA 4PJ5E 1AD9A 3R8QA 5D1ZB 5GZOD 1A3RL 5EO9A 1J1XL 2E8YA 4X6CA 4KKCC 1A3RH 4RBPH 4LHUD 1H8NA 1IGFL 1LP9F 2YA0A 1B3JA 3Q3GA 2XXCB 3N1MC 3GBNL 2CLVA 4EJ1C 2A6KA 5JW5B 1KPRB 5SWZB 3C08L 3MLPA 4XCCL 2CDGA 1OSZB 3PWNA 4XX1G 1ZHNA 4XCCH 5IM7B 3QDJA 4NJAL 5DJAB 1DN0B 2KPNA 2FX7L 3RL2B 3LEYL 3MYJB 3UTPE 1BFTA 4KTYA 5IVXE 2DIAA 3B9KB 4L8BA 3C6LD 6FABL 4M7ZC 3MRIB 1I3RA 1MCWM 2X4OA 4MQTB 1WCBA 2QQNL 2I24N 1KCKA 1MFCH 4NQCD 3CPLA 4Z18A 4UQ2A 4I13B 2QQNH 2C5DC 3QULB 3I6GA 1AGFA 3BVNA 1XF3B 2GSIB 4N0FA 1ED3A 3HMXL 5HHNA 5AZEL 5ITFB 1CDHA 1URLA 3PQYD 4X6DB 2UZIH 4P0DA 5AZEH 5TH2B 5H35A 5I1HL 4LCUB 4MS8D 3KLHC 3KPOB 1J8HB 4M7JL 3QUML 5DD5H 1LK3H 4HD9A 3CIQA 4KMQA 4P5MA 2XY2A 3VG0H 1NKRA 4XNQB 1ACYH 1KCRL 3ZDZE 1I8LC 4ZQKB 5KSBF 5DWUH 1Q94B 4P4KB 2DQIL 2OI9B 5SWSA 3ZSSA 5FHAH 3B5HA 1UH4A 5FA3B 3L3DB 4EUPH 4OZHA 1BQHB 2WQ8A 3MUZ1 2P8MB 5IOPA 1KXQE 5J57B 2KZ1B 2YC1A 3GMQA 5D5MB 4X9FA 1DE4A 1UJ3C 3P9WB 3RPKA 4C56B 3DVFA 3O9WA 5IMLA 3E6HB 3HZYA 4JM4H 3REWB 2IH3B 4ZUUA 5ICZA 2PO6A 3LPGA 3VXRB 5DD6B 1RUPH 2VQ1B 4NO0B 1I7TB 3I6LD 3BFOA 4GRWE 3MFGB 2DF3A 3F6IA 1I9JL 3EBAA 1UYWH 1PLGH 2RR3A 4RGMB 3BWAB 5C0JA 3IDJA 1P4BL 3NCJH 1VFBB 1AGCB 1D9KC 3WS3A 3OKKA 3JTSA 1I4FB 3T3ME 4QCIA 4ZFFA 4NC0B 3TGXA 2HKFL 3T4AA 4UBDD 2Q76B 3KPSA 3RNQA 1YPZB 1OB1B 2RFXB 5I1KL 2AXFA 4GFTB 5DC0A 3DPBA 5A1AA 1AHWA 2HH0L 1EFXD 4LASL 1OAZL 1WWCA 1GL4B 3C5JA 1OF2B 1X5YA 2DJSA 4FQJL 4H8WC 2HH0H 4IDJL 4E0RA 4YDVA 2VLJE 3T8XB 3LKRA 3F5WB 3U0WH 4IDJH 4ZUSA 4KK6C 5SX4H 3Q1SL 4JPVH 4W4OC 2HJKA 2H26A 1BZ9B 3L3IB 3RNKB 4WCYH 5IW6A 3FO0L 5MP6L 4MMZC 4H1LB 1HILB 4PJ7F 3NAAL 5I17B 25C8H 2VISB 3EOYG 4UT6L 3T09A 3GIVB 2RCSL 5F72S 5L88L 4XPAL 2E6JA 3I75B 4OGYL 4FQ1L 3V5HB 1OD9A 3P9LB 5I66B 5J6HA 1JGVL 3P4NB 3L5XL 4OGYH 4FQ1H 1T1XA 5EOCJ 2NX5A 1G0YR 5F71A 3BP6B 2VZSA 4MJIE 3CFKA 2AABL 3ORJA 4XZUA 3WD5L 3QQ3B 1RD6A 1NQBA 1SYVB 4GG6F 4QOKE 4F9PC 1I7RB 3SJVD 2WIIA 4NQXB 3ECBA 4I18A 2QEJA 4YHOL 4A6YB 3VWKC 1X5GA 4ZUVA 5DK2A 5EBLB 3K4ZA 4P2RE 3WO4C 4JZJA 3OJMB 4M8QA 3NIGF 5EPMB 4U1LA 3ULSA 2R9HC 1G6RB 4I3GA 2B5IC 1WZKA 2NR6C 4P57A 5E6IC 4MD5B 2WBJA 2QHRL 1B4RA 1OAQL 3KYOB 1RMFL 4ZUWB 4OCSH 5IB1A 1EERB 5D72H 1MQKL 3MLWL 4OZFB 1WFNA 3MLTB 1WWAX 5EOTB 2WLZA 1FO0B 4ODWB 3HAEH 4MA1B 1GYAA 1GHFH 1GGYA 2CMRH 4TUKH 5ETUB 1FE8L 1KXVC 4OD3L 4X7TB 2DQDL 1P7QB 5M94B 5GRYA 3TV3L 1YEHL 5GZOC 3GB7B 2AKRA 2I26N 2Y4SA 5MEOB 5BZDA 1NCCH 1XF5B 1EH9A 1UB6A 2KDGA 3HZVB 1F6AA 1H8OA 3L3OB 5AZ2L 5E24E 2IPKB 3OGCB 1CXEA 5IW1A 3WL9A 1TJHL 4HF5L 2AV1A 5AZ2H 2ITCA 3SCMB 1I1FA 3CH1A 1KPVB 3OKNA 5TGBA 1ZEAL 3O3EA 4HQQL 3RKPA 1AGBA 2OSLB 3F12A 2GSGA 4KZEL 1ZEAH 4YIQA 3S5LG 4CVUA 4HJJH 2APWA 5C0GB 3SE4C 4KZEH 3TVMC 4JDVA 4MX7B 5LJYH 3GZKA 3S96A 1G0XA 1X5ZA 5TDNB 3JWOL 3DHMA 1ORSA 2F19L 3OMZA 1DVFA 4PJXF 2YD6A 5EUOA 2GY5A 3OJDA 2XY1A 5DVMA 2F19H 2P45B 3DGGB 2G5RA 5EU6E 3C6LC 5GGSA 5DHVB 1JF1A 1CGXA 4S1QH 1S9WB 4LCWE 4JB9L 4PJDB 2M8XA 3FFCD 2LAAA 1IQWH 3IGAB 3LZFL 3KLSA 2SEBB 3VFPB 2YEZA 4S0SD 1V8HA 4ZG1A 1YQ2A 3MRRB 1R5IB 1C5BH 5DUBB 1CGTA 3F7VA 4N9GB 3CMGA 5DRNA 5F6IB 3W2DH 4NRZA 4MS8C 2V7HB 2ERJB 1XF4A 1XIWD 4WUUE 3VRLF 3MREB 3QEHA 4GW5A 1A6ZB 3ISWA 4HUMB 1N26A 5CZVL 4JM2D 4F3FA 1KEGH 2V9TA 5FCUH 1RJCA 5CZVH 1BLNA 4XP1H 4L9LA 1QLEH 4WW2C 4NZJA 1Y18A 5IKCB 4OF0A 1T04A 3KHOA 5DD3H 2AJVL 4M8VA 4UOW1 1U58A 3ZT7A 1CDJA 3EFFA 1BOGA 4Z7QF 2NNAA 3Q5TA 4XCEB 1MAML 1BMGA 1WBXA 3LIZL 3MX0A 2EXWD 2UV3A 4MDJB 1WV7T 3BIKA 2WP3T 1J0HA 3CD4A 4YX2H 4Q0XL 1UGNA 2Q3AA 4UILL 1KELH 3FQTA 4Q0XH 1OQOA 4S11A 3UJTL 3IU4H 1R0AL 3T3PF 4EI5A 1V3LA 3BAEL 3UJTH 4HMEA 1UWGH 4NSKA 1N3NA 4LU5L 1R0AH 3X12A 3DO7B 4O51A 3DVGB 5FOJA 3D39B 4HUVB 1UQSB 3VMNA 3WXWL 4KDVA 2DWEB 3Q5YA 3EIFA 2D03L 2OK0L 1R3HA 3IFPB 5F21B 4UBDC 2AJXL 4BQBA 1RULL 3ETBF 3KYNB 4JFYA 4IEFB 4NQCB 3QSKB 3QT2A 5AD0B 3OJVC 1UCBH 4OFVA 3JXAA 3K2MC 3OKLA 5F7FA 4PTTB 1O5DT 1DBAL 1CF8L 3HI5H 5GGVL 3O4LE 2YPLE 5DJYB 1CF8H 4LSSH 3RI5K 1CD1B 5GJSL 3IAQA 1C1EH 4ZNEE 2GW5A 4GBXD 5GJSH 2VDRL 3RUGA 3UJIL 3G6JB 1F11B 5HI5D 4DN3H 1BBDL 3RWJA 3NN8A 3VI4E 5LBSH 3GMOA 4M1DL 4YHIA 2VLRA 3GI8H 4HHAB 3L5WA 4CVXA 4YC2C 1N2RB 3LKNA 1YECH 4NPYA 5FGRA 1QEWB 4WW2B 1QFWH 4NQTA 3STZA 1Q0XH 1MF2H 4JRXD 4KJPD 3NFPA 2XWTB 3IDIA 4PV9A 5EN2B 1LO0L 1B2WL 1C16A 1G9NL 3DV6B 5H37H 3K2UL 4M61B 1Q9LA 2EDDA 3Q6GH 4ZO7A 1R3KA 2QQKH 1SJVA 1JHLL 2UYLA 3W0WE 2DLFH 2XZAH 3RJDA 3SKMA 1QFHA 3BT2H 3RWHB 1U92B 4K3GA 3SDCD 4QRUA 4Y1AB 1OPGH 1H3PH 4UUJB 4JJHA 3OX8B 1XMWA 3VMPA 3E8UL 3BGFB 2GEEA 2WWKT 3MOAL 4GAYB 4PJHB 1OP3K 1DR9A 1TPXB 3Q2CA 1SEBB 3MOAH 4HWZB 2K7PA 2PNDA 1B90A 4HZLB 3QPXH 1T7WA 2LVCA 4G8GD 2X42A 3BDYH 1DL7L 2J8UF 1G6RL 5MENB 3OBAA 5ISZE 2ARJA 3IAGC 2CDEB 1OM3L 2OMNA 4WEBL 1OM3H 4PJEF 1F4WL 5E8PA 5GHWL 4PG2C 2XT1B 1FO0L 3JWDL 1HIML 1OAXL 3P11L 5DA0B 1MJJB 2DTSA 4LDLB 1IC1A 4WW1A 1BIIB 1EO8L 3QDMA 1CICD 1PEWA 1EZVY 4Z9KB 2BY1A 4ZD3H 4HK0B 4IS6A 3HI1A 4JDZA 2AI0H 4GLRH 4H8WL 1WZLA 3IFOA 3X13A 3EYOB 4FQCH 4Q9RL 1MIML 2VIRB 2J1KA 4K2UL 3GIZL 1ZT4B 4K2UH 3QZWA 3GIZH 4XPFL 4XMPH 3S4SG 2FL5B 1WWBX 5EORH 3GEWB 1JYNA 1NGWB 2DWDA 1LO2L 2P42B 2O5ZH 1ZT7A 4TUJB 3DX6B 3GJFK 4K23H 4DQOL 5IT2L 3W5MA 2ZCLL 4RMWA 3Q6FA 2A73A 5EC2A 1A64A 5B38G 3WUWG 4DQOH 3D0VA 1CL7L 4WFFE 1MPAL 3DUSA 1X7QA 4AEIH 1DUYB 2B7DT 3QA3B 4J7RA 4OLXL 4U1SB 2NY5C 3BQUA 3L3HA 5I18L 3GSNB 3SJVB 4GW4B 2ZZUT 3HS0B 5EU4A 2C3VA 4OKDA 4M7LL 2EIBA 3QEGL 3LRGA 5E70A 1YQVL 1AO7B 4M6ML 4MCYB 2X4RB 3QEGH 1XIWC 5KS9E 3KPQA 4F7TA 3BKJL 3MMEB 2VXSL 3ARFA 2APFA 3LMJH 1I3VA 4JM2C 3CFEB 1MCSA 5C0AA 5GRZA 4UNTA 4P48A 1IM9A 3C87A 3TJEH 1OHQA 2FDBP 3U30B 4U2ZA 3QIUB 1PKQB 4YHZL 1BHGA 3WDHA 2HP4A 3FQWB 5ICYA 2P8PB 4HCRH 4XNMB 3MBEB 4LIQH 4MA8H 3T2NH 3QFJD 5C0FA 4Y2OA 4NC1C 2BSED 3BD3A 1N5AB 1LILA 2FATL 1UC6A 3MGTA 2IG2H 3B5TA 3GM0A 2DD8L 4OZ4B 2EXWC 4PBVC 1EEUA 4M43L 1WZ1L 5FHBL 3MJ8B 3I3DA 1GAFL 1J8HE 1KLGB 4I0PB 3S3SA 4KAQH 1W72H 4F2MA 3IT8D 1ZHLA 1CT8A 2B0SH 4PLOB 1UACL 4JFFD 2D7TH 2RQ8A 4FFVD 1L0XA 5E8DL 3W39B 1NMBL 2HFTA 1KJVB 3PWLA 3ZKSD 3UBXB 4WWID 2GITA 4XCNB 4NQVB 4N0YH 3V6BR 1XR8B 3V6FA 4BZ2H 4M1GL 4NO3B 5F9AC 4XP5L 3CUPA 1NCTA 4NUGH 2ENYA 1ZSDA 1UM5H 5HHVH 4C56E 1N6UA 2R2EA 1UWXK 4NRYA 4I1NB 5LGHH 5CP3H 4HIJA 1XAUA 1ZS8B 3C2AL 4NQEA 4JVUA 3M17B 2FCBA 5GZND 3ZYIA 3CCHA 3C2AH 4MA3A 3VXRE 2BC4B 4WO4B 4ORGB 4HAFA 2YD8A 4FTVE 4LAJH 5DR5H 1X5LA 4GBXC 4HXBL 4BSWB 2ITDB 2D0GA 1A1OB 3CLFL 1INEL 1T21A 3ZT6A 3BKCL 5HI5C 5FKPA 5CEYA 1ADQA 2VDLH 4IJ3B 4K3EL 1NBYB 5EBWA 5F1IB 4UV4H 5L2KA 2J88H 4JM2B 1H0DB 1MLBB 5F7EL 3STBA 4U1KA 5D7KD 4JN1L 3CVHH 3PWPB 4N90E 4K8RH 5DUPL 3V95A 4E41B 1NGQH 1NGXB 4JN1H 3RFZC 4POZD 3T0EA 1G7IA 2EDYA 4KJPC 4BH8B 2F58L 1QO3A 3PP4L 5BQ7A 2JCCE 2JLLA 3DYPA 3STLA 4WWKA 2F58H 5EOQL 3NTCH 2ADGA 3AM8C 5DGQA 4K7PX 1T2QL 4MJ2A 4DGYH 5SWQB 3S9DB 4HK3N 3JBG7 5BV7C 3SDCC 4LSRH 5BS0D 4F7PB 5TJWK 5GS0D 1FYHB 5TPWL 2NW3A 1JZ5A 4RZCB 2BXYA 4KI5D 5IHLB 3LKOB 4XVTH 4KY1L 5FO7B 4YDLB 2NW2A 5H2BA 2XYCA 2X89D 4KY1H 4CJ1A 1GZPB 1PGRB 4Q9QH 3MRCB 5C09D 4WI3A 3VRJB 3L3GA 3PF2A 4JG1L 3MRFA 2C4FT 3HE7A 3NPSB 4PR5A 1H15B 2FJFB 1YNLL 3G08B 1IEAA 4QXTA 5JORB 3BGAA 3C9NA 3SGEI 1YNLH 1VFUA 4WV1C 2YPKB 1CICC 1V7ML 5L8LB 1C7SA 2CIIB 4NM4L 3OR6B 3TPUB 4XP9H 2GHWB 4JFDE 4PBXA 1C5CH 3CLEH 2ZSWA 3CMOL 5DEGA 2GK0B 3VXUE 3WIFB 5D7LE 2FO4A 3CMOH 2XTJB 4RCAA 1N5YH 2A9NH 4X5LA 4Z0BH 3FRUA 2FZ3B 4X99A 3GK8L 1L7IH 1W72A 3DVNA 4MNHB 3EFDL 3OWEA 4DGVH 1XZ0B 2A83B 2XXMB 4ZFZA 3PABB 3GJEB 4PJIB 4YHLL 5IVXF 4MNQD 1E6JL 1MCNA 2WP3O 5D70L 4ODVH 2P5ED 4Z78B 1CN4A 4JREC 5BJTB 3RIFF 3KYKL 5C08A 3MZGB 5BV7B 1ZA3B 4PY8J 3GSNL 4PGZA 5INCA 4FFWD 4DUXA 4I2XB 3RWDA 1YNTA 4NM8H 2QR0B 3M8OH 2R2HB 3CX5K 3P4OA 1JGEB 2BVOA 4XPGH 3VGAB 1WIUA 4G8GB 3ZDZF 5E9DD 2DQEH 2ZOLA 1T5WB 2BSTA 1AQDB 2L7UA 3QG7L 2J12B 1U8QA 3SEPA 1MLCA 5GISL 3VXNB 2ZUQC 4YBLB 1FNLA 1HSAA 5E4EB 3TZVA 4X4XA 3T1FB 5KSVA 3BMWA 4PJDE 3PXHA 3WE6A 3CVHA 1T0MB 1I3GL 3ARGA 4U2YA 4GO6B 4KV5E 1I3GH 3BSZL 3VJ6A 1MFEL 4AH2A 1LHZA 2MHAA 2HYMA 2B20A 3FONB 5CCKH 1XR9B 1MFEH 5K93A 3JUYA 2BHYA 1R3LB 3B9AA 4U1JA 4V1DE 3WDIA 3EYVB 3QAZC 3T0BA 5DK0A 1TZIA 5J8OA 1VFAA 3AXLB 4FFVC 3T4YA 1D5XB 3RL1A 3QXUA 4GRWF 4N0UA 1T2XA 5HYJA 3X3GH 3QJFB 4OLZL 5DDHB 1MI5D 3IB4A 5IFAL 5B3NA 2IBZY 3LD8C 4TTGA 3VXTA 5C71A 2XN9D 5IFAH 1FL5A 2ADJA 1LQSR 2H6PA 2P48B 3T3MF 2EYTA 5EUKB 3DTXA 2AJZA 3UC0H 2DQGL 3GRWH 3QDAA 3OB0H 1QSFD 4YFLI 5KJRL 2WWKO 1U2CA 5GZNC 1IE5A 5KJRH 2FBOJ 2NY5L 4Y4KD 2VITB 3MGOB 3B83A 3U0TB 2NY5H 4KVNL 1AQKL 4YAQA 1YA5A 4LK4A 1QHPA 4Z0XA 4Z7OE 5F7KC 1FL6B 1FQ9C 1JPSH 3L7FB 4Y16A 2V2WB 3G6DH 1F02I 5DJDA 4NBYB 3V4PL 5C9KA 4FQPA 2UVEA 1AE6L 3IJSB 3DJ9A 4POZC 1AE6H 3CXDH 1FGNL 3TIEA 3JUZA 4NZTL 3BEWA 5J4MA 4NQCE 4F9LC 3MGAA 3LS4L 2J5LB 4NIKB 1TQCB 3O3UN 1RIUL 3DHJA 4U1GB 1XGTA 3LS4H 4Z76A 4X9GA 1A7NL 5DVLA 5ACLA 4XBGB 1A5FH 4Y5YA 4KQ4L 3PQYE 1A7NH 5F3HA 3B9DA 5GS0C 4D94A 4KQ4H 4IHOB 1YEDA 4LRIC 5C2BL 2M26A 3OKDB 4KJWD 3MRQA 4KI5C 4PRPD 5GGRA 4PY8I 4S1RH 5CJOL 4CU8A 2Z35B 1GGIH 5CJQL 4PGEA 4FQLH 2F15A 1CDUA 4HUWA 1DLFH 4BFIA 2F5AL 2PXYA 3HG1A 1S9VA 1RZGA 2Q7YB 2AERT 3FO9A 3MNZA 3D48R 5CBAA 3TNNA 1KJ2H 1LO4L 3MRNB 4PRIB 4EN3A 1JYWA 4LFHG 5D1XC 1HH9A 1TJGH 3HTLX 5D7SL 3S35X 1S7SA 4PRHB 1J88A 2LQRA 4Y4HA 4DZ8A 2A1WL 1MIEH 2EDJA 2R0LL 5I1CL 4HWBL 3UDWC 2WUCH 4QXGH 3TBSB 1BF8A 1WIOA 2ZUXA 4HWBH 3OQ3B 2YD9A 2FBJL 4QRPD 4JQXC 2PYEB 2VZUA 5IVXA 4PJBB 3I6LE 4G6FD 2Y23A 2B4CL 5F9JA 3HC4L 3MROB 1AP2A 3FN3A 3U6RB 1MRCH 5KVFL 3MOBH 3CFCH 5B8CA 3HC4H 4CGTA 3QEQB 4NKDA 5AYUL 5FOBA 3WLBA 1TIUA 3SGKA 3O41A 2NZ9C 3TLRA 3MRJB 4TNWK 2H3NB 3VE0A 5I8CB 5KAQF 1MRFL 4JKLA 2X4TA 4LRNL 5CBEA 3EDKA 3WS6A 1VKXA 3VCLA 1MREL 1Z5LB 3HPJB 1LO3L 2PR4H 2J3SA 4PIRF 3IXTB 5T1MB 1GOGA 1MREH 4GRMA 3TH2T 3GMNA 3FQUA 4WTZA 4R26L 4R97C 5C92A 4X8JA 5BXFB 4K71C 3ZSTA 4FFWC 5D93C 5BV7L 1QRNB 1D6EA 3GO1L 5HHXH 1A4KA 4Z6AT 3GO1H 5IGXH 1KYOK 7FABH 4GXVL 1HXYB 2CLRA 4HIHB 1T89A 1OCWL 2Z31A 1IC7L 5FFLA 4GXVH 1OCWH 1S9XB 2BX5A 1EBAA 1CG9B 1FNAA 2QADD 1HKLH 4R90H 5JHDA 5DTFB 3PV7A 4S2SA 5DHYA 5L6YL 3FOMA 3KPRD 4PRDB 3V6OC 4Y19B 2IANB 3B2UD 1SEQL 1GGCL 5J56B 5J6GB 3LN5B 2VDNL 2HLAB 1A8JH 3SDXB 1TVBA 2DQFA 3VFGL 5C6TL 1KULA 1JNHA 4NP4L 3SJVE 3UTSD 5HHOD 4NKMA 1SBBA 3MV8A 3P9MB 4R3SB 4QHMB 2LVEA 3MO1A 1INQB 1HSBB 3MJ9H 1UH2A 4KXZI 4AEHL 1JFQL 5KANI 3CK0L 1MJUL 3GMLA 5F96L 4OLWL 2DI9A 2I9LA 4OQTL 4CAGA 1IC5H 4X83A 4OQTH 4OGAD 3TO4D 1QHOA 4HFWA 2MCPL 4HIEB 1KIPB 4OIIL 1VACA 5J12C 3VWJD 3VXOA 4RQQB 5JPMA 2YSSB 5JXED 4ZAKD 4OIIH 5IJKC 2NY4D 3NCFB 4RGND 1NMCB 4PGDA 2VWEC 4JKMA 2WV3A 4OV6F 2VLJA 2Y5TA 3EOBA 5D9SB 1XGQA 4YFLF 5KG9A 1EMTL 1NEUA 1W2KT 4W6XB 4PP2A 5LAXB 2P5EB 3IS0X 4LGPB 3S37X 1ZT1B 4P3DB 2VXVL 3U1SL 2MQ3A 3QB7C 1A6AA 2VXVH 1MNUL 1WVZA 1EVUA 2CKBL 2J2ZA 4Y4KC 5FYJD 4MVBD 4N1EA 2IGFL 1CE6B 4CDGC 2CKBH 5BVPL 4JN2B 1IC4L 3K8LA 3GGWB 4XP4H 3TEUA 3U4EA 2UWEB 2NCMA 4GAJL 4HJGB 4DKDC 2DMKA 3HE6A 3QCVH 3IDGB 1FJ1A 3VI4F 4U0QB 5FKAB 2GKIA 3QIBA 5T5NF 2A77H 5DQ9B 2FLBT 4L8SB 3MTRA 3CVIH 5K9OB 4P5KB 1I9IL 3QEUA 5C0CA 4LLQA 4RDQG 3KJ6L 5TF1L 1PG7L 5D6DC 3CFDA 3FFCE 4NBXB 1I1YA 3KJ6H 5FCSH 1DQLH 2RGSA 3C2SA 3G5ZB 1Q9OA 1S7RA 2A6IA 1KIRB 3L1OH 3VXSD 5CIPH 4Z7VE 5DRZB 2BCKA 3TCXA 2ZOKB 2VC2H 3SBWA 1T0PB 2XZZA 2VAJA 3OR7A 1TITA 4RISH 4G3YL 4NFDA 1U8JA 1K8IB 5L7XL 4KJWC 3DV4B 4MD0A 1CGWA 1NC2A 1HYSD 4YDIL 4I0CC 3P4LA 1JRHH 3QXAB 2ZG1A 2AXJA 1CIDA 4E41E 5CFHA 4IOIB 5ACMA 3QXDA 3U2SB 4JRYB 1TQBC 2Y06H 5FB8A 2XN9B 1YEKL 2R4RH 4HC1A 1NDMB 4NC1E 3RY5A 5GQBA 1SBSL 2IPTL 4YXHH 2J6EH 4NQDD 1FRGH 1S9YA 3LRHA 2IPTH 5E2TL 4Z95L 4ETQB 1MH5B 1JPFA 4FQQA 4LF3A 2Y7QA 5E8NA 3DXAA 4QXWA 1T5XB 1P84J 3DROA 5IIEA 3IXAB 3PHSA 5CD3A 1C12A 1NFIA 5B39B 4HBCH 2GYSA 5IF0B 4GUPA 2XWJB 2AK4B 3MA9H 3TESA 5C0RL 5T5FL 4MA7H 3RTQD 4U4BA 1FZJA 3RIAK 5DJCB 1CFSB 4FG6D 15C8L 4X98A 1ZHBB 4OSUH 4P9MH 3MJ9A 2XQBH 1YN6B 15C8H 2ARWA 5TF0A 3QISA 2P5WA 1VGEH 4ZTOL 2BVYA 5T3ZD 3K3QA 4U6VL 2Y36L 4GRLB 1EEZA 1NCBH 4RIRA 3ARRA 3HNSH 5EZIH 4ONOA 3VG9B 5FM5M 3B9EA 3NBNA 4KQ3L 1F4YH 2HT2D 3P3YA 3NPZB 1FIGL 4WGWB 3UP1A 5I1EH 4FQXB 4QTIL 4WHCA 4MAYB 1FIGH 4XNUH 4WUUA 2C3WA 1FFQA 3GJFB 4KUCF 4OCMC 3TN0D 3FQNB 3VXMB 4CMHB 1PX4A 4R7DB 3C8KA 5GSVA 4N8VA 2I07B 1B4JH 1MRDH 2OXGA 2YA1A 3SE3A 5KSAD 2HA1A 1OVZA 3QZWG 3GM8A 2HVKA 1PQZB 3PWUB 2CJUH 5BCAA 3RA7L 1FAIL 4FQIL 3MXVH 4D3CL 5GS0L 1C08B 4G8IA 4Y5VC 4X4ME 3RA7H 5IROA 4ZFOA 3OV6A 3GSWB 4KHXL 4YBHA 2ZPKH 3H8NA 4XBEL 1KIQB 4ODSH 3WIHH 3UTTB 2QADC 4XBEH 4B7IA 1KT2A 3G6AA 1RZIB 1V05A 3C5ZA 1T20B 2CKNA 3B2UC 2ESVD 2R4SL 5ESAA 4L4TA 3WCYA 4HXAL 4RFNB 3KLDA 2GTWB 1E6OL 1L7TL 3QUMA 2JJTC 1CL7I 3C5SB 3FO2A 3NCBB 3CDYA 2J4WL 5IBUB 4XVSL 3DO3A 3FB7A 1NCAH 1MCKA 5E7BA 4QLRA 3SDAC 4UTBL 4X6DF 4Q97A 1MAKA 4UIKH 5EZOL 1LEGB 4QRPB 4OB5L 1XGYH 3DSFL 4B41A 4RWYH